3EEHA

The crystal structure of the domain of the putative light and redox sensing histidine kinase from haloarcula marismortui
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
116
structure length
116
Chain Sequence
ERRVRELTEATNDILWEFTADLSEVLVINSAYEDIWGRSVAKLRENPHDFLNGIHPEDRELMKDTMQSLMDGESADVECRVNATEEYQRWVWIQGEPITNDAGETVRVAGFARDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the domain of the putative light and redox sensing histidine kinase from Haloarcula marismortui
rcsb
source organism Haloarcula marismortui
molecule tags Transferase
molecule keywords putative light and redox sensing histidine kinase
total genus 34
structure length 116
sequence length 116
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3eehA00
4XT2B 1OTAA 2H28A 1T18A 2V0UA 1F9IA 3ICYA 4BBTA 2CMNA 5DJTA 3PYPA 2VLGA 3F1OA 4H6JA 2QJ5A 3UB6A 3A0VA 2B02A 3CWFA 5HDCA 2ZOHA 5IU1A 3SW1A 1T19A 4HHDA 2M1CA 2VV6A 4I3JA 1N9LA 3LIAA 1KOUA 2R78A 1DRMA 3HJIA 4LRYC 2VEAA 2A24A 1X0OA 2PYRA 2VV7A 3A0SA 1OT6A 3LIEA 4NXGA 3MQOA 4NXBA 4HI4A 5G4YA 5HWVA 1OTEA 4JGRA 2V1BA 2ZOIA 4DJ3A 2BASA 3MQQA 4KUKA 5F6AA 1GSVA 1TS0A 2J80A 2KDKA 4LPZA 2V0WA 1VB6A 2QHKA 3F1PA 1P97A 4HP4A 2QJ7A 1S4SA 2L1MA 3K3CA 5TBMA 3C2WA 2PR5A 3H82A 2P7JA 4K08A 5G4ZA 3UMEA 4WLAA 1LT0A 1S1ZA 2Z6CA 1Y28A 1V9YA 3T50A 4NXFA 1DP9A 5F69A 3NOTC 1DP8A 4LRZE 4HNBA 3VOLA 3K3DA 1G28A 4WUJA 4GS9B 4HOIA 2PYPA 3HJKA 4H6JB 2ZBBA 4R38A 4KQDA 1OT9A 3CLOA 3IS2B 4WF0A 4EEUA 3BY9A 2W0NA 5HDDA 2GJ3A 3BY8A 2OWHA 2YKHA 1XJ4A 2PR6A 1T1CA 4PKYA 2A24B 1XJ2A 3UE6A 3P7NA 2HV1A 3NOPC 4L9EA 3D72A 3EEHA 5DJUA 5J7EA 2YKFA 2KX6A 3GDIA 5HD3A 4BBVA 1S67L 4BBUA 5IS1A 2WKRA 4JGPA 1UWPX 4EEPA 1XFQA 3G6OA 5HSQA 3F1PB 3C8CA 1T1BA 1NWZA 2JHEA 4MN5A 5TBMB 1DP6A 5A8BA 1OTDA 3LIBA 3A0RA 4JGOA 2PHYA 1OJ5A 2I9VA 3E4PA 3BWLA 2WKPA 2L4RA 5F5YA 1EW0A 3MR0A 2OWJA 4I38A 5AVFA 4EW7A 1T1AA 3CAXA 3F1NA 5HWWA 3LUQA 2W27A 4GS9A 1S66L 4I5SA 4E04A 2V9AA 1UGUA 2D02A 4R6LA 1S4RA 3IS2A 2PD7A 3MFXA 4LLOB 3OLOA 1OJGA 4HP9A 5HD5A 5AVEA 4EETB 1D7EA 3LIFA 4F3LB 4EESA 3KX0X 4JGQA 4RQ9A 4WN5A 4KUOA 5DKKA 2QWSA 4HJ6A 4HQAA 1LSWA 2Z6DA 3H9WA 4HJ4A 4L9FA 1LSVA 1LL8A 2V1AA 3E4OA 5HWTA 5F68A 3LYXA 1UWNX 4HH2A 4L9GA 3VE4A 4EERA 4NXEA 5DKLA 1N9OA 3LICA 3FC7A 1N9NA 3H7WB 4GHIB 4WL9A 3RTYA 1OTIA 2OOLA 1MZUA 1ODVA 1GSWA 2VV8A 3E4QA 3IBRA 3LIDA 4XT2A 3MXQA 3F1NB 5J3WA 4F3LA 3GECA 2WKQA 3F1OB 3NJAA 4HIAA 4R3AA 4HY8A 4R70A 1GSXA 1BYWA 3LI9A 5HZHA 4I39A 3UB8A 1S1YA 4M4XA 3NHQA 3EWKA 4GCZA 4MN6A 4GW9A 3RH8B 2EA9A 2INWA 1OTBA 1LSXA 3B33A 1TS6A 3PHYA 2D01A 1D06A 5J4EA 1WA9A 4EQ1A 4DJ2A 4LRXC 2PDRA 3ULFA 3NOUC 1TS7A 1XJ6A 1P0ZA 2JN7A 2PD8A 4I3IA 2K7SA 4PKYG 2QKPA 4HH3A 5EFWA 3UB9A 4B9OA 5HDSA 3FG8A 3H82B 3ZQ5A 2L0WA 1TS8A 3UMDA 1XJ3A 1JNUA 3H7WA 4GHIA 1XFNA 4HJ3A 3MJQA 5I5LA 3VE3A 4EXOA 1V9ZA 3LI8A 4I3AA 5KIZA 3UB7A 4YWZA 1F98A
chains in the Genus database with same CATH superfamily
1OTAA 2V0UA 4FD8A 2CMNA 1O7EA 4JBFA 3F1OA 1W8QA 4R3JA 1BLCA 2ZC5B 3HLGA 4K0XA 4NXBA 1OT6A 4OOYA 1IKGA 2XRNA 1OTEA 1JWPA 4KUKA 1TS0A 2BLSA 1GHIA 3N7WA 4BD0A 1LHYA 4HESA 5CXWA 1GA9A 2G2UA 3S4XA 4WBGA 3ITBA 2W1TB 2JKRI 3FZCA 3W2ZA 5DJUA 3GDIA 2A3UA 1K25A 2FFYA 4IBRA 4BBVA 2XFSA 4R3BA 2ZLYA 1XPBA 4JGPA 3AGFA 5L07A 5FEFA 2Q0OA 2K2NA 4Y2FA 3V3RA 3SH8A 2ZC7A 3HREA 2I9VA 2OLVA 2ZQDA 5U47A 1ZG6A 4X55A 1S4RA 3CG5A 4BWIA 3LIFA 2Z6DA 1IOUA 4L9FA 3S1YA 4CQHA 4HH2A 3NDGA 3VE4A 5A91A 1BULA 1ZC2A 3IX8A 3RTYA 3T12B 3FWLA 3UY6A 5EVID 1WYBA 3E4QA 4BD1A 1LL5A 3V39A 3EWKA 2O9AA 4O01A 2XSSA 2P74A 5EFWA 2K7SA 5DF8A 2JCHA 5HDSA 1FIKA 4LFUA 3LO7A 1PI5A 3UB7A 2EFXA 4KG2A 4WZ5C 4OQGA 5FAOA 1MWUA 1TD5A 2KLIA 1X0OA 4OOLA 1SZVA 4E3MA 1SDEA 1BTLA 3MQQA 3O86A 1VQQA 2ZQCA 3BFFA 3G31A 2HDQA 3PBRA 3VP0A 2Z6CA 1RGZA 3T50A 1DP9A 2WUQA 5A93A 5AQ9A 2ZBBA 3G2ZA 2H0YA 1T1CA 3KO6A 4F3LA 3HLDA 5GHXA 2V1ZA 4P6ZM 4GOGA 4EQIA 1PW8A 3T4QA 4JLFA 3BLSA 2H0TA 3FPVA 3ZG5A 4CLCC 4Z1WA 3ZG0A 5EE8A 2D02A 4R6LA 1FR1A 2VGLS 4OLDA 2O0YA 5EPHA 5GLAA 1N4OA 1YQSA 2JE5A 4LGWA 2GDNA 2OOLA 1FR6A 2E8JA 4UA7A 2I72A 4HBUA 1VM1A 4WZ5A 4YINA 4WELA 4CPKA 1PZPA 3NHQA 4N9KA 1TEMA 1E4DA 5FAQA 4MNRA 1WA9A 2J7VA 3T1QB 4JF5A 3KYZA 3UB9A 3MSHA 3RJUA 4Y7PA 5CEDA 5I5LA 3MJQA 4EXOA 1G5UA 3BECA 4LLOB 2PU2A 2Y4AA 4BL3A 3UB6A 1Q2QA 5FASA 3DBAA 3OPPA 2Y2JA 1BUEA 4JGRA 2WZXA 5FA7A 1VB6A 1YLPA 1S4SA 3IHBA 3T4OA 1KDWA 5FQ9A 1NXYA 2PBYA 5AQBA 1IFQA 4CJNA 3DTIA 1J3WA 4H6JB 3I7JA 4ARZA 4M3KA 4WF0A 4EEUA 1W63Q 3D72A 4JXGA 4Y15A 3VP4A 4R4SA 4B4XA 5L8MA 4DXCA 3GV9A 5FQQA 3LR5A 2QMIA 2ZD8A 4ZJ2A 1MC0A 4N9LA 5EM0A 1MWSA 5HW3A 4GN2A 1STZA 3IF5A 3IS2A 4BLMA 4ESPA 2J9PA 4GLQA 3KX0X 3WS2A 2QWSA 2WAEA 3CPTA 3H9WA 3IXGA 1G6OA 4R4RA 4EERA 5HFOA 3LICA 4S2JA 1L3LA 4MDZA 2B5RA 1MZUA 3IBRA 1HD8A 4AFIA 3CUEC 4GJ4A 1Z09A 4GCZA 1L0EA 4DE3A 2WADA 3OPRA 5J4EA 3CZDA 5GLBA 5J8XA 2Y2QA 4LRXC 2XR0A 1SDNA 3ULFA 2Y2LA 5CGWA 3LFVA 3FG8A 1CJFA 3UMDA 1JNUA 4OKPA 3UO9A 1F98A 2H28A 5DTSA 3ZDJA 4KENB 3T4TA 2ZOHA 3SW1A 2H10A 2JKTI 4I3JA 2XA7S 3HJIA 3BFEA 4Z9QA 5EM1A 2R9XA 2WZZA 1ACFA 1GSVA 2UV0E 1S0WA 4NXFA 5F69A 1SHVA 1CF0A 3HJKA 1BLHA 