3EETA

Crystal structure of putative gntr-family transcriptional regulator
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
255
structure length
245
Chain Sequence
YFEQPAYLRVAGDLRKKIVDGSLPPHTRLPSQARIREEYGVSDTVALEARKVLMAEGLVEGRSGTYVRERPVPRRVARSGYRPSGATPFRQEQADGAVRGTWESHSEQAEASGAIAERLDIRPGERVMCTKYVFRDAGEVMMLSTSWEPLAVTGRTPVMLPEEGPVGGMGVVERMAAIDVIVDNVTEEVGARPGLAEELLTLGGVPGHVVLVIQRTYFASGRPVETADVVVPADRYRVAYHLPVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative GntR-family transcriptional regulator
publication title Crystal structure of putative GntR-family transcriptional regulator from Streptomyces avermitilis
rcsb
source organism Streptomyces avermitilis
molecule tags Transcription regulator
total genus 62
structure length 245
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
A PF07702 UTRA UTRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3eetA01
3.40.1410.10 Alpha Beta 3-Layer(aba) Sandwich Chorismate lyase Chorismate lyase-like 3eetA02
3TO7A 1T98A 1B4AA 2M87A 1TW2A 4ZYEA 3JSPA 2OAZA 2QLZA 3FZVA 4I2OA 2MLKA 5ED4A 3ZN1A 1R1TA 4FX0A 3MCZA 1SD4A 5LHGA 1SD7A 1DDNA 3HTSB 2VC0A 3KCCA 2YPRA 1S7OA 2F5CA 3DV8A 2IP2A 3B73A 4EJVA 3M9AA 1TQMA 1B9MA 5IT3A 1LNWA 3QU6A 3WTYC 2W85A 5DEQA 3CJNA 5L3EA 2Z9OA 3E6CC 1U5TC 1FX7A 1SD6A 3KP6A 4XBFA 2M5WA 4L0ZB 4YG2F 5JVTA 3TGNA 2EV6A 1O3TA 2XAJA 2JZYA 1MGTA 2B0LA 5HLHA 2VT3A 3BJAA 1HKTA 3BZ6A 4D0PA 3ZQ7A 3DQVC 2FNPA 3JAMK 2EFPA 2LSOA 1FW9A 2F5EA 3LQRA 5LHHA 3FHZA 5DD4A 1O7LA 1W5TA 2OZ6A 2HYGD 4EM0B 1YW7A 5HLGA 5E1XA 1MJ9A 2ZNYA 2C6YA 4GGGA 2JSCA 4KFCA 1ZRCA 4R1HA 1CF7A 5LEJA 2EFWA 1R5HA 1P4XA 1O57A 4LG0B 5K5QA 1PUEE 4EGYA 4L5JA 1ONVA 1G3SA 3N4MA 1XSVA 2O61A 5E1ZB 1LVAA 2A69F 1D3YA 1FP2A 2UXXA 3JW4A 1T0FA 4PZJA 4CHUA 5CVJA 2VT2A 4UV9A 2XV4S 3C18A 4UXNA 3IWFA 2BE5F 3SFZA 4OMZA 1U78A 2PBIA 1HSJA 3O6BB 4GYGA 3ZMDA 2Y48A 3HTUA 5E8GA 3L9FA 1SD5A 3RYRA 5DD8A 5E8IA 4BHBA 2COMA 4IRIA 1WSUA 4M9SA 5HS9A 3R4KA 4RGSA 3D5LA 3JAMZ 4I01A 1ZREA 2LNBA 1ZRDA 2GIVA 1FNNA 4KN4X 1HW1A 1W7PA 4QWQA 4MQ9F 4PGGA 3CTAA 5HDGA 3ZN0A 3E5XA 1U6GA 2HR3A 1FPQA 3QPHA 1RIOH 2CG4A 3BJ6A 3IKVA 3L00A 3LQQA 1HSTA 2EV5A 5LBQA 5TRDA 4RB2C 2XASA 2YR2A 1FYMA 3I53A 5D8KB 2NS0A 1FC3A 3TDZC 3M7GA 2IW5A 2HZTA 2KIUA 5CJ9A 2Z33A 3BY6A 2F2EA 5JFRA 1FLIA 5CVVA 4KT5C 4MGRA 1E2XA 4G9YA 3PQKA 4YFKF 4IVNA 3WGHA 2FA5A 1XLRA 4CGZA 1TW3A 5D5WB 4EJWA 4U0VA 4HF0A 2ZKZA 5TJJA 2L4AA 3DKWA 3RI4A 2L54A 3T1BA 1P4WA 3HUGA 5D5VB 1DPUA 4KICA 2RN7A 2IVMA 4LK0F 2A68F 3D0SA 2LKPA 2FF4A 2Z3YA 4N0BA 2KIMA 4G7HF 3HSEA 2ZMEA 2HKOA 1IN5A 3G3ZA 2BBYA 2L3DA 1G3YA 3CLOA 4WXHA 4ZSBA 5ICCA 2FOKA 3JTGA 2FSWA 2J5PA 4P55A 2TDXA 3WTUC 2MD5A 2V1DA 3NEUA 3FXRA 3F8NA 3RYPA 2HKXA 4Y15A 1BIBA 3HOTA 3BPXA 4OIRF 4MTDA 1BIAA 1T39A 2DQRA 2AS5F 2ADUA 2FE3A 1K79A 2XKPA 3F8CA 4S04A 4EQQA 1EH6A 5J8CA 4CXFA 1GHCA 1J59A 1ON2A 4UUVA 2OBPA 4N9HA 3F6OA 1KYWA 1KA8A 1ZARA 3V8JA 3WE2A 1LDDA 5LGUA 3BROA 1QQIA 5JHUA 4KIFA 1X3UA 4G7ZF 3GXOA 4RB0A 4DNCA 1XSXA 3LA3A 1H9GA 1REPC 1R7JA 3F6VA 1T2KA 1I6XA 1USTA 4LLLA 1KQ0A 3AAFA 3DXJF 5FB2A 3K1NA 1F5TA 1FSHA 4I02A 2DW4A 3GFJA 1HQCA 5FO5A 4RGXA 1W7PB 5L3CA 1H9TA 4HLXA 2J5OA 1K78B 3HIFA 1BBYA 4LGWA 5DDGA 4Y17A 3HSRA 2IPQX 1SAXA 4LK1F 1XN7A 4HV5A 5HDKA 1IUYA 2ZFWA 1YFHA 2IKKA 5KVRA 3FXUA 4MTEA 1UHWA 1OKRA 4KDPA 1ZG3A 3K9TA 1Z91A 4XSXF 3GO5A 2DT5A 4R79A 2KKOA 3I59B 2DBBA 4G6DA 4OINF 2RGVA 3ZMVA 3E97A 5F1RA 1ZGJA 4HX8A 1FYLA 3U1DA 3FM5A 3JTHA 4ZYGA 3CUOA 3V7RA 3P9KA 1U3EM 2Y75A 4OIPF 1HW2A 6PAXA 1MD0A 2XIGA 2O03A 3F8FA 3S2WA 2GAUA 5AIQA 3IRQA 4PCQA 2E7XA 3IKTA 4LG0A 5ICEA 3KEOA 3L7WA 4JBAA 4UVBA 2RC4A 1BJAA 5K5RA 1AWCA 2OQGA 4EMSA 3E6DA 3WTWC 3O3KA 2A6EF 2MH2A 1ZHFA 2HTJA 3KP7A 3V7SA 5BPDA 2QVOA 2H6CA 3E5QA 1KU3A 2VN2A 1WRJA 3O2PE 1J0RA 2F5FA 1V3FA 2ESNA 3EQLF 3I71A 3T0YA 2IT0A 5HOOA 4I0AA 2OU2A 2ZCWA 1ZGAA 5DCMA 3W6KB 4G94A 2VBWA 1QO0D 1F1ZA 2X0LA 2EFQA 1Z6TA 4B8XA 4M9XA 2XKOA 4G7OF 1S3JA 4RB1A 3H3ZA 3ERED 3HOSA 2Z99A 1RUOA 2EA2A 3Q9SA 1ULYA 5FFZA 3P9CA 3C7JA 2ISYA 2P8TA 3BOQA 1Y0UA 3H92A 1OYIA 5IT9K 4Y13A 4A12A 3SQNA 2GZWA 3R6SA 1MKMA 4UVAA 5BS6A 4OMYA 4GXOA 1USSA 5FLXK 1R00A 2CSOA 4EV0A 4U7BA 1KU7A 4OU0A 1KGSA 4PDKA 2R7DA 4ENNA 3T8TA 3WTZA 1MJAA 5DV5A 1H0MA 3K1PA 3T8RA 1PDNC 2P5LC 3QOPA 1E17A 2MLGA 3DDVA 5FGMA 3BP8A 1HKQA 4CICA 1ZG5A 1PP7U 4FHTA 2PLYA 1FT9A 2GA2A 2O0YA 3CO6C 3IWZA 4A5NA 4OIQF 1OR7A 1ZRFA 2H6BA 1PP8F 2DTRA 3WTTC 1IN7A 2FQ3A 3WTVC 4BXUA 1RUNA 5E20A 3MFKA 2IA1A 4Q5SF 4AVPA 2HYFA 3N97A 4ENMA 2CGPA 1UHMA 1JHHA 2VE9A 2D1VA 2CYYA 3OV8A 1GVJA 2L02A 1BC7C 1ON1A 2D1HA 3K0LA 3TQNA 1JD3A 4M6XA 5IT9Z 3KETA 1TNTA 4M72A 2O8XA 5KK1A 3EYYA 3GFLA 3HRSA 1U2WA 4LD5A 3NRVA 4HV6A 3ELKA 1ZLKA 2VONA 2WV0A 5FLXZ 1BI0A 2PI0A 4BYYA 2G7HA 4AD9A 3CUQC 3LAPA 5CVUA 1Z9CA 3L5ZA 1XMAA 5CYVA 2L4MA 4HAMA 1KU9A 4NQWA 1S6LA 2KIFA 4I0BA 5DCMB 1D8KA 1XGSA 1I5ZA 1KYZA 4HBLA 1I1SA 1TBXA 2YU3A 3L2CA 3C1DA 3CNVA 1O3QA 2KJBA 4WXCA 1QBJA 4ESJA 4FT8A 1QGPA 3VFZA 2W84A 2RA5A 1K78A 1C0WA 2A07F 2HDCA 3HYIA 1FSEA 2P6TA 4M74A 4WCGA 1WI9A 1G3TA 5D5UB 1T6SA 3GX4X 2HWVA 3QRFF 2FBIA 2QQAA 4ASNA 1R23A 5LLQA 1YS7A 5F64A 2A61A 3GEZA 1W5SA 3B02A 3MEXA 1RI7A 2QZ8A 4CDGA 1G1BA 4P9FA 4BQAA 2DK5A 3I59A 2BGCA 2V1UA 4EJUA 1FWZA 1QZYA 3TKYA 2M1BA 2WWYA 1J7KA 3QAHA 1FOKA 3ZPLA 3E6MA 1STZA 4ZZLA 2NRAC 1D5VA 1QNTA 5BMZA 3F22A 4ZYDA 1FBQA 4L5IA 2JRTA 4YIIA 3V8KA 4LLGF 4ENJA 2IJLA 4I98B 2R3SA 5EEHA 1Q1HA 4XSZF 4GYIA 3T5XA 4HOBA 2PJPA 3VODA 4HQEA 2E7WA 3BPVA 