3EEHA

The crystal structure of the domain of the putative light and redox sensing histidine kinase from haloarcula marismortui
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
116
structure length
116
Chain Sequence
ERRVRELTEATNDILWEFTADLSEVLVINSAYEDIWGRSVAKLRENPHDFLNGIHPEDRELMKDTMQSLMDGESADVECRVNATEEYQRWVWIQGEPITNDAGETVRVAGFARDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the domain of the putative light and redox sensing histidine kinase from Haloarcula marismortui
rcsb
source organism Haloarcula marismortui
molecule tags Transferase
molecule keywords putative light and redox sensing histidine kinase
total genus 34
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3eehA00
2PD7A 3RH8B 2L4RA 3PYPA 3H7WB 2ZOIA 5DKKA 3NOPC 3NOTC 3MFXA 2INWA 3A0VA 1UGUA 1T19A 3PHYA 4I38A 5TBMA 5A8BA 1EW0A 4EEPA 3UE6A 1P0ZA 2VEAA 3MXQA 4DJ3A 3LIBA 1T18A 3FC7A 2OWJA 4HP9A 4L9GA 3E4QA 1V9ZA 4EXOA 2V0UA 2W27A 1OJ5A 4I3IA 3UB7A 4EETB 4H6JB 1JNUA 3H7WA 5J7EA 3T50A 3CWFA 1OTDA 3G6OA 3MR0A 2QKPA 2OWHA 4E04A 3H82B 1N9NA 4EESA 4I5SA 4EEUA 2VV6A 5HZHA 3ULFA 1LL8A 5F69A 4GS9B 3E4OA 1MZUA 4LLOB 1S4RA 1TS8A 5HWVA 2PD8A 3SW1A 4R70A 2D02A 1XJ6A 1DP6A 4R38A 4I3AA 1GSVA 4JGRA 2J80A 1DRMA 3IS2B 1T1CA 3B33A 5AVFA 2R78A 1Y28A 3K3CA 3VOLA 3KX0X 3A0RA 1LSVA 3UMEA 3LIFA 3LI9A 5HDSA 2Z6CA 1OTBA 1XJ3A 4R3AA 1OTAA 4HJ3A 4KQDA 4LRZE 5TBMB 4F3LA 1TS6A 3IS2A 1S66L 2ZOHA 2V0WA 4I3JA 4L9EA 2PR5A 2VV8A 4M4XA 4MN6A 1G28A 1OTIA 5IU1A 3MJQA 1OTEA 3NHQA 2M1CA 1XFNA 4EERA 1UWPX 1V9YA 2CMNA 2HV1A 2PYRA 2WKRA 3F1PB 4JGPA 4WUJA 5EFWA 4HNBA 3FG8A 5AVEA 4YWZA 3C8CA 4GW9A 4HQAA 4L9FA 1D7EA 3GDIA 3MQOA 3D72A 1XJ2A 4HY8A 3UMDA 5HSQA 3H82A 5HDCA 3P7NA 1P97A 4WLAA 4PKYG 1NWZA 1ODVA 1OT6A 1S1YA 2V1BA 4WL9A 2D01A 2Z6DA 2P7JA 3LIAA 4LRYC 4NXGA 2PYPA 3F1NB 1D06A 2L1MA 3NOUC 1DP9A 1S67L 2A24A 1LT0A 1S1ZA 2YKFA 3ICYA 2QWSA 2ZBBA 3LICA 3LIDA 4HP4A 1OT9A 5HDDA 4GCZA 4HHDA 3UB9A 4EW7A 5IS1A 4DJ2A 3E4PA 3MQQA 2H28A 1X0OA 2PHYA 2VV7A 3CLOA 3EWKA 5DKLA 4NXEA 4WF0A 5J3WA 1S4SA 4GHIA 4XT2B 3LUQA 4BBTA 1TS0A 4NXFA 3C2WA 1N9OA 4R6LA 3BY9A 2EA9A 3HJIA 4RQ9A 3F1NA 1TS7A 1UWNX 4K08A 2BASA 2JHEA 4KUOA 3NJAA 4XT2A 4HH2A 5G4YA 5DJTA 1BYWA 2I9VA 4EQ1A 1KOUA 2K7SA 5DJUA 1F9IA 3OLOA 5F68A 4HJ6A 1GSWA 1XFQA 4LPZA 2W0NA 4HOIA 4GHIB 4KUKA 2QJ5A 4NXBA 4BBUA 1LSXA 3LIEA 1OJGA 3LYXA 1VB6A 2VLGA 4JGOA 2L0WA 3F1OB 2B02A 2QJ7A 4HI4A 2V9AA 5HWTA 2WKQA 1GSXA 2YKHA 1XJ4A 3BY8A 3LI8A 4HIAA 4PKYA 1DP8A 3ZQ5A 3BWLA 1F98A 5KIZA 3EEHA 2PR6A 4HJ4A 4I39A 5I5LA 1LSWA 2A24B 2V1AA 3K3DA 1WA9A 4H6JA 5G4ZA 2KDKA 5HD3A 3UB8A 5HD5A 4GS9A 4F3LB 3RTYA 4BBVA 3GECA 3F1OA 5HWWA 4WN5A 2WKPA 3A0SA 3CAXA 4LRXC 4B9OA 4JGQA 3VE4A 2PDRA 2QHKA 4MN5A 1N9LA 5F6AA 3HJKA 5F5YA 3UB6A 3H9WA 4HH3A 1T1AA 2GJ3A 5J4EA 3F1PA 3VE3A 1T1BA 2KX6A 3IBRA 2OOLA 2JN7A
chains in the Genus database with same CATH superfamily
1JWZA 3H7WB 2ZL1A 4DE2A 3A0VA 4IBXA 4U0TA 3V39A 4DN0A 1P0ZA 4E3JA 5L8MA 4HP9A 1XKZA 1LLBA 2V0UA 2HDUA 3E2KA 1K0KA 2CC1A 4WM9A 1XX2A 1K25A 4NK3A 4LLOB 4ME4A 1VQQA 4N92A 3ZYTA 1RCJA 4RVAA 4BD1A 3M6BA 3OPHA 5EOEA 4K0WA 2H10A 2Y2OA 3IF6A 3VOZA 1IYPA 4OH0A 3DTMA 1K6SA 2XRNA 2IWCA 4S2JA 5L10A 1BLPA 1YLWA 1O7EA 2QMIA 2LB5A 3OPRA 4WLAA 4C75A 5L07A 2Z6DA 1S67L 2ZM0A 1TD5A 4HHDA 3E4PA 4ZJ2A 2ZQ8A 2XH9A 3GVBA 1GA0A 3RFBA 1W7FA 4R6LA 2EA9A 3UB6A 4EUZA 3CG5A 2GDNA 4H8RA 1F9IA 1W79A 4PM9A 5GL9A 4HOIA 5C5KA 1VB6A 3K2NA 1W8YA 3LR4A 4OQGA 3MZFA 1BSGA 3MF0A 4Y0OA 4F94A 3DTIA 2DMWA 3V3SA 3T4QA 3VP1A 5DF8A 3T1XA 4Z9QA 4E3NA 3ZNTA 2E8IA 4Q0HA 5HX9A 1PW1A 2OWJA 3VP3A 2OSUA 2Y2GA 4MLLA 2I72A 2XA7S 3O3VA 5CEBA 4S2LA 4NG2A 5FQMA 2ZC5B 1EROA 5HL1A 4Y3IA 1ES4A 1E4DA 1GCEA 5CHJA 3LR3A 1OTAA 4DXCA 3N4IA 1YT4A 4S2IA 3VP2A 3CJMA 1ONGA 3W2ZA 1UWPX 5HW3A 3Q07A 3F1PB 4XUXA 2J9OA 4QD4A 4OP5A 3LIAA 4OQ0A 4X6TA 1D06A 3NOUC 4PPRA 1CI9A 2YKFA 5HDDA 4EW7A 4UA6A 3CLOA 4L0LA 4X69A 2XK1A 1TS0A 3BY9A 2FFFB 1HLUP 3D4FA 1TEMA 1I2WA 2W0NA 4GHIB 4KUKA 1BULA 1Q2PA 4JGOA 5E2EA 3BY8A 1KE0A 5DF9A 4WMCA 2ZQDA 1P9WA 4I39A 3KSFA 2A24B 4IHQA 3CI6A 1TF1A 1ONHA 3SOIA 4JGQA 4IVIA 4BJPA 4FOFA 2J7VA 1W5DA 3CPTB 4GKUA 5CRFA 2HDRA 4I38A 3SH9A 3Q7VB 3QP2A 1T18A 2G2UA 4WZ5A 3PBOA 1SKOA 3DTEA 4RA7A 4AFIA 4EBPA 1STZA 4R4SA 4BWIA 3T50A 3P09A 3N6IA 4ETZA 2ZMAA 2QKPA 1PZPA 5EVIA 3ULFA 1PI4A 3E4OA 3UPPA 4R38A 4R0QA 1I5QA 4S2KA 3SS4A 4EBNA 5U47A 4F3LA 1DJBA 2WKIA 1K55A 2NUPC 1NY0A 4JXVA 4WEJA 4KZ4A 4Y15A 3IF6B 5EVLA 1MPLA 1NWZA 4IUHA 3VFFA 1PWCA 2EWWA 4LV0A 1FOFA 3BW6A 3HLFA 5TJJA 3U2AA 3MZEA 5I94A 4LV3A 4XT2B 4NXFA 3T4SA 5JYOA 3BFGA 5CERA 3PBTA 3FKWA 2V20A 4IJGA 4QHCA 5EE8A 2LB9A 2QJ5A 4FH4A 3LYXA 2Y2HA 3BM6A 3JVVA 3KO6A 5CTMA 5E2FA 1PYYA 2EX6A 5HD5A 2DCFA 2WKHA 5FI2A 3ZCZA 5EUAA 5GHXA 3PBQA 3VE3A 3O86A 3N8SA 2KX6A 4OLGA 3B47A 3UE1A 4N9LA 1T19A 5F1GA 3UE6A 3FV7A 4DJ3A 1LI9A 1IOUA 4OOYA 2Q0OA 5CGXA 3UE3A 3LEZA 4E3OA 5A92A 1LL9A 2W3DA 5KZHA 5F83A 3FYZA 3T4KA 3WS5A 2O9AA 3DWKA 3BRMA 3CPTA 3P01A 5EVIC 1ALQA 1YLPA 1KGFA 2W1RA 3BJNA 4KZ7A 2Y2JA 4QY6A 3W4QA 4DKIA 1FIKA 3BFEA 4JPMA 4JLFA 4KZBA 3FG8A 4L9FA 3V67A 1ACFA 5HAPA 1IKIA 