3D9YA 5KSHA 2XLNA 4P6BA 4PM6A 1W8YA 3UE6A 2PR6A 2Y2HA 3P7NA 4PMAA 4DF6A 3Q7VA 3BQAA 3G6OA 3JPUA 5F82A 3C8CA 1T1BA 5GLDA 1XP4A 3OZHA 5F5YA 2XROA 2QYBA 5HPIA 5HWWA 1PNEA 2V9AA 2ZJ9A 3OLOA 1M6KA 3QHYA 2Y91A 2P9VA 2FZ0A 4O7DA 1LSWA 1NRFA 4UAAA 4U0XA 3IT9A 5F1GA 3UNWA 3LGOA 2Y2KA 1VETB 2ZC3B 5FI2A 2M7VA 4OH0A 1BYWA 1SKOA 1PWGA 3BYDA 4S2LA 1YPRA 4JF4A 3CUEA 2D01A 4IHQA 3S7QA 2IWBA 3RXXA 1W5DA 4WMCA 4PKYG 3O5YA 1DY6A 5GHZA 1TS8A 5IT5A 4OQHA 4FTXA 1ESUA 5DJTA 1HVBA 1K55C 3LY3A 4P85A 1N9LA 3O3VA 2VV7A 1MY8A 1HLUP 3HCYA 2ACGA 4NEED 5CHMA 2EXAA 2V0WA 3F1PA 4ZAMA 5FQIA 1XA7A 1LT0A 4X25A 1IYQA 2WGVA 3HL9A 1MKMA 1G28A 3Q81A 4RYEA 3WS5A 1YSQA 2J3TC 2JBFA 1IKIA 5HSQA 1PYYA 4CLCD 3B42A 1PFLA 5E43A 2L4RA 3EQUA 3MZFA 5K5BA 3AGEA 3IF6A 3HLCA 2WKEA 4RVAA 4QPRA 5FEGA 4HQAA 4Q0IA 3T4SA 1GHMA 2PAVP 4S2OA 3TRCA 1NYYA 3ZCZA 1PWCA 2V2FF 1OTIA 3HUMA 1GA0A 4UHUA 5JYOA 1F2KA 4R70A 1ES5A 2R9WA 1JTDA 4JKTA 2VZWA 4N1HA 3RH8B 1E3UD 4F94A 4PM7A 1P0ZA 3NCKA 3E2KA 2E8IA 3IWIA 3K2NA 1K6SA 1XJ3A 2XEPA 2Y2MA 4FOFA 4JXVA 4KG6A 2G2WA 3EGDC 3GMWA 4U0TA 1I2WA 4OQIA 4QU3A 2C6WB 2A24A 2LB9A 3FKWA 4IEDA 4X53A 3R7WA 5IHVA 5F6AA 3IWOA 2FH5A 2HPBA 3UMEA 2P7JA 5A92A 5DTKA 1VEUA 1KE4A 4LENA 1ZHHB 4KQDA 5HDDA 4FCFA 4G3WA 2ZQ8A 2KX6A 3OBFA 1E25A 3QP5A 1NLZA 4KZ4A 5EVIC 3ZVWA 4UEYA 1KE3A 3SS5A 1YKDA 1PI4A 3B3XA 4S2KA 3Q1FA 5DKKA 3NC8A 4ZTKA 1MBLA 5HAQA 3SZTA 3HLEA 4S2PA 1ES4A 1W79A 5DFXA 3M2KA 3H7WB 4XUXA 2VKSA 3KSGA 1XGIA 3F1NB 2EX6A 4R3AA 2B18A 1JWVA 2VJWA 2EA9A 3OCNA 1K57A 1NZUA 2JN7A 3W4PA 5FL3A 2J9OA 4YFMA 3ITAA 4UQIM 4HJ3A 1ONHA 3EEAA 5G18A 4XT2B 3IH8A 4KZ5A 3V5MA 4BMWA 5HDCA 5GHYA 4NXGA 1NZOA 1E3UA 2VGJA 3MF0A 1MKIA 2WKHA 4ME4A 3HUOA 4LPZA 3VMAA 3G35A 3K3CA 5TBMA 4K08A 5CX7A 3VOYA 2HGVA 1FQGA 4HOIA 4R38A 4DDYA 3BW6A 3UE0A 1OT9A 4KZ6A 1K56D 3OPHA 5AJGA 4EBPA 3A3DA 2HJEA 1BLPA 5IS1A 3IXBA 3DTMA 2VX8A 4E3OA 2V8CA 4WEJA 4C6YA 2WGWB 4MN5A 4KQQA 4K91A 1W7FA 3BWLA 2HZ5A 3VP3A 2HDRA 3KSIA 3NBLA 3MKFA 4CLCB 2OSUA 3MFXA 4BJPA 4EETB 1D7EA 1K54C 4EESA 1K55A 1ZG4A 1LL8A 1EROA 3PAGA 4LCMA 3VFHA 5EECA 4N92A 5DFYA 3C7VA 4IUKA 5TGFA 2DMWA 4NETA 2BG1A 4R1GA 3ZYTA 5EVEA 1TS6A 3T1XA 1YLWA 3S7OA 3FPWA 4PAUA 2HDUA 2QKPA 4HH3A 4MBFA 1LL9A 3H82B 3OOVA 3SH7A 2AVXA 3VE3A 3TOIA 4Y13A 3E2LA 2HJ9C 3DTKA 2LB5A 5TJJA 3UPOA 5FDSA 2DCFA 1ONGA 1FCOA 2R78A 3BFDA 2DRWA 1K4FA 3A0SA 1AWIA 3BJNA 3MQOA 2QJ7A 1IELA 2W1RA 4C3QA 2ZM2A 4MLLA 1S1ZA 3PBOA 4GS9B 3KSFA 1IYSA 4G3VA 4BENA 4P87A 2Y8HA 1FSYA 4B93A 3WS1A 3EEHA 1AXBA 5EOEA 5EVIA 5AQAA 5A8BA 3V3SA 3G34A 3W4OA 3CJMA 3P09A 4IBXA 2WYXA 4EW7A 3AGDA 3NECA 3MBZA 2JKFA 1ERQA 1DJCA 4RA7A 3B47A 4EBNA 4DE1A 2XFTA 1U60A 2OAP1 4WN5A 4KUOA 4DKIA 4HJ6A 1C3BA 5F68A 1FSWA 3LYXA 4O8GA 2EX2A 4Q0JA 4QB8A 4E3IA 3LIDA 3MZDA 1WE4A 3GSGA 3NDEA 5HZHA 2XK1A 4I39A 2ZC4B 2Q9MA 3TE8A 3C30A 1MXOA 5DVAA 2Y55A 3TG9A 3WWXA 2IA2A 3LI8A 3JVUA 4OPQA 4BBTA 3RFBA 4GB7A 3A0VA 2XDMA 4HHDA 2VV6A 1DRMA 1WYCA 2VEAA 5G4YA 4BL2A 5HWVA 2Y79A 4EWFA 1YSPA 3C2WA 2PR5A 3E0YA 4WLAA 3VOLA 4X1LA 2VGKA 1XKZA 3IXHA 5HARA 5FSRA 2ZL1B 1XJ2A 1EWZA 1S67L 3L9KA 3A3EA 1PIOA 3QNBA 1NWZA 3LIBA 2PHYA 3E98A 2Y2GA 4EV4A 3CITA 5CERA 4FUWA 2HP6A 1OJGA 1YMSA 4MEZA 4ZRRA 5FQJA 4F3LB 1KVLA 3LR4A 4ID4A 3UB5P 1TDGA 2ZMFA 4OLGA 1N9NA 4GHIB 3VSLA 1KDSA 5CRFA 3G4PA 3M6BA 3UPPA 3F1OB 3KYEA 4NG2A 2Z2LB 4HY8A 4HBTA 1S1YA 4M4XA 4UA9A 4DDSA 2EWWA 3A3IA 5CTMA 3C7UA 1YLTA 2PDRA 4I3IA 4IUHA 1FILA 2OLUA 4K0WA 3IQAA 1GCEA 4EUVA 1F9IA 1PRQA 3UE3A 2B02A 2W1TA 3CWFA 3N8LA 4PPRA 5GLCA 1KOUA 4N1XA 1NLYA 5L09A 4HI4A 2XH9A 5AQ7A 4KZ8A 1L2SA 5E2EA 2ZC6B 2W3HA 3IX3A 3PR6A 4JXSA 1YMXA 3G2YA 5HAIA 5J7EA 1VHMA 3IF6C 3DAVA 3ZHHA 4BBUA 3VFFA 1G6AA 4E6WA 1XX2A 4E3NA 1DP6A 2EXBA 3LR0A 1OPXA 1K54A 4I38A 5AVFA 2PRFA 5M18A 1CEFA 3MS6A 4G3KA 3ZNTA 1H8YA 4IVIA 2PD7A 4KQRA 1L0DA 3VV4A 5FQMA 4P0MA 4GZBA 5CEBA 3QP6A 4X6TA 1UWNX 4DXBA 1ES2A 1XGJA 4KZ7A 5D3OA 3U2AA 3PBQA 1ES3A 2RL3A 2MJ6A 4S2MA 4A5RA 1OTBA 1LSXA 3PHYA 3IHAA 4UA6A 1L0GA 4OOMA 3QP4A 1XFNA 3ICYA 3R4KA 1XXMA 1SKFA 2ZQAA 2VGLM 3V67A 1NY0A 3FV7A 4Y3IA 2ZQ7A 3EGXC 3RXWA 1LI9A 4GD6A 2KDKA 3LR3A 3BM6A 1KVMA 5G4ZA 2ZM0A 1Y28A 1V9YA 5FDHA 4JF6A 1DP8A 5I94A 5HAPA 1Y4OA 3NY4A 1FOFA 3C4PA 1PW1A 2GJ3A 2YKHA 1XJ4A 2V8FA 3OC2A 5M19A 2BTFP 5MC7A 1RGYA 1FCMA 3HVFA 5TFQA 2H5SA 1ZKJA 3CI6A 4XXRA 3N4IA 4S2NC 2X02A 5HL1A 5DF9A 1DJAA 5CTNA 1EW0A 3BFGA 1T1AA 3CAXA 2J3WA 5BOHA 3SS4A 3BQ8A 3SOIA 3UN7A 4JGQA 4LV0A 4QD4A 3G30A 4HJ4A 1CI9A 3E4OA 3G32A 1Y54A 1K57C 1ALQA 4WYYA 4PM8A 1G68A 3MXSA 3PTEA 2OAQ1 1LI0A 1ODVA 1CEGA 3CMZA 2ZQ9A 4R0QA 3A3FA 5FAPA 4L0LA 1ESIA 4OPZA 4DRTA 2EFUA 2VK3A 2W3FA 1KGFA 4YOFA 1D06A 3W4QA 4EQ1A 4WZ4A 1TS7A 1XJ6A 2PD8A 4GDNA 3HUNA 4XUZA 3C38A 4WUJA 4YWZA 4GDBA 4PHTA 4FSFA 4H6JA 2QJ5A 1VETA 4ARZB 1T19A 1SKOB 5F1FA 4LRYC 3IBJA 5FI7A 3D4FA 5FI6A 1GHPA 4DJ3A 2CC1A 4GD8A 3W8KA 4HP4A 2L1MA 2PT7A 4U3TA 1S6RA 3V50A 4X68A 3K3DA 2A49A 4IVKA 2PU4A 4R23A 3IS2B 3LEQA 1LLBA 4PKYA 4OP8A 5CECA 3UDFA 4JPMA 3SH9A 5HD3A 3CPTB 1Q2PA 3F1PB 5A90A 4GNUA 2GX5A 1OTDA 1O07A 1OJ5A 2WKPA 1DJBA 3MR0A 1CK3A 3UPNA 2IWDA 4Q8IA 1P9RA 3MMHA 4KZ3A 3NIAA 1N9BA 1I2SA 