3EESA

Structure of the rna pyrophosphohydrolase bdrpph
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
131
Chain Sequence
HWIPVVAGFLRKDGKILVGQRPENNSLAGQWEFPGGKIENGETPEEALARELNEELGIEAEVGELKLACTHSYGDVGILILFYEILYWKGEPRAKHHMMLEWIHPEELKHRNIPEANRKILHKIYKALGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable pyrophosphohydrolase
publication title Structure and Biological Function of the RNA Pyrophosphohydrolase BdRppH from Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus
molecule tags Hydrolase
total genus 32
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.6.1.-:
pdb deposition date 2008-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14815 NUDIX_4 NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3eesA00
2QJTA 5GHMA 2A8SA 3GWYA 3X0LA 1PUQA 2I8UA 3O6ZA 4YPHA 3R03A 3ID9A 5I8UA 3X0SA 4JZSA 4MPOA 3X0NA 5ANVA 3X0RA 3J7Ye 3F13A 1VC8A 1V8RA 1MR2A 3X0PA 3X0KA 1RRSA 3FJYA 2QKMB 1MQWA 1X84A 1KHZA 1VIQA 3DUPA 2RRKA 1X51A 1MK1A 4YPRA 1F3YA 2G74A 1G9QA 2PQVA 5GHOA 1TUMA 1SOIA 4S2XA 3OGAA 5DPKA 3GG6A 3MDGA 4JZTA 4NFWA 3A6TA 1PVFA 1XSCA 2YVNA 3GZ5A 3HHJA 4KYXA 1I9AA 1K26A 2W4EA 2VNQA 4HFQA 5FSLA 5DDGA 3FFUA 1XSAA 1PPVA 3X0QA 1NFSA 3I7VA 2YVOA 3QSJA 4C9XA 5BS6A 2B2KA 2B06A 3HYQA 1Q54A 2YYHA 3DKUA 2JVBA 4N1TA 5GHIA 5BONA 3GZ6A 2YVPA 3X0IA 5IW4A 1SU2A 1V8IA 3SMDA 3N77A 4DYWA 2DSCA 2VNPA 1V8MA 2XSQA 3FK9A 3I9XA 4ZG0A 2A8QA 5C7TA 4YOQA 4S2WA 2GT2A 3Q2TA 1PUSA 1R67A 1JKNA 3BM4A 1V8NA 5ANUA 3GRNA 5GHPA 3MCFA 1V8YA 2A6TA 5CFIA 1NQYA 2O5WA 2FKBA 3BAPA 3SONA 2DSBA 3A6VA 2PNYA 5FSNA 1QVJA 1NFZA 2GB5A 1IRYA 5GHQA 1MQEA 4N1UA 2A8PA 1PPXA 1V8VA 5ANWA 2AZWA 3E57A 3X0JA 3O61A 5CFJA 1KTGA 1XSBA 4IJXA 4NFXA 3MDIA 3BHOA 1SZ3A 3O52A 1RYAA 1PUNA 1V8LA 3RH7A 3A6UA 5DEQA 2I8TA 3ACAA 4S2VA 3GZ8A 1VK6A 2O5FA 5DD4A 5C7QA 1PPWA 5LPGA 1U20A 1SJYA 2I6KA 3ZR1A 1HX3A 3COUA 5IW5A 3A6SA 2R5WA 3EEUA 2ICJA 2DHOA 2O1CA 3H95A 3N9UA 3Q2SA 4V14A 1V8UA 1OW2A 4ILQA 1VCDA 3L85A 1NQZA 1V8SA 2DSDA 1G0SA 3I7UA 1MUTA 2J8QA 4ICKA 