1S1ZA 2WAEA 4KZ9A 1N9BA 4XXRA 3C5AA 5TGFA 5FATA 3LUQA 1N9OA 1W63Q 3MFDA 1IKGA 2K7SA 1ES5A 5F68A 4KQRA 4OONA 4OPZA 2BLSA 1DY6A 5GHYA 2B5RA 2ZLYA 4PKYA 1K4EA 4PM7A 3UB8A 3D3OA 2WKPA 3Q81A 1ES3A 4O01A 4ID4A 2GJ3A 3F1PA 4KQOA 2V1BA 2BTFP 3QNBA 2XLNA 3IWIA 5F1FA 3NOPC 3MFXA 3MZDA 4Z1WA 5M19A 4EEPA 1H5XA 1ESUA 4KQQA 3VMAA 1H0MA 3JVUA 2EX2A 3HUMA 3TOIA 1JNUA 4EETB 1A0KA 1H8MA 1ERQA 4DDYA 4LENA 5F69A 5KMWA 2Y2PA 4QJGA 3IXBA 5AVFA 4CLCB 1NYMA 2EXBA 4BLMA 3L9KA 1H3QA 4KG5A 2C6WB 3T1SA 2W1TA 3VP4A 2WKEA 2ACGA 3NDEA 3KSHA 5M18A 2VV8A 3HCYA 1F2KA 3NHQA 5CGWA 3IF5A 2Y2QA 3S1YA 3UMDA 3FKVA 1MXOA 2G7UA 5CEDA 3HBRA 2J3TD 4WL9A 3F1NB 3UO9A 2IA2A 5EVID 3LIDA 3W4PA 1OT9A 1YLYA 3MQQA 5GLDA 3IBJA 4P6BA 1LL5A 4C3QA 1UWNX 2ZJ9A 4OP8A 1E3UA 4OPYA 2WGWA 4X1LA 2GX5A 5MC7A 2GZAA 4HJ6A 1GSWA 3G2YA 5L09A 3A3JA 2VLGA 5FEFA 2PAVP 3DWZA 3OOVA 4WMCD 1SKOB 4KZAA 3PTEA 4WEKA 1WA9A 2Z2LB 1NXYA 2ZC6B 3OC2A 1FCOA 5E43A 2Y2IA 5A91A 2HGVA 3IT9A 2P04A 4DMZA 3P98A 2X01A 1M40A 2J3WA 3MXQA 4BD0A 3E4QA 4A5RA 3S7PA 2Y79A 1ERMA 1CK3A 4CLCD 1MY8A 4MNRA 4S2NA 3NECA 3HLCA 3T1QB 4JGRA 1PNEA 1NJ4A 4GDNA 1H8ZA 3UMEA 2VGKA 4NETA 3MS6A 4MN6A 5IU1A 4MN7A 2OAP1 3N8RA 4JGPA 4II7A 3ZG7B 4QU3A 2VGLM 4WZ4A 4MDZA 1IYOA 2P74A 4WBGA 2ZBBA 4GCZA 2H28A 4ZAMA 4G3WA 4P6ZS 3SZTA 4HEFA 5G18A 4KUOA 1P9RA 2BASA 3WS1A 4R23A 1MWTA 3MKFA 3TG9A 2P08A 3UB5P 1MWRA 1Q2QA 2Y4AA 2RL3A 1BLCA 5AQ7A 3NIAA 1LSWA 3UPOA 4LRXC 3UDFA 2PDRA 1L2SA 1WE4A 3H9WA 4D60A 3IXGA 1AXBA 1YQSA 3C30A 3RH8B 2INWA 3BFFA 1UGUA 2XD5A 3HUOA 4MBFA 1BTLA 2ZD8A 2UWXA 3E0YA 3BLSA 5AQ9A 4EXOA 4I3IA 2VGLS 3NY4A 4K91A 3G6OA 1RGYA 3H82B 1N9NA 4Q0IA 3I7JA 1RP5A 3C4PA 3FPWA 2P9VA 2EFXA 5EVIB 2XF3A 2D02A 1XJ6A 3IS2B 1Y28A 3KX0X 2UV0E 4QPRA 5HDSA 4DXBA 5FI6A 4B4XA 3NDGA 1TDGA 5HARA 1C3BA 3UN7A 2GNXA 5EM0A 3ZDJA 1LI0A 3PAGA 1OT6A 3HREA 1G5UA 4JF4A 4PM5A 1DP9A 5AQBA 4HP4A 1LT0A 2QWSA 5IS1A 2K2NA 4HBUA 2NUTC 5FASA 1MKIA 4GHIA 5FDHA 3HLEA 3CHWP 3QP5A 5EM1A 2EX8A 5FQKA 3EQUA 3HLBA 3G34A 1YLZA 5CXWA 3K3DA 2ZC4B 3RTYA 5FEGA 2K31A 2JKTI 1PFLA 2V1ZA 1SHVA 4P87A 2O9BA 2L4RA 1IYSA 3PYPA 1FR1A 3RJUA 1E3UD 2W1TB 3IXDA 4C6YA 4EBLA 3D9YA 4HESA 3CWFA 1YPRA 2OWHA 3T4TA 4EEUA 3T4LA 5A93A 1ESIA 5EECA 5HWVA 4ZJ3A 4UAAA 4I3AA 3MSHA 2XSSA 3IHBA 3B33A 4Y17A 3K3CA 3VOLA 1KVLA 3NBLA 3RXWA 3NULA 2J3TC 1MWSA 1HD8A 1KE3A 4CLCA 3OBFA 4OPQA 2ZC7A 2J9PA 2HJ9C 1NZUA 2WAFA 4EERA 5AJGA 2PYRA 3TRCA 4WUJA 2RCXA 1FCMA 1D7EA 1VEUA 1XJ2A 4LGWA 5HDCA 1CQAA 3UNWA 3V50A 1JWVA 2WZXA 2ZQ7A 3ZG8B 2L1MA 2HF6A 3IX3A 3LICA 3TE8A 3EQVA 3UB9A 3A3EA 1H8YA 3QP8A 4KG2A 4LCMA 2PHYA 3EWKA 4YNRA 5FI7A 3HJIA 4PM6A 4EQ1A 1IELA 2I9VA 4X56A 1KVMA 1L0GA 2V9AA 2HP5A 3U4LP 3ZQ5A 3A3IA 4ZJ1A 5G4ZA 2KDKA 4PM8A 1W8QA 1K54C 1NZOA 3VE4A 2ZQAA 4MN5A 1N9LA 4EV4A 2XA7M 3MMHA 4UQIS 4B93A 1Z09A 2ZL1B 3PHYA 5A8BA 2WYXA 2IWDA 3Q82A 2HP6A 1K38A 3R7WB 3E98A 4L9GA 3BYDA 1YMXA 2W27A 3LR5A 3VSLA 3QP6A 4O0PA 5DTTA 1PWDA 3CUEA 1L0DA 4CLCE 3SW1A 1PI5A 4EU0A 2XDMA 1T1CA 2R78A 1YLTA 4R1GA 4S2NC 3B3XA 3MXRA 4LFUA 3CITA 1PIOA 1G6AA 3LI9A 3QNCA 1QMFA 4NKPA 4DE0A 3V5MA 5EVEA 1VEUB 1G28A 4IVKA 1OTIA 2V8CA 2M1CA 2AVXA 3HUNA 3LO7A 3LFVA 4HNBA 2OLVA 4NEED 3D72A 5GLBA 1S1YA 2D01A 2QZ6A 2PRFA 2WZZA 1ZG6A 1K4FA 5J3WA 1FR6A 1ZHHB 3ZVWA 1JTDA 1XGJA 4K08A 2OV5A 3NJAA 2VJWA 2Y2NA 2WADA 1XFQA 1IFQA 3QP1A 4O8GA 2QJ7A 5HWTA 2WKQA 1F98A 2PR6A 1DJAA 1YSPA 1K56A 2QYBA 4GS9A 4KZ8A 5D3OA 3C7VA 3UY6A 3IX8A 4CPKA 2QHKA 3UDXA 1EI5A 4EUVA 1KDWA 1T1AA 4P6ZM 2HDQA 3HLWA 3OPPA 4GOGA 4QB8A 4BBVA 2R9WA 3HL9A 4OOMA 1J9MA 5EOOA 5GHZA 2HJEA 3UB7A 4ZDXA 5FSRA 3IXHA 5DVAA 5DF7A 3UPNA 2ZM8A 3SS3A 2VV6A 4CLCC 3G32A 3KYEA 1MZUA 1S4RA 1MKMA 1K57C 4RX3A 2JKTM 3TW8A 2Z6CA 2XGNA 5DFYA 3Q7VA 4I3JA 4FCFA 4RYEA 1W63M 2CMNA 2X02A 4YWZA 3GDIA 4HY8A 1YKDA 3H82A 5LBRA 1PZOA 5HPIA 4NXGA 1KGGA 2A24A 5FA7A 2EWVA 1Z6FA 4GN2A 2W3EA 4FH2A 5HAIA 3TJZC 5DFXA 3BFDA 4BQMA 4JXSA 1VHMA 1Y54A 2PU4A 1KGEA 1BLSA 3KYZA 3S7NA 4NXBA 4ARZA 2VA0A 2B02A 1WYBA 2EXAA 3WWXA 1PWGA 2VK3A 1ES2A 3VV4A 5IT5A 2ZQ9A 4WN5A 3PBSA 1SCWA 5EPHA 2PD8A 4JF6A 3PAEA 4X68A 5CGSA 3IH9A 4JKTA 4B4ZA 3NOTC 5TBMA 4GD8A 2R9XA 4LV2A 3WRZA 3T12B 3C7UA 2W3GA 4K0XA 3UE0A 3H7WA 4WZ5C 4EQIA 4E04A 1BUEA 4UA9A 4GLQA 1GSVA 3A3DA 3DAVA 3S7OA 2A2LA 4MBKA 2XEPA 2HDSA 1OTBA 4R3AA 2FH5A 5HFOA 5CTNA 1VM1A 2ZOHA 4L9EA 4M4XA 1CI8A 3S7QA 2J8YA 3PR6A 1V9YA 1XPBA 1WYCA 5L2FA 4OQHA 2P9VB 1G68A 3MBZA 1JVJA 1ODVA 3HVFA 4OVDA 1SZVA 3G2ZA 5DKLA 1X0OA 1YLJA 1BT5A 3F1NA 4X25A 4GJ4A 4XT2A 2XFSA 2V2FF 2JE5A 3OLOA 2HP9A 1O07A 1LSXA 3ZG9B 2Q9NA 3CMZA 2YKHA 3G35A 1DP8A 3BWLA 3EGXC 3IWOA 3UDIA 4PMAA 4UEYA 4JXWA 3AGFA 3BQAA 5HWWA 3IX4A 1BLHA 5F5YA 4DRTA 2XQZA 4UA7A 4Q8IA 1J3WA 3EEHA 1L0EA 5GLAA 2HZ5A 4G3KA 1EW0A 4OOLA 3GMWA 5EV0A 3OPLA 3FZCA 3A3FA 3GTCA 1V9ZA 2XR0A 3FWLA 4MCWA 5BOHA 3ZVTA 3MR0A 4R4RA 2WUQA 3MQ0A 4KZ3A 4P85A 1CEGA 2BG1A 3BECA 2W3HA 3LIFA 4BENA 4KQDA 1I2SA 5FL3A 1DJCA 4X53A 3Q1FA 1MBLA 2M7UA 4ESPA 2X71A 3WS2A 4IUKA 3MQOA 4YOFA 3P7NA 3GRJA 4QWOA 3O87A 4N9KA 5M1AA 3QHYA 1K54A 5AQAA 4E3MA 5FQQA 3KYQA 3BLMA 2IWBA 4M3KA 3LCEA 4BBTA 1S0WA 2DRWA 3RXXA 1SDNA 3B42A 5G4YA 