1IN6A 4BH9A 2A3SA 4GCVA 1L3LA 3ULQB 1SMTA 2GXGA 4HLYA 5CLSA 1I1GA 2F5DA 1YYVA 4IF4A 1NHAA 1GXQA 4ON0A 1SMYF 2XAQA 1YW9A 2NYXA 2OQRA 4XRFA 2ETHA 5L3FA 5ILVA 2V9VA 2ZBKA 2MC3A 3F8LA 3ZMZA 4S05A 2QM3A 2V1XA 2Q0OA 2UXNA 3GFIA 4NHJA 4WXDA 5DCFA 3MAJA 3WGGA 5ERIA 4HX4A 3TOBA 4ZH4F 3LFKA 3E3VA 2PG4A 4O3MA 4GO1A 4UNOA 1G81A 1IRFA 3FWEA 2DPDA 1D8JA 4ETSA 1T38A 3F8MA 1U5TB 3QP5A 1QZZA 2UWMA 3DP7A 1BM9A 4WF2A 4A2UA 2FA1A 3KP3A 4KN7X 4LJZF 3SHFA 3GW2A 3LA7A 1L0OC 1UB9A 2A5YB 2OA4A 2W24A 2A6HF 4KUMA 4LB5A 3ABTA 1MZBA 2D45A 1FZPB 1ZLJA 2BEOA 4KA4A 5HS7A 4P5OA 3FMRA 1WKMA 2HTSA 4TV7A 2K27A 1ZYRF 4LLNA 2MA3A 2PN6A 2G7UA 4EGZA 3RIRA 3IC7A 3V4GA 2HFHA 2LF8A 1UFMA 3GLXA 4Q4ZF 2JPBA 4KIGA 2H94A 1A04A 1OPCA 2KJCA 4P9UA 3RKXA 2HGCA 4MHGA 3TDUC 3F8BA 5K5OA 5ICGA 4BHCA 1OMIA 1XCVA 2O3FA 2CWEA 1YS6A 3RDIA 1XCBA 2DK8A 4UHTA 1GXPA 3I64A 3IHUA 2OGGA 3KP4A 2M45A 2PEXA 2ZJ2A 1KQ9A 2O6GE 4EJOA 3PFIA 1P4AA 3QU3A 2DO7A 2XROA 1S29A 2W57A 3DEUA 1FBUA 1KU2A 2HQRA 5ICFA 2AHCA 1B6AA 4UVCA 2WC2A 3G73A 1Z6RA 3J80Z 4HX7A 2OOIA 2XAGA 4JK1X 2NNYA 3ECHA 5H20A 2JPCA 3WU0A 1TQPA 2KRFA 3P9IA 3U9GA 2E1CA 5H6QA 1IRGA 2RNJA 1OYYA 3QPTA 2IA2A 4MEXF 4L9NA 3R61A 3WODF 3K69A 4HDUA 4HQMA 3NQOA 4G6QA 4UV8A 1B1BA 1ZN2A 4L0YB 2FEZA 2EK5A 3MWMA 4BAYA 2NWIA 1J2XA 4IJAA 2M30A 2PMHA 4HDVA 1IF1A 3KZYA 4L9TA 1Z05A 3DPLC 2DPUA 4WX9A 2VOPA 4HZFA 1R1UA 2PMUA 3WE3A 1P6RA 1MDMA 3P7NA 1BI3A 1LJ9A 1TNSA 2X4HA 4HW0A 3GZ5A 1XDUA 3U2RA 5F6FA 3ZP5A 4HF2A 2EV0A 1IN8A 5E17F 3F23A 3E6BA 4RAZA 2RDPA 1IN4A 3C3WA 2PQ8A 2HS5A 4M9ZA 3ABUA 1OYWA 3FF5A 3GYHX 2H09A 3LSTA 1FP1D 4U0WA 4ZYHA 1YO5C 1R22A 4Q48A 4OIOF 1ZH5A 5J8FA 1W4MA 5LGNA 1TTYA 3DFGA 2V6CA 4BHPA 1YLFA 2RQPA 1BI1A 5D4SA 1P92A 1J9IA 4F7ZA 4ESFA 1K6OA 4I09A 1TLHB 3ISPA 4NB5A 1IZ1A 4A6EA 3CO7C 3TO6A 4LFUA 5L3DA 3GVAA 2ELHA 3V7CA 1YQAA 5D4RA 4P96A 5JR3A 1B9NA 4KMUX 1AOYA 3FMQA 1XD7A 3HRUA 1O3RA 5E1WA 4RGUA 3IRRA 1XGMA 1DUXC 3LHEA 3EUHA 3BJOA 3SZPA 3RPUA 4M71A 2K4BA 2VOOA 3WTSC 1IW7F 1K7AA 2RV8A 4IHTA 1JE8A 1RNLA 3EYIA 2XVCA 2XAHA 3WTXC 2PKHA 1JHFA 3RPQA 3HRTA 2XHKA 4K2EA 1LDKB 2FBKA 4KIBA 5LHIA 4ZSKA 3ZMUA 3VB2A 3RJPA 2VODA 2GQQA 5LRRA 5BQTA 1I27A 2P6SA 5L3BA 3EETA 3ZMSA 3GWZA 5BOXA 2OD5A 5EEGA 1EH8A 2LDUA 5FFXA 1FBSA 3KP2A 3J81K 2GWRA 4MQVA 4ZSIA 1YG2A 2HEOA 2QUFA 1P2FA 2EA4A 2BV6A 1XDSA 4N9IA 2DI3A 2STTA 3RTRA 4E70A 2EFNA 2ACJA 4ENKA 1TQIA 1U5TA 1F4KA 4EVIA 4A0XA 1BN5A 2BYVE 1SFUA 2STWA 2VXZA 1YW8A 4CO8A 2HOEA 1UCRA 5LGTA 3I4PA 3I54A 3RKYA 3VOEA 4AIJA 5J6XA 1MDMB 4I7HA 4HYEA 5D6EA 1XMKA 3VEPA 3V8LA 1R5GA 1SFXA 1JGSA 4B09A 2CW0F 3I0TA 2QBYB 1TT8A 1W7PD 3OOPA 4IRGA 2R7FA 3GF2A 1S8NA 4ESBA 2GXBA 3ROUA 2XAFA 3DF8A 3EDPA 4U88A 5HLIA 2PFBA 3TOAA 1VTNC 1R36A 4EM1A 4JQFA 3FXQA 3KLNA 1ODDA 3ZMTA 5AIPA 3GZ6A 4M73A 4IRHA 1HW5A 2Q2EA 4RS8A 4RB3C 3R60A 4CZZA 1BOAA 2MBFA 1G6NA 2L01A 2YX7A 3H3UA 2Q8KA 3J81Z 2P5KA 5A2QK 2K02A 3R0AA 1Z1DA 4MEYF 2K7LA 1HKSA 2FU4A 5HS8A 4L18B 5K1YA 4YIFA 2P7CB 3MQ0A 2NAZA 3TO9A 5LEKA 3CUQA 3HRMA 3LWFA 3I58A 1R1VA 3K1MA 2M8EA 4CYDA 2ZXJA 1LEAA 5HDNA 4KNYA 2EB7A 2Y0MA 2Z5UA 1WQ2A 4YFXF 1FYKA 2OZUA 1IXRC 1WWXA 1ZG1A 5HVQC 3FM3A 5D5XB 2P5VA 2QWWA 1HXDA 3KZZA 1B59A 4O6JA 2QQBA 3Q5FA 3HHGA 4A0YA 2XUBA 1LEBA 1BI2A 4AIKA 2E1NA 5BPIA 2DAOA 4G8XA 3Q9VA 4Q47A 1YTYA 2H27A 5E18F 3ML6A 1CGPA 3GUDA 2QQ9A 3HHHA 1JXSA 2NNNA 2QENA 2FBHA 3F21A 2VBXA 3JSOA 4AIHA 5A2QZ 3FX3A 3LA2A 1CF7B 5DUKA 2CQKA 2WTEA 2FMLA 4PGHA 1RZ4A 4DQ2A 3FMSA 3REOA 1SFEA 2RKHA 4H0EA 4BNCA 3ECOA 2ZNZA 4KYWA 2XGXA 3QP6A 3J80K 1XSDA 4XLPF 2VBYA 4HA8A 5CVIA 4R8HA 3M8EA 4WWCA 3J7AO 3L09A 1XGNA 2MH9A 2FMYA 4WK8F 2FXAA 3BDDA 1U8RA 2V79A 3F3XA 2GA1A 1LB2A 2EWNA 4U7DA 4FX4A 1O7FA 1XGOA 2IA0A 2JTVA 3COAC 1HBXG 1V4RA 1QPMA 1DP7P 3M1EA 5ILSA 5AONA 4RGRA 1J5YA 5CVRA 3LAJA 5L3GA 3PQJA 1LDJA 4KMFA 2DLLA 1DPRA 5FD6A 2VC1A 1FY7A 2IRFG 3F72A 2P4WA 2DFIA 2XRNA 3HFIA 3GFMA 1O3SA 4EJTA 2EJRA 4A6DA 3R0JA 3CUQB 5ILUA 3KEQA 1F9NA 1ZAOA 4U0YA 3BWGA 5D6FA 5JI6A 2RVCA 2DQLA 1Z7UA 3KFWX 2LF7A 5LRSA 1IAWA 4IXAA 3MZYA 3IL2A 2P19A 4A5MA 2D2WA 4LMYA 1EH7A 5H6RA 2YX4A 1EV7A 2DU9A 3W6JB 1XB4A 1G4DA 4L9JA 4LB6B 5DUIA 2K86A 5FD5A 4OOIA 1YIOA 2YSRA 4RAYA 1MJBA 2ESHA 4L9VA 4MNUA 4ZZDA 5DYMA 4YFNF 4AWXB 3WGIA 3WU1B 1LQ1A 3E5UA 2HQNA 2VBZA 2ZMEB 2P7VB 3SXYA 2AXLA 3RKWA 3SZTA 4XLNF 3DPTA 1G3WA 5D8LB 1KQ8A 2ISZA 4QLCU 2CFXA 2G9WA 2FRHA 2EFOA 3KLOA 4M6YA 4IPAA 2K4JA 3WG9A 2QBYA 2W25A 2QYOA 3M8FA 2ZO4A 3CDHA 1S7AA 3KE2A 4Z2YA 3MZHA 4HF1A 4EM2A 2CO5A 3K2ZA 4O5VA 4IHSA 2VE8A 2UZKA 1J75A 1IXSB 3HSFA 1IXCA 3KP5A 3I5UA 2FNAA 1R58A 4A0ZA 2JT1A 1BC8C
chains in the Genus database with same CATH superfamily
3TO7A 1T98A 3CESA 4IO9F 3KZIC 1WJDA 1B4AA 2MC4A 2M87A 1TW2A 4ZYEA 4YELA 3JSPA 1QHHD 1R6RA 2OAZA 2QLZA 3FZVA 4BDZA 2MLKA 2XRLA 1ZQ3P 2H8RA 4I2OA 1MH4A 3JRIA 5ED4A 2R5YA 5J3LA 3ZN1A 1R1TA 2E5NA 3MCZA 4FX0A 1SD4A 3JREA 5LHGA 1SD7A 1XX5A 3KYDB 1DDNA 1WJ5A 3MKLA 1WJCA 3HTSB 2VC0A 3KCCA 2YPRA 1S7OA 2L5QA 2F5CA 1Z3YA 3DV8A 3AFHA 3CMAI 2RNGA 2X51A 3OYBA 2IP2A 3B73A 3I3LA 4EJVA 4PJ0C 4A3KJ 1Z21A 3M9AA 1TQMA 1B9MA 2JJ7A 1I3AA 4Y33A 1RETA 5IT3A 4KT6A 4RAFA 2ZC2A 1LNWA 4ZJZA 3QU6A 1DP3A 3WTYC 2W85A 5IYCJ 3H0DA 5DEQA 1Y8RB 3CJNA 5L3EA 2Z9OA 3E6CC 5K7HA 3CCLI 1OJLA 4F92B 1U5TC 1R4NB 1FX7A 2XF5A 1SD6A 1ORKA 3KP6A 3JRHA 3GTJJ 4XBFA 2M5WA 1EF4A 1JTXA 4L0ZB 4IEJA 4YG2F 5JVTA 3TGNA 4UB8C 5GTIC 2EV6A 4W97A 1VQ8I 1O3TA 1FTZA 2XAJA 2JZYA 3VYSB 4E7KA 1MGTA 2B0LA 5HLHA 5M3MJ 5JHFA 4BE1A 1Q1VA 5J4VA 1WGXA 2GOXB 2VT3A 