4KG3A 4JZVA 2FVVA 2G73A 1V8TA 2ICKA 2KDVA 3CNGA 3F6AA 5FSMA 5FSOA 3X0MA 5ISYA 1Q27A 3Q91A 2KDWA 1VRLA 1Q33A 3ZR0A 4S2YA 4HVYA 2CL3A 3WHWA 3P6YA 4C9WA 3EF5A 3MGMA 4KG4A 5ANSA 1MP2A 2DUKA 3U53A 4K6EA 5GHNA 3G0QA 5FSIA 3AC9A 5FSKA 4JZUA 2YVMA 4KTBA 1VIUA 2A8RA 3FCMA 1KT9A 1VHGA 3Q4IA 1VC9A 3FSPA 2GT4A 1HZTA 1K2EA 1VHZA 1X83A 2Q9PA 1JRKA 2QJOA 3KVHA 3Q93A 5GHJA 3EESA 2A8TA 1GA7A 3O8SA 1V8WA 5ANTA 2B0VA 5C8LA 3P5TA 5HZXA 1RRQA 3O69A 3X0OA 3EXQA 2FMLA 3SHDA 3Q1PA
chains in the Genus database with same CATH superfamily
2QJTA 5GHMA 2A8SA 3GWYA 3X0LA 1PUQA 2I8UA 3O6ZA 4YPHA 3R03A 3ID9A 5I8UA 3X0SA 4JZSA 4MPOA 3X0NA 5ANVA 3X0RA 3J7Ye 3F13A 1VC8A 1V8RA 1MR2A 3X0PA 3X0KA 1RRSA 3FJYA 2QKMB 1MQWA 1X84A 1KHZA 1VIQA 3DUPA 2RRKA 1X51A 1MK1A 4YPRA 1F3YA 2G74A 1G9QA 2PQVA 5GHOA 1TUMA 1SOIA 4S2XA 3OGAA 5DPKA 3GG6A 3MDGA 4JZTA 4NFWA 3A6TA 1PVFA 1XSCA 2YVNA 3GZ5A 3HHJA 4KYXA 1I9AA 1K26A 2W4EA 2VNQA 4HFQA 5FSLA 5DDGA 3FFUA 1XSAA 1PPVA 3X0QA 1NFSA 3I7VA 2YVOA 3QSJA 4J7GA 4C9XA 2B2KA 5BS6A 2B06A 3HYQA 1Q54A 2YYHA 3DKUA 2JVBA 4N1TA 5GHIA 5BONA 3GZ6A 2YVPA 3X0IA 5IW4A 1SU2A 1V8IA 3SMDA 3N77A 4DYWA 2DSCA 2VNPA 1V8MA 2XSQA 3FK9A 3I9XA 4ZG0A 2A8QA 5C7TA 4YOQA 4S2WA 2GT2A 3Q2TA 1PUSA 1R67A 1JKNA 3BM4A 1V8NA 5ANUA 3GRNA 5GHPA 3MCFA 1V8YA 2A6TA 5CFIA 1NQYA 2O5WA 2FKBA 3BAPA 3SONA 2DSBA 3A6VA 2PNYA 5FSNA 1QVJA 1NFZA 2GB5A 1IRYA 5GHQA 1MQEA 4N1UA 2A8PA 1PPXA 1V8VA 5ANWA 2AZWA 3E57A 3X0JA 3O61A 5CFJA 1KTGA 1XSBA 4IJXA 4NFXA 3MDIA 3BHOA 1SZ3A 3O52A 1RYAA 1PUNA 1V8LA 3RH7A 3A6UA 5DEQA 2I8TA 3ACAA 4J7HA 4S2VA 3GZ8A 1VK6A 2O5FA 5DD4A 5C7QA 1PPWA 5LPGA 1U20A 1SJYA 2I6KA 3ZR1A 1HX3A 3COUA 5IW5A 3A6SA 2R5WA 3EEUA 2ICJA 2DHOA 2O1CA 3H95A 3N9UA 3Q2SA 4V14A 1V8UA 1OW2A 4ILQA 1VCDA 3L85A 1NQZA 1V8SA 2DSDA 1G0SA 3I7UA 1MUTA 2J8QA 4ICKA 4KG3A 4JZVA 2FVVA 2G73A 1V8TA 2ICKA 2KDVA 2CZRA 3CNGA 3F6AA 5FSOA 5FSMA 3X0MA 5ISYA 1Q27A 3Q91A 2KDWA 1VRLA 1Q33A 3ZR0A 4S2YA 4HVYA 2CL3A 3WHWA 3P6YA 4C9WA 3EF5A 3MGMA 4KG4A 5ANSA 1MP2A 2DUKA 3U53A 4K6EA 5GHNA 3G0QA 5FSIA 3AC9A 5FSKA 4JZUA 2YVMA 4KTBA 1VIUA 2A8RA 3FCMA 1KT9A 1VHGA 3Q4IA 1VC9A 3FSPA 2GT4A 1HZTA 1K2EA 1VHZA 1X83A 2Q9PA 1JRKA 2QJOA 3KVHA 3Q93A 5GHJA 3EESA 2A8TA 1GA7A 3O8SA 1V8WA 5ANTA 2B0VA 5C8LA 3P5TA 5HZXA 1RRQA 3O69A 3X0OA 3EXQA 2FMLA 3SHDA 3Q1PA