5HD5A 4HP9A 2XA7M 5AVEA 1YAXA 3NULA 1YM1A 1YLZA 3BFCA 2VA0A 5LBRA 4ZBEA 2GNXA 2W3GA 5EOOA 4WL9A 2HDSA 3EQVA 2VV8A 5J3WA 2HP5A 3WS4A 5C5KA 4OPRA 2G7UA 3IF6B 3JVVA 4QHCA 2Y2PA 3VSKA 3B33A 1HZOA 1KGGA 1K6RA 3MKEA 4II7A 3T1SA 4NK3A 3DW0A 3ZG8B 5E2GA 4ZJ3A 4RX3A 5TR7A 1V9ZA 4I3AA 4DMZA 3PYPA 2ZM8A 5IU1A 2M1CA 3QP8A 3VP1A 1FCNA 4S2NA 3Q7VB 4EU0A 2X01A 3UDIA 4WMCD 5EUAA 4ETZA 4S2IA 3S7PA 3MXRA 5L2FA 1K4EA 2NUTC 4D2OA 3S7NA 5E2HA 2PYPA 2ZMAA 3EOIA 2P08A 4QY5A 2OWHA 1JTGA 2A24B 2P9VB 4Y5FA 1XA1A 3PXPA 3MFDA 2W3EA 1UWPX 4EEPA 1TF1A 3HLFA 3IWQA 3A0RA 3E4PA 3DTEA 2OWJA 3QP2A 3ZVTA 4WEKA 2FFFB 4RQ9A 1RCJA 5CHUA 1MWTA 4PM9A 2OV5A 2C5WB 3CHWP 4NXEA 4UQIS 3UDXA 5KZHA 1GSWA 4JXWA 1NYMA 2WKQA 5KSCA 3HBRA 2Y59A 1TDLA 3TSGA 1EI5A 1L0FA 4DJ2A 4D60A 4IJGA 2L0WA 3BLMA 3H7WA 4WM9A 4OVDA 5M1AA 3P98A 3C4OA 4MCWA 2RCXA 1T18A 1BZAA 4QWOA 1H5XA 2EX9A 2VLGA 1D1JA 4QJGA 2Y2NA 2PYRA 3SS3A 3LIEA 3NI9A 1I5QA 1K38A 1PZOA 2GZAA 2Y2IA 1CQAA 2XGNA 3GVBA 1YT4A 5HX9A 1QMEA 3O88A 3IXDA 4LRZE 4PM5A 1ERMA 4ZJ1A 4O0PA 2KOIA 4Y17A 3NOPC 3GTCA 4L9EA 4YNRA 2YKFA 3M6HA 1NRJA 2WKRA 5DTTA 2PBDP 1XFQA 3GQZA 1BLSA 2ZMVA 5EVLA 3Q07A 5TBMB 3HLWA 2A2LA 4C75A 2DNSA 4FH2A 3LUQA 4I5SA 3PBNA 1Z6FA 4DN0A 3MQ0A 4EUZA 1W63M 5HPFA 5HWTA 4X56A 1MWRA 2WGWA 1H8ZA 1ZTUA 3ZG7B 2EX8A 3JYIA 3MXQA 3MZEA 4CLCA 2O99A 3NJAA 4Y0OA 4HIAA 4LCLA 3T4JA 2K31A 1F5MA 1GSXA 3LI9A 1HTZA 4MN6A 2O9BA 4X1MA 3GR2A 4OPYA 3PAEA 3R7WB 5FATA 4LV3A 3NOUC 5GL9A 5L10A 2XD5A 5E2FA 4Y0UA 4E6XA 5KIZA 5EV0A 3OPLA 1VEUB 1A0KA 2M7UA 3TW8A 2J3TD 2HP9A 3ZNYA 1K56A 2XD1A 3S22A 4MBKA 4ETXA 2ZOIA 2BASA 2Z2MB 4EBLA 4H8RA 3H82A 3N8SA 3NOTC 5DF7A 4OQ0A 2B95A 3ZG9B 3D3OA 1K0KA 2O9CA 1CI8A 2NUPC 2JKGA 5CHJA 1H3QA 1IYOA 1YLYA 2XQZA 2JHEA 4Q0HA 5KMWA 4KZAA 3GRJA 3F1NA 2W27A 4GS9A 1QMFA 4KQOA 1UGUA 3LEZA 3LY4A 3HLBA 3WRZA 4KZ9A 5HL6A 1YLJA 5EVIB 4NKPA 1LSVA 3UE1A 2V1AA 3OCLA 4L9GA 1JVJA 4CLCE 4DE2A 3C5AA 4XT2A 4LV2A 4P6ZS 3GECA 1JWZA 1J9MA 1H8MA 3U4LP 3ZGAB 3P01A 3DWZA 1BT5A 4B88A 4KZBA 2QPNA 3IH9A 4B9OA 2V20A 3FKVA 4QY6A 2JKTM 3M2JA 1PWDA 3ZQ5A 4HEFA 4ZDXA 4X69A 1MPLA 1P9WA 2Q9NA 3T1RA 5CGSA 3TJZC 4MN7A 2X71A 3QNCA 3LIAA 5CGXA 4MBHA 4OONA 4GKUA 3FYZA 2V1BA 2QZ6A 2J80A 2QHKA 3VOZA 4E3JA 1P97A 3KYQA 3A3JA 3PBTA 4HNBA 1H0MA 3L7HA 1RP5A 4B4ZA 3CLOA 2WAFA 3T4KA 3BY9A 2W0NA 3BY8A 1KGEA 3BRMA 3IX4A 2HV1A 4LV1A 5F83A 2WKIA 2W3DA 4JGOA 3Q82A 2P04A 3T4LA 4E04A 1S66L 2WK0A 2JC7A 3N8RA 2WGIA 3BEBA 4KG5A 4E3KA 4OP5A 2EWVA 3O87A 2ZL1A 4Y0TA 4DE0A 4BQMA 3LCEA 4FH4A 3KSHA 3N6IA 1TVFA 3ISGA 1BSGA 5DKLA 1N9OA 3PBSA 3FC7A 2UWXA 2J8YA 5JYPA 3WS0A 1SCWA 3Q7ZA 3VP2A 2HF6A 3UB8A 2JKRM 3ZFZA 4GW9A 2XF3A 2INWA 4E3LA 2IWCA 1M40A 4RX2A 1NJ4A 3QP1A 3WRTA 2Y2OA 1IEMA 1KE0A 4MMNA 5FQKA 4GHIA 1IYPA 3DWKA 1OMEA
chains in the Genus database with same CATH topology
1OTAA 4DMZA 4BBTA 2V0UA 2CMNA 5DJTA 3PYPA 3F1OA 3RFBA 3A0VA 5IU1A 4HHDA 2M1CA 2VV6A 1N9LA 1DRMA 2VEAA 2VV7A 4NXBA 1OT6A 3HCYA 5G4YA 4NEED 5HWVA 2XRNA 1OTEA 2Y79A 4KUKA 1YSPA 1TS0A 4EU0A 2V0WA 3F1PA 3C2WA 2PR5A 3E0YA 4WLAA 1LT0A 4ETZA 1MKMA 3S7PA 2NUTC 3VOLA 3S7NA 1G28A 2PYPA 2W1TB 3EOIA 2P08A 2JKRI 1YSQA 2OWHA 3W2ZA 2A24B 1XJ2A 4Y5FA 5DJUA 3PXPA 3GDIA 2J3TC 4BBVA 2W3EA 1S67L 4JGPA 1UWPX 4EEPA 5HSQA 1TF1A 4CLCD 2K2NA 3B42A 4Y2FA 1NWZA 3LIBA 3A0RA 2PHYA 2I9VA 3E4PA 3E98A 2L4RA 3EQUA 2OWJA 5K5BA 4WEKA 3CITA 1S4RA 1OJGA 4BWIA 4ZRRA 3LIFA 4F3LB 4RQ9A 4QPRA 4HQAA 4Q0IA 2Z6DA 1IOUA 3LR4A 4L9FA 4CQHA 3T4SA 4HH2A 3VE4A 4NXEA 4UQIS 3TRCA 2ZMFA 1N9NA 4GHIB 3RTYA 1OTIA 1GSWA 3E4QA 2WKQA 3F1OB 4HY8A 4I3AA 4R70A 1S1YA 4M4XA 3EWKA 2O9AA 2VZWA 3RH8B 2EWWA 4O01A 2XSSA 4DJ2A 2PDRA 4IJGA 4I3IA 1P0ZA 4IUHA 5EFWA 2K7SA 5HDSA 3K2NA 2L0WA 1XJ3A 3H7WA 4MCWA 3UB7A 4FOFA 4EUVA 1T18A 1F9IA 2VLGA 3UE3A 3EGDC 2B02A 2W1TA 3CWFA 1KOUA 1NLYA 1TD5A 2KLIA 2A24A 1X0OA 2LB9A 2PYRA 3LIEA 4OOLA 4HI4A 3R7WA 3MQQA 5F6AA 2GZAA 2FH5A 3UMEA 2P7JA 3PBRA 2Z6CA 3T50A 1DP9A 4LRZE 2W3HA 3PR6A 2ZBBA 1ZHHB 4KQDA 4O0PA 5HDDA 1T1CA 3KO6A 2KOIA 4F3LA 4G3WA 3NOPC 4L9EA 5J7EA 4YNRA 1VHMA 2KX6A 2YKFA 3OBFA 4P6ZM 1NRJA 4BBUA 2WKRA 1NLZA 1XFQA 2ZMVA 5TBMB 1DP6A 3T4QA 3LR0A 1OPXA 2A2LA 4UEYA 3FPVA 4I38A 5AVFA 1YKDA 4CLCC 3LUQA 4I5SA 4Z1WA 4G3KA 3PBNA 2D02A 4R6LA 2PD7A 4DN0A 2VGLS 3MQ0A 3VV4A 5DKKA 2O0YA 1W63M 5HPFA 5HWTA 1UWNX 5DFXA 1ZTUA 3H7WB 2VKSA 3KSGA 3U2AA 2OOLA 3MXQA 3F1NB 3PBQA 4CLCA 2O99A 3NJAA 4HIAA 4R3AA 3T4JA 2K31A 2B18A 1F5MA 1GSXA 2MJ6A 2VJWA 3LI9A 4WELA 4MN6A 3NHQA 2O9BA 2EA9A 1OTBA 1LSXA 3PHYA 3OCNA 3R7WB 1WA9A 3NOUC 2JN7A 3KYZA 3UB9A 5FL3A 4OOMA 4UQIM 4HJ3A 1XFNA 5I5LA 3MJQA 4EXOA 5KIZA 3EEAA 4LLOB 4XT2B 3ICYA 3R4KA 2M7UA 3TW8A 3UB6A 2J3TD 4BMWA 5HDCA 3DBAA 2VGLM 4ETXA 4NXGA 3V67A 4Y3IA 3EGXC 3MF0A 4JGRA 2ZOIA 2BASA 4ME4A 2KDKA 4LPZA 1VB6A 3LR3A 1S4SA 3K3CA 5TBMA 4K08A 3H82A 5G4ZA 3T4OA 1Y28A 1V9YA 3NOTC 5CX7A 1IFQA 1DP8A 2HGVA 3D3OA 4HOIA 4R38A 4H6JB 3BW6A 1OT9A 2O9CA 4ARZA 4WF0A 4EEUA 2NUPC 2GJ3A 2YKHA 1XJ4A 1W63Q 3OC2A 5MC7A 5AJGA 1H3QA 3D72A 2HJEA 5IS1A 3CI6A 2VX8A 4WEJA 5L8MA 2JHEA 4MN5A 4Q0HA 3LR5A 5DF9A 3BWLA 3KSIA 1EW0A 1MC0A 1T1AA 3CAXA 3F1NA 2W27A 2J3WA 4GS9A 