3BJAA 3VPRA 4BDYA 1HKTA 4ZTJA 3LSRA 3BZ6A 5GAGJ 4A3FJ 1TT5B 3S1NJ 2BHZA 4D0PA 2FOWA 4A3LJ 3DEEA 3ZQ7A 3DQVC 1VQPI 5HODA 5EGOA 3K4NA 2EPFA 1E3PA 5J1RA 3HDDA 2FNPA 2MFZA 3JAMK 2EFPA 1SAUA 2LSOA 3S32A 1FW9A 2F5EA 1AA7A 3LQRA 1T95A 2L9RA 5LHHA 3FHZA 3JCUC 5DD4A 3LOCA 2LR8A 2RAEA 1O7LA 1RRJA 2V9KA 3W2AA 1X4PA 1W5TA 2OZ6A 2HYGD 3ERMA 3ZQGA 3SEZA 2MG4A 4EM0B 2VQHA 2EINH 1YW7A 1LFUP 2E2IJ 3HKZN 5HLGA 5E1XA 3K2AA 3SJMA 1MJ9A 2ZNYA 2C6YA 4GGGA 2JSCA 3OY9A 4KFCA 4XRMA 1ZRCA 4R1HA 1CF7A 2OUMA 5LEJA 2EFWA 1R5HA 1P4XA 2Y31A 1O57A 4LG0B 3IH4A 5K5QA 1YJNI 1PUEE 4EGYA 4BEHB 4L5JA 1ONVA 5DM7F 1K6YA 2ZXIA 2KIQA 1G3SA 1K4TA 3N4MA 1XSVA 2O61A 5E1ZB 1LVAA 3K4KA 2A69F 2KL4A 4XLHA 4J01A 1IRZA 1HCRA 1D3YA 1FP2A 2UXXA 5IYBJ 3DTEA 3JW4A 4HSTA 3TMOA 1T0FA 3A0BC 3ZRGA 3AG4H 5M5XJ 1N75A 4PZJA 4ZDLA 3GTGJ 4CHUA 5CVJA 2VT2A 3A1YA 4UV9A 4J00A 2XV4S 3C18A 2MABA 1QHGA 4UXNA 2X9DA 4DJAA 3DU6A 3IWFA 2BE5F 3LL7A 1R49A 1DGRM 4XLAA 5TISC 3SFZA 4OMZA 1U78A 1OCOH 2R0QC 2PBIA 1EA3A 1HSJA 3OIQA 3O6BB 4GYGA 3ZMDA 4J19A 2VL8A 2Y48A 3PIOF 1I3QJ 3HTUA 3BCBA 2KMUA 5E8GA 3L9FA 1SD5A 4HNUA 3FXLA 4QSHA 1RESA 3RYRA 5DD8A 3CCRI 5E8IA 4BHBA 2COMA 1LFPA 4IRIA 1WSUA 2VKEA 2VQGA 4M9SA 5HS9A 3QOEA 1MBHA 3H5NA 3R4KA 4BL0B 2V1NA 4RGSA 5M5YJ 1FIAA 3D5LA 3JAMZ 1X19A 4I01A 1ZREA 1SANA 2LNBA 4GFBA 2HOAA 4LIUA 3C2BA 2IEKA 1ZRDA 2GIVA 2WY8Q 1FNNA 4II3A 3F9KA 4KN4X 4M3BA 1HW1A 3DTKA 1W7PA 4QWQA 2VKVA 3OMYA 4MQ9F 4PGGA 1G2HA 1TL8A 3CTAA 5HDGA 3ZN0A 3E5XA 3IV5A 2K9LA 1U6GA 1UG0A 2HR3A 2R5YB 1FPQA 2EIKH 3OR2C 3QPHA 1RIOH 3BR3A 2CG4A 3BJ6A 3PUFA 2Z16A 3IKVA 3SFIA 1IG7A 3L00A 3CJTB 3LQQA 1HSTA 2EV5A 4XKCA 5LBQA 3H9JA 5TRDA 1WJBA 4RB2C 1WJAA 1IV8A 2CU7A 2XASA 2YR2A 4CA0A 4IZZA 2M0MA 4UY8I 1FYMA 3I53A 5D8KB 1YHQI 4N4OB 2IS6A 2NS0A 1FC3A 3TDZC 4F3QA 2Y9YA 3M7GA 5EG0A 2IW5A 3VDXA 2HZTA 2KIUA 5CJ9A 2Z33A 3BY6A 2HI3A 1RPWA 1FEXA 2F2EA 2M8GX 5IOYA 1MMGA 5JFRA 1FLIA 1XPXA 2E35A 2UUZA 4HSRA 5CVVA 2L2OA 4KT5C 4MGRA 2V7FA 1LE8A 1E2XA 4G9YA 1VQ7I 3PQKA 3PSFA 3CMMA 4YFKF 4IVNA 3WGHA 2FA5A 1P9QC 4DYRA 2XB5A 2KFDA 2VB6A 4XOTA 1XLRA 4CGZA 1TW3A 4CZCA 1OQYA 5D5WB 4EJWA 3S14J 4U0VA 4HF0A 4YRVA 2QA4I 2ZKZA 4RA2A 1IC8A 2R7OA 5TJJA 3LNQA 2L4AA 3DKWA 5EDNA 3RI4A 2L54A 3T1BA 1P4WA 3HUGA 5D5VB 2JA5J 4BQOA 1DPUA 2ME6A 4FASD 5JVGF 4KICA 2RN7A 2IVMA 4LK0F 2VPLA 3S1RJ 1D1AA 2A68F 3D0SA 4BBRJ 2M2EA 2LKPA 2CW8A 2FF4A 2Y0SN 2Z3YA 4NC8A 4N0BA 2KIMA 3LSPA 4G7HF 2V6EA 1IDZA 3KYLA 2I5UA 3PJRA 1ZK8A 4DOZA 5KAFC 3HSEA 2ZMEA 3L2VA 2HKOA 1IN5A 3GTMJ 3HM5A 1E3OC 3G3ZA 1FJLA 5K7ZA 2BBYA 2DA5A 1G3YA 1RR7A 2L3DA 5FKNA 3WU2C 4B43A 3CLOA 3AL0C 2MGQA 4WXHA 4D1QA 3KYCB 4ZSBA 3OYMA 5ICCA 1R4MB 2FOKA 2HVRA 2WV1A 3JTGA 2FSWA 2J5PA 3P5JA 4P55A 2TDXA 1X1BA 3WTUC 2MD5A 2DJIA 2V1DA 3NEUA 1BR4A 3FXRA 3F8NA 3RYPA 2HKXA 3CCEI 1T33A 3GTLJ 4Y15A 1BIBA 2MD0A 3MKZA 3HOTA 3BPXA 4OIRF 2DT6A 4MTDA 4EATA 4PJJA 1BIAA 2NVQJ 1T39A 2KZVA 2DQRA 9ANTA 2LMDA 2AS5F 2ADUA 2FE3A 1U9OA 2DODA 3MMYB 3L2UA 1K79A 3S15J 5C44J 2XKPA 3CCUI 3F8CA 4S04A 3G71I 1YRNB 3RKQA 3CCYA 3BG3A 4EQQA 1EH6A 5J8CA 1PUFA 3GBGA 4CXFA 2BY2A 1SFKA 1GHCA 1J59A 1ON2A 4UUVA 2OBPA 4N9HA 2LG4A 3F6OA 1KYWA 1KA8A 3QWLA 1ZARA 3V8JA 3WE2A 1LDDA 2QSFX 5LGUA 3BROA 4PUSA 4QIWN 1QQIA 5JHUA 1ETYA 2DFHA 3BG7A 4KIFA 1X3UA 4NQWB 2FUG2 3BR0A 5E3MA 4G7ZF 3I4NJ 3GXOA 4RB0A 1AKHB 4DNCA 3DBLB 4E7HA 2XF7A 1X3ZB 1XSXA 3IUOA 1AHDP 3LA3A 1H9GA 1REPC 3A0HC 1D0YA 1R7JA 3F6VA 1T2KA 3HOXJ 2EZKA 2NS8A 2AQEA 1I6XA 1USTA 4LLLA 1KQ0A 4BKXA 3AAFA 3DXJF 1P7IA 5FB2A 3EUAA 3K1NA 1UELB 1F5TA 1FSHA 3MZ8A 1TT0A 4I02A 2DW4A 3GFJA 4CCNA 1HQCA 5IP6A 2D5VA 5FO5A 4RGXA 1TP4A 1V54H 1W7PB 5L3CA 1H9TA 2IGKA 2KHMA 4HLXA 1WVRA 2J5OA 4XN0A 1K78B 4XONA 3HIFA 1BBYA 2O7OA 2NS7A 2HOSA 3HOYJ 2M9HA 4NDLA 4LGWA 3DLLF 1UMQA 2K85A 1AU7A 3AG1H 3CCJI 1XS9A 5DDGA 4Y17A 2E1MC 2M7AA 3HSRA 2IPQX 1SAXA 2E19A 4LK1F 1XN7A 3KX2A 1WPKA 2JMWA 2MW8A 4G12A 2IGOA 4HV5A 4AYBN 5HDKA 1IUYA 2ZFWA 2EIMH 4XORA 1YFHA 2IKKA 3RZOJ 1V5EA 3OL3A 5KVRA 5KNLA 1Z3XA 3FXUA 2F6CA 1MSEC 4MTEA 1UHWA 5FKOA 4ZDPA 1OKRA 1H88C 1S9HA 4PK4A 4KDPA 3A02A 1ZG3A 3K9TA 1Z91A 3HKZA 4XSXF 3A4CA 3GO5A 2DT5A 4R79A 2KKOA 3I59B 3S17J 4D5FA 2DBBA 4G6DA 1JKPC 4OINF 4C30A 1DQUA 3QYBA 2RGVA 2ZJRF 3ZMVA 1XC5A 3E97A 1ZGJA 4HX8A 5F1RA 1FYLA 3OYFA 3U1DA 1KZHA 3FM5A 3JTHA 2VXDA 4ZYGA 3CUOA 2BW3B 1ETQA 2RREA 1S5LC 3V7RA 4A69C 4E7LA 3P9KA 2DMNA 2DDBA 3GTQJ 3JRAA 1IO2A 1U3EM 2WA0A 4LOCA 3G1LA 2Y75A 4OIPF 4E4HA 1HW2A 6PAXA 1MD0A 2IXSA 2XIGA 2O03A 1DU6A 3F8FA 2E2HJ 5K7FA 2Q1ZB 3S2WA 2GAUA 3DEWA 5AIQA 1RC9A 2JA2A 4IOAF 1W36C 3IRQA 3BR6A 4PCQA 2EZLA 2FJ1A 2E7XA 3IKTA 2QF7A 2DFFA 4LG0A 5ICEA 4BEHA 1W0TA 1WCMJ 1ACIA 2R7RA 3KEOA 3TP3A 3J7ZI 4UB6C 2GBYA 4D5CA 3DU5A 3L7WA 4JBAA 5M3FJ 5B1AH 2W4SA 4C3JJ 3S3OA 4UVBA 2RC4A 1BJAA 5K5RA 1AWCA 2OQGA 4EMSA 3E6DA 2LKXA 3WTWC 2ZJPF 3O3KA 3Q0VA 2A6EF 1W5CC 1JUSA 2MH2A 3TL4X 1ZHFA 2HTJA 3KP7A 2KISA 3V7SA 5BPDA 2QVOA 2H6CA 3A03A 2B9SA 3E5QA 1KU3A 2DOEA 3CMEI 2MYSA 4C2TA 2VN2A 2XAUA 1WRJA 3O2PE 5M5WJ 1VF9A 3DWLE 1T56A 3QPLA 1J0RA 2F5FA 1V3FA 3QPSA 2VQCA 1TWFJ 2ESNA 3EQLF 3I71A 3T0YA 2JSPA 2IT0A 5E3OA 5HOOA 4I0AA 2OC6A 2OU2A 3ZQHA 1ERDA 2N8GA 2ZCWA 3L2RA 1ZGAA 5DCMA 2DMPA 2K9NA 4G94A 3W6KB 2VBWA 1QO0D 3RSNA 3AG3H 3ZCOA 1F1ZA 5GPCA 1JI8A 3BG6A 2X0LA 2EFQA 1Z6TA 4B8XA 1HC8A 4M9XA 2XKOA 4G7OF 1D1BA 1S3JA 3ZR8X 1OCCH 4RB1A 3H3ZA 4EEFG 3ERED 1MMNA 3HOSA 1VQ6I 3W6VA 1MMDA 2Z99A 3BQYA 1FMWA 2M0CA 3H35A 1RUOA 2EA2A 3Q9SA 1ULYA 5FFZA 1B8IB 5FLVA 2ZXHA 4Z6YA 3P9CA 3C7JA 