chains in the Genus database with same CATH topology
2QJTA 5GHMA 2A8SA 3GWYA 3X0LA 1PUQA 2I8UA 3O6ZA 4YPHA 3R03A 3ID9A 5I8UA 3X0SA 4JZSA 4MPOA 3X0NA 5ANVA 3X0RA 3J7Ye 3F13A 1VC8A 1V8RA 1MR2A 3X0PA 3X0KA 1RRSA 3FJYA 2QKMB 1MQWA 1X84A 1KHZA 1VIQA 3DUPA 2RRKA 1X51A 1MK1A 4YPRA 1F3YA 2G74A 1G9QA 2PQVA 5GHOA 1TUMA 1SOIA 4S2XA 3OGAA 5DPKA 3GG6A 3MDGA 4JZTA 4NFWA 3A6TA 1PVFA 1XSCA 2YVNA 3GZ5A 3HHJA 4KYXA 1I9AA 1K26A 2W4EA 2VNQA 4HFQA 5FSLA 5DDGA 3FFUA 1XSAA 1PPVA 3X0QA 1NFSA 3I7VA 2YVOA 3QSJA 4J7GA 4C9XA 2B2KA 5BS6A 2B06A 3HYQA 1Q54A 2YYHA 3DKUA 2JVBA 4N1TA 5GHIA 5BONA 3GZ6A 2YVPA 3X0IA 5IW4A 1SU2A 1V8IA 3SMDA 3N77A 4DYWA 2DSCA 2VNPA 1V8MA 2XSQA 3FK9A 3I9XA 4ZG0A 2A8QA 5C7TA 4YOQA 4S2WA 2GT2A 3Q2TA 1PUSA 1R67A 1JKNA 3BM4A 1V8NA 5ANUA 3GRNA 5GHPA 3MCFA 1V8YA 2A6TA 5CFIA 1NQYA 2O5WA 2FKBA 3BAPA 3SONA 2DSBA 3A6VA 2PNYA 5FSNA 1QVJA 1NFZA 2GB5A 1IRYA 5GHQA 1MQEA 4N1UA 2A8PA 1PPXA 1V8VA 5ANWA 2AZWA 3E57A 3X0JA 3O61A 5CFJA 1KTGA 1XSBA 4IJXA 4NFXA 3MDIA 3BHOA 1SZ3A 3O52A 1RYAA 1PUNA 1V8LA 3RH7A 3A6UA 5DEQA 2I8TA 3ACAA 4J7HA 4S2VA 3GZ8A 1VK6A 2O5FA 5DD4A 5C7QA 1PPWA 5LPGA 1U20A 1SJYA 2I6KA 3ZR1A 1HX3A 3COUA 5IW5A 3A6SA 2R5WA 3EEUA 2ICJA 2DHOA 2O1CA 3H95A 3N9UA 3Q2SA 4V14A 1V8UA 1OW2A 4ILQA 1VCDA 3L85A 1NQZA 1V8SA 2DSDA 1G0SA 3I7UA 1MUTA 2J8QA 4ICKA 4KG3A 4JZVA 2FVVA 2G73A 1V8TA 2ICKA 2KDVA 2CZRA 3CNGA 3F6AA 5FSOA 5FSMA 3X0MA 5ISYA 1Q27A 3Q91A 2KDWA 1VRLA 1Q33A 3ZR0A 4S2YA 4HVYA 2CL3A 3WHWA 3P6YA 4C9WA 3EF5A 3MGMA 4KG4A 5ANSA 1MP2A 2DUKA 3U53A 4K6EA 5GHNA 3G0QA 5FSIA 3AC9A 5FSKA 4JZUA 2YVMA 4KTBA 1VIUA 2A8RA 3FCMA 1KT9A 1VHGA 3Q4IA 1VC9A 3FSPA 2GT4A 1HZTA 1K2EA 1VHZA 1X83A 2Q9PA 1JRKA 2QJOA 3KVHA 3Q93A 5GHJA 3EESA 2A8TA 1GA7A 3O8SA 1V8WA 5ANTA 2B0VA 5C8LA 3P5TA 5HZXA 