5DJUA 3ZG0A 2FZ0A 4KG6A 1IYQA 4OKPA 3ZNYA 3NCKA 3Q7ZA 5CECA 3O88A 2Y2LA 3ZG5A 4YFMA 3L7HA 1S6RA 4RX2A 3WS0A 3GECA 2Z2MB 1BZAA 3A0SA 3G30A 1NRFA 5J4EA 3BEBA 4Q0JA 3IWQA 2PBYA 4U0XA 5KSHA 4X55A 1OJ5A 2ZM2A 4H6JB 5F82A 1NLYA 5J7EA 3NC8A 1K55C 1HVBA 4O7DA 4P0MA 4GD6A 2XFTA 1TDLA 3GR2A 2M7VA 3M2KA 2HPBA 2EX9A 2Y91A 4EWFA 3ZHHA 3C38A 1JWPA 1AWIA 1MWUA 2O9CA 4FTXA 1LSVA 1TVFA 2C5WB 1GA9A 2QPNA 4HJ3A 4IBRA 1FILA 3PXPA 4B88A 3IS2A 4MEZA 2V0WA 4ETXA 2WKRA 3ISGA 3C8CA 3ZFZA 2H5SA 2O0YA 4GZBA 3T4JA 1P97A 1XA7A 1YSQA 2XD1A 1YMSA 2P7JA 4ZBEA 4LRYC 4UHUA 3CUEC 3ICYA 4LV1A 2ZQCA 3LY4A 5JYPA 4WF0A 5KSCA 4Y5FA 3EEAA 1VETB 2DNSA 4G3VA 1YM1A 3IH8A 2KLIA 2H0YA 4E3LA 4ZRRA 4R3BA 5TFQA 4LPZA 2JKRM 4CJNA 4JXGA 4U3TA 3OZHA 5KIZA 2Y8HA 4HJ4A 2MJ6A 3WS4A 2OAQ1 5J8XA 5HD3A 3LR0A 3T4OA 5FAPA 5E2HA 1SKFA 4DE3A 1G6OA 5FAQA 1FQGA 4JF5A 4HBTA 5K5BA 5I5LA 5CHUA 4BMWA 3IBRA 4Y0UA 2VKSA 4KENB 3GV9A 2Q9MA 2V8FA 2VEAA 3LIBA 3JPUA 4Y13A 4E3KA 2W3FA 3PBRA 1OTDA 5FAOA 4N1XA 4EESA 2PT7A 1PRQA 3V3RA 2A3UA 5FDSA 4GS9B 1TS8A 3T1RA 1DP6A 1RGZA 2J80A 2ZMFA 1EWZA 2JKGA 4PHTA 1K57A 3N7WA 3NI9A 3SH7A 5A90A 3R7WA 1NYYA 5FQIA 4LCLA 3E2LA 4WYYA 1IEMA 3S4XA 2Y2KA 4OPRA 5GLCA 3SH8A 1YAXA 5EFWA 4GW9A 3LGOA 1XP4A 4R3JA 5HAQA 4Y7PA 4WELA 3N8LA 2PU2A 1CF0A 2WGIA 4XUZA 3M6HA 2VV7A 1ZG4A 2A49A 2FFYA 3C2WA 4S2OA 5E2GA 3QP4A 1TS7A 3W8KA 1LHYA 2ZMVA 1OMEA 4HH2A 4E3IA 2PBDP 4S2PA 1GHPA 3O5YA 3OCNA 3EGDC 4HI4A 5FQ9A 1GSXA 4BL2A 1N4OA 3G31A 2VX8A 1GHMA 3ZGAB 3MXSA 3F1OA 4S2MA 1HTZA 2ZC3B 3VSKA 4E6WA 2JBFA 3HJKA 3TSGA 2B95A 1XA1A 2JN7A 1FSYA 5DKKA 1ZTUA 4GNUA 4DE1A 5DTKA 3HLGA 3ITBA 3M2JA 1XXMA 3AGDA 4I5SA 5HZHA 1LL8A 3ITAA 4R70A 1DRMA 3GSGA 1KE4A 3A0RA 1K56D 3MKEA 1XJ3A 2OLUA 4N1HA 4YINA 5FQJA 5TBMB 1TS6A 1S66L 3VOYA 3MJQA 4IEDA 3R4KA 1KDSA 2JKFA 1E25A 2HV1A 5CX7A 2B18A 5AVEA 4HQAA 4GDBA 3DBAA 3VFHA 4PKYG 2O99A 4PAUA 5TR7A 3EOIA 2PYPA 1NRJA 1ZKJA 4Y2FA 4D2OA 2E8JA 4KZ6A 1MC0A 2Y55A 4DF6A 4CQHA 3AGEA 3BQ8A 1L3LA 4ARZB 1GHIA 4FSFA 4RQ9A 4OQIA 5DJTA 1BYWA 3IQAA 3KSGA 2H0TA 3JYIA 3GQZA 1ZC2A 3CZDA 2Y59A 4BBUA 3LIEA 1OJGA 5HL6A 2VGJA 3FPVA 3F1OB 4Y0TA 1XJ4A 1D1JA 2JKRI 3W4OA 2V1AA 4H6JA 3CAXA 3DTKA 4B9OA 4HH3A 3HLDA 3SS5A 4UQIM 2PD7A 4BL3A 2ZOIA 2WK0A 3FC7A 4MBHA 3C4OA 3LY3A 3S22A 1VETA 4FUWA 3WRTA 4QY5A 1QMEA 4JBFA 1PW8A 1SDEA 1U60A 3IHAA 1Y4OA 4DDSA 2JC7A 2VZWA 3LEQA 4X1MA 4LRZE 1FSWA 1CEFA 2PR5A 5IHVA 1OTEA 4GB7A 5HPFA 3BFCA 2WGWB 1XFNA 3IF6C 1XGIA 1L0FA 5HSQA 1K6RA 2G2WA 4DJ2A 4NXEA 1CJFA 1S4SA 4ZTKA 2JHEA 1KOUA 2Y2MA 5CHMA 4MMNA 2JCHA 5DTSA 3OCLA 1F5MA 1JTGA 3G4PA 2L0WA 4E6XA 2KOIA 1OPXA 3LI8A 4HIAA 2XROA 3PBNA 4FD8A 4OLDA 2WGVA 4F3LB 2EFUA 3VP0A 1NLZA 1HZOA 1M6KA 5F6AA 1FCNA 3DW0A 4KZ5A 3KSIA 1T1BA 2OOLA
chains in the Genus database with same CATH topology
3H7WB 3NOPC 3PHYA 3MFXA 3A0VA 5A8BA 4Z1WA 4EEPA 4DN0A 1P0ZA 5KSHA 5L8MA 4HP9A 3R7WB 3E98A 4L9GA 2V0UA 2W27A 3JVUA 3LR5A 1OJ5A 4EETB 4H6JB 1JNUA 1NLYA 4O0PA 5J7EA 1H8MA 3CUEA 5F69A 2M7VA 4CLCE 4LLOB 3SW1A 4ME4A 4EU0A 1T1CA 5AVFA 4CLCB 2R78A 3C38A 3ZYTA 2O9CA 1LSVA 1H3QA 3CITA 3LI9A 2W1TA 4NKPA 4HJ3A 3PXPA 3IS2A 3KSHA 2V0WA 2VV8A 3HCYA 1G28A 1OTIA 4ETXA 3NHQA 2M1CA 2WKRA 3LFVA 2XRNA 3UMDA 4HNBA 3C8CA 4NEED 2O0YA 3D72A 2G7UA 3T4JA 2LB5A 1P97A 4WLAA 1YSQA 2J3TD 1S1YA 4WL9A 2D01A 2Z6DA 2P7JA 4LRYC 3F1NB 3CUEC 2IA2A 3ICYA 1S67L 3LIDA 1OT9A 1TD5A 4HHDA 3E4PA 3MQQA 5J3WA 3IBJA 4WF0A 3RFBA 4Y5FA 1ZHHB 3EEAA 4R6LA 2EA9A 4G3VA 3UB6A 1UWNX 4K08A 3NJAA 2VJWA 2GX5A 5MC7A 2KLIA 1F9IA 4ZRRA 2GZAA 4HJ6A 1GSWA 1XFQA 4LPZA 4HOIA 1IFQA 2JKRM 5C5KA 1VB6A 2VLGA 4O8GA 2QJ7A 3K2NA 5HWTA 3OOVA 2WKQA 1F98A 5KIZA 2PR6A 2Y8HA 4HJ4A 2MJ6A 3LR4A 2OAQ1 4WEKA 5HD3A 1WA9A 1YSPA 3LR0A 3MF0A 2QYBA 4GS9A 3T4OA 3OC2A 1G6OA 2DMWA 2QHKA 3T4QA 4EUVA 1T1AA 2HGVA 4P6ZM 5K5BA 5I5LA 2P04A 3IBRA 4BMWA 4DMZA 4BBVA 2VKSA 4Q0HA 2J3WA 4KQOA 3MXQA 2VEAA 3LIBA 4OOMA 2OWJA 3E4QA 2HJEA 3S7PA 2W3FA 2Y79A 3UB7A 3PBRA 2XA7S 1OTDA 4CLCD 4EESA 2PT7A 2VV6A 4CLCC 4GS9B 1MZUA 1S4RA 1TS8A 1MKMA 1DP6A 4JGRA 2J80A 4Y3IA 2ZMFA 4PHTA 2JKTM 3UMEA 3TW8A 2Z6CA 3LR3A 3R7WA 1OTAA 5DFYA 4MN6A 4I3JA 5IU1A 3W2ZA 4MN7A 1W63M 2OAP1 1UWPX 2CMNA 1YAXA 4JGPA 3F1PB 4II7A 5EFWA 4YWZA 4GW9A 3GDIA 4HY8A 1YKDA 3H82A 2VGLM 5LBRA 3LIAA 5HPIA 4NXGA 4MDZA 4WELA 1D06A 3NOUC 2A24A 2EWVA 2YKFA 2ZBBA 5HDDA 4GCZA 4EW7A 2W3EA 2H28A 2VV7A 3CLOA 4G3WA 4L0LA 4P6ZS 3TJZC 5DFXA 1TS0A 3C2WA 1VHMA 3BY9A 4KUOA 1TS7A 1P9RA 2BASA 2ZMVA 4HH2A 2P08A 2W0NA 3KYZA 3S7NA 4GHIB 4KUKA 3O5YA 3OCNA 3EGDC 4NXBA 4ARZA 2VA0A 4JGOA 2B02A 4HI4A 3BY8A 1GSXA 5DF9A 2VX8A 1P9WA 4I39A 3KSFA 1LSWA 2A24B 3VV4A 5IT5A 4IHQA 3F1OA 3CI6A 1TF1A 4WN5A 3PBSA 4LRXC 4JGQA 2PDRA 4BJPA 3HJKA 4FOFA 3H9WA 2PD8A 2JN7A 3C30A 3RH8B 5DKKA 3NOTC 2INWA 4I38A 1UGUA 5TBMA 1ZTUA 1T18A 3E0YA 3PBOA 4AFIA 4EXOA 2W3GA 1STZA 4I3IA 2VGLS 3H7WA 4BWIA 3T50A 3G6OA 4ETZA 2QKPA 4E04A 3H82B 1N9NA 4Q0IA 4I5SA 5HZHA 3ULFA 1LL8A 3E4OA 3FPWA 4R70A 2D02A 1XJ6A 4R38A 4GLQA 1GSVA 1DRMA 3IS2B 1Y28A 3KX0X 3A0RA 3S7OA 2A2LA 4QPRA 5HDSA 1OTBA 1XJ3A 4R3AA 2FH5A 5TBMB 4F3LA 1TS6A 1S66L 2ZOHA 4L9EA 4M4XA 2NUPC 2GNXA 1T1BA 