2ISYA 3EPZA 1W36D 2P8TA 3TBIA 1Y0NA 4E7IA 3BOQA 1CQTA 4BQNA 1Y0UA 4UUTA 3O8GA 2EQRA 3TP0A 3IAS2 2VUMJ 3H92A 1OYIA 2ICWG 5IT9K 4Y13A 4A12A 3SQNA 1JGGA 2XDVA 1X2NA 2GZWA 1O4XA 3R6SA 4A3IJ 2ECBA 4A3JJ 1K61A 3BTJA 5E79C 4XQFA 1MNDA 4XOPA 3CCQI 1GUUA 1MKMA 4XKVA 2V9PA 1VQKI 4UVAA 3KIOA 5BS6A 1G8XA 4I76A 4XLCA 4HNTA 2GM4A 4BQQA 4OMYA 3LSKA 4GXOA 1YX5A 2HYJA 1ITYA 1USSA 2EZIA 2X1EA 4AC0A 1JJ8C 5FLXK 1UJ8A 1R00A 2CSOA 4EV0A 1IRXA 4U7BA 1N25A 1KU7A 4OU0A 3LSJA 4KITB 1KGSA 2QSHX 4PDKA 2R7DA 4IOCF 2K9QA 3OOUA 3RPUD 1A5JA 3JRBA 1WHUA 2NVUB 4ENNA 3T8TA 2AQFA 1MNMC 3WTZA 3G4SI 1MJAA 3AG2H 5DV5A 1H0MA 3LSHA 2R7UA 3K1PA 3T8RA 1MW7A 2R7QA 1PDNC 2P5LC 1Y6IA 3QOPA 1E17A 3ASOH 2FX0A 1WJEA 2EZHA 2MLGA 3CJRB 3B6AA 3DDVA 5FGMA 1T0FC 3BP8A 1U8BA 1HKQA 3JRCA 2Y0SA 4CICA 1ZG5A 2JA6J 1W0UA 4DYQA 1PP7U 4FHTA 2PLYA 1FT9A 2GA2A 2O0YA 2QEXI 3CO6C 2JRMA 3IWZA 4A5NA 2DTZA 1U9NA 3PNVA 4OIQF 1OR7A 1WI3A 4RDUA 1ZRFA 5IPAA 3SDGA 3LSMA 2L9VA 3KEYA 2H6BA 3HC7A 1LUJB 1LKXA 2DTRA 1UZCA 4V2GA 1PP8F 1IN7A 2FQ3A 4CCOA 3WTVC 3WTTC 4BXUA 3LFUA 3VYTB 4RAGA 1TWHJ 2ECCA 3ZQQA 2X48A 1D0ZA 4Y3OA 1RUNA 5E20A 3W3CA 2LD5A 4C3HJ 1GV2A 3MFKA 4IX7A 3BTLA 2IA1A 1MSFC 4Q5SF 5FKLA 4AVPA 2L9SA 2HYFA 3N97A 1OCTC 5J4YA 4ENMA 1APLC 5DS9A 2CGPA 1ETKA 1UHMA 4AUXA 1JHHA 2VE9A 2D1VA 2CYYA 3H0GJ 3OV8A 1GVJA 3S2DJ 2L02A 1BC7C 1ON1A 2D1HA 3HJEA 3K0LA 3TQNA 1JD3A 4M6XA 2BVLA 2PX9A 2DYRH 3SEQA 2E34A 4XRSG 5IT9Z 1MNEA 4CYCB 5CQEA 4IL6C 4CH7A 3KETA 4IKFA 4Y52J 1TNTA 3CCVI 4M72A 2VJ5A 3WHCA 1OCPA 2YU9J 2O8XA 1MBJA 5KK1A 3EYYA 3GFLA 3HRSA 1U2WA 4LD5A 2QGUA 5TGTA 3NRVA 4HV6A 1UG2A 3ELKA 1ZLKA 2B7EA 1W1WE 2GXAA 1E3HA 1I6HJ 2VONA 3GTPJ 2WV0A 3AKZA 5FLXZ 1BI0A 3S3MA 2IS1A 3N05A 3FK6A 3K7AJ 2PI0A 4BYYA 2G7HA 2KLOA 1MBKA 2Y69H 4AD9A 3CUQC 1ETOA 1D0XA 1YRNA 2HXIA 3LAPA 3OL4A 2X6XA 4W1UA 5CVUA 1Z9CA 1NTCA 3L5ZA 1XMAA 5CYVA 2L0KA 1JTYA 2L4MA 2LVSA 2KRHA 2DJNA 4HAMA 1BOBA 1KU9A 4NQWA 5FRMA 2F48A 1S6LA 2KIFA 2OTLI 4I0BA 5DCMB 1D8KA 1XGSA 1AKHA 4I99C 1I5ZA 1KYZA 1X2MA 4U87A 4HBLA 3ESWB 2X6OA 5F0CA 3TW7A 2DDAA 1I50J 1Y39A 1I1SA 1TBXA 4X0GA 2YU3A 2W48A 2L7MP 3L2CA 3C1DA 3CNVA 4DBRA 2HDDA 1O3QA 4LG3A 2KJBA 4IQJA 4WXCA 3OYLA 2ZSIB 1QBJA 4ESJA 4FT8A 1QGPA 4F52A 2Y2ZA 3VFZA 4AYBA 1IDYA 2QQ8A 4Y4RA 2W84A 2RA5A 4UUSB 1K78A 2DOAA 4N4NB 5KCMA 1C0WA 1UHSA 5F27A 3FK7A 4XN3A 5FJ8J 2ZMEC 2BXZA 2LY2A 2A07F 4BBSJ 2HDCA 2R7ZJ 3HYIA 1FSEA 2X6YA 2P6TA 4M74A 3I56I 4WCGA 1WI9A 1SC7A 1G3TA 1PYVA 3QYEA 1T6SA 5D5UB 3GX4X 2HWVA 1HDPA 3QRFF 2FBIA 2VI6A 2QQAA 4ASNA 1R23A 1FOXA 5LLQA 5EJCA 1YS7A 2HVQA 3HOWJ 5F64A 2A61A 3GEZA 1W5SA 2MSYA 5KAIC 3B02A 3MEXA 1RI7A 2QZ8A 4CDGA 3DBRB 1BL0A 5IY5H 1G1BA 4P9FA 4BQAA 2QCOA 3VSLA 3K70C 2DK5A 3I59A 1A31A 3U21A 2BGCA 2HPIA 1Z77A 2V1UA 4EJUA 1FWZA 2IBDA 3RZDJ 1QZYA 5GAHJ 2ZB9A 3TKYA 2M1BA 2WWYA 1J7KA 3QAHA 1FOKA 1QVUA 4A3MJ 2BW3A 3ZPLA 2E1OA 3E6MA 1STZA 2PMZN 4L5EA 1RKWA 5DTDA 4ZZLA 4XNFA 2NRAC 1D5VA 1QNTA 2CW7A 5BMZA 1FBQA 4L5IA 4YIIA 4ZYDA 2JRTA 3F22A 3V8KA 4LLGF 4ENJA 2IJLA 4Y7NJ 3CD6I 4I98B 3CJQB 2R3SA 2ELKA 2OPTA 5EEHA 1Q1HA 4E6KG 5IP9J 4XSZF 1F43A 2L7KA 4GYIA 2BY1A 3T5XA 4RLQA 1Y8QB 1X58A 3QODA 4HOBA 1XG1A 2AXTC 2PJPA 3HOUJ 3VODA 4HQEA 2E7WA 1F36A 1IN6A 3BPVA 4BH9A 2A3SA 4GCVA 5IP7J 1L3LA 3A2KA 4XLEA 3ULQB 1SMTA 3OYEA 2GXGA 4HLYA 3L2WA 4GDFA 5CLSA 1I1GA 3OS2A 3HOVJ 2F5DA 1YYVA 4IF4A 3BR5A 2EBIA 1NHAA 1ZKGA 3I9V2 2IAIA 1FOWA 1GXQA 3GZNB 4ON0A 2CQQA 3RQ4A 4FTHA 4B44A 1SMYF 2XAQA 1YW9A 2NYXA 3FXJA 1P7JA 2OQRA 2VJJA 2ETHA 4XRFA 5L3FA 4HNVA 5ILVA 4BE0A 2V9VA 2NVXJ 1SEUA 2ZBKA 2OTJI 3JRFA 2MC3A 2ZJQF 2L7FP 3F8LA 3ZMZA 2K5CA 4S05A 1BW5A 1WH5A 3PNYA 1Y1VJ 2QM3A 3HG9A 1KONA 2V1XA 2Q0OA 3K70D 2UXNA 3O8HA 3GFIA 1VQOI 4NHJA 3DKYA 4WXDA 5DCFA 1NG7A 1VZ0A 3MAJA 3ASNH 3BTIA 3WGGA 4B3AA 5ERIA 2ME0A 4HX4A 3TOBA 2E71A 4ZH4F 1A6QA 1VQ4I 5J47A 3LFKA 4BUPA 5FKMA 3E3VA 2PG4A 5CKTA 4O3MA 4GO1A 4UNOA 1G81A 1IRFA 3HXLA 2LRDA 3FWEA 2KQRA 2DPDA 2H1KA 3H9GA 5LD2C 4ETSA 1T38A 1B8IA 1D8JA 4ITVA 3F8MA 3HZJA 3BZCA 3CCMI 3HB9A 1U5TB 1DU0A 1VQ9I 3QP5A 1QZZA 2UWMA 2XPUA 3DP7A 1BM9A 2LC2A 4WF2A 3H5RA 3ABMH 4BY7J 2BY3A 4A2UA 2FA1A 3KP3A 4KN7X 4LJZF 4MIMA 1TWCJ 2O5RA 2Z2SB 4IQ4A 3SHFA 3GW2A 3LA7A 1L0OC 3H36A 2JVGA 1UB9A 2A5YB 3K4CA 2OA4A 2W24A 1NK3P 2A6HF 2LY9A 1OLTA 3Q0UA 4KUMA 5EYRA 4LB5A 3GTKJ 2DMQA 3ABTA 1D1CA 1MZBA 2D45A 1FZPB 1ZLJA 4RM3A 1K4SA 2LYCA 2BEOA 4KA4A 5HS7A 4P5OA 3FMRA 1WKMA 5EZGA 2LK2A 2HTSA 4TV7A 2K27A 1ZYRF 4LLNA 4MFDA 3VSKA 2MA3A 2PN6A 4YEJA 4MO7A 3MD2A 2G7UA 4EGZA 5B66C 3Q0WA 3RIRA 2RQQA 3IC7A 1A36A 5JLWA 3V4GA 4M3GA 2HFHA 2LF8A 1QVTA 1UFMA 4NC7A 2L9NA 2W1OA 3C2GA 3A01B 3GLXA 1YX3A 3WHBA 2WAQN 3NWTA 2JK3A 2NOGA 4Q4ZF 2JPBA 2F4MB 4KIGA 5GAEJ 3OIPA 2H94A 3G1OA 2XC7A 1MH3A 1J09A 1A04A 1OPCA 2E36A 2KJCA 2JUGA 3SYTA 2Q2EB 2CS3A 4P9UA 3NAUA 3RKXA 2HGCA 4MHGA 3TDUC 3F8BA 1MIJA 5K5OA 5ICGA 1NH3A 1A35A 2IGNA 2DA6A 2QSGX 3ZXSA 2A5WA 2XSJC 1K83J 4BHCA 1OMIA 3DCFA 1XCVA 2O3FA 2CWEA 3MN2A 1YS6A 1H89C 2ZSHB 3RDIA 1XCBA 2DK8A 1JT6A 3OYCA 4UHTA 1GXPA 3BCAA 3I64A 3PO3J 3IHUA 2IS4A 2OGGA 2X1CA 3KP4A 4ZC3A 5GP9A 3FXMA 1HOMA 2M45A 2HQ5A 2PEXA 2ZJ2A 3ZGKA 1KQ9A 3D1NI 2O6GE 4EJOA 4XICA 3PFIA 1P4AA 4HPQA 3QU3A 2DO7A 2XROA 1S29A 2W57A 3ZOBA 3DEUA 1FBUA 1KU2A 3GCMA 2HQRA 3BQZA 4CYCA 5ICFA 3QQAA 3W2WA 2LTPA 2AHCA 1B6AA 1GLNA 4UVCA 2WC2A 3G73A 1Z6RA 3BR2A 3J80Z 2KDZA 2CQ7A 4HX7A 3RCOA 2OOIA 2XAGA 4DIQA 3LSIA 4JK1X 2NNYA 3ECHA 2R7TA 2HDWA 5H20A 4DGWB 2JPCA 3WU0A 3FHNA 1TQPA 2KRFA 2XGCA 3P9IA 3U9GA 3HBLA 