1RRQA 3O69A 3X0OA 3EXQA 2FMLA 3SHDA 3Q1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJT A;  5GHM A;  2A8S A;  3GWY A;  3X0L A;  1PUQ A;  2I8U A;  3O6Z A;  4YPH A;  3R03 A;  3ID9 A;  5I8U A;  3X0S A;  4JZS A;  4MPO A;  3X0N A;  5ANV A;  3X0R A;  3J7Y e;  3F13 A;  1VC8 A;  1V8R A;  1MR2 A;  3X0P A;  3X0K A;  1RRS A;  3FJY A;  2QKM B;  1MQW A;  1X84 A;  1KHZ A;  1VIQ A;  3DUP A;  2RRK A;  1X51 A;  1MK1 A;  4YPR A;  1F3Y A;  2G74 A;  1G9Q A;  2PQV A;  5GHO A;  1TUM A;  1SOI A;  4S2X A;  3OGA A;  5DPK A;  3GG6 A;  3MDG A;  4JZT A;  4NFW A;  3A6T A;  1PVF A;  1XSC A;  2YVN A;  3GZ5 A;  3HHJ A;  4KYX A;  1I9A A;  1K26 A;  2W4E A;  2VNQ A;  4HFQ A;  5FSL A;  5DDG A;  3FFU A;  1XSA A;  1PPV A;  3X0Q A;  1NFS A;  3I7V A;  2YVO A;  3QSJ A;  4C9X A;  5BS6 A;  2B2K A;  2B06 A;  3HYQ A;  1Q54 A;  2YYH A;  3DKU A;  2JVB A;  4N1T A;  5GHI A;  5BON A;  3GZ6 A;  2YVP A;  3X0I A;  5IW4 A;  1SU2 A;  1V8I A;  3SMD A;  3N77 A;  4DYW A;  2DSC A;  2VNP A;  1V8M A;  2XSQ A;  3FK9 A;  3I9X A;  4ZG0 A;  2A8Q A;  5C7T A;  4YOQ A;  4S2W A;  2GT2 A;  3Q2T A;  1PUS A;  1R67 A;  1JKN A;  3BM4 A;  1V8N A;  5ANU A;  3GRN A;  5GHP A;  3MCF A;  1V8Y A;  2A6T A;  5CFI A;  1NQY A;  2O5W A;  2FKB A;  3BAP A;  3SON A;  2DSB A;  3A6V A;  2PNY A;  5FSN A;  1QVJ A;  1NFZ A;  2GB5 A;  1IRY A;  5GHQ A;  1MQE A;  4N1U A;  2A8P A;  1PPX A;  1V8V A;  5ANW A;  2AZW A;  3E57 A;  3X0J A;  3O61 A;  5CFJ A;  1KTG A;  1XSB A;  4IJX A;  4NFX A;  3MDI A;  3BHO A;  1SZ3 A;  3O52 A;  1RYA A;  1PUN A;  1V8L A;  3RH7 A;  3A6U A;  5DEQ A;  2I8T A;  3ACA A;  4S2V A;  3GZ8 A;  1VK6 A;  2O5F A;  5DD4 A;  5C7Q A;  1PPW A;  5LPG A;  1U20 A;  1SJY A;  2I6K A;  3ZR1 A;  1HX3 A;  3COU A;  5IW5 A;  3A6S A;  2R5W A;  3EEU A;  2ICJ A;  2DHO A;  2O1C A;  3H95 A;  3N9U A;  3Q2S A;  4V14 A;  1V8U A;  1OW2 A;  4ILQ A;  1VCD A;  3L85 A;  1NQZ A;  1V8S A;  2DSD A;  1G0S A;  3I7U A;  1MUT A;  2J8Q A;  4ICK A;  4KG3 A;  4JZV A;  2FVV A;  2G73 A;  1V8T A;  2ICK A;  2KDV