4CLCB 4KQOA 1UGUA 1STZA 3IS2A 3MFXA 4BJPA 3BQ8A 4EETB 1D7EA 4GLQA 5HL6A 4EESA 3KX0X 4JGQA 2QWSA 3H9WA 4HJ4A 4NKPA 1LSVA 1LL8A 2V1AA 3E4OA 1G6OA 3OCLA 4L9GA 4EERA 3LICA 4CLCE 2OAQ1 4MDZA 1MZUA 1ODVA 4XT2A 3IBRA 4P6ZS 3GECA 4L0LA 5DFYA 4AFIA 3CUEC 4IUKA 1H8MA 2DMWA 4GJ4A 4GCZA 3P01A 2W3FA 3ZYTA 1TS6A 4YOFA 5J4EA 1D06A 4EQ1A 4LRXC 3S7OA 3FPWA 4PAUA 3ULFA 1TS7A 1XJ6A 2PD8A 4B9OA 2QKPA 4HH3A 2JKTM 3LFVA 3FG8A 3H82B 3OOVA 3ZQ5A 3UMDA 1JNUA 3VE3A 1P9WA 3C38A 2HJ9C 4WUJA 4YWZA 1F98A 2H28A 2LB5A 4PHTA 3TJZC 4FSFA 4MN7A 4H6JA 2QJ5A 5TJJA 3T4TA 2ZOHA 3SW1A 2JKTI 1T19A 4ARZB 4I3JA 2XA7S 3LIAA 2R78A 3HJIA 4LRYC 3IBJA 3A0SA 3BJNA 3MQOA 2V1BA 4DJ3A 1GSVA 2J80A 2QHKA 1P97A 3KYQA 2QJ7A 2W1RA 2L1MA 4HP4A 2PT7A 1S1ZA 3PBTA 4NXFA 5F69A 3PBOA 4HNBA 3K3DA 4GS9B 3KSFA 3HJKA 3CLOA 3IS2B 5KSHA 4G3VA 3T4KA 3BY9A 2W0NA 3BY8A 3UE6A 4PKYA 2PR6A 2Y8HA 4B93A 3P7NA 2HV1A 3EEHA 5HD3A 3BQAA 3G6OA 3F1PB 3C8CA 1T1BA 2GX5A 5A8BA 1OTDA 2W3DA 4JGOA 1OJ5A 5F5YA 2XROA 2WKPA 2QYBA 5HPIA 2P04A 3MR0A 4EW7A 5HWWA 3T4LA 4E04A 1S66L 1P9RA 2V9AA 3MMHA 3B47A 3OLOA 4HP9A 5HD5A 2XA7M 5AVEA 2EWVA 1YAXA 2OAP1 4WN5A 2FZ0A 4KUOA 4HJ6A 1LSWA 3KSHA 2VA0A 5F68A 5LBRA 3LYXA 4O8GA 5DKLA 1N9OA 3PBSA 2GNXA 2W3GA 3FC7A 4Q0JA 4WL9A 3EQVA 2VV8A 3LIDA 5J3WA 5C5KA 2HF6A 2M7VA 5HZHA 1BYWA 4I39A 3UB8A 2G7UA 2JKRM 3JVVA 3TE8A 3C30A 4GW9A 2INWA 3B33A 3CUEA 2D01A 4IHQA 3S7QA 4II7A 4PKYG 3O5YA 4MMNA 1TS8A 5IT5A 4GHIA 2IA2A 1V9ZA 3LI8A 3JVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XT2 B;  1OTA A;  2H28 A;  1T18 A;  2V0U A;  1F9I A;  3ICY A;  4BBT A;  2CMN A;  5DJT A;  3PYP A;  2VLG A;  3F1O A;  4H6J A;  2QJ5 A;  3UB6 A;  3A0V A;  2B02 A;  3CWF A;  5HDC A;  2ZOH A;  5IU1 A;  3SW1 A;  1T19 A;  4HHD A;  2M1C A;  2VV6 A;  4I3J A;  1N9L A;  3LIA A;  1KOU A;  2R78 A;  1DRM A;  3HJI A;  4LRY C;  2VEA A;  2A24 A;  1X0O A;  2PYR A;  2VV7 A;  3A0S A;  1OT6 A;  3LIE A;  4NXG A;  3MQO A;  4NXB A;  4HI4 A;  5G4Y A;  5HWV A;  1OTE A;  4JGR A;  2V1B A;  2ZOI A;  4DJ3 A;  2BAS A;  3MQQ A;  4KUK A;  5F6A A;  1GSV A;  1TS0 A;  2J80 A;  2KDK A;  4LPZ A;  2V0W A;  1VB6 A;  2QHK A;  3F1P A;  1P97 A;  4HP4 A;  2QJ7 A;  1S4S A;  2L1M A;  3K3C A;  5TBM A;  3C2W A;  2PR5 A;  3H82 A;  2P7J A;  4K08 A;  5G4Z A;  3UME A;  4WLA A;  1LT0 A;  1S1Z A;  2Z6C A;  1Y28 A;  1V9Y A;  3T50 A;  4NXF A;  1DP9 A;  5F69 A;  3NOT C;  1DP8 A;  4LRZ E;  4HNB A;  3VOL A;  3K3D A;  1G28 A;  4WUJ A;  4GS9 B;  4HOI A;  2PYP A;  3HJK A;  4H6J B;  2ZBB A;  4R38 A;  4KQD A;  1OT9 A;  3CLO A;  3IS2 B;  4WF0 A;  4EEU A;  3BY9 A;  2W0N A;  5HDD A;  2GJ3 A;  3BY8 A;  2OWH A;  2YKH A;  1XJ4 A;  2PR6 A;  1T1C A;  4PKY A;  2A24 B;  1XJ2 A;  3UE6 A;  3P7N A;  2HV1 A;  3NOP C;  4L9E A;  3D72 A;  3EEH A;  5DJU A;  5J7E A;  2YKF A;  2KX6 A;  3GDI A;  5HD3 A;  4BBV A;  1S67 L;  4BBU A;  5IS1 A;  2WKR A;  4JGP A;  1UWP X;  4EEP A;  1XFQ A;  3G6O A;  5HSQ A;  3F1P B;  3C8C A;  1T1B A;  1NWZ A;  2JHE A;  4MN5 A;  5TBM B;  1DP6 A;  5A8B A;  1OTD A;  3LIB A;  3A0R A;  4JGO A;  2PHY A;  1OJ5 A;  2I9V A;  3E4P A;  3BWL A;  2WKP A;  2L4R A;  5F5Y A;  1EW0 A;  3MR0 A;  2OWJ A;  4I38 A;  5AVF A;  4EW7 A;  1T1A A;  3CAX A;  3F1N A;  5HWW A;  3LUQ A;  2W27 A;  4GS9 A;  1S66 L;  4I5S A;  4E04 A;  2V9A A;  1UGU A;  2D02 A;  4R6L A;  1S4R A;  3IS2 A;  2PD7 A;  3MFX A;  4LLO B;  3OLO A;  1OJG A;  4HP9 A;  5HD5 A;  5AVE A;  4EET B;  1D7E A;  3LIF A;  4F3L B;  4EES A;  3KX0 X;  4JGQ A;  4RQ9 A;  4WN5 A;  4KUO A;  5DKK A;  2QWS A;  4HJ6 A;  4HQA A;  1LSW A;  2Z6D A;  3H9W A;  4HJ4 A;  4L9F A;  1LSV A;  1LL8 A;  2V1A A;  3E4O A;  5HWT A;  5F68 A;  3LYX A;  1UWN X;  4HH2 A;  4L9G A;  3VE4 A;  4EER A;  4NXE A;  5DKL A;  1N9O A;  3LIC A;  3FC7 A;  1N9N A;  3H7W B;  4GHI B;  4WL9 A;  3RTY A;  1OTI A;  2OOL A;  1MZU A;  1ODV A;  1GSW A;  2VV8 A;  3E4Q A;  3IBR A;  3LID A;  4XT2 A;  3MXQ A;  3F1N B;  5J3W A;  4F3L A;  3GEC A;  2WKQ A;  3F1O B;  3NJA A;  4HIA A;  4R3A A;  4HY8 A;  4R70 A;  1GSX A;  1BYW A;  3LI9 A;  5HZH A;  4I39 A;  3UB8 A;  1S1Y A;  4M4X A;  3NHQ A;  3EWK A;  4GCZ A;  4MN6 A;  4GW9 A;  3RH8 B;  2EA9 A;  2INW A;  1OTB A;  1LSX A;  3B33 A;  1TS6 A;  3PHY A;  2D01 A;  1D06 A;  5J4E A;  1WA9 A;  4EQ1 A;  4DJ2 A;  4LRX C;  2PDR A;  3ULF A;  3NOU C;  1TS7 A;  1XJ6 A;  1P0Z A;  2JN7 A;  2PD8 A;  4I3I A;  2K7S A;  4PKY G;  2QKP A;  4HH3 A;  5EFW A;  3UB9 A;  4B9O A;  5HDS A;  3FG8 A;  3H82 B;  3ZQ5 A;  2L0W A;  1TS8 A;  3UMD A;  1XJ3 A;  1JNU A;  3H7W A;  4GHI A;  1XFN A;  4HJ3 A;  3MJQ A;  5I5L A;  3VE3 A;  4EXO A;  1V9Z A;  3LI8 A;  4I3A A;  5KIZ A;  3UB7 A;  4YWZ A;  1F98 A; 
#chains in the Genus database with same CATH topology