2E1CA 1N78A 5H6QA 1IRGA 2A05A 2RNJA 1OYYA 4XR6A 3QPTA 2IA2A 3H3VK 4MEXF 3F0CA 4L9NA 2LREA 3R61A 3WODF 1G59A 2R7WA 1WH7A 3K69A 2F4OB 4HDUA 4HQMA 3NQOA 4G6QA 4UV8A 1MBEA 1B1BA 1ZN2A 2KZGA 4L0YB 1YITI 2FEZA 2EK5A 3MWMA 4BAYA 2NWIA 1J2XA 4IJAA 2M30A 2PMHA 4HDVA 1IF1A 4A3GJ 3KZYA 4L9TA 3IH2A 5HLTA 2E5ZA 1Z05A 4AU7A 3DPLC 2DPUA 4WX9A 5GADJ 2VOPA 4HZFA 3IH3A 3OSFA 1R1UA 2PMUA 3WE3A 4C9YA 1P6RA 1MDMA 4FISA 4CUGA 1Z7LA 3P7NA 4BJTA 1BI3A 1LJ9A 3HEFA 3HL2A 1TNSA 1ENHA 2X4HA 4HW0A 1GDTA 3GZ5A 1XDUA 1XTAA 4II2A 1OR7C 2CMPA 2DN0A 2X1DA 1IV6A 3U2RA 4CCLA 5F6FA 3ZP5A 4HF2A 3PO2J 2EV0A 2CV2A 1IN8A 2BVMA 3MKWB 5E17F 3F23A 3E6BA 4RAZA 4AIDA 2LY1A 1JUMA 2CH0A 2RDPA 1IN4A 2BHYA 3OYHA 3C3WA 3W2VA 2PQ8A 4JX4A 4UUSA 3OS1A 2HS5A 4M9ZA 3ABUA 2DMUA 1OYWA 3FF5A 3GYHX 2H09A 3CC4I 3LSTA 4IHWA 1FP1D 4U0WA 4ZYHA 4JYKA 5KHDA 3HGYA 3FKIJ 1YO5C 4FETA 3PIPF 3OYKA 3Q3SA 1R22A 4Q48A 1HDDC 2GIZA 4OIOF 3BG9A 1ZH5A 5J8FA 1OFCX 1W4MA 2F5VA 5LGNA 2OV7A 2R5ZA 1QRYA 1TTYA 2CQNA 3DFGA 2WB1N 2LLKA 2V6CA 4BHPA 1ZELA 2KDOA 3UKGA 1YLFA 2RQPA 1BI1A 5D4SA 1P92A 1J9IA 2PMZA 1U0JA 4PSWA 4F7ZA 2NVYJ 1TWGJ 4ESFA 1R9TJ 1K6OA 4I09A 1GVDA 3ZQFA 1B72B 1VI0A 5C4JJ 1TLHB 3ISPA 4NB5A 4JOMA 4BXXJ 1IZ1A 4A6EA 4C3IJ 2CFOA 5F0FA 3S8PA 3CO7C 3TO6A 4LFUA 5L3DA 3GVAA 2ELHA 4XKBA 3CQZJ 3RQIA 3ZQLA 3V7CA 1YQAA 5D4RA 5F04A 4P96A 5JR3A 2NOJB 5B5EC 2M4GA 2ZFUA 2HPMA 1XMXA 2YS9A 2V26A 1B9NA 3PFYA 4V19K 3AL0B 4KMUX 1AOYA 4RM2A 3BTCA 4KJZA 2WAEA 3FMQA 1MMAA 1XD7A 5GPAA 3X2QH 2EH3A 3HRUA 1O3RA 2KT0A 2ELJA 2XPVA 1SVOA 5E1WA 2AO9A 2H8WA 3ABKH 2LH9A 4RGUA 3IRRA 2DA3A 1XGMA 1DUXC 3LHEA 2TCTA 3EUHA 3BJOA 3SZPA 3RPUA 4M71A 4PFOA 2K4BA 1NK2P 2DFEA 3OWTA 3M8JA 2O9LA 2VOOA 5FROA 3WTSC 3JRDA 1IW7F 5J1UA 1K7AA 2M3AA 2RV8A 4IHTA 1JE8A 1EJ9A 1SFOJ 1RNLA 1S7EA 3EYIA 2XSDC 4IHVA 1EKEA 2XVCA 2XAHA 1R5ID 1N77A 3E0JB 1ETVA 4B3XA 4PFPA 4QPOA 3WTXC 3E7LA 2PKHA 1BA5A 4RBOA 3VYUB 1JHFA 3RPQA 3HRTA 2XHKA 4K2EA 1LDKB 1QPIA 1MBGA 3S1QJ 2FBKA 3CZ6A 3OYNA 4KIBA 2R7XA 5LHIA 4PJLA 4ZSKA 3ZMUA 3CF2A 3VB2A 3RJPA 1ETXA 2JN6A 2VODA 2GQQA 5LRRA 5BQTA 1I27A 1M1EB 2P6SA 5L3BA 2P0WA 3EETA 2LBFB 3ZMSA 1QU3A 2OJED 3GWZA 2VKHA 5BOXA 2OD5A 5EEGA 2Y9ZA 1EH8A 1X3WB 2LDUA 5FFXA 5BNGA 3H9QA 5EZHA 1FBSA 2JUCA 3KP2A 2UV1A 3J81K 4AM3A 1SVMA 2GWRA 4MQVA 4ZSIA 3H5AA 1I39A 1YG2A 3FBNB 2HEOA 2QUFA 1P2FA 3HPHA 2M7BA 2EA4A 4ZTFA 2R93J 2LFBA 2BV6A 1XDSA 4LIVA 4XMYA 4QTRA 4N9IA 4X1EA 3OYGA 2DI3A 2STTA 2XGDA 3RTRA 1Y1WJ 4OWRB 2WY7Q 4E70A 4XKWA 2OCEA 2EIJH 4ZDOA 1GV5A 2DMTA 2EFNA 2WAFA 4BXFA 4ENKA 1TQIA 3IP4B 2ACJA 4HRIA 3OIOA 4D9JA 1U5TA 2BZTA 1F4KA 2K9SA 4EVIA 4A0XA 4B4CA 1BN5A 2DYSH 2BYVE 1SFUA 4A3CJ 2STWA 2VXZA 4ANJA 3G1MA 4BJ6C 1JKOC 1YW8A 4CO8A 2B63J 2HOEA 3G6EI 3CC2I 1DGWY 1UCRA 4MFEA 2X85A 2E2JJ 5LGTA 3J7AY 2PJRB 2E1MB 4YIRX 3I4PA 2EILH 3FXKA 3M4OJ 3I54A 3RKYA 2DT7B 3VOEA 2OCCH 1UAAA 4A3BJ 4AIJA 5J6XA 4FCYA 1MDMB 4I7HA 4RLFA 4HYEA 3LSGA 2WAQA 5D6EA 3I4MJ 1XMKA 2VJIA 2Z1DA 3VEPA 3V8LA 2VPRA 1R5GA 1SFXA 4BS9A 2VKDA 1JUPA 1JGSA 1T08B 3OYDA 4B09A 1RR8C 5J40A 1YOVB 2CW0F 2M4KA 3I0TA 2QBYB 3B6CA 3FISA 5C4XJ 1W7PD 3OOPA 1TT8A 4IRGA 4F93B 2R7FA 1JT0A 1LPQA 4GRIA 3GF2A 4PJNA 2DA7A 4NNJA 1S8NA 4ESBA 3A01A 2GXBA 2XAFA 3EDPA 3DF8A 4U88A 5HLIA 3ROUA 5FRNA 2PFBA 3TOAA 2DA4A 3ABLH 1VTNC 1R36A 4CCJA 4EM1A 4JQFA 3FXQA 3KLNA 1OCRH 1ODDA 2DXIA 2R7VA 1X4OA 5AIPA 3ZMTA 3GZ6A 2P81A 4M73A 2V4JC 4IRHA 4FE7A 4BJ5C 2YUSA 1Z0XA 1WJFA 2LKSA 1HW5A 2Q2EA 2G0EA 3GMEA 4RS8A 4RB3C 5HNFA 3CP2A 4XIDA 2XF6A 3R60A 4CZZA 2R5ZB 1BOAA 3K6GA 2MBFA 1G6NA 2L01A 2YX7A 2KP6A 3H3UA 2Q8KA 4BACA 3J81Z 1SVLA 3PSIA 5JLXA 3UR3C 2P5KA 5A2QK 3BG5A 2K02A 4DZJA 4CCMA 3R0AA 4B47A 2CUFA 1Z1DA 5C3EJ 2ID3A 4MEYF 3V42A 1D5YA 2K7LA 2HQAA 1HKSA 1LVKA 2FU4A 3U1KA 5HS8A 4L18B 2LOOA 5K1YA 5CPRB 4YIFA 2P7CB 3MQ0A 2BY0A 2NAZA 4S0HB 2LP0A 3TO9A 2QKMB 3BC8A 5LEKA 3CUQA 1PVEA 3NARA 3HRMA 2DCEA 3LWFA 3I58A 5E3LA 3NWSA 1R1VA 1BR2A 3K1MA 2M8EA 4CYDA 2ZXJA 3CC7I 1LEAA 1VQLI 2X6WA 4DZPA 5HDNA 5DM6F 4KNYA 1S72I 3D5SC 3LMMA 2EB7A 4HEA2 2Y0MA 2Z5UA 1X1CA 4E7ZA 1WQ2A 2K9MA 4YFXF 1E0EA 1IJWC 1V5FA 1FYKA 4XLFA 1HLVA 2OZUA 1IXRC 2W00A 1WWXA 3HGGA 1ZG1A 5HVQC 2I8DA 3FM3A 3S3NA 5D5XB 3DBHB 2W82A 2I10A 2P5VA 2QWWA 3OR1C 1HXDA 4E7SA 3JR9A 3KZZA 1X1AA 1B59A 3VWBA 4KISA 1FTTA 3BLYA 1OISA 4JX6A 4O6JA 3SZGA 3CLQA 3ZQCA 2QQBA 3Q5FA 3DKXA 3HHGA 4A0YA 2WADA 2XUBA 3FIWA 1BI2A 1LEBA 5EGOB 4AIKA 2E1NA 2CRGA 4FQGA 4FE4A 2ZXWH 4PJMA 3UNGC 5BPIA 2DA2A 2CJJA 2DAOA 4G8XA 3Q9VA 4G6TB 4Q47A 1YTYA 3DTIA 1TWAJ 5FLMJ 5F0HA 2H27A 3TEDA 3K10A 5E18F 3ML6A 5F1JA 1PJRA 3OYIA 4B48A 1CGPA 3GUDA 2QQ9A 3HHHA 1JXSA 2NNNA 2QENA 4BE2A 2HVSA 1YE9A 2FBHA 2O8KA 3OYJA 3F21A 2VBXA 3JSOA 3M1CA 4BU2A 4B1RA 4AIHA 3J7YJ 5A2QZ 3FX3A 1R71A 2WBMA 3LA2A 4QPQA 1CF7B 1IGNA 3EUKL 1JKRC 5DUKA 2VLAA 2CQKA 2TRTA 3PL8A 2WTEA 3E1SA 1V5GA 2OF7A 1TC3C 2FMLA 2XGEA 2VASA 4PGHA 2WB1A 2JA7J 4AVZA 4X6AJ 2IS2A 1RZ4A 4DQ2A 3C2HA 3FMSA 3REOA 1SFEA 2BXYA 2RKHA 4H0EA 3OYAA 4BNCA 3ECOA 4BGDA 2ZNZA 5LFAA 1A6IA 4JP0A 1HF0A 4KYWA 4P1WA 2XGXA 3OSGA 5B1BH 3QP6A 2HNHA 3PM1A 3SDBA 3J80K 2W7NA 4NC6A 1XSDA 5IOZA 1ZR2A 4XLPF 1WZ2A 2VBYA 3K4MA 4HA8A 3JRGA 2L7ZA 5CVIA 4R8HA 3TW6A 4PSXA 3PNTA 3M8EA 4WWCA 3J7AO 3L09A 3MKYB 1XGNA 1X1DA 3S2HJ 2MH9A 3S1MJ 1B72A 2FMYA 4WK8F 2FXAA 3BDDA 5EF6A 2DOFA 4A3DJ 1VNDA 2XPWA 4E7JA 1U8RA 4XM3A 2V79A 3F3XA 2CUEA 4V2FA 2HXOA 1VQ5I 2GA1A 1LFBA 1LB2A 1MMSA 2EWNA 3ONQA 2JWTA 4U7DA 1JJ6C 4A93J 2FD5A 3KPHA 1O7FA 4FX4A 1QA6A 2Y30A 1XGOA 2IA0A 3VYRB 