A;  3CNG A;  3F6A A;  5FSM A;  5FSO A;  3X0M A;  5ISY A;  1Q27 A;  3Q91 A;  2KDW A;  1VRL A;  1Q33 A;  3ZR0 A;  4S2Y A;  4HVY A;  2CL3 A;  3WHW A;  3P6Y A;  4C9W A;  3EF5 A;  3MGM A;  4KG4 A;  5ANS A;  1MP2 A;  2DUK A;  3U53 A;  4K6E A;  5GHN A;  3G0Q A;  5FSI A;  3AC9 A;  5FSK A;  4JZU A;  2YVM A;  4KTB A;  1VIU A;  2A8R A;  3FCM A;  1KT9 A;  1VHG A;  3Q4I A;  1VC9 A;  3FSP A;  2GT4 A;  1HZT A;  1K2E A;  1VHZ A;  1X83 A;  2Q9P A;  1JRK A;  2QJO A;  3KVH A;  3Q93 A;  5GHJ A;  3EES A;  2A8T A;  1GA7 A;  3O8S A;  1V8W A;  5ANT A;  2B0V A;  5C8L A;  3P5T A;  5HZX A;  1RRQ A;  3O69 A;  3X0O A;  3EXQ A;  2FML A;  3SHD A;  3Q1P A; 
#chains in the Genus database with same CATH topology
 2QJT A;  5GHM A;  2A8S A;  3GWY A;  3X0L A;  1PUQ A;  2I8U A;  3O6Z A;  4YPH A;  3R03 A;  3ID9 A;  5I8U A;  3X0S A;  4JZS A;  4MPO A;  3X0N A;  5ANV A;  3X0R A;  3J7Y e;  3F13 A;  1VC8 A;  1V8R A;  1MR2 A;  3X0P A;  3X0K A;  1RRS A;  3FJY A;  2QKM B;  1MQW A;  1X84 A;  1KHZ A;  1VIQ A;  3DUP A;  2RRK A;  1X51 A;  1MK1 A;  4YPR A;  1F3Y A;  2G74 A;  1G9Q A;  2PQV A;  5GHO A;  1TUM A;  1SOI A;  4S2X A;  3OGA A;  5DPK A;  3GG6 A;  3MDG A;  4JZT A;  4NFW A;  3A6T A;  1PVF A;  1XSC A;  2YVN A;  3GZ5 A;  3HHJ A;  4KYX A;  1I9A A;  1K26 A;  2W4E A;  2VNQ A;  4HFQ A;  5FSL A;  5DDG A;  3FFU A;  1XSA A;  1PPV A;  3X0Q A;  1NFS A;  3I7V A;  2YVO A;  3QSJ A;  4J7G A;  4C9X A;  2B2K A;  5BS6 A;  2B06 A;  3HYQ A;  1Q54 A;  2YYH A;  3DKU A;  2JVB A;  4N1T A;  5GHI A;  5BON A;  3GZ6 A;  2YVP A;  3X0I A;  5IW4 A;  1SU2 A;  1V8I A;  3SMD A;  3N77 A;  4DYW A;  2DSC A;  2VNP A;  1V8M A;  2XSQ A;  3FK9 A;  3I9X A;  4ZG0 A;  2A8Q A;  5C7T A;  4YOQ A;  4S2W A;  2GT2 A;  3Q2T A;  1PUS A;  1R67 A;  1JKN A;  3BM4 A;  1V8N A;  5ANU A;  3GRN A;  5GHP A;  3MCF A;  1V8Y A;  2A6T A;  5CFI A;  1NQY A;  2O5W A;  2FKB A;  3BAP A;  3SON A;  2DSB A;  3A6V A;  2PNY A;  5FSN A;  1QVJ A;  1NFZ A;  2GB5 A;  1IRY A;  5GHQ A;  1MQE A;  4N1U A;  2A8P A;  1PPX A;  1V8V