 1OTA A;  2V0U A;  4FD8 A;  2CMN A;  1O7E A;  4JBF A;  3F1O A;  1W8Q A;  4R3J A;  1BLC A;  2ZC5 B;  3HLG A;  4K0X A;  4NXB A;  1OT6 A;  4OOY A;  1IKG A;  2XRN A;  1OTE A;  1JWP A;  4KUK A;  1TS0 A;  2BLS A;  1GHI A;  3N7W A;  4BD0 A;  1LHY A;  4HES A;  5CXW A;  1GA9 A;  2G2U A;  3S4X A;  4WBG A;  3ITB A;  2W1T B;  2JKR I;  3FZC A;  3W2Z A;  5DJU A;  3GDI A;  2A3U A;  1K25 A;  2FFY A;  4IBR A;  4BBV A;  2XFS A;  4R3B A;  2ZLY A;  1XPB A;  4JGP A;  3AGF A;  5L07 A;  5FEF A;  2Q0O A;  2K2N A;  4Y2F A;  3V3R A;  3SH8 A;  2ZC7 A;  3HRE A;  2I9V A;  2OLV A;  2ZQD A;  5U47 A;  1ZG6 A;  4X55 A;  1S4R A;  3CG5 A;  4BWI A;  3LIF A;  2Z6D A;  1IOU A;  4L9F A;  3S1Y A;  4CQH A;  4HH2 A;  3NDG A;  3VE4 A;  5A91 A;  1BUL A;  1ZC2 A;  3IX8 A;  3RTY A;  3T12 B;  3FWL A;  3UY6 A;  5EVI D;  1WYB A;  3E4Q A;  4BD1 A;  1LL5 A;  3V39 A;  3EWK A;  2O9A A;  4O01 A;  2XSS A;  2P74 A;  5EFW A;  2K7S A;  5DF8 A;  2JCH A;  5HDS A;  1FIK A;  4LFU A;  3LO7 A;  1PI5 A;  3UB7 A;  2EFX A;  4KG2 A;  4WZ5 C;  4OQG A;  5FAO A;  1MWU A;  1TD5 A;  2KLI A;  1X0O A;  4OOL A;  1SZV A;  4E3M A;  1SDE A;  1BTL A;  3MQQ A;  3O86 A;  1VQQ A;  2ZQC A;  3BFF A;  3G31 A;  2HDQ A;  3PBR A;  3VP0 A;  2Z6C A;  1RGZ A;  3T50 A;  1DP9 A;  2WUQ A;  5A93 A;  5AQ9 A;  2ZBB A;  3G2Z A;  2H0Y A;  1T1C A;  3KO6 A;  4F3L A;  3HLD A;  5GHX A;  2V1Z A;  4P6Z M;  4GOG A;  4EQI A;  1PW8 A;  3T4Q A;  4JLF A;  3BLS A;  2H0T A;  3FPV A;  3ZG5 A;  4CLC C;  4Z1W A;  3ZG0 A;  5EE8 A;  2D02 A;  4R6L A;  1FR1 A;  2VGL S;  4OLD A;  2O0Y A;  5EPH A;  5GLA A;  1N4O A;  1YQS A;  2JE5 A;  4LGW A;  2GDN A;  2OOL A;  1FR6 A;  2E8J A;  4UA7 A;  2I72 A;  4HBU A;  1VM1 A;  4WZ5 A;  4YIN A;  4WEL A;  4CPK A;  1PZP A;  3NHQ A;  4N9K A;  1TEM A;  1E4D A;  5FAQ A;  4MNR A;  1WA9 A;  2J7V A;  3T1Q B;  4JF5 A;  3KYZ A;  3UB9 A;  3MSH A;  3RJU A;  4Y7P A;  5CED A;  5I5L A;  3MJQ A;  4EXO A;  1G5U A;  3BEC A;  4LLO B;  2PU2 A;  2Y4A A;  4BL3 A;  3UB6 A;  1Q2Q A;  5FAS A;  3DBA A;  3OPP A;  2Y2J A;  1BUE A;  4JGR A;  2WZX A;  5FA7 A;  1VB6 A;  1YLP A;  1S4S A;  3IHB A;  3T4O A;  1KDW A;  5FQ9 A;  1NXY A;  2PBY A;  5AQB A;  1IFQ A;  4CJN A;  3DTI A;  1J3W A;  4H6J B;  3I7J A;  4ARZ A;  4M3K A;  4WF0 A;  4EEU A;  1W63 Q;  3D72 A;  4JXG A;  4Y15 A;  3VP4 A;  4R4S A;  4B4X A;  5L8M A;  4DXC A;  3GV9 A;  5FQQ A;  3LR5 A;  2QMI A;  2ZD8 A;  4ZJ2 A;  1MC0 A;  4N9L A;  5EM0 A;  1MWS A;  5HW3 A;  4GN2 A;  1STZ A;  3IF5 A;  3IS2 A;  4BLM A;  4ESP A;  2J9P A;  4GLQ A;  3KX0 X;  3WS2 A;  2QWS A;  2WAE A;  3CPT A;  3H9W A;  3IXG A;  1G6O A;  4R4R A;  4EER A;  5HFO A;  3LIC A;  4S2J A;  1L3L A;  4MDZ A;  2B5R A;  1MZU A;  3IBR A;  1HD8 A;  4AFI A;  3CUE C;  4GJ4 A;  1Z09 A;  4GCZ A;  1L0E A;  4DE3 A;  2WAD A;  3OPR A;  5J4E A;  3CZD A;  5GLB A;  5J8X A;  2Y2Q A;  4LRX C;  2XR0 A;  1SDN A;  3ULF A;  2Y2L A;  5CGW A;  3LFV A;  3FG8 A;  1CJF A;  3UMD A;  1JNU A;  4OKP A;  3UO9 A;  1F98 A;  2H28 A;  5DTS A;  3ZDJ A;  4KEN B;  3T4T A;  2ZOH A;  3SW1 A;  2H10 A;  2JKT I;  4I3J A;  2XA7 S;  3HJI A;  3BFE A;  4Z9Q A;  5EM1 A;  2R9X A;  2WZZ A;  1ACF A;  1GSV A;  2UV0 E;  1S0W A;  4NXF A;  5F69 A;  1SHV A;  1CF0 A;  3HJK A;  1BLH A;  3D9Y A;  5KSH A;  2XLN A;  4P6B A;  4PM6 A;  1W8Y A;  3UE6 A;  2PR6 A;  2Y2H A;  3P7N A;  4PMA A;  4DF6 A;  3Q7V A;  3BQA A;  3G6O A;  3JPU A;  5F82 A;  3C8C A;  1T1B A;  5GLD A;  1XP4 A;  3OZH A;  5F5Y A;  2XRO A;  2QYB A;  5HPI A;  5HWW A;  1PNE A;  2V9A A;  2ZJ9 A;  3OLO A;  1M6K A;  3QHY A;  2Y91 A;  2P9V A;  2FZ0 A;  4O7D A;  1LSW A;  1NRF A;  4UAA A;  4U0X A;  3IT9 A;  5F1G A;  3UNW A;  3LGO A;  2Y2K A;  1VET B;  2ZC3 B;  5FI2 A;  2M7V A;  4OH0 A;  1BYW A;  1SKO A;  1PWG A;  3BYD A;  4S2L A;  1YPR A;  4JF4 A;  3CUE A;  2D01 A;  4IHQ A;  3S7Q A;  2IWB A;  3RXX A;  1W5D A;  4WMC A;  4PKY G;  3O5Y A;  1DY6 A;  5GHZ A;  1TS8 A;  5IT5 A;  4OQH A;  4FTX A;  1ESU A;  5DJT A;  1HVB A;  1K55 C;  3LY3 A;  4P85 A;  1N9L A;  3O3V A;  2VV7 A;  1MY8 A;  1HLU P;  3HCY A;  2ACG A;  4NEE D;  5CHM A;  2EXA A;  2V0W A;  3F1P A;  4ZAM A;  5FQI A;  1XA7 A;  1LT0 A;  4X25 A;  1IYQ A;  2WGV A;  3HL9 A;  1MKM A;  1G28 A;  3Q81 A;  4RYE A;  3WS5 A;  1YSQ A;  2J3T C;  2JBF A;  1IKI A;  5HSQ A;  1PYY A;  4CLC D;  3B42 A;  1PFL A;  5E43 A;  2L4R A;  3EQU A;  3MZF A;  5K5B A;  3AGE A;  3IF6 A;  3HLC A;  2WKE A;  4RVA A;  4QPR A;  5FEG A;  4HQA A;  4Q0I A;  3T4S A;  1GHM A;  2PAV P;  4S2O A;  3TRC A;  1NYY A;  3ZCZ A;  1PWC A;  2V2F F;  1OTI A;  3HUM A;  1GA0 A;  4UHU A;  5JYO A;  1F2K A;  4R70 A;  1ES5 A;  2R9W A;  1JTD A;  4JKT A;  2VZW A;  4N1H A;  3RH8 B;  1E3U D;  4F94 A;  4PM7 A;  1P0Z A;  3NCK A;  3E2K A;  2E8I A;  3IWI A;  3K2N A;  1K6S A;  1XJ3 A;  2XEP A;  2Y2M A;  4FOF A;  4JXV A;  4KG6 A;  2G2W A;  3EGD C;  3GMW A;  4U0T A;  1I2W A;  4OQI A;  4QU3 A;  2C6W B;  2A24 A;  2LB9 A;  3FKW A;  4IED A;  4X53 A;  3R7W A;  5IHV A;  5F6A A;  3IWO A;  2FH5 A;  2HPB A;  3UME A;  2P7J A;  5A92 A;  5DTK A;  1VEU A;  1KE4 A;  4LEN A;  1ZHH B;  4KQD A;  5HDD A;  4FCF A;  4G3W A;  2ZQ8 A;  2KX6 A;  3OBF A;  1E25 A;  3QP5 A;  1NLZ A;  4KZ4 A;  5EVI C;  3ZVW A;  4UEY A;  1KE3 A;  3SS5 A;  1YKD A;  1PI4 A;  3B3X A;  4S2K A;  3Q1F A;  5DKK A;  3NC8 A;  4ZTK A;  1MBL A;  5HAQ A;  3SZT A;  3HLE A;  4S2P A;  1ES4 A;  1W79 A;  5DFX A;  3M2K A;  3H7W B;  4XUX A;  2VKS A;  3KSG A;  1XGI A;  3F1N B;  2EX6 A;  4R3A A;  2B18 