3MJQA 3S7QA 3R4KA 3PR6A 4WEJA 1V9YA 2HV1A 5CX7A 2B18A 5AVEA 4HQAA 3DBAA 4PKYG 1NWZA 1ODVA 1OT6A 2O99A 4IUHA 4PAUA 3EOIA 2PYPA 1NRJA 2EWWA 1DP9A 4HP4A 1LT0A 4Y2FA 2QWSA 3BW6A 5IS1A 5TJJA 1MC0A 3U2AA 5DKLA 1X0OA 2K2NA 4CQHA 2NUTC 3BQ8A 4GHIA 4XT2B 4NXFA 4ARZB 3T4SA 4FSFA 4RQ9A 3F1NA 4XT2A 4GJ4A 5DJTA 1BYWA 3KSGA 3PBTA 3OLOA 4IJGA 3EQUA 2LB9A 2QJ5A 4BBUA 1LSXA 3LIEA 1OJGA 5HL6A 3LYXA 3FPVA 3F1OB 2YKHA 1XJ4A 1DP8A 3KO6A 3BWLA 2JKRI 3JVVA 3EGXC 2V1AA 3K3DA 4UEYA 4H6JA 5HD5A 3RTYA 2K31A 3BQAA 5HWWA 3CAXA 4B9OA 2JKTI 5F5YA 4HH3A 3PBQA 3VE3A 2O9BA 2KX6A 4UQIM 3B47A 3EEHA 2PD7A 2L4RA 3PYPA 2ZOIA 1T19A 4G3KA 1EW0A 4OOLA 3UE6A 4DJ3A 1IOUA 3FC7A 2W1TB 3UE3A 1V9ZA 2W3DA 4MCWA 3CWFA 3MR0A 2OWHA 3T4TA 4EEUA 3T4KA 3T4LA 2O9AA 5HWVA 3MQ0A 4I3AA 3P01A 2XSSA 3B33A 3K3CA 2W3HA 3VOLA 2J3TC 3LIFA 2VZWA 4KQDA 4LRZE 2W1RA 3BJNA 4CLCA 3OBFA 2PR5A 5FL3A 2HJ9C 1OTEA 5HPFA 1XFNA 4EERA 5AJGA 2M7UA 2PYRA 3TRCA 4WUJA 3FG8A 4IUKA 4L9FA 1D7EA 3MQOA 3V67A 1XJ2A 5HSQA 5HDCA 4YOFA 3P7NA 2L1MA 2HF6A 3LICA 1S1ZA 3TE8A 3EQVA 3UB9A 4DJ2A 3KYQA 2PHYA 3EWKA 4YNRA 4NXEA 1S4SA 3LUQA 4BBTA 1N9OA 1W63Q 3HJIA 3B42A 4EQ1A 2JHEA 5G4YA 2I9VA 1KOUA 2K7SA 4MMNA 5DJUA 5F68A 3OCLA 1F5MA 2FZ0A 2L0WA 2KOIA 2V9AA 1OPXA 4PKYA 3LI8A 4HIAA 2XROA 3ZQ5A 3PBNA 5G4ZA 3UB8A 2KDKA 3D3OA 4F3LB 3GECA 2WKPA 3A0SA 1NLZA 4O01A 3VE4A 4MN5A 1N9LA 5F6AA 2XA7M 2GJ3A 3MMHA 3F1PA 4Q0JA 5J4EA 4UQIS 4B93A 3KSIA 2V1BA 2OOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PD7 A;  3RH8 B;  2L4R A;  3PYP A;  3H7W B;  2ZOI A;  5DKK A;  3NOP C;  3NOT C;  3MFX A;  2INW A;  3A0V A;  1UGU A;  1T19 A;  3PHY A;  4I38 A;  5TBM A;  5A8B A;  1EW0 A;  4EEP A;  3UE6 A;  1P0Z A;  2VEA A;  3MXQ A;  4DJ3 A;  3LIB A;  1T18 A;  3FC7 A;  2OWJ A;  4HP9 A;  4L9G A;  3E4Q A;  1V9Z A;  4EXO A;  2V0U A;  2W27 A;  1OJ5 A;  4I3I A;  3UB7 A;  4EET B;  4H6J B;  1JNU A;  3H7W A;  5J7E A;  3T50 A;  3CWF A;  1OTD A;  3G6O A;  3MR0 A;  2QKP A;  2OWH A;  4E04 A;  3H82 B;  1N9N A;  4EES A;  4I5S A;  4EEU A;  2VV6 A;  5HZH A;  3ULF A;  1LL8 A;  5F69 A;  4GS9 B;  3E4O A;  1MZU A;  4LLO B;  1S4R A;  1TS8 A;  5HWV A;  2PD8 A;  3SW1 A;  4R70 A;  2D02 A;  1XJ6 A;  1DP6 A;  4R38 A;  4I3A A;  1GSV A;  4JGR A;  2J80 A;  1DRM A;  3IS2 B;  1T1C A;  3B33 A;  5AVF A;  2R78 A;  1Y28 A;  3K3C A;  3VOL A;  3KX0 X;  3A0R A;  1LSV A;  3UME A;  3LIF A;  3LI9 A;  5HDS A;  2Z6C A;  1OTB A;  1XJ3 A;  4R3A A;  1OTA A;  4HJ3 A;  4KQD A;  4LRZ E;  5TBM B;  4F3L A;  1TS6 A;  3IS2 A;  1S66 L;  2ZOH A;  2V0W A;  4I3J A;  4L9E A;  2PR5 A;  2VV8 A;  4M4X A;  4MN6 A;  1G28 A;  1OTI A;  5IU1 A;  3MJQ A;  1OTE A;  3NHQ A;  2M1C A;  1XFN A;  4EER A;  1UWP X;  1V9Y A;  2CMN A;  2HV1 A;  2PYR A;  2WKR A;  3F1P B;  4JGP A;  4WUJ A;  5EFW A;  4HNB A;  3FG8 A;  5AVE A;  4YWZ A;  3C8C A;  4GW9 A;  4HQA A;  4L9F A;  1D7E A;  3GDI A;  3MQO A;  3D72 A;  1XJ2 A;  4HY8 A;  3UMD A;  5HSQ A;  3H82 A;  5HDC A;  3P7N A;  1P97 A;  4WLA A;  4PKY G;  1NWZ A;  1ODV A;  1OT6 A;  1S1Y A;  2V1B A;  4WL9 A;  2D01 A;  2Z6D A;  2P7J A;  3LIA A;  4LRY C;  4NXG A;  2PYP A;  3F1N B;  1D06 A;  2L1M A;  3NOU C;  1DP9 A;  1S67 L;  2A24 A;  1LT0 A;  1S1Z A;  2YKF A;  3ICY A;  2QWS A;  2ZBB A;  3LIC A;  3LID A;  4HP4 A;  1OT9 A;  5HDD A;  4GCZ A;  4HHD A;  3UB9 A;  4EW7 A;  5IS1 A;  4DJ2 A;  3E4P A;  3MQQ A;  2H28 A;  1X0O A;  2PHY A;  2VV7 A;  3CLO A;  3EWK A;  5DKL A;  4NXE A;  4WF0 A;  5J3W A;  1S4S A;  4GHI A;  4XT2 B;  3LUQ A;  4BBT A;  1TS0 A;  4NXF A;  3C2W A;  1N9O A;  4R6L A;  3BY9 A;  2EA9 A;  3HJI A;  4RQ9 A;  3F1N A;  1TS7 A;  1UWN X;  4K08 A;  2BAS A;  2JHE A;  4KUO A;  3NJA A;  4XT2 A;  4HH2 A;  5G4Y A;  5DJT A;  1BYW A;  2I9V A;  4EQ1 A;  1KOU A;  2K7S A;  5DJU A;  1F9I A;  3OLO A;  5F68 A;  4HJ6 A;  1GSW A;  1XFQ A;  4LPZ A;  2W0N A;  4HOI A;  4GHI B;  4KUK A;  2QJ5 A;  4NXB A;  4BBU A;  1LSX A;  3LIE A;  1OJG A;  3LYX A;  1VB6 A;  2VLG A;  4JGO A;  2L0W A;  3F1O B;  2B02 A;  2QJ7 A;  4HI4 A;  2V9A A;  5HWT A;  2WKQ A;  1GSX A;  2YKH A;  1XJ4 A;  3BY8 A;  3LI8 A;  4HIA A;  4PKY A;  1DP8 A;  3ZQ5 A;  3BWL A;  1F98 A;  5KIZ A;  3EEH A;  2PR6 A;  4HJ4 A;  4I39 A;  5I5L A;  1LSW A;  2A24 B;  2V1A A;  3K3D A;  1WA9 A;  4H6J A;  5G4Z A;  2KDK A;  5HD3 A;  3UB8 A;  5HD5 A;  4GS9 A;  4F3L B;  3RTY A;  4BBV A;  3GEC A;  3F1O A;  5HWW A;  4WN5 A;  2WKP A;  3A0S A;  3CAX A;  4LRX C;  4B9O A;  4JGQ A;  3VE4 A;  2PDR A;  2QHK A;  4MN5 A;  1N9L A;  5F6A A;  3HJK A;  5F5Y A;  3UB6 A;  3H9W A;  4HH3 A;  1T1A A;  2GJ3 A;  5J4E A;  3F1P A;  3VE3 A;  1T1B A;  2KX6 A;  3IBR A;  2OOL A;  2JN7 A; 
#chains in the Genus database with same CATH topology