A;  5ANW A;  2AZW A;  3E57 A;  3X0J A;  3O61 A;  5CFJ A;  1KTG A;  1XSB A;  4IJX A;  4NFX A;  3MDI A;  3BHO A;  1SZ3 A;  3O52 A;  1RYA A;  1PUN A;  1V8L A;  3RH7 A;  3A6U A;  5DEQ A;  2I8T A;  3ACA A;  4J7H A;  4S2V A;  3GZ8 A;  1VK6 A;  2O5F A;  5DD4 A;  5C7Q A;  1PPW A;  5LPG A;  1U20 A;  1SJY A;  2I6K A;  3ZR1 A;  1HX3 A;  3COU A;  5IW5 A;  3A6S A;  2R5W A;  3EEU A;  2ICJ A;  2DHO A;  2O1C A;  3H95 A;  3N9U A;  3Q2S A;  4V14 A;  1V8U A;  1OW2 A;  4ILQ A;  1VCD A;  3L85 A;  1NQZ A;  1V8S A;  2DSD A;  1G0S A;  3I7U A;  1MUT A;  2J8Q A;  4ICK A;  4KG3 A;  4JZV A;  2FVV A;  2G73 A;  1V8T A;  2ICK A;  2KDV A;  2CZR A;  3CNG A;  3F6A A;  5FSO A;  5FSM A;  3X0M A;  5ISY A;  1Q27 A;  3Q91 A;  2KDW A;  1VRL A;  1Q33 A;  3ZR0 A;  4S2Y A;  4HVY A;  2CL3 A;  3WHW A;  3P6Y A;  4C9W A;  3EF5 A;  3MGM A;  4KG4 A;  5ANS A;  1MP2 A;  2DUK A;  3U53 A;  4K6E A;  5GHN A;  3G0Q A;  5FSI A;  3AC9 A;  5FSK A;  4JZU A;  2YVM A;  4KTB A;  1VIU A;  2A8R A;  3FCM A;  1KT9 A;  1VHG A;  3Q4I A;  1VC9 A;  3FSP A;  2GT4 A;  1HZT A;  1K2E A;  1VHZ A;  1X83 A;  2Q9P A;  1JRK A;  2QJO A;  3KVH A;  3Q93 A;  5GHJ A;  3EES A;  2A8T A;  1GA7 A;  3O8S A;  1V8W A;  5ANT A;  2B0V A;  5C8L A;  3P5T A;  5HZX A;  1RRQ A;  3O69 A;  3X0O A;  3EXQ A;  2FML A;  3SHD A;  3Q1P A; 
#chains in the Genus database with same CATH homology
 2QJT A;  5GHM A;  2A8S A;  3GWY A;  3X0L A;  1PUQ A;  2I8U A;  3O6Z A;  4YPH A;  3R03 A;  3ID9 A;  5I8U A;  3X0S A;  4JZS A;  4MPO A;  3X0N A;  5ANV A;  3X0R A;  3J7Y e;  3F13 A;  1VC8 A;  1V8R A;  1MR2 A;  3X0P A;  3X0K A;  1RRS A;  3FJY A;  2QKM B;  1MQW A;  1X84 A;  1KHZ A;  1VIQ A;  3DUP A;  2RRK A;  1X51 A;  1MK1 A;  4YPR A;  1F3Y A;  2G74 A;  1G9Q A;  2PQV A;  5GHO A;  1TUM A;  1SOI A;  4S2X A;  3OGA A;  5DPK A;  3GG6 A;  3MDG A;  4JZT A;  4NFW A;  3A6T A;  1PVF A;  1XSC A;  2YVN A;  3GZ5 A;  3HHJ A;  4KYX A;  1I9A A;  1K26 A;  2W4E A;  2VNQ A;  4HFQ A;  5FSL A;  5DDG A;  3FFU A;  1XSA A;  1PPV A;  3X0Q A;  