A;  1JWV A;  2VJW A;  2EA9 A;  3OCN A;  1K57 A;  1NZU A;  2JN7 A;  3W4P A;  5FL3 A;  2J9O A;  4YFM A;  3ITA A;  4UQI M;  4HJ3 A;  1ONH A;  3EEA A;  5G18 A;  4XT2 B;  3IH8 A;  4KZ5 A;  3V5M A;  4BMW A;  5HDC A;  5GHY A;  4NXG A;  1NZO A;  1E3U A;  2VGJ A;  3MF0 A;  1MKI A;  2WKH A;  4ME4 A;  3HUO A;  4LPZ A;  3VMA A;  3G35 A;  3K3C A;  5TBM A;  4K08 A;  5CX7 A;  3VOY A;  2HGV A;  1FQG A;  4HOI A;  4R38 A;  4DDY A;  3BW6 A;  3UE0 A;  1OT9 A;  4KZ6 A;  1K56 D;  3OPH A;  5AJG A;  4EBP A;  3A3D A;  2HJE A;  1BLP A;  5IS1 A;  3IXB A;  3DTM A;  2VX8 A;  4E3O A;  2V8C A;  4WEJ A;  4C6Y A;  2WGW B;  4MN5 A;  4KQQ A;  4K91 A;  1W7F A;  3BWL A;  2HZ5 A;  3VP3 A;  2HDR A;  3KSI A;  3NBL A;  3MKF A;  4CLC B;  2OSU A;  3MFX A;  4BJP A;  4EET B;  1D7E A;  1K54 C;  4EES A;  1K55 A;  1ZG4 A;  1LL8 A;  1ERO A;  3PAG A;  4LCM A;  3VFH A;  5EEC A;  4N92 A;  5DFY A;  3C7V A;  4IUK A;  5TGF A;  2DMW A;  4NET A;  2BG1 A;  4R1G A;  3ZYT A;  5EVE A;  1TS6 A;  3T1X A;  1YLW A;  3S7O A;  3FPW A;  4PAU A;  2HDU A;  2QKP A;  4HH3 A;  4MBF A;  1LL9 A;  3H82 B;  3OOV A;  3SH7 A;  2AVX A;  3VE3 A;  3TOI A;  4Y13 A;  3E2L A;  2HJ9 C;  3DTK A;  2LB5 A;  5TJJ A;  3UPO A;  5FDS A;  2DCF A;  1ONG A;  1FCO A;  2R78 A;  3BFD A;  2DRW A;  1K4F A;  3A0S A;  1AWI A;  3BJN A;  3MQO A;  2QJ7 A;  1IEL A;  2W1R A;  4C3Q A;  2ZM2 A;  4MLL A;  1S1Z A;  3PBO A;  4GS9 B;  3KSF A;  1IYS A;  4G3V A;  4BEN A;  4P87 A;  2Y8H A;  1FSY A;  4B93 A;  3WS1 A;  3EEH A;  1AXB A;  5EOE A;  5EVI A;  5AQA A;  5A8B A;  3V3S A;  3G34 A;  3W4O A;  3CJM A;  3P09 A;  4IBX A;  2WYX A;  4EW7 A;  3AGD A;  3NEC A;  3MBZ A;  2JKF A;  1ERQ A;  1DJC A;  4RA7 A;  3B47 A;  4EBN A;  4DE1 A;  2XFT A;  1U60 A;  2OAP 1;  4WN5 A;  4KUO A;  4DKI A;  4HJ6 A;  1C3B A;  5F68 A;  1FSW A;  3LYX A;  4O8G A;  2EX2 A;  4Q0J A;  4QB8 A;  4E3I A;  3LID A;  3MZD A;  1WE4 A;  3GSG A;  3NDE A;  5HZH A;  2XK1 A;  4I39 A;  2ZC4 B;  2Q9M A;  3TE8 A;  3C30 A;  1MXO A;  5DVA A;  2Y55 A;  3TG9 A;  3WWX A;  2IA2 A;  3LI8 A;  3JVU A;  4OPQ A;  4BBT A;  3RFB A;  4GB7 A;  3A0V A;  2XDM A;  4HHD A;  2VV6 A;  1DRM A;  1WYC A;  2VEA A;  5G4Y A;  4BL2 A;  5HWV A;  2Y79 A;  4EWF A;  1YSP A;  3C2W A;  2PR5 A;  3E0Y A;  4WLA A;  3VOL A;  4X1L A;  2VGK A;  1XKZ A;  3IXH A;  5HAR A;  5FSR A;  2ZL1 B;  1XJ2 A;  1EWZ A;  1S67 L;  3L9K A;  3A3E A;  1PIO A;  3QNB A;  1NWZ A;  3LIB A;  2PHY A;  3E98 A;  2Y2G A;  4EV4 A;  3CIT A;  5CER A;  4FUW A;  2HP6 A;  1OJG A;  1YMS A;  4MEZ A;  4ZRR A;  5FQJ A;  4F3L B;  1KVL A;  3LR4 A;  4ID4 A;  3UB5 P;  1TDG A;  2ZMF A;  4OLG A;  1N9N A;  4GHI B;  3VSL A;  1KDS A;  5CRF A;  3G4P A;  3M6B A;  3UPP A;  3F1O B;  3KYE A;  4NG2 A;  2Z2L B;  4HY8 A;  4HBT A;  1S1Y A;  4M4X A;  4UA9 A;  4DDS A;  2EWW A;  3A3I A;  5CTM A;  3C7U A;  1YLT A;  2PDR A;  4I3I A;  4IUH A;  1FIL A;  2OLU A;  4K0W A;  3IQA A;  1GCE A;  4EUV A;  1F9I A;  1PRQ A;  3UE3 A;  2B02 A;  2W1T A;  3CWF A;  3N8L A;  4PPR A;  5GLC A;  1KOU A;  4N1X A;  1NLY A;  5L09 A;  4HI4 A;  2XH9 A;  5AQ7 A;  4KZ8 A;  1L2S A;  5E2E A;  2ZC6 B;  2W3H A;  3IX3 A;  3PR6 A;  4JXS A;  1YMX A;  3G2Y A;  5HAI A;  5J7E A;  1VHM A;  3IF6 C;  3DAV A;  3ZHH A;  4BBU A;  3VFF A;  1G6A A;  4E6W A;  1XX2 A;  4E3N A;  1DP6 A;  2EXB A;  3LR0 A;  1OPX A;  1K54 A;  4I38 A;  5AVF A;  2PRF A;  5M18 A;  1CEF A;  3MS6 A;  4G3K A;  3ZNT A;  1H8Y A;  4IVI A;  2PD7 A;  4KQR A;  1L0D A;  3VV4 A;  5FQM A;  4P0M A;  4GZB A;  5CEB A;  3QP6 A;  4X6T A;  1UWN X;  4DXB A;  1ES2 A;  1XGJ A;  4KZ7 A;  5D3O A;  3U2A A;  3PBQ A;  1ES3 A;  2RL3 A;  2MJ6 A;  4S2M A;  4A5R A;  1OTB A;  1LSX A;  3PHY A;  3IHA A;  4UA6 A;  1L0G A;  4OOM A;  3QP4 A;  1XFN A;  3ICY A;  3R4K A;  1XXM A;  1SKF A;  2ZQA A;  2VGL M;  3V67 A;  1NY0 A;  3FV7 A;  4Y3I A;  2ZQ7 A;  3EGX C;  3RXW A;  1LI9 A;  4GD6 A;  2KDK A;  3LR3 A;  3BM6 A;  1KVM A;  5G4Z A;  2ZM0 A;  1Y28 A;  1V9Y A;  5FDH A;  4JF6 A;  1DP8 A;  5I94 A;  5HAP A;  1Y4O A;  3NY4 A;  1FOF A;  3C4P A;  1PW1 A;  2GJ3 A;  2YKH A;  1XJ4 A;  2V8F A;  3OC2 A;  5M19 A;  2BTF P;  5MC7 A;  1RGY A;  1FCM A;  3HVF A;  5TFQ A;  2H5S A;  1ZKJ A;  3CI6 A;  4XXR A;  3N4I A;  4S2N C;  2X02 A;  5HL1 A;  5DF9 A;  1DJA A;  5CTN A;  1EW0 A;  3BFG A;  1T1A A;  3CAX A;  2J3W A;  5BOH A;  3SS4 A;  3BQ8 A;  3SOI A;  3UN7 A;  4JGQ A;  4LV0 A;  4QD4 A;  3G30 A;  4HJ4 A;  1CI9 A;  3E4O A;  3G32 A;  1Y54 A;  1K57 C;  1ALQ A;  4WYY A;  4PM8 A;  1G68 A;  3MXS A;  3PTE A;  2OAQ 1;  1LI0 A;  1ODV A;  1CEG A;  3CMZ A;  2ZQ9 A;  4R0Q A;  3A3F A;  5FAP A;  4L0L A;  1ESI A;  4OPZ A;  4DRT A;  2EFU A;  2VK3 A;  2W3F A;  1KGF A;  4YOF A;  1D06 A;  3W4Q A;  4EQ1 A;  4WZ4 A;  1TS7 A;  1XJ6 A;  2PD8 A;  4GDN A;  3HUN A;  4XUZ A;  3C38 A;  4WUJ A;  4YWZ A;  4GDB A;  4PHT A;  4FSF A;  4H6J A;  2QJ5 A;  1VET A;  4ARZ B;  1T19 A;  1SKO B;  5F1F A;  4LRY C;  3IBJ A;  5FI7 A;  3D4F A;  5FI6 A;  1GHP A;  4DJ3 A;  2CC1 A;  4GD8 A;  3W8K A;  4HP4 A;  2L1M A;  2PT7 A;  4U3T A;  1S6R A;  3V50 A;  4X68 A;  3K3D A;  2A49 A;  4IVK A;  