2R92J 1YJ9I 2JTVA 3COAC 1HBXG 2K40A 1FOYA 1V4RA 1QPMA 1DP7P 1YJWI 3M1EA 5ILSA 5AONA 4RGRA 1GT0C 1J5YA 4D7NA 5CVRA 2HZDA 2CV1A 3LAJA 5L3GA 3BZKA 3S93A 3PQJA 4DYCA 3FBIB 3M3YJ 1LDJA 1X1PA 5E3NA 4KMFA 2DLLA 2AHQA 3I55I 1DPRA 2ID6A 4XK4A 3OS0A 5FD6A 2CUJA 1YIJI 2VC1A 2A6TA 1FY7A 1FMVA 2IRFG 3F72A 2P4WA 2DFIA 2XRNA 4M3EA 3HFIA 2NXNB 3GFMA 4ZYAA 3CDLA 1O3SA 3K4LA 2KPMA 3CP8A 1T8IA 4EJTA 2EJRA 4C2MJ 4A6DA 3R0JA 2HU9A 3CUQB 4IHYA 5ILUA 5EG0B 4NBQA 4F55A 3KEQA 1F9NA 3BR1A 1ZAOA 4U0YA 5CQGA 3DPUA 3BWGA 3L2QA 5IYDJ 5D6FA 5JI6A 3DLAA 4LITA 2LBFA 3QYFA 2RVCA 1ETWA 2JVHA 2XB0X 3FKJA 5EEAA 2M34A 2DQLA 2VJ4A 1Z7UA 3HPGA 3K4BA 3GTOJ 3KFWX 1ZGWA 4CCKA 1LE8B 1VFCA 2GLOA 2HOTA 2QKLB 3M07A 2LF7A 5LRSA 3CMYA 1IAWA 4DBQA 4IXAA 2NVTJ 2COBA 3K4JA 3HOZJ 3MZYA 1QZEA 1Y56A 3IL2A 2P19A 1POGA 1WFXA 4A5MA 2D2WA 4F91B 4LMYA 1EH7A 3GLLA 4IHXA 3S16J 1FIPA 4RMNA 1OCZH 5HNHA 2CV0A 5H6RA 2YX4A 1EV7A 2DU9A 3W6JB 1XB4A 1G4DA 4L9JA 4LB6B 5DUIA 2K86A 5FKKA 5FD5A 2GOMA 4OOIA 3WG7H 2R7SA 3PUBA 2BOLA 5F08A 2E60A 1YIOA 2YSRA 3HUGB 4RAYA 1MJBA 2ESHA 1IUFA 1JKQC 4L9VA 4MNUA 2H1LA 4M3DA 4ZZDA 2JA8J 5DYMA 2CQXA 4YFNF 4XRSA 4AWXB 4C2UA 3FDYA 3WGIA 1HA8A 4JX5A 1BJZA 3WU1B 1LQ1A 3E5UA 1TZLA 3CF5F 2JQ7A 2HQNA 4BY1J 1ZTRA 3G2BA 2VBZA 2ZMEB 4D7MA 1VQMI 4DW6A 2P7VB 3SXYA 4M6VA 2FQ4A 2AXLA 1YI2I 3RKWA 4CSWA 2PJRA 3SZTA 2K3PA 4NUBA 4XLNF 3DPTA 3ZQIA 2F4IA 1G3WA 5D8LB 5J1YA 1KQ8A 5B3SH 2IGMA 2ISZA 4QLCU 2CFXA 4ABZA 2R4GA 1VQNI 2DA1A 2G9WA 2KRCA 1MBFA 1V55H 2FRHA 2EFOA 2VIXA 4H4KC 3KLOA 1H8AC 4HG2A 3EUHC 4M6YA 4IPAA 2K4JA 3BT9A 3D5RC 1NG6A 3WG9A 4MLOA 2QBYA 2W25A 2QYOA 2VQLA 3H1CA 3M8FA 5GTHC 1ZR4A 1RKTA 2ZO4A 1BW6A 3CDHA 1S7AA 3KE2A 4Z2YA 4M3FA 3MVPA 3MZHA 4HF1A 4A3EJ 3L1PA 3FXOA 4XL9A 4EM2A 4I6ZA 2CO5A 3K2ZA 4O5VA 4IHSA 2VE8A 2UZKA 3CDIA 4OAZA 1J75A 5H2FC 1IXSB 3HSFA 3IAM2 1IXCA 4OAYA 1Z67A 1BR1A 3KP5A 2K3FA 3I5UA 2FNAA 1R58A 2CUZA 4A0ZA 2JT1A 3CCSI 1BC8C 1PUFB
chains in the Genus database with same CATH topology
3TO7A 1T98A 1B4AA 2M87A 1TW2A 4ZYEA 3JSPA 2OAZA 2QLZA 3FZVA 4I2OA 2MLKA 5ED4A 3ZN1A 1R1TA 4FX0A 3MCZA 1SD4A 5LHGA 1SD7A 1DDNA 3HTSB 2VC0A 3KCCA 2YPRA 1S7OA 2F5CA 3DV8A 2IP2A 3B73A 4EJVA 3M9AA 1TQMA 1B9MA 5IT3A 1LNWA 3QU6A 3WTYC 2W85A 5DEQA 3CJNA 5L3EA 2Z9OA 3E6CC 1U5TC 1FX7A 1SD6A 3KP6A 4XBFA 2M5WA 4L0ZB 4YG2F 5JVTA 3TGNA 2EV6A 1O3TA 2XAJA 2JZYA 1MGTA 2B0LA 5HLHA 2VT3A 3BJAA 1HKTA 3BZ6A 4D0PA 3ZQ7A 3DQVC 2FNPA 3JAMK 2EFPA 2LSOA 1FW9A 2F5EA 3LQRA 5LHHA 3FHZA 5DD4A 1O7LA 1W5TA 2OZ6A 2HYGD 4EM0B 1YW7A 5HLGA 5E1XA 1MJ9A 2ZNYA 2C6YA 4GGGA 2JSCA 4KFCA 1ZRCA 4R1HA 1CF7A 5LEJA 2EFWA 1R5HA 1P4XA 1O57A 4LG0B 5K5QA 1PUEE 4EGYA 4L5JA 1ONVA 1G3SA 3N4MA 1XSVA 2O61A 5E1ZB 1LVAA 2A69F 1D3YA 1FP2A 2UXXA 3JW4A 1T0FA 4PZJA 4CHUA 5CVJA 2VT2A 4UV9A 2XV4S 3C18A 4UXNA 3IWFA 2BE5F 3SFZA 4OMZA 1U78A 2PBIA 1HSJA 3O6BB 4GYGA 3ZMDA 2Y48A 3HTUA 5E8GA 3L9FA 1SD5A 3RYRA 5DD8A 5E8IA 4BHBA 2COMA 4IRIA 1WSUA 4M9SA 5HS9A 3R4KA 4RGSA 3D5LA 3JAMZ 4I01A 1ZREA 2LNBA 1ZRDA 2GIVA 1FNNA 4KN4X 1HW1A 1W7PA 4QWQA 4MQ9F 4PGGA 3CTAA 5HDGA 3ZN0A 3E5XA 1U6GA 2HR3A 1FPQA 3QPHA 1RIOH 2CG4A 3BJ6A 3IKVA 3L00A 3LQQA 1HSTA 2EV5A 5LBQA 5TRDA 4RB2C 2XASA 2YR2A 1FYMA 3I53A 5D8KB 2NS0A 1FC3A 3TDZC 3M7GA 2IW5A 2HZTA 2KIUA 5CJ9A 2Z33A 3BY6A 2F2EA 5JFRA 1FLIA 5CVVA 4KT5C 4MGRA 1E2XA 4G9YA 3PQKA 4YFKF 4IVNA 3WGHA 2FA5A 1XLRA 4CGZA 1TW3A 5D5WB 4EJWA 4U0VA 4HF0A 2ZKZA 5TJJA 2L4AA 3DKWA 3RI4A 2L54A 3T1BA 1P4WA 3HUGA 5D5VB 1DPUA 4KICA 2RN7A 2IVMA 4LK0F 2A68F 3D0SA 2LKPA 2FF4A 2Z3YA 4N0BA 2KIMA 4G7HF 3HSEA 2ZMEA 2HKOA 1IN5A 3G3ZA 2BBYA 2L3DA 1G3YA 3CLOA 4WXHA 4ZSBA 5ICCA 2FOKA 3JTGA 2FSWA 2J5PA 4P55A 2TDXA 3WTUC 2MD5A 2V1DA 3NEUA 3FXRA 3F8NA 3RYPA 2HKXA 4Y15A 1BIBA 3HOTA 3BPXA 4OIRF 4MTDA 1BIAA 1T39A 2DQRA 2AS5F 2ADUA 2FE3A 1K79A 2XKPA 3F8CA 4S04A 4EQQA 1EH6A 5J8CA 4CXFA 1GHCA 1J59A 1ON2A 4UUVA 2OBPA 4N9HA 3F6OA 1KYWA 1KA8A 1ZARA 3V8JA 3WE2A 1LDDA 5LGUA 3BROA 1QQIA 5JHUA 4KIFA 1X3UA 4G7ZF 3GXOA 4RB0A 4DNCA 1XSXA 3LA3A 1H9GA 1REPC 1R7JA 3F6VA 1T2KA 1I6XA 1USTA 4LLLA 1KQ0A 3AAFA 3DXJF 5FB2A 3K1NA 1F5TA 1FSHA 4I02A 2DW4A 3GFJA 1HQCA 5FO5A 4RGXA 1W7PB 5L3CA 1H9TA 4HLXA 2J5OA 1K78B 3HIFA 1BBYA 4LGWA 5DDGA 4Y17A 3HSRA 2IPQX 1SAXA 4LK1F 1XN7A 4HV5A 5HDKA 1IUYA 2ZFWA 1YFHA 2IKKA 5KVRA 3FXUA 4MTEA 1UHWA 1OKRA 4KDPA 1ZG3A 3K9TA 1Z91A 4XSXF 3GO5A 2DT5A 4R79A 2KKOA 3I59B 2DBBA 4G6DA 4OINF 2RGVA 3ZMVA 3E97A 5F1RA 1ZGJA 4HX8A 1FYLA 3U1DA 3FM5A 3JTHA 4ZYGA 3CUOA 3V7RA 3P9KA 1U3EM 2Y75A 4OIPF 1HW2A 6PAXA 1MD0A 2XIGA 2O03A 3F8FA 3S2WA 2GAUA 5AIQA 3IRQA 4PCQA 2E7XA 3IKTA 4LG0A 5ICEA 3KEOA 3L7WA 4JBAA 4UVBA 2RC4A 1BJAA 5K5RA 1AWCA 2OQGA 4EMSA 3E6DA 3WTWC 3O3KA 2A6EF 2MH2A 1ZHFA 2HTJA 3KP7A 3V7SA 5BPDA 2QVOA 2H6CA 3E5QA 1KU3A 2VN2A 1WRJA 3O2PE 1J0RA 2F5FA 1V3FA 2ESNA 3EQLF 3I71A 3T0YA 2IT0A 5HOOA 4I0AA 2OU2A 2ZCWA 1ZGAA 5DCMA 3W6KB 4G94A 2VBWA 1QO0D 1F1ZA 2X0LA 2EFQA 1Z6TA 4B8XA 4M9XA 2XKOA 4G7OF 1S3JA 4RB1A 3H3ZA 3ERED 3HOSA 2Z99A 1RUOA 2EA2A 3Q9SA 1ULYA 5FFZA 3P9CA 3C7JA 2ISYA 2P8TA 3BOQA 1Y0UA 3H92A 1OYIA 5IT9K 4Y13A 4A12A 3SQNA 2GZWA 3R6SA 1MKMA 4UVAA 5BS6A 4OMYA 4GXOA 1USSA 5FLXK 1R00A 2CSOA 4EV0A 4U7BA 1KU7A 4OU0A 1KGSA 4PDKA 2R7DA 4ENNA 3T8TA 3WTZA 1MJAA 5DV5A 1H0MA 3K1PA 3T8RA 1PDNC 2P5LC 3QOPA 1E17A 2MLGA 3DDVA 5FGMA 3BP8A 1HKQA 4CICA 1ZG5A 1PP7U 4FHTA 2PLYA 1FT9A 2GA2A 2O0YA 3CO6C 3IWZA 4A5NA 4OIQF 1OR7A 1ZRFA 2H6BA 1PP8F 2DTRA 3WTTC 1IN7A 2FQ3A 3WTVC 4BXUA 1RUNA 5E20A 3MFKA 2IA1A 4Q5SF 4AVPA 2HYFA 3N97A 4ENMA 2CGPA 