1NFS A;  3I7V A;  2YVO A;  3QSJ A;  4J7G A;  4C9X A;  2B2K A;  5BS6 A;  2B06 A;  3HYQ A;  1Q54 A;  2YYH A;  3DKU A;  2JVB A;  4N1T A;  5GHI A;  5BON A;  3GZ6 A;  2YVP A;  3X0I A;  5IW4 A;  1SU2 A;  1V8I A;  3SMD A;  3N77 A;  4DYW A;  2DSC A;  2VNP A;  1V8M A;  2XSQ A;  3FK9 A;  3I9X A;  4ZG0 A;  2A8Q A;  5C7T A;  4YOQ A;  4S2W A;  2GT2 A;  3Q2T A;  1PUS A;  1R67 A;  1JKN A;  3BM4 A;  1V8N A;  5ANU A;  3GRN A;  5GHP A;  3MCF A;  1V8Y A;  2A6T A;  5CFI A;  1NQY A;  2O5W A;  2FKB A;  3BAP A;  3SON A;  2DSB A;  3A6V A;  2PNY A;  5FSN A;  1QVJ A;  1NFZ A;  2GB5 A;  1IRY A;  5GHQ A;  1MQE A;  4N1U A;  2A8P A;  1PPX A;  1V8V A;  5ANW A;  2AZW A;  3E57 A;  3X0J A;  3O61 A;  5CFJ A;  1KTG A;  1XSB A;  4IJX A;  4NFX A;  3MDI A;  3BHO A;  1SZ3 A;  3O52 A;  1RYA A;  1PUN A;  1V8L A;  3RH7 A;  3A6U A;  5DEQ A;  2I8T A;  3ACA A;  4J7H A;  4S2V A;  3GZ8 A;  1VK6 A;  2O5F A;  5DD4 A;  5C7Q A;  1PPW A;  5LPG A;  1U20 A;  1SJY A;  2I6K A;  3ZR1 A;  1HX3 A;  3COU A;  5IW5 A;  3A6S A;  2R5W A;  3EEU A;  2ICJ A;  2DHO A;  2O1C A;  3H95 A;  3N9U A;  3Q2S A;  4V14 A;  1V8U A;  1OW2 A;  4ILQ A;  1VCD A;  3L85 A;  1NQZ A;  1V8S A;  2DSD A;  1G0S A;  3I7U A;  1MUT A;  2J8Q A;  4ICK A;  4KG3 A;  4JZV A;  2FVV A;  2G73 A;  1V8T A;  2ICK A;  2KDV A;  2CZR A;  3CNG A;  3F6A A;  5FSO A;  5FSM A;  3X0M A;  5ISY A;  1Q27 A;  3Q91 A;  2KDW A;  1VRL A;  1Q33 A;  3ZR0 A;  4S2Y A;  4HVY A;  2CL3 A;  3WHW A;  3P6Y A;  4C9W A;  3EF5 A;  3MGM A;  4KG4 A;  5ANS A;  1MP2 A;  2DUK A;  3U53 A;  4K6E A;  5GHN A;  3G0Q A;  5FSI A;  3AC9 A;  5FSK A;  4JZU A;  2YVM A;  4KTB A;  1VIU A;  2A8R A;  3FCM A;  1KT9 A;  1VHG A;  3Q4I A;  1VC9 A;  3FSP A;  2GT4 A;  1HZT A;  1K2E A;  1VHZ A;  1X83 A;  2Q9P A;  1JRK A;  2QJO A;  3KVH A;  3Q93 A;  5GHJ A;  3EES A;  2A8T A;  1GA7 A;  3O8S A;  1V8W A;  5ANT A;  2B0V A;  5C8L A;  3P5T A;  5HZX A;  1RRQ A;  3O69 A;  3X0O A;  3EXQ A;  2FML A;  3SHD A;  3Q1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...