 1JWZ A;  3H7W B;  2ZL1 A;  4DE2 A;  3A0V A;  4IBX A;  4U0T A;  3V39 A;  4DN0 A;  1P0Z A;  4E3J A;  5L8M A;  4HP9 A;  1XKZ A;  1LLB A;  2V0U A;  2HDU A;  3E2K A;  1K0K A;  2CC1 A;  4WM9 A;  1XX2 A;  1K25 A;  4NK3 A;  4LLO B;  4ME4 A;  1VQQ A;  4N92 A;  3ZYT A;  1RCJ A;  4RVA A;  4BD1 A;  3M6B A;  3OPH A;  5EOE A;  4K0W A;  2H10 A;  2Y2O A;  3IF6 A;  3VOZ A;  1IYP A;  4OH0 A;  3DTM A;  1K6S A;  2XRN A;  2IWC A;  4S2J A;  5L10 A;  1BLP A;  1YLW A;  1O7E A;  2QMI A;  2LB5 A;  3OPR A;  4WLA A;  4C75 A;  5L07 A;  2Z6D A;  1S67 L;  2ZM0 A;  1TD5 A;  4HHD A;  3E4P A;  4ZJ2 A;  2ZQ8 A;  2XH9 A;  3GVB A;  1GA0 A;  3RFB A;  1W7F A;  4R6L A;  2EA9 A;  3UB6 A;  4EUZ A;  3CG5 A;  2GDN A;  4H8R A;  1F9I A;  1W79 A;  4PM9 A;  5GL9 A;  4HOI A;  5C5K A;  1VB6 A;  3K2N A;  1W8Y A;  3LR4 A;  4OQG A;  3MZF A;  1BSG A;  3MF0 A;  4Y0O A;  4F94 A;  3DTI A;  2DMW A;  3V3S A;  3T4Q A;  3VP1 A;  5DF8 A;  3T1X A;  4Z9Q A;  4E3N A;  3ZNT A;  2E8I A;  4Q0H A;  5HX9 A;  1PW1 A;  2OWJ A;  3VP3 A;  2OSU A;  2Y2G A;  4MLL A;  2I72 A;  2XA7 S;  3O3V A;  5CEB A;  4S2L A;  4NG2 A;  5FQM A;  2ZC5 B;  1ERO A;  5HL1 A;  4Y3I A;  1ES4 A;  1E4D A;  1GCE A;  5CHJ A;  3LR3 A;  1OTA A;  4DXC A;  3N4I A;  1YT4 A;  4S2I A;  3VP2 A;  3CJM A;  1ONG A;  3W2Z A;  1UWP X;  5HW3 A;  3Q07 A;  3F1P B;  4XUX A;  2J9O A;  4QD4 A;  4OP5 A;  3LIA A;  4OQ0 A;  4X6T A;  1D06 A;  3NOU C;  4PPR A;  1CI9 A;  2YKF A;  5HDD A;  4EW7 A;  4UA6 A;  3CLO A;  4L0L A;  4X69 A;  2XK1 A;  1TS0 A;  3BY9 A;  2FFF B;  1HLU P;  3D4F A;  1TEM A;  1I2W A;  2W0N A;  4GHI B;  4KUK A;  1BUL A;  1Q2P A;  4JGO A;  5E2E A;  3BY8 A;  1KE0 A;  5DF9 A;  4WMC A;  2ZQD A;  1P9W A;  4I39 A;  3KSF A;  2A24 B;  4IHQ A;  3CI6 A;  1TF1 A;  1ONH A;  3SOI A;  4JGQ A;  4IVI A;  4BJP A;  4FOF A;  2J7V A;  1W5D A;  3CPT B;  4GKU A;  5CRF A;  2HDR A;  4I38 A;  3SH9 A;  3Q7V B;  3QP2 A;  1T18 A;  2G2U A;  4WZ5 A;  3PBO A;  1SKO A;  3DTE A;  4RA7 A;  4AFI A;  4EBP A;  1STZ A;  4R4S A;  4BWI A;  3T50 A;  3P09 A;  3N6I A;  4ETZ A;  2ZMA A;  2QKP A;  1PZP A;  5EVI A;  3ULF A;  1PI4 A;  3E4O A;  3UPP A;  4R38 A;  4R0Q A;  1I5Q A;  4S2K A;  3SS4 A;  4EBN A;  5U47 A;  4F3L A;  1DJB A;  2WKI A;  1K55 A;  2NUP C;  1NY0 A;  4JXV A;  4WEJ A;  4KZ4 A;  4Y15 A;  3IF6 B;  5EVL A;  1MPL A;  1NWZ A;  4IUH A;  3VFF A;  1PWC A;  2EWW A;  4LV0 A;  1FOF A;  3BW6 A;  3HLF A;  5TJJ A;  3U2A A;  3MZE A;  5I94 A;  4LV3 A;  4XT2 B;  4NXF A;  3T4S A;  5JYO A;  3BFG A;  5CER A;  3PBT A;  3FKW A;  2V20 A;  4IJG A;  4QHC A;  5EE8 A;  2LB9 A;  2QJ5 A;  4FH4 A;  3LYX A;  2Y2H A;  3BM6 A;  3JVV A;  3KO6 A;  5CTM A;  5E2F A;  1PYY A;  2EX6 A;  5HD5 A;  2DCF A;  2WKH A;  5FI2 A;  3ZCZ A;  5EUA A;  5GHX A;  3PBQ A;  3VE3 A;  3O86 A;  3N8S A;  2KX6 A;  4OLG A;  3B47 A;  3UE1 A;  4N9L A;  1T19 A;  5F1G A;  3UE6 A;  3FV7 A;  4DJ3 A;  1LI9 A;  1IOU A;  4OOY A;  2Q0O A;  5CGX A;  3UE3 A;  3LEZ A;  4E3O A;  5A92 A;  1LL9 A;  2W3D A;  5KZH A;  5F83 A;  3FYZ A;  3T4K A;  3WS5 A;  2O9A A;  3DWK A;  3BRM A;  3CPT A;  3P01 A;  5EVI C;  1ALQ A;  1YLP A;  1KGF A;  2W1R A;  3BJN A;  4KZ7 A;  2Y2J A;  4QY6 A;  3W4Q A;  4DKI A;  1FIK A;  3BFE A;  4JPM A;  4JLF A;  4KZB A;  3FG8 A;  4L9F A;  3V67 A;  1ACF A;  5HAP A;  1IKI A;  1S1Z A;  2WAE A;  4KZ9 A;  1N9B A;  4XXR A;  3C5A A;  5TGF A;  5FAT A;  3LUQ A;  1N9O A;  1W63 Q;  3MFD A;  1IKG A;  2K7S A;  1ES5 A;  5F68 A;  4KQR A;  4OON A;  4OPZ A;  2BLS A;  1DY6 A;  5GHY A;  2B5R A;  2ZLY A;  4PKY A;  1K4E A;  4PM7 A;  3UB8 A;  3D3O A;  2WKP A;  3Q81 A;  1ES3 A;  4O01 A;  4ID4 A;  2GJ3 A;  3F1P A;  4KQO A;  2V1B A;  2BTF P;  3QNB A;  2XLN A;  3IWI A;  5F1F A;  3NOP C;  3MFX A;  3MZD A;  4Z1W A;  5M19 A;  4EEP A;  1H5X A;  1ESU A;  4KQQ A;  3VMA A;  1H0M A;  3JVU A;  2EX2 A;  3HUM A;  3TOI A;  1JNU A;  4EET B;  1A0K A;  1H8M A;  1ERQ A;  4DDY A;  4LEN A;  5F69 A;  5KMW A;  2Y2P A;  4QJG A;  3IXB A;  5AVF A;  4CLC B;  1NYM A;  2EXB A;  4BLM A;  3L9K A;  1H3Q A;  4KG5 A;  2C6W B;  3T1S A;  2W1T A;  3VP4 A;  2WKE A;  2ACG A;  3NDE A;  3KSH A;  5M18 A;  2VV8 A;  3HCY A;  1F2K A;  3NHQ A;  5CGW A;  3IF5 A;  2Y2Q A;  3S1Y A;  3UMD A;  3FKV A;  1MXO A;  2G7U A;  5CED A;  3HBR A;  2J3T D;  4WL9 A;  3F1N B;  3UO9 A;  2IA2 A;  5EVI D;  3LID A;  3W4P A;  1OT9 A;  1YLY A;  3MQQ A;  5GLD A;  3IBJ A;  4P6B A;  1LL5 A;  4C3Q A;  1UWN X;  2ZJ9 A;  4OP8 A;  1E3U A;  4OPY A;  2WGW A;  4X1L A;  2GX5 A;  5MC7 A;  2GZA A;  4HJ6 A;  1GSW A;  3G2Y A;  5L09 A;  3A3J A;  2VLG A;  5FEF A;  2PAV P;  3DWZ A;  3OOV A;  4WMC D;  1SKO B;  4KZA A;  3PTE A;  4WEK A;  1WA9 A;  2Z2L B;  1NXY A;  2ZC6 B;  3OC2 A;  1FCO A;  5E43 A;  2Y2I A;  5A91 A;  2HGV A;  3IT9 A;  2P04 A;  4DMZ A;  3P98 A;  2X01 A;  1M40 A;  2J3W A;  3MXQ A;  4BD0 A;  3E4Q A;  4A5R A;  3S7P A;  2Y79 A;  1ERM A;  1CK3 A;  4CLC D;  1MY8 A;  4MNR A;  4S2N A;  3NEC A;  3HLC A;  3T1Q B;  4JGR A;  1PNE A;  1NJ4 A;  4GDN A;  1H8Z A;  3UME A;  2VGK A;  4NET A;  3MS6 A;  4MN6 A;  5IU1 A;  4MN7 A;  2OAP 1;  3N8R A;  4JGP A;  4II7 A;  3ZG7 B;  4QU3 A;  2VGL M;  4WZ4 A;  4MDZ A;  1IYO A;  2P74 A;  4WBG A;  2ZBB A;  4GCZ A;  2H28 A;  4ZAM A;  4G3W A;  4P6Z S;  3SZT A;  4HEF A;  5G18 A;  4KUO A;  1P9R A;  2BAS A;  3WS1 A;  4R23 A;  1MWT A;  3MKF A;  3TG9 A;  2P08 A;  3UB5 P;  1MWR A;  1Q2Q A;  2Y4A A;  2RL3 A;  1BLC A;  5AQ7 A;  3NIA A;  1LSW A;  3UPO A;  4LRX C;  3UDF A;  2PDR A;  1L2S A;  1WE4 A;  