2PU4 A;  4R23 A;  3IS2 B;  3LEQ A;  1LLB A;  4PKY A;  4OP8 A;  5CEC A;  3UDF A;  4JPM A;  3SH9 A;  5HD3 A;  3CPT B;  1Q2P A;  3F1P B;  5A90 A;  4GNU A;  2GX5 A;  1OTD A;  1O07 A;  1OJ5 A;  2WKP A;  1DJB A;  3MR0 A;  1CK3 A;  3UPN A;  2IWD A;  4Q8I A;  1P9R A;  3MMH A;  4KZ3 A;  3NIA A;  1N9B A;  1I2S A;  5HD5 A;  4HP9 A;  2XA7 M;  5AVE A;  1YAX A;  3NUL A;  1YM1 A;  1YLZ A;  3BFC A;  2VA0 A;  5LBR A;  4ZBE A;  2GNX A;  2W3G A;  5EOO A;  4WL9 A;  2HDS A;  3EQV A;  2VV8 A;  5J3W A;  2HP5 A;  3WS4 A;  5C5K A;  4OPR A;  2G7U A;  3IF6 B;  3JVV A;  4QHC A;  2Y2P A;  3VSK A;  3B33 A;  1HZO A;  1KGG A;  1K6R A;  3MKE A;  4II7 A;  3T1S A;  4NK3 A;  3DW0 A;  3ZG8 B;  5E2G A;  4ZJ3 A;  4RX3 A;  5TR7 A;  1V9Z A;  4I3A A;  4DMZ A;  3PYP A;  2ZM8 A;  5IU1 A;  2M1C A;  3QP8 A;  3VP1 A;  1FCN A;  4S2N A;  3Q7V B;  4EU0 A;  2X01 A;  3UDI A;  4WMC D;  5EUA A;  4ETZ A;  4S2I A;  3S7P A;  3MXR A;  5L2F A;  1K4E A;  2NUT C;  4D2O A;  3S7N A;  5E2H A;  2PYP A;  2ZMA A;  3EOI A;  2P08 A;  4QY5 A;  2OWH A;  1JTG A;  2A24 B;  2P9V B;  4Y5F A;  1XA1 A;  3PXP A;  3MFD A;  2W3E A;  1UWP X;  4EEP A;  1TF1 A;  3HLF A;  3IWQ A;  3A0R A;  3E4P A;  3DTE A;  2OWJ A;  3QP2 A;  3ZVT A;  4WEK A;  2FFF B;  4RQ9 A;  1RCJ A;  5CHU A;  1MWT A;  4PM9 A;  2OV5 A;  2C5W B;  3CHW P;  4NXE A;  4UQI S;  3UDX A;  5KZH A;  1GSW A;  4JXW A;  1NYM A;  2WKQ A;  5KSC A;  3HBR A;  2Y59 A;  1TDL A;  3TSG A;  1EI5 A;  1L0F A;  4DJ2 A;  4D60 A;  4IJG A;  2L0W A;  3BLM A;  3H7W A;  4WM9 A;  4OVD A;  5M1A A;  3P98 A;  3C4O A;  4MCW A;  2RCX A;  1T18 A;  1BZA A;  4QWO A;  1H5X A;  2EX9 A;  2VLG A;  1D1J A;  4QJG A;  2Y2N A;  2PYR A;  3SS3 A;  3LIE A;  3NI9 A;  1I5Q A;  1K38 A;  1PZO A;  2GZA A;  2Y2I A;  1CQA A;  2XGN A;  3GVB A;  1YT4 A;  5HX9 A;  1QME A;  3O88 A;  3IXD A;  4LRZ E;  4PM5 A;  1ERM A;  4ZJ1 A;  4O0P A;  2KOI A;  4Y17 A;  3NOP C;  3GTC A;  4L9E A;  4YNR A;  2YKF A;  3M6H A;  1NRJ A;  2WKR A;  5DTT A;  2PBD P;  1XFQ A;  3GQZ A;  1BLS A;  2ZMV A;  5EVL A;  3Q07 A;  5TBM B;  3HLW A;  2A2L A;  4C75 A;  2DNS A;  4FH2 A;  3LUQ A;  4I5S A;  3PBN A;  1Z6F A;  4DN0 A;  3MQ0 A;  4EUZ A;  1W63 M;  5HPF A;  5HWT A;  4X56 A;  1MWR A;  2WGW A;  1H8Z A;  1ZTU A;  3ZG7 B;  2EX8 A;  3JYI A;  3MXQ A;  3MZE A;  4CLC A;  2O99 A;  3NJA A;  4Y0O A;  4HIA A;  4LCL A;  3T4J A;  2K31 A;  1F5M A;  1GSX A;  3LI9 A;  1HTZ A;  4MN6 A;  2O9B A;  4X1M A;  3GR2 A;  4OPY A;  3PAE A;  3R7W B;  5FAT A;  4LV3 A;  3NOU C;  5GL9 A;  5L10 A;  2XD5 A;  5E2F A;  4Y0U A;  4E6X A;  5KIZ A;  5EV0 A;  3OPL A;  1VEU B;  1A0K A;  2M7U A;  3TW8 A;  2J3T D;  2HP9 A;  3ZNY A;  1K56 A;  2XD1 A;  3S22 A;  4MBK A;  4ETX A;  2ZOI A;  2BAS A;  2Z2M B;  4EBL A;  4H8R A;  3H82 A;  3N8S A;  3NOT C;  5DF7 A;  4OQ0 A;  2B95 A;  3ZG9 B;  3D3O A;  1K0K A;  2O9C A;  1CI8 A;  2NUP C;  2JKG A;  5CHJ A;  1H3Q A;  1IYO A;  1YLY A;  2XQZ A;  2JHE A;  4Q0H A;  5KMW A;  4KZA A;  3GRJ A;  3F1N A;  2W27 A;  4GS9 A;  1QMF A;  4KQO A;  1UGU A;  3LEZ A;  3LY4 A;  3HLB A;  3WRZ A;  4KZ9 A;  5HL6 A;  1YLJ A;  5EVI B;  4NKP A;  1LSV A;  3UE1 A;  2V1A A;  3OCL A;  4L9G A;  1JVJ A;  4CLC E;  4DE2 A;  3C5A A;  4XT2 A;  4LV2 A;  4P6Z S;  3GEC A;  1JWZ A;  1J9M A;  1H8M A;  3U4L P;  3ZGA B;  3P01 A;  3DWZ A;  1BT5 A;  4B88 A;  4KZB A;  2QPN A;  3IH9 A;  4B9O A;  2V20 A;  3FKV A;  4QY6 A;  2JKT M;  3M2J A;  1PWD A;  3ZQ5 A;  4HEF A;  4ZDX A;  4X69 A;  1MPL A;  1P9W A;  2Q9N A;  3T1R A;  5CGS A;  3TJZ C;  4MN7 A;  2X71 A;  3QNC A;  3LIA A;  5CGX A;  4MBH A;  4OON A;  4GKU A;  3FYZ A;  2V1B A;  2QZ6 A;  2J80 A;  2QHK A;  3VOZ A;  4E3J A;  1P97 A;  3KYQ A;  3A3J A;  3PBT A;  4HNB A;  1H0M A;  3L7H A;  1RP5 A;  4B4Z A;  3CLO A;  2WAF A;  3T4K A;  3BY9 A;  2W0N A;  3BY8 A;  1KGE A;  3BRM A;  3IX4 A;  2HV1 A;  4LV1 A;  5F83 A;  2WKI A;  2W3D A;  4JGO A;  3Q82 A;  2P04 A;  3T4L A;  4E04 A;  1S66 L;  2WK0 A;  2JC7 A;  3N8R A;  2WGI A;  3BEB A;  4KG5 A;  4E3K A;  4OP5 A;  2EWV A;  3O87 A;  2ZL1 A;  4Y0T A;  4DE0 A;  4BQM A;  3LCE A;  4FH4 A;  3KSH A;  3N6I A;  1TVF A;  3ISG A;  1BSG A;  5DKL A;  1N9O A;  3PBS A;  3FC7 A;  2UWX A;  2J8Y A;  5JYP A;  3WS0 A;  1SCW A;  3Q7Z A;  3VP2 A;  2HF6 A;  3UB8 A;  2JKR M;  3ZFZ A;  4GW9 A;  2XF3 A;  2INW A;  4E3L A;  2IWC A;  1M40 A;  4RX2 A;  1NJ4 A;  3QP1 A;  3WRT A;  2Y2O A;  1IEM A;  1KE0 A;  4MMN A;  5FQK A;  4GHI A;  1IYP A;  3DWK A;  1OME A; 
#chains in the Genus database with same CATH homology