1UHMA 1JHHA 2VE9A 2D1VA 2CYYA 3OV8A 1GVJA 2L02A 1BC7C 1ON1A 2D1HA 3K0LA 3TQNA 1JD3A 4M6XA 5IT9Z 3KETA 1TNTA 4M72A 2O8XA 5KK1A 3EYYA 3GFLA 3HRSA 1U2WA 4LD5A 3NRVA 4HV6A 3ELKA 1ZLKA 2VONA 2WV0A 5FLXZ 1BI0A 2PI0A 4BYYA 2G7HA 4AD9A 3CUQC 3LAPA 5CVUA 1Z9CA 3L5ZA 1XMAA 5CYVA 2L4MA 4HAMA 1KU9A 4NQWA 1S6LA 2KIFA 4I0BA 5DCMB 1D8KA 1XGSA 1I5ZA 1KYZA 4HBLA 1I1SA 1TBXA 2YU3A 3L2CA 3C1DA 3CNVA 1O3QA 2KJBA 4WXCA 1QBJA 4ESJA 4FT8A 1QGPA 3VFZA 2W84A 2RA5A 1K78A 1C0WA 2A07F 2HDCA 3HYIA 1FSEA 2P6TA 4M74A 4WCGA 1WI9A 1G3TA 5D5UB 1T6SA 3GX4X 2HWVA 3QRFF 2FBIA 2QQAA 4ASNA 1R23A 5LLQA 1YS7A 5F64A 2A61A 3GEZA 1W5SA 3B02A 3MEXA 1RI7A 2QZ8A 4CDGA 1G1BA 4P9FA 4BQAA 2DK5A 3I59A 2BGCA 2V1UA 4EJUA 1FWZA 1QZYA 3TKYA 2M1BA 2WWYA 1J7KA 3QAHA 1FOKA 3ZPLA 3E6MA 1STZA 4ZZLA 2NRAC 1D5VA 1QNTA 5BMZA 3F22A 4ZYDA 1FBQA 4L5IA 2JRTA 4YIIA 3V8KA 4LLGF 4ENJA 2IJLA 4I98B 2R3SA 5EEHA 1Q1HA 4XSZF 4GYIA 3T5XA 4HOBA 2PJPA 3VODA 4HQEA 2E7WA 3BPVA 1IN6A 4BH9A 2A3SA 4GCVA 1L3LA 3ULQB 1SMTA 2GXGA 4HLYA 5CLSA 1I1GA 2F5DA 1YYVA 4IF4A 1NHAA 1GXQA 4ON0A 1SMYF 2XAQA 1YW9A 2NYXA 2OQRA 4XRFA 2ETHA 5L3FA 5ILVA 2V9VA 2ZBKA 2MC3A 3F8LA 3ZMZA 4S05A 2QM3A 2V1XA 2Q0OA 2UXNA 3GFIA 4NHJA 4WXDA 5DCFA 3MAJA 3WGGA 5ERIA 4HX4A 3TOBA 4ZH4F 3LFKA 3E3VA 2PG4A 4O3MA 4GO1A 4UNOA 1G81A 1IRFA 3FWEA 2DPDA 1D8JA 4ETSA 1T38A 3F8MA 1U5TB 3QP5A 1QZZA 2UWMA 3DP7A 1BM9A 4WF2A 4A2UA 2FA1A 3KP3A 4KN7X 4LJZF 3SHFA 3GW2A 3LA7A 1L0OC 1UB9A 2A5YB 2OA4A 2W24A 2A6HF 4KUMA 4LB5A 3ABTA 1MZBA 2D45A 1FZPB 1ZLJA 2BEOA 4KA4A 5HS7A 4P5OA 3FMRA 1WKMA 2HTSA 4TV7A 2K27A 1ZYRF 4LLNA 2MA3A 2PN6A 2G7UA 4EGZA 3RIRA 3IC7A 3V4GA 2HFHA 2LF8A 1UFMA 3GLXA 4Q4ZF 2JPBA 4KIGA 2H94A 1A04A 1OPCA 2KJCA 4P9UA 3RKXA 2HGCA 4MHGA 3TDUC 3F8BA 5K5OA 5ICGA 4BHCA 1OMIA 1XCVA 2O3FA 2CWEA 1YS6A 3RDIA 1XCBA 2DK8A 4UHTA 1GXPA 3I64A 3IHUA 2OGGA 3KP4A 2M45A 2PEXA 2ZJ2A 1KQ9A 2O6GE 4EJOA 3PFIA 1P4AA 3QU3A 2DO7A 2XROA 1S29A 2W57A 3DEUA 1FBUA 1KU2A 2HQRA 5ICFA 2AHCA 1B6AA 4UVCA 2WC2A 3G73A 1Z6RA 3J80Z 4HX7A 2OOIA 2XAGA 4JK1X 2NNYA 3ECHA 5H20A 2JPCA 3WU0A 1TQPA 2KRFA 3P9IA 3U9GA 2E1CA 5H6QA 1IRGA 2RNJA 1OYYA 3QPTA 2IA2A 4MEXF 4L9NA 3R61A 3WODF 3K69A 4HDUA 4HQMA 3NQOA 4G6QA 4UV8A 1B1BA 1ZN2A 4L0YB 2FEZA 2EK5A 3MWMA 4BAYA 2NWIA 1J2XA 4IJAA 2M30A 2PMHA 4HDVA 1IF1A 3KZYA 4L9TA 1Z05A 3DPLC 2DPUA 4WX9A 2VOPA 4HZFA 1R1UA 2PMUA 3WE3A 1P6RA 1MDMA 3P7NA 1BI3A 1LJ9A 1TNSA 2X4HA 4HW0A 3GZ5A 1XDUA 3U2RA 5F6FA 3ZP5A 4HF2A 2EV0A 1IN8A 5E17F 3F23A 3E6BA 4RAZA 2RDPA 1IN4A 3C3WA 2PQ8A 2HS5A 4M9ZA 3ABUA 1OYWA 3FF5A 3GYHX 2H09A 3LSTA 1FP1D 4U0WA 4ZYHA 1YO5C 1R22A 4Q48A 4OIOF 1ZH5A 5J8FA 1W4MA 5LGNA 1TTYA 3DFGA 2V6CA 4BHPA 1YLFA 2RQPA 1BI1A 5D4SA 1P92A 1J9IA 4F7ZA 4ESFA 1K6OA 4I09A 1TLHB 3ISPA 4NB5A 1IZ1A 4A6EA 3CO7C 3TO6A 4LFUA 5L3DA 3GVAA 2ELHA 3V7CA 1YQAA 5D4RA 4P96A 5JR3A 1B9NA 4KMUX 1AOYA 3FMQA 1XD7A 3HRUA 1O3RA 5E1WA 4RGUA 3IRRA 1XGMA 1DUXC 3LHEA 3EUHA 3BJOA 3SZPA 3RPUA 4M71A 2K4BA 2VOOA 3WTSC 1IW7F 1K7AA 2RV8A 4IHTA 1JE8A 1RNLA 3EYIA 2XVCA 2XAHA 3WTXC 2PKHA 1JHFA 3RPQA 3HRTA 2XHKA 4K2EA 1LDKB 2FBKA 4KIBA 5LHIA 4ZSKA 3ZMUA 3VB2A 3RJPA 2VODA 2GQQA 5LRRA 5BQTA 1I27A 2P6SA 5L3BA 3EETA 3ZMSA 3GWZA 5BOXA 2OD5A 5EEGA 1EH8A 2LDUA 5FFXA 1FBSA 3KP2A 3J81K 2GWRA 4MQVA 4ZSIA 1YG2A 2HEOA 2QUFA 1P2FA 2EA4A 2BV6A 1XDSA 4N9IA 2DI3A 2STTA 3RTRA 4E70A 2EFNA 2ACJA 4ENKA 1TQIA 1U5TA 1F4KA 4EVIA 4A0XA 1BN5A 2BYVE 1SFUA 2STWA 2VXZA 1YW8A 4CO8A 2HOEA 1UCRA 5LGTA 3I4PA 3I54A 3RKYA 3VOEA 4AIJA 5J6XA 1MDMB 4I7HA 4HYEA 5D6EA 1XMKA 3VEPA 3V8LA 1R5GA 1SFXA 1JGSA 4B09A 2CW0F 3I0TA 2QBYB 1TT8A 1W7PD 3OOPA 4IRGA 2R7FA 3GF2A 1S8NA 4ESBA 2GXBA 3ROUA 2XAFA 3DF8A 3EDPA 4U88A 5HLIA 2PFBA 3TOAA 1VTNC 1R36A 4EM1A 4JQFA 3FXQA 3KLNA 1ODDA 3ZMTA 5AIPA 3GZ6A 4M73A 4IRHA 1HW5A 2Q2EA 4RS8A 4RB3C 3R60A 4CZZA 1BOAA 2MBFA 1G6NA 2L01A 2YX7A 3H3UA 2Q8KA 3J81Z 2P5KA 5A2QK 2K02A 3R0AA 1Z1DA 4MEYF 2K7LA 1HKSA 2FU4A 5HS8A 4L18B 5K1YA 4YIFA 2P7CB 3MQ0A 2NAZA 3TO9A 5LEKA 3CUQA 3HRMA 3LWFA 3I58A 1R1VA 3K1MA 2M8EA 4CYDA 2ZXJA 1LEAA 5HDNA 4KNYA 2EB7A 2Y0MA 2Z5UA 1WQ2A 4YFXF 1FYKA 2OZUA 1IXRC 1WWXA 1ZG1A 5HVQC 3FM3A 5D5XB 2P5VA 2QWWA 1HXDA 3KZZA 1B59A 4O6JA 2QQBA 3Q5FA 3HHGA 4A0YA 2XUBA 1LEBA 1BI2A 4AIKA 2E1NA 5BPIA 2DAOA 4G8XA 3Q9VA 4Q47A 1YTYA 2H27A 5E18F 3ML6A 1CGPA 3GUDA 2QQ9A 3HHHA 1JXSA 2NNNA 2QENA 2FBHA 3F21A 2VBXA 3JSOA 4AIHA 5A2QZ 3FX3A 3LA2A 1CF7B 5DUKA 2CQKA 2WTEA 2FMLA 4PGHA 1RZ4A 4DQ2A 3FMSA 3REOA 1SFEA 2RKHA 4H0EA 4BNCA 3ECOA 2ZNZA 4KYWA 2XGXA 3QP6A 3J80K 1XSDA 4XLPF 2VBYA 4HA8A 5CVIA 4R8HA 3M8EA 4WWCA 3J7AO 3L09A 1XGNA 2MH9A 2FMYA 4WK8F 2FXAA 3BDDA 1U8RA 2V79A 3F3XA 2GA1A 1LB2A 2EWNA 4U7DA 4FX4A 1O7FA 1XGOA 2IA0A 2JTVA 3COAC 1HBXG 1V4RA 1QPMA 1DP7P 3M1EA 5ILSA 5AONA 4RGRA 1J5YA 5CVRA 3LAJA 5L3GA 3PQJA 1LDJA 4KMFA 2DLLA 1DPRA 5FD6A 2VC1A 1FY7A 2IRFG 3F72A 2P4WA 2DFIA 2XRNA 3HFIA 3GFMA 1O3SA 4EJTA 2EJRA 4A6DA 3R0JA 3CUQB 5ILUA 3KEQA 1F9NA 1ZAOA 4U0YA 3BWGA 5D6FA 5JI6A 2RVCA 2DQLA 1Z7UA 3KFWX 2LF7A 5LRSA 1IAWA 4IXAA 3MZYA 3IL2A 2P19A 4A5MA 2D2WA 4LMYA 1EH7A 5H6RA 2YX4A 1EV7A 2DU9A 3W6JB 1XB4A 1G4DA 4L9JA 4LB6B 5DUIA 2K86A 5FD5A 4OOIA 1YIOA 2YSRA 4RAYA 1MJBA 2ESHA 4L9VA 4MNUA 4ZZDA 5DYMA 4YFNF 4AWXB 3WGIA 3WU1B 1LQ1A 3E5UA 2HQNA 2VBZA 2ZMEB 2P7VB 3SXYA 2AXLA 3RKWA 3SZTA 4XLNF 3DPTA 1G3WA 5D8LB 1KQ8A 2ISZA 4QLCU 2CFXA 2G9WA 2FRHA 2EFOA 3KLOA 4M6YA 4IPAA 2K4JA 3WG9A 2QBYA 2W25A 2QYOA 3M8FA 2ZO4A 3CDHA 1S7AA 3KE2A 4Z2YA 3MZHA 4HF1A 4EM2A 2CO5A 3K2ZA 4O5VA 4IHSA 2VE8A 2UZKA 1J75A 1IXSB 