3H9W A;  4D60 A;  3IXG A;  1AXB A;  1YQS A;  3C30 A;  3RH8 B;  2INW A;  3BFF A;  1UGU A;  2XD5 A;  3HUO A;  4MBF A;  1BTL A;  2ZD8 A;  2UWX A;  3E0Y A;  3BLS A;  5AQ9 A;  4EXO A;  4I3I A;  2VGL S;  3NY4 A;  4K91 A;  3G6O A;  1RGY A;  3H82 B;  1N9N A;  4Q0I A;  3I7J A;  1RP5 A;  3C4P A;  3FPW A;  2P9V A;  2EFX A;  5EVI B;  2XF3 A;  2D02 A;  1XJ6 A;  3IS2 B;  1Y28 A;  3KX0 X;  2UV0 E;  4QPR A;  5HDS A;  4DXB A;  5FI6 A;  4B4X A;  3NDG A;  1TDG A;  5HAR A;  1C3B A;  3UN7 A;  2GNX A;  5EM0 A;  3ZDJ A;  1LI0 A;  3PAG A;  1OT6 A;  3HRE A;  1G5U A;  4JF4 A;  4PM5 A;  1DP9 A;  5AQB A;  4HP4 A;  1LT0 A;  2QWS A;  5IS1 A;  2K2N A;  4HBU A;  2NUT C;  5FAS A;  1MKI A;  4GHI A;  5FDH A;  3HLE A;  3CHW P;  3QP5 A;  5EM1 A;  2EX8 A;  5FQK A;  3EQU A;  3HLB A;  3G34 A;  1YLZ A;  5CXW A;  3K3D A;  2ZC4 B;  3RTY A;  5FEG A;  2K31 A;  2JKT I;  1PFL A;  2V1Z A;  1SHV A;  4P87 A;  2O9B A;  2L4R A;  1IYS A;  3PYP A;  1FR1 A;  3RJU A;  1E3U D;  2W1T B;  3IXD A;  4C6Y A;  4EBL A;  3D9Y A;  4HES A;  3CWF A;  1YPR A;  2OWH A;  3T4T A;  4EEU A;  3T4L A;  5A93 A;  1ESI A;  5EEC A;  5HWV A;  4ZJ3 A;  4UAA A;  4I3A A;  3MSH A;  2XSS A;  3IHB A;  3B33 A;  4Y17 A;  3K3C A;  3VOL A;  1KVL A;  3NBL A;  3RXW A;  3NUL A;  2J3T C;  1MWS A;  1HD8 A;  1KE3 A;  4CLC A;  3OBF A;  4OPQ A;  2ZC7 A;  2J9P A;  2HJ9 C;  1NZU A;  2WAF A;  4EER A;  5AJG A;  2PYR A;  3TRC A;  4WUJ A;  2RCX A;  1FCM A;  1D7E A;  1VEU A;  1XJ2 A;  4LGW A;  5HDC A;  1CQA A;  3UNW A;  3V50 A;  1JWV A;  2WZX A;  2ZQ7 A;  3ZG8 B;  2L1M A;  2HF6 A;  3IX3 A;  3LIC A;  3TE8 A;  3EQV A;  3UB9 A;  3A3E A;  1H8Y A;  3QP8 A;  4KG2 A;  4LCM A;  2PHY A;  3EWK A;  4YNR A;  5FI7 A;  3HJI A;  4PM6 A;  4EQ1 A;  1IEL A;  2I9V A;  4X56 A;  1KVM A;  1L0G A;  2V9A A;  2HP5 A;  3U4L P;  3ZQ5 A;  3A3I A;  4ZJ1 A;  5G4Z A;  2KDK A;  4PM8 A;  1W8Q A;  1K54 C;  1NZO A;  3VE4 A;  2ZQA A;  4MN5 A;  1N9L A;  4EV4 A;  2XA7 M;  3MMH A;  4UQI S;  4B93 A;  1Z09 A;  2ZL1 B;  3PHY A;  5A8B A;  2WYX A;  2IWD A;  3Q82 A;  2HP6 A;  1K38 A;  3R7W B;  3E98 A;  4L9G A;  3BYD A;  1YMX A;  2W27 A;  3LR5 A;  3VSL A;  3QP6 A;  4O0P A;  5DTT A;  1PWD A;  3CUE A;  1L0D A;  4CLC E;  3SW1 A;  1PI5 A;  4EU0 A;  2XDM A;  1T1C A;  2R78 A;  1YLT A;  4R1G A;  4S2N C;  3B3X A;  3MXR A;  4LFU A;  3CIT A;  1PIO A;  1G6A A;  3LI9 A;  3QNC A;  1QMF A;  4NKP A;  4DE0 A;  3V5M A;  5EVE A;  1VEU B;  1G28 A;  4IVK A;  1OTI A;  2V8C A;  2M1C A;  2AVX A;  3HUN A;  3LO7 A;  3LFV A;  4HNB A;  2OLV A;  4NEE D;  3D72 A;  5GLB A;  1S1Y A;  2D01 A;  2QZ6 A;  2PRF A;  2WZZ A;  1ZG6 A;  1K4F A;  5J3W A;  1FR6 A;  1ZHH B;  3ZVW A;  1JTD A;  1XGJ A;  4K08 A;  2OV5 A;  3NJA A;  2VJW A;  2Y2N A;  2WAD A;  1XFQ A;  1IFQ A;  3QP1 A;  4O8G A;  2QJ7 A;  5HWT A;  2WKQ A;  1F98 A;  2PR6 A;  1DJA A;  1YSP A;  1K56 A;  2QYB A;  4GS9 A;  4KZ8 A;  5D3O A;  3C7V A;  3UY6 A;  3IX8 A;  4CPK A;  2QHK A;  3UDX A;  1EI5 A;  4EUV A;  1KDW A;  1T1A A;  4P6Z M;  2HDQ A;  3HLW A;  3OPP A;  4GOG A;  4QB8 A;  4BBV A;  2R9W A;  3HL9 A;  4OOM A;  1J9M A;  5EOO A;  5GHZ A;  2HJE A;  3UB7 A;  4ZDX A;  5FSR A;  3IXH A;  5DVA A;  5DF7 A;  3UPN A;  2ZM8 A;  3SS3 A;  2VV6 A;  4CLC C;  3G32 A;  3KYE A;  1MZU A;  1S4R A;  1MKM A;  1K57 C;  4RX3 A;  2JKT M;  3TW8 A;  2Z6C A;  2XGN A;  5DFY A;  3Q7V A;  4I3J A;  4FCF A;  4RYE A;  1W63 M;  2CMN A;  2X02 A;  4YWZ A;  3GDI A;  4HY8 A;  1YKD A;  3H82 A;  5LBR A;  1PZO A;  5HPI A;  4NXG A;  1KGG A;  2A24 A;  5FA7 A;  2EWV A;  1Z6F A;  4GN2 A;  2W3E A;  4FH2 A;  5HAI A;  3TJZ C;  5DFX A;  3BFD A;  4BQM A;  4JXS A;  1VHM A;  1Y54 A;  2PU4 A;  1KGE A;  1BLS A;  3KYZ A;  3S7N A;  4NXB A;  4ARZ A;  2VA0 A;  2B02 A;  1WYB A;  2EXA A;  3WWX A;  1PWG A;  2VK3 A;  1ES2 A;  3VV4 A;  5IT5 A;  2ZQ9 A;  4WN5 A;  3PBS A;  1SCW A;  5EPH A;  2PD8 A;  4JF6 A;  3PAE A;  4X68 A;  5CGS A;  3IH9 A;  4JKT A;  4B4Z A;  3NOT C;  5TBM A;  4GD8 A;  2R9X A;  4LV2 A;  3WRZ A;  3T12 B;  3C7U A;  2W3G A;  4K0X A;  3UE0 A;  3H7W A;  4WZ5 C;  4EQI A;  4E04 A;  1BUE A;  4UA9 A;  4GLQ A;  1GSV A;  3A3D A;  3DAV A;  3S7O A;  2A2L A;  4MBK A;  2XEP A;  2HDS A;  1OTB A;  4R3A A;  2FH5 A;  5HFO A;  5CTN A;  1VM1 A;  2ZOH A;  4L9E A;  4M4X A;  1CI8 A;  3S7Q A;  2J8Y A;  3PR6 A;  1V9Y A;  1XPB A;  1WYC A;  5L2F A;  4OQH A;  2P9V B;  1G68 A;  3MBZ A;  1JVJ A;  1ODV A;  3HVF A;  4OVD A;  1SZV A;  3G2Z A;  5DKL A;  1X0O A;  1YLJ A;  1BT5 A;  3F1N A;  4X25 A;  4GJ4 A;  4XT2 A;  2XFS A;  2V2F F;  2JE5 A;  3OLO A;  2HP9 A;  1O07 A;  1LSX A;  3ZG9 B;  2Q9N A;  3CMZ A;  2YKH A;  3G35 A;  1DP8 A;  3BWL A;  3EGX C;  3IWO A;  3UDI A;  4PMA A;  4UEY A;  4JXW A;  3AGF A;  3BQA A;  5HWW A;  3IX4 A;  1BLH A;  5F5Y A;  4DRT A;  2XQZ A;  4UA7 A;  4Q8I A;  1J3W A;  3EEH A;  1L0E A;  5GLA A;  2HZ5 A;  4G3K A;  1EW0 A;  4OOL A;  3GMW A;  5EV0 A;  3OPL A;  3FZC A;  3A3F A;  3GTC A;  1V9Z A;  2XR0 A;  3FWL A;  4MCW A;  5BOH A;  3ZVT A;  3MR0 A;  4R4R A;  2WUQ A;  3MQ0 A;  4KZ3 A;  4P85 A;  1CEG A;  2BG1 A;  3BEC A;  2W3H A;  3LIF A;  