 1OTA A;  4DMZ A;  4BBT A;  2V0U A;  2CMN A;  5DJT A;  3PYP A;  3F1O A;  3RFB A;  3A0V A;  5IU1 A;  4HHD A;  2M1C A;  2VV6 A;  1N9L A;  1DRM A;  2VEA A;  2VV7 A;  4NXB A;  1OT6 A;  3HCY A;  5G4Y A;  4NEE D;  5HWV A;  2XRN A;  1OTE A;  2Y79 A;  4KUK A;  1YSP A;  1TS0 A;  4EU0 A;  2V0W A;  3F1P A;  3C2W A;  2PR5 A;  3E0Y A;  4WLA A;  1LT0 A;  4ETZ A;  1MKM A;  3S7P A;  2NUT C;  3VOL A;  3S7N A;  1G28 A;  2PYP A;  2W1T B;  3EOI A;  2P08 A;  2JKR I;  1YSQ A;  2OWH A;  3W2Z A;  2A24 B;  1XJ2 A;  4Y5F A;  5DJU A;  3PXP A;  3GDI A;  2J3T C;  4BBV A;  2W3E A;  1S67 L;  4JGP A;  1UWP X;  4EEP A;  5HSQ A;  1TF1 A;  4CLC D;  2K2N A;  3B42 A;  4Y2F A;  1NWZ A;  3LIB A;  3A0R A;  2PHY A;  2I9V A;  3E4P A;  3E98 A;  2L4R A;  3EQU A;  2OWJ A;  5K5B A;  4WEK A;  3CIT A;  1S4R A;  1OJG A;  4BWI A;  4ZRR A;  3LIF A;  4F3L B;  4RQ9 A;  4QPR A;  4HQA A;  4Q0I A;  2Z6D A;  1IOU A;  3LR4 A;  4L9F A;  4CQH A;  3T4S A;  4HH2 A;  3VE4 A;  4NXE A;  4UQI S;  3TRC A;  2ZMF A;  1N9N A;  4GHI B;  3RTY A;  1OTI A;  1GSW A;  3E4Q A;  2WKQ A;  3F1O B;  4HY8 A;  4I3A A;  4R70 A;  1S1Y A;  4M4X A;  3EWK A;  2O9A A;  2VZW A;  3RH8 B;  2EWW A;  4O01 A;  2XSS A;  4DJ2 A;  2PDR A;  4IJG A;  4I3I A;  1P0Z A;  4IUH A;  5EFW A;  2K7S A;  5HDS A;  3K2N A;  2L0W A;  1XJ3 A;  3H7W A;  4MCW A;  3UB7 A;  4FOF A;  4EUV A;  1T18 A;  1F9I A;  2VLG A;  3UE3 A;  3EGD C;  2B02 A;  2W1T A;  3CWF A;  1KOU A;  1NLY A;  1TD5 A;  2KLI A;  2A24 A;  1X0O A;  2LB9 A;  2PYR A;  3LIE A;  4OOL A;  4HI4 A;  3R7W A;  3MQQ A;  5F6A A;  2GZA A;  2FH5 A;  3UME A;  2P7J A;  3PBR A;  2Z6C A;  3T50 A;  1DP9 A;  4LRZ E;  2W3H A;  3PR6 A;  2ZBB A;  1ZHH B;  4KQD A;  4O0P A;  5HDD A;  1T1C A;  3KO6 A;  2KOI A;  4F3L A;  4G3W A;  3NOP C;  4L9E A;  5J7E A;  4YNR A;  1VHM A;  2KX6 A;  2YKF A;  3OBF A;  4P6Z M;  1NRJ A;  4BBU A;  2WKR A;  1NLZ A;  1XFQ A;  2ZMV A;  5TBM B;  1DP6 A;  3T4Q A;  3LR0 A;  1OPX A;  2A2L A;  4UEY A;  3FPV A;  4I38 A;  5AVF A;  1YKD A;  4CLC C;  3LUQ A;  4I5S A;  4Z1W A;  4G3K A;  3PBN A;  2D02 A;  4R6L A;  2PD7 A;  4DN0 A;  2VGL S;  3MQ0 A;  3VV4 A;  5DKK A;  2O0Y A;  1W63 M;  5HPF A;  5HWT A;  1UWN X;  5DFX A;  1ZTU A;  3H7W B;  2VKS A;  3KSG A;  3U2A A;  2OOL A;  3MXQ A;  3F1N B;  3PBQ A;  4CLC A;  2O99 A;  3NJA A;  4HIA A;  4R3A A;  3T4J A;  2K31 A;  2B18 A;  1F5M A;  1GSX A;  2MJ6 A;  2VJW A;  3LI9 A;  4WEL A;  4MN6 A;  3NHQ A;  2O9B A;  2EA9 A;  1OTB A;  1LSX A;  3PHY A;  3OCN A;  3R7W B;  1WA9 A;  3NOU C;  2JN7 A;  3KYZ A;  3UB9 A;  5FL3 A;  4OOM A;  4UQI M;  4HJ3 A;  1XFN A;  5I5L A;  3MJQ A;  4EXO A;  5KIZ A;  3EEA A;  4LLO B;  4XT2 B;  3ICY A;  3R4K A;  2M7U A;  3TW8 A;  3UB6 A;  2J3T D;  4BMW A;  5HDC A;  3DBA A;  2VGL M;  4ETX A;  4NXG A;  3V67 A;  4Y3I A;  3EGX C;  3MF0 A;  4JGR A;  2ZOI A;  2BAS A;  4ME4 A;  2KDK A;  4LPZ A;  1VB6 A;  3LR3 A;  1S4S A;  3K3C A;  5TBM A;  4K08 A;  3H82 A;  5G4Z A;  3T4O A;  1Y28 A;  1V9Y A;  3NOT C;  5CX7 A;  1IFQ A;  1DP8 A;  2HGV A;  3D3O A;  4HOI A;  4R38 A;  4H6J B;  3BW6 A;  1OT9 A;  2O9C A;  4ARZ A;  4WF0 A;  4EEU A;  2NUP C;  2GJ3 A;  2YKH A;  1XJ4 A;  1W63 Q;  3OC2 A;  5MC7 A;  5AJG A;  1H3Q A;  3D72 A;  2HJE A;  5IS1 A;  3CI6 A;  2VX8 A;  4WEJ A;  5L8M A;  2JHE A;  4MN5 A;  4Q0H A;  3LR5 A;  5DF9 A;  3BWL A;  3KSI A;  1EW0 A;  1MC0 A;  1T1A A;  3CAX A;  3F1N A;  2W27 A;  2J3W A;  4GS9 A;  4CLC B;  4KQO A;  1UGU A;  1STZ A;  3IS2 A;  3MFX A;  4BJP A;  3BQ8 A;  4EET B;  1D7E A;  4GLQ A;  5HL6 A;  4EES A;  3KX0 X;  4JGQ A;  2QWS A;  3H9W A;  4HJ4 A;  4NKP A;  1LSV A;  1LL8 A;  2V1A A;  3E4O A;  1G6O A;  3OCL A;  4L9G A;  4EER A;  3LIC A;  4CLC E;  2OAQ 1;  4MDZ A;  1MZU A;  1ODV A;  4XT2 A;  3IBR A;  4P6Z S;  3GEC A;  4L0L A;  5DFY A;  4AFI A;  3CUE C;  4IUK A;  1H8M A;  2DMW A;  4GJ4 A;  4GCZ A;  3P01 A;  2W3F A;  3ZYT A;  1TS6 A;  4YOF A;  5J4E A;  1D06 A;  4EQ1 A;  4LRX C;  3S7O A;  3FPW A;  4PAU A;  3ULF A;  1TS7 A;  1XJ6 A;  2PD8 A;  4B9O A;  2QKP A;  4HH3 A;  2JKT M;  3LFV A;  3FG8 A;  3H82 B;  3OOV A;  3ZQ5 A;  3UMD A;  1JNU A;  3VE3 A;  1P9W A;  3C38 A;  2HJ9 C;  4WUJ A;  4YWZ A;  1F98 A;  2H28 A;  2LB5 A;  4PHT A;  3TJZ C;  4FSF A;  4MN7 A;  4H6J A;  2QJ5 A;  5TJJ A;  3T4T A;  2ZOH A;  3SW1 A;  2JKT I;  1T19 A;  4ARZ B;  4I3J A;  2XA7 S;  3LIA A;  2R78 A;  3HJI A;  4LRY C;  3IBJ A;  3A0S A;  3BJN A;  3MQO A;  2V1B A;  4DJ3 A;  1GSV A;  2J80 A;  2QHK A;  1P97 A;  3KYQ A;  2QJ7 A;  2W1R A;  2L1M A;  4HP4 A;  2PT7 A;  1S1Z A;  3PBT A;  4NXF A;  5F69 A;  3PBO A;  4HNB A;  3K3D A;  4GS9 B;  3KSF A;  3HJK A;  3CLO A;  3IS2 B;  5KSH A;  4G3V A;  3T4K A;  3BY9 A;  2W0N A;  3BY8 A;  3UE6 A;  4PKY A;  2PR6 A;  2Y8H A;  4B93 A;  3P7N A;  2HV1 A;  3EEH A;  5HD3 A;  3BQA A;  3G6O A;  3F1P B;  3C8C A;  1T1B A;  2GX5 A;  5A8B A;  1OTD A;  2W3D A;  4JGO A;  1OJ5 A;  5F5Y A;  2XRO A;  2WKP A;  2QYB A;  5HPI A;  2P04 A;  3MR0 A;  4EW7 A;  5HWW A;  3T4L A;  4E04 A;  1S66 L;  1P9R A;  2V9A A;  3MMH A;  3B47 A;  3OLO A;  4HP9 A;  5HD5 A;  2XA7 M;  5AVE A;  2EWV A;  1YAX A;  2OAP 1;  4WN5 A;  2FZ0 A;  4KUO A;  4HJ6 A;  1LSW A;  3KSH A;  2VA0 A;  5F68 A;  5LBR A;  3LYX A;  4O8G A;  5DKL A;  1N9O A;  3PBS A;  2GNX A;  2W3G A;  3FC7 A;  4Q0J A;  4WL9 A;  3EQV A;  2VV8 A;  3LID A;  5J3W A;  5C5K A;  2HF6 A;  2M7V A;  5HZH A;  1BYW A;  4I39 A;  3UB8 A;  2G7U A;  2JKR M;  3JVV A;  3TE8 A;  3C30 A;  4GW9 A;  2INW A;  3B33 A;  3CUE A;  2D01 A;  4IHQ A;  3S7Q A;  4II7 A;  4PKY G;  3O5Y A;  4MMN A;  1TS8 A;  5IT5 A;  4GHI A;  2IA2 A;  1V9Z A;  3LI8 A;  3JVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...