4BEN A;  4KQD A;  1I2S A;  5FL3 A;  1DJC A;  4X53 A;  3Q1F A;  1MBL A;  2M7U A;  4ESP A;  2X71 A;  3WS2 A;  4IUK A;  3MQO A;  4YOF A;  3P7N A;  3GRJ A;  4QWO A;  3O87 A;  4N9K A;  5M1A A;  3QHY A;  1K54 A;  5AQA A;  4E3M A;  5FQQ A;  3KYQ A;  3BLM A;  2IWB A;  4M3K A;  3LCE A;  4BBT A;  1S0W A;  2DRW A;  3RXX A;  1SDN A;  3B42 A;  5G4Y A;  5DJU A;  3ZG0 A;  2FZ0 A;  4KG6 A;  1IYQ A;  4OKP A;  3ZNY A;  3NCK A;  3Q7Z A;  5CEC A;  3O88 A;  2Y2L A;  3ZG5 A;  4YFM A;  3L7H A;  1S6R A;  4RX2 A;  3WS0 A;  3GEC A;  2Z2M B;  1BZA A;  3A0S A;  3G30 A;  1NRF A;  5J4E A;  3BEB A;  4Q0J A;  3IWQ A;  2PBY A;  4U0X A;  5KSH A;  4X55 A;  1OJ5 A;  2ZM2 A;  4H6J B;  5F82 A;  1NLY A;  5J7E A;  3NC8 A;  1K55 C;  1HVB A;  4O7D A;  4P0M A;  4GD6 A;  2XFT A;  1TDL A;  3GR2 A;  2M7V A;  3M2K A;  2HPB A;  2EX9 A;  2Y91 A;  4EWF A;  3ZHH A;  3C38 A;  1JWP A;  1AWI A;  1MWU A;  2O9C A;  4FTX A;  1LSV A;  1TVF A;  2C5W B;  1GA9 A;  2QPN A;  4HJ3 A;  4IBR A;  1FIL A;  3PXP A;  4B88 A;  3IS2 A;  4MEZ A;  2V0W A;  4ETX A;  2WKR A;  3ISG A;  3C8C A;  3ZFZ A;  2H5S A;  2O0Y A;  4GZB A;  3T4J A;  1P97 A;  1XA7 A;  1YSQ A;  2XD1 A;  1YMS A;  2P7J A;  4ZBE A;  4LRY C;  4UHU A;  3CUE C;  3ICY A;  4LV1 A;  2ZQC A;  3LY4 A;  5JYP A;  4WF0 A;  5KSC A;  4Y5F A;  3EEA A;  1VET B;  2DNS A;  4G3V A;  1YM1 A;  3IH8 A;  2KLI A;  2H0Y A;  4E3L A;  4ZRR A;  4R3B A;  5TFQ A;  4LPZ A;  2JKR M;  4CJN A;  4JXG A;  4U3T A;  3OZH A;  5KIZ A;  2Y8H A;  4HJ4 A;  2MJ6 A;  3WS4 A;  2OAQ 1;  5J8X A;  5HD3 A;  3LR0 A;  3T4O A;  5FAP A;  5E2H A;  1SKF A;  4DE3 A;  1G6O A;  5FAQ A;  1FQG A;  4JF5 A;  4HBT A;  5K5B A;  5I5L A;  5CHU A;  4BMW A;  3IBR A;  4Y0U A;  2VKS A;  4KEN B;  3GV9 A;  2Q9M A;  2V8F A;  2VEA A;  3LIB A;  3JPU A;  4Y13 A;  4E3K A;  2W3F A;  3PBR A;  1OTD A;  5FAO A;  4N1X A;  4EES A;  2PT7 A;  1PRQ A;  3V3R A;  2A3U A;  5FDS A;  4GS9 B;  1TS8 A;  3T1R A;  1DP6 A;  1RGZ A;  2J80 A;  2ZMF A;  1EWZ A;  2JKG A;  4PHT A;  1K57 A;  3N7W A;  3NI9 A;  3SH7 A;  5A90 A;  3R7W A;  1NYY A;  5FQI A;  4LCL A;  3E2L A;  4WYY A;  1IEM A;  3S4X A;  2Y2K A;  4OPR A;  5GLC A;  3SH8 A;  1YAX A;  5EFW A;  4GW9 A;  3LGO A;  1XP4 A;  4R3J A;  5HAQ A;  4Y7P A;  4WEL A;  3N8L A;  2PU2 A;  1CF0 A;  2WGI A;  4XUZ A;  3M6H A;  2VV7 A;  1ZG4 A;  2A49 A;  2FFY A;  3C2W A;  4S2O A;  5E2G A;  3QP4 A;  1TS7 A;  3W8K A;  1LHY A;  2ZMV A;  1OME A;  4HH2 A;  4E3I A;  2PBD P;  4S2P A;  1GHP A;  3O5Y A;  3OCN A;  3EGD C;  4HI4 A;  5FQ9 A;  1GSX A;  4BL2 A;  1N4O A;  3G31 A;  2VX8 A;  1GHM A;  3ZGA B;  3MXS A;  3F1O A;  4S2M A;  1HTZ A;  2ZC3 B;  3VSK A;  4E6W A;  2JBF A;  3HJK A;  3TSG A;  2B95 A;  1XA1 A;  2JN7 A;  1FSY A;  5DKK A;  1ZTU A;  4GNU A;  4DE1 A;  5DTK A;  3HLG A;  3ITB A;  3M2J A;  1XXM A;  3AGD A;  4I5S A;  5HZH A;  1LL8 A;  3ITA A;  4R70 A;  1DRM A;  3GSG A;  1KE4 A;  3A0R A;  1K56 D;  3MKE A;  1XJ3 A;  2OLU A;  4N1H A;  4YIN A;  5FQJ A;  5TBM B;  1TS6 A;  1S66 L;  3VOY A;  3MJQ A;  4IED A;  3R4K A;  1KDS A;  2JKF A;  1E25 A;  2HV1 A;  5CX7 A;  2B18 A;  5AVE A;  4HQA A;  4GDB A;  3DBA A;  3VFH A;  4PKY G;  2O99 A;  4PAU A;  5TR7 A;  3EOI A;  2PYP A;  1NRJ A;  1ZKJ A;  4Y2F A;  4D2O A;  2E8J A;  4KZ6 A;  1MC0 A;  2Y55 A;  4DF6 A;  4CQH A;  3AGE A;  3BQ8 A;  1L3L A;  4ARZ B;  1GHI A;  4FSF A;  4RQ9 A;  4OQI A;  5DJT A;  1BYW A;  3IQA A;  3KSG A;  2H0T A;  3JYI A;  3GQZ A;  1ZC2 A;  3CZD A;  2Y59 A;  4BBU A;  3LIE A;  1OJG A;  5HL6 A;  2VGJ A;  3FPV A;  3F1O B;  4Y0T A;  1XJ4 A;  1D1J A;  2JKR I;  3W4O A;  2V1A A;  4H6J A;  3CAX A;  3DTK A;  4B9O A;  4HH3 A;  3HLD A;  3SS5 A;  4UQI M;  2PD7 A;  4BL3 A;  2ZOI A;  2WK0 A;  3FC7 A;  4MBH A;  3C4O A;  3LY3 A;  3S22 A;  1VET A;  4FUW A;  3WRT A;  4QY5 A;  1QME A;  4JBF A;  1PW8 A;  1SDE A;  1U60 A;  3IHA A;  1Y4O A;  4DDS A;  2JC7 A;  2VZW A;  3LEQ A;  4X1M A;  4LRZ E;  1FSW A;  1CEF A;  2PR5 A;  5IHV A;  1OTE A;  4GB7 A;  5HPF A;  3BFC A;  2WGW B;  1XFN A;  3IF6 C;  1XGI A;  1L0F A;  5HSQ A;  1K6R A;  2G2W A;  4DJ2 A;  4NXE A;  1CJF A;  1S4S A;  4ZTK A;  2JHE A;  1KOU A;  2Y2M A;  5CHM A;  4MMN A;  2JCH A;  5DTS A;  3OCL A;  1F5M A;  1JTG A;  3G4P A;  2L0W A;  4E6X A;  2KOI A;  1OPX A;  3LI8 A;  4HIA A;  2XRO A;  3PBN A;  4FD8 A;  4OLD A;  2WGV A;  4F3L B;  2EFU A;  3VP0 A;  1NLZ A;  1HZO A;  1M6K A;  5F6A A;  1FCN A;  3DW0 A;  4KZ5 A;  3KSI A;  1T1B A;  2OOL A; 
#chains in the Genus database with same CATH homology
 3H7W B;  3NOP C;  3PHY A;  3MFX A;  3A0V A;  5A8B A;  4Z1W A;  4EEP A;  4DN0 A;  1P0Z A;  5KSH A;  5L8M A;  4HP9 A;  3R7W B;  3E98 A;  4L9G A;  2V0U A;  2W27 A;  3JVU A;  3LR5 A;  1OJ5 A;  4EET B;  4H6J B;  1JNU A;  1NLY A;  4O0P A;  5J7E A;  1H8M A;  3CUE A;  5F69 A;  2M7V A;  4CLC E;  4LLO B;  3SW1 A;  4ME4 A;  4EU0 A;  1T1C A;  5AVF A;  4CLC B;  2R78 A;  3C38 A;  3ZYT A;  2O9C A;  1LSV A;  1H3Q A;  3CIT A;  3LI9 A;  2W1T A;  4NKP A;  4HJ3 A;  3PXP A;  3IS2 A;  3KSH A;  2V0W A;  2VV8 A;  3HCY A;  1G28 A;  1OTI A;  4ETX A;  3NHQ A;  2M1C A;  2WKR A;  3LFV A;  2XRN A;  3UMD A;  4HNB A;  3C8C A;  4NEE D;  2O0Y A;  3D72 A;  2G7U A;  3T4J A;  2LB5 A;  1P97 A;  4WLA A;  1YSQ A;  2J3T D;  1S1Y A;  4WL9 A;  2D01 A;  2Z6D A;  2P7J A;  4LRY C;  3F1N B;  3CUE C;  2IA2 A;  3ICY A;  1S67 L;  3LID A;  1OT9 A;  1TD5 A;  4HHD A;  3E4P A;  3MQQ A;  5J3W A;  3IBJ A;  4WF0 A;  3RFB A;  4Y5F A;  1ZHH B;  3EEA A;  4R6L A;  2EA9 A;  4G3V A;  3UB6 A;  1UWN X;  4K08 A;  3NJA A;  2VJW A;  2GX5 A;  5MC7 A;  2KLI A;  1F9I A;  4ZRR A;  2GZA A;  4HJ6 A;  1GSW A;  1XFQ A;  4LPZ A;  4HOI A;  1IFQ A;  2JKR M;  5C5K A;  1VB6 A;  2VLG A;  4O8G A;  2QJ7 A;  3K2N A;  5HWT A;  3OOV A;  2WKQ A;  1F98 A;  5KIZ A;  2PR6 A;  2Y8H A;  4HJ4 A;  2MJ6 A;  3LR4 A;  2OAQ 1;  4WEK A;  5HD3 A;  1WA9 A;  1YSP A;  3LR0 A;  3MF0 A;  2QYB A;  4GS9 A;  3T4O A;  3OC2 A;  1G6O A;  2DMW A;  2QHK A;  3T4Q A;  4EUV A;  1T1A A;  2HGV A;  4P6Z M;  5K5B A;  5I5L A;  2P04 A;  3IBR A;  4BMW A;  4DMZ A;  4BBV A;  2VKS A;  4Q0H A;  2J3W A;  4KQO A;  3MXQ A;  2VEA A;  3LIB A;  4OOM A;  2OWJ A;  3E4Q A;  2HJE A;  3S7P A;  2W3F A;  2Y79 A;  3UB7 A;  3PBR A;  2XA7 S;  1OTD A;  4CLC D;  4EES A;  2PT7 A;  2VV6 A;  4CLC C;  4GS9 B;  1MZU A;  1S4R A;  1TS8 A;  1MKM A;  1DP6 A;  4JGR A;  2J80 A;  4Y3I A;  2ZMF A;  4PHT A;  2JKT M;  3UME A;  3TW8 A;  2Z6C A;  3LR3 A;  3R7W A;  1OTA A;  5DFY A;  4MN6 A;  4I3J A;  5IU1 A;  3W2Z A;  4MN7 A;  1W63 M;  2OAP 1;  1UWP X;  2CMN A;  1YAX A;  4JGP A;  3F1P B;  4II7 A;  5EFW A;  4YWZ A;  4GW9 A;  3GDI A;  4HY8 A;  1YKD A;  3H82 A;  2VGL M;  5LBR A;  3LIA A;  5HPI A;  4NXG A;  4MDZ A;  4WEL A;  1D06 A;  3NOU C;  2A24 A;  2EWV A;  2YKF A;  2ZBB A;  5HDD A;  4GCZ A;  4EW7 A;  2W3E A;  2H28 A;  2VV7 A;  3CLO A;  4G3W A;  4L0L A;  4P6Z S;  3TJZ C;  5DFX A;  1TS0 A;  3C2W A;  1VHM A;  3BY9 A;  4KUO A;  1TS7 A;  1P9R A;  2BAS A;  2ZMV A;  4HH2 A;  2P08 A;  2W0N A;  3KYZ A;  3S7N A;  4GHI B;  4KUK A;  3O5Y A;  3OCN A;  3EGD C;  4NXB A;  4ARZ A;  2VA0 A;  4JGO A;  2B02 A;  4HI4 A;  3BY8 A;  1GSX A;  5DF9 A;  2VX8 A;  1P9W A;  4I39 A;  3KSF A;  1LSW A;  2A24 B;  3VV4 A;  5IT5 A;  4IHQ A;  3F1O A;  3CI6 A;  1TF1 A;  4WN5 A;  3PBS A;  4LRX C;  4JGQ A;  2PDR A;  4BJP A;  3HJK A;  4FOF A;  3H9W A;  2PD8 A;  2JN7 A;  3C30 A;  3RH8 B;  5DKK A;  3NOT C;  2INW A;  4I38 A;  1UGU A;  5TBM A;  1ZTU A;  1T18 A;  3E0Y A;  3PBO A;  4AFI A;  4EXO A;  2W3G A;  1STZ A;  4I3I A;  2VGL S;  3H7W A;  4BWI A;  3T50 A;  3G6O A;  4ETZ A;  2QKP A;  4E04 A;  3H82 B;  1N9N A;  4Q0I A;  4I5S A;  5HZH A;  3ULF A;  1LL8 A;  3E4O A;  3FPW A;  4R70 A;  2D02 A;  1XJ6 A;  4R38 A;  4GLQ A;  1GSV A;  1DRM A;  3IS2 B;  1Y28 A;  3KX0 X;  3A0R A;  3S7O A;  2A2L A;  4QPR A;  5HDS A;  1OTB A;  1XJ3 A;  4R3A A;  2FH5 A;  5TBM B;  4F3L A;  1TS6 A;  1S66 L;  2ZOH A;  4L9E A;  4M4X A;  2NUP C;  2GNX A;  1T1B A;  3MJQ A;  3S7Q A;  3R4K A;  3PR6 A;  4WEJ A;  1V9Y A;  2HV1 A;  5CX7 A;  2B18 A;  5AVE A;  4HQA A;  3DBA A;  4PKY G;  1NWZ A;  1ODV A;  1OT6 A;  2O99 A;  4IUH A;  4PAU A;  3EOI A;  2PYP A;  1NRJ A;  2EWW A;  1DP9 A;  4HP4 A;  1LT0 A;  4Y2F A;  2QWS A;  3BW6 A;  5IS1 A;  5TJJ A;  1MC0 A;  3U2A A;  5DKL A;  1X0O A;  2K2N A;  4CQH A;  2NUT C;  3BQ8 A;  4GHI A;  4XT2 B;  4NXF A;  4ARZ B;  3T4S A;  4FSF A;  4RQ9 A;  3F1N A;  4XT2 A;  4GJ4 A;  5DJT A;  1BYW A;  3KSG A;  3PBT A;  3OLO A;  4IJG A;  3EQU A;  2LB9 A;  2QJ5 A;  4BBU A;  1LSX A;  3LIE A;  1OJG A;  5HL6 A;  3LYX A;  3FPV A;  3F1O B;  2YKH A;  1XJ4 A;  1DP8 A;  3KO6 A;  3BWL A;  2JKR I;  3JVV A;  3EGX C;  2V1A A;  3K3D A;  4UEY A;  4H6J A;  5HD5 A;  3RTY A;  2K31 A;  3BQA A;  5HWW A;  3CAX A;  4B9O A;  2JKT I;  5F5Y A;  4HH3 A;  3PBQ A;  3VE3 A;  2O9B A;  2KX6 A;  4UQI M;  3B47 A;  3EEH A;  2PD7 A;  2L4R A;  3PYP A;  2ZOI A;  1T19 A;  4G3K A;  1EW0 A;  4OOL A;  3UE6 A;  4DJ3 A;  1IOU A;  3FC7 A;  2W1T B;  3UE3 A;  1V9Z A;  2W3D A;  4MCW A;  3CWF A;  3MR0 A;  2OWH A;  3T4T A;  4EEU A;  3T4K A;  3T4L A;  2O9A A;  5HWV A;  3MQ0 A;  4I3A A;  3P01 A;  2XSS A;  3B33 A;  3K3C A;  2W3H A;  3VOL A;  2J3T C;  3LIF A;  2VZW A;  4KQD A;  4LRZ E;  2W1R A;  3BJN A;  4CLC A;  3OBF A;  2PR5 A;  5FL3 A;  2HJ9 C;  1OTE A;  5HPF A;  1XFN A;  4EER A;  5AJG A;  2M7U A;  2PYR A;  3TRC A;  4WUJ A;  3FG8 A;  4IUK A;  4L9F A;  1D7E A;  3MQO A;  3V67 A;  1XJ2 A;  5HSQ A;  5HDC A;  4YOF A;  3P7N A;  2L1M A;  2HF6 A;  3LIC A;  1S1Z A;  3TE8 A;  3EQV A;  3UB9 A;  4DJ2 A;  3KYQ A;  2PHY A;  3EWK A;  4YNR A;  4NXE A;  1S4S A;  3LUQ A;  4BBT A;  1N9O A;  1W63 Q;  3HJI A;  3B42 A;  4EQ1 A;  2JHE A;  5G4Y A;  2I9V A;  1KOU A;  2K7S A;  4MMN A;  5DJU A;  5F68 A;  3OCL A;  1F5M A;  2FZ0 A;  2L0W A;  2KOI A;  2V9A A;  1OPX A;  4PKY A;  3LI8 A;  4HIA A;  2XRO A;  3ZQ5 A;  3PBN A;  5G4Z A;  3UB8 A;  2KDK A;  3D3O A;  4F3L B;  3GEC A;  2WKP A;  3A0S A;  1NLZ A;  4O01 A;  3VE4 A;  4MN5 A;  1N9L A;  5F6A A;  2XA7 M;  2GJ3 A;  3MMH A;  3F1P A;  4Q0J A;  5J4E A;  4UQI S;  4B93 A;  3KSI A;  2V1B A;  2OOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...