3HSFA 1IXCA 3KP5A 3I5UA 2FNAA 1R58A 4A0ZA 2JT1A 1BC8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO7 A;  1T98 A;  1B4A A;  2M87 A;  1TW2 A;  4ZYE A;  3JSP A;  2OAZ A;  2QLZ A;  3FZV A;  4I2O A;  2MLK A;  5ED4 A;  3ZN1 A;  1R1T A;  4FX0 A;  3MCZ A;  1SD4 A;  5LHG A;  1SD7 A;  1DDN A;  3HTS B;  2VC0 A;  3KCC A;  2YPR A;  1S7O A;  2F5C A;  3DV8 A;  2IP2 A;  3B73 A;  4EJV A;  3M9A A;  1TQM A;  1B9M A;  5IT3 A;  1LNW A;  3QU6 A;  3WTY C;  2W85 A;  5DEQ A;  3CJN A;  5L3E A;  2Z9O A;  3E6C C;  1U5T C;  1FX7 A;  1SD6 A;  3KP6 A;  4XBF A;  2M5W A;  4L0Z B;  4YG2 F;  5JVT A;  3TGN A;  2EV6 A;  1O3T A;  2XAJ A;  2JZY A;  1MGT A;  2B0L A;  5HLH A;  2VT3 A;  3BJA A;  1HKT A;  3BZ6 A;  4D0P A;  3ZQ7 A;  3DQV C;  2FNP A;  3JAM K;  2EFP A;  2LSO A;  1FW9 A;  2F5E A;  3LQR A;  5LHH A;  3FHZ A;  5DD4 A;  1O7L A;  1W5T A;  2OZ6 A;  2HYG D;  4EM0 B;  1YW7 A;  5HLG A;  5E1X A;  1MJ9 A;  2ZNY A;  2C6Y A;  4GGG A;  2JSC A;  4KFC A;  1ZRC A;  4R1H A;  1CF7 A;  5LEJ A;  2EFW A;  1R5H A;  1P4X A;  1O57 A;  4LG0 B;  5K5Q A;  1PUE E;  4EGY A;  4L5J A;  1ONV A;  1G3S A;  3N4M A;  1XSV A;  2O61 A;  5E1Z B;  1LVA A;  2A69 F;  1D3Y A;  1FP2 A;  2UXX A;  3JW4 A;  1T0F A;  4PZJ A;  4CHU A;  5CVJ A;  2VT2 A;  4UV9 A;  2XV4 S;  3C18 A;  4UXN A;  3IWF A;  2BE5 F;  3SFZ A;  4OMZ A;  1U78 A;  2PBI A;  1HSJ A;  3O6B B;  4GYG A;  3ZMD A;  2Y48 A;  3HTU A;  5E8G A;  3L9F A;  1SD5 A;  3RYR A;  5DD8 A;  5E8I A;  4BHB A;  2COM A;  4IRI A;  1WSU A;  4M9S A;  5HS9 A;  3R4K A;  4RGS A;  3D5L A;  3JAM Z;  4I01 A;  1ZRE A;  2LNB A;  1ZRD A;  2GIV A;  1FNN A;  4KN4 X;  1HW1 A;  1W7P A;  4QWQ A;  4MQ9 F;  4PGG A;  3CTA A;  5HDG A;  3ZN0 A;  3E5X A;  1U6G A;  2HR3 A;  1FPQ A;  3QPH A;  1RIO H;  2CG4 A;  3BJ6 A;  3IKV A;  3L00 A;  3LQQ A;  1HST A;  2EV5 A;  5LBQ A;  5TRD A;  4RB2 C;  2XAS A;  2YR2 A;  1FYM A;  3I53 A;  5D8K B;  2NS0 A;  1FC3 A;  3TDZ C;  3M7G A;  2IW5 A;  2HZT A;  2KIU A;  5CJ9 A;  2Z33 A;  3BY6 A;  2F2E A;  5JFR A;  1FLI A;  5CVV A;  4KT5 C;  4MGR A;  1E2X A;  4G9Y A;  3PQK A;  4YFK F;  4IVN A;  3WGH A;  2FA5 A;  1XLR A;  4CGZ A;  1TW3 A;  5D5W B;  4EJW A;  4U0V A;  4HF0 A;  2ZKZ A;  5TJJ A;  2L4A A;  3DKW A;  3RI4 A;  2L54 A;  3T1B A;  1P4W A;  3HUG A;  5D5V B;  1DPU A;  4KIC A;  2RN7 A;  2IVM A;  4LK0 F;  2A68 F;  3D0S A;  2LKP A;  2FF4 A;  2Z3Y A;  4N0B A;  2KIM A;  4G7H F;  3HSE A;  2ZME A;  2HKO A;  1IN5 A;  3G3Z A;  2BBY A;  2L3D A;  1G3Y A;  3CLO A;  4WXH A;  4ZSB A;  5ICC A;  2FOK A;  3JTG A;  2FSW A;  2J5P A;  4P55 A;  2TDX A;  3WTU C;  2MD5 A;  2V1D A;  3NEU A;  3FXR A;  3F8N A;  3RYP A;  2HKX A;  4Y15 A;  1BIB A;  3HOT A;  3BPX A;  4OIR F;  4MTD A;  1BIA A;  1T39 A;  2DQR A;  2AS5 F;  2ADU A;  2FE3 A;  1K79 A;  2XKP A;  3F8C A;  4S04 A;  4EQQ A;  1EH6 A;  5J8C A;  4CXF A;  1GHC A;  1J59 A;  1ON2 A;  4UUV A;  2OBP A;  4N9H A;  3F6O A;  1KYW A;  1KA8 A;  1ZAR A;  3V8J A;  3WE2 A;  1LDD A;  5LGU A;  3BRO A;  1QQI A;  5JHU A;  4KIF A;  1X3U A;  4G7Z F;  3GXO A;  4RB0 A;  4DNC A;  1XSX A;  3LA3 A;  1H9G A;  1REP C;  1R7J A;  3F6V A;  1T2K A;  1I6X A;  1UST A;  4LLL A;  1KQ0 A;  3AAF A;  3DXJ F;  5FB2 A;  3K1N A;  1F5T A;  1FSH A;  4I02 A;  2DW4 A;  3GFJ A;  1HQC A;  5FO5 A;  4RGX A;  1W7P B;  5L3C A;  1H9T A;  4HLX A;  2J5O A;  1K78 B;  3HIF A;  1BBY A;  4LGW A;  5DDG A;  4Y17 A;  3HSR A;  2IPQ X;  1SAX A;  4LK1 F;  1XN7 A;  4HV5 A;  5HDK A;  1IUY A;  2ZFW A;  1YFH A;  2IKK A;  5KVR A;  3FXU A;  4MTE A;  1UHW A;  1OKR A;  4KDP A;  1ZG3 A;  3K9T A;  1Z91 A;  4XSX F;  3GO5 A;  2DT5 A;  4R79 A;  2KKO A;  3I59 B;  2DBB A;  4G6D A;  4OIN F;  2RGV A;  3ZMV A;  3E97 A;  5F1R A;  1ZGJ A;  4HX8 A;  1FYL A;  3U1D A;  3FM5 A;  3JTH A;  4ZYG A;  3CUO A;  3V7R A;  3P9K A;  1U3E M;  2Y75 A;  4OIP F;  1HW2 A;  6PAX A;  1MD0 A;  2XIG A;  2O03 A;  3F8F A;  3S2W A;  2GAU A;  5AIQ A;  3IRQ A;  4PCQ A;  2E7X A;  3IKT A;  4LG0 A;  5ICE A;  3KEO A;  3L7W A;  4JBA A;  4UVB A;  2RC4 A;  1BJA A;  5K5R A;  1AWC A;  2OQG A;  4EMS A;  3E6D A;  3WTW C;  3O3K A;  2A6E F;  2MH2 A;  1ZHF A;  2HTJ A;  3KP7 A;  3V7S A;  5BPD A;  2QVO A;  2H6C A;  3E5Q A;  1KU3 A;  2VN2 A;  1WRJ A;  3O2P E;  1J0R A;  2F5F A;  1V3F A;  2ESN A;  3EQL F;  3I71 A;  3T0Y A;  2IT0 A;  5HOO A;  4I0A A;  2OU2 A;  2ZCW A;  1ZGA A;  5DCM A;  3W6K B;  4G94 A;  2VBW A;  1QO0 D;  1F1Z A;  2X0L A;  2EFQ A;  1Z6T A;  4B8X A;  4M9X A;  2XKO A;  4G7O F;  1S3J A;  4RB1 A;  3H3Z A;  3ERE D;  3HOS A;  2Z99 A;  1RUO A;  2EA2 A;  3Q9S A;  1ULY A;  5FFZ A;  3P9C A;  3C7J A;  2ISY A;  2P8T A;  3BOQ A;  1Y0U A;  3H92 A;  1OYI A;  5IT9 K;  4Y13 A;  4A12 A;  3SQN A;  2GZW A;  3R6S A;  1MKM A;  4UVA A;  5BS6 A;  4OMY A;  4GXO A;  1USS A;  5FLX K;  1R00 A;  2CSO A;  4EV0 A;  4U7B A;  1KU7 A;  4OU0 A;  1KGS A;  4PDK A;  2R7D A;  4ENN A;  3T8T A;  3WTZ A;  1MJA A;  5DV5 A;  1H0M A;  3K1P A;  3T8R A;  1PDN C;  2P5L C;  3QOP A;  1E17 A;  2MLG A;  3DDV A;  5FGM A;  3BP8 A;  1HKQ A;  4CIC A;  1ZG5 A;  1PP7 U;  4FHT A;  2PLY A;  1FT9 A;  2GA2 A;  2O0Y A;  3CO6 C;  3IWZ A;  4A5N A;  4OIQ F;  1OR7 A;  1ZRF A;  2H6B A;  1PP8 F;  2DTR A;  3WTT C;  1IN7 A;  2FQ3 A;  3WTV C;  4BXU A;  1RUN A;  5E20 A;  3MFK A;  2IA1 A;  4Q5S F;  4AVP A;  2HYF A;  3N97 A;  4ENM A;  2CGP A;  1UHM A;  1JHH A;  2VE9 A;  2D1V A;  2CYY A;  3OV8 A;  1GVJ A;  2L02 A;  1BC7 C;  1ON1 A;  2D1H A;  3K0L A;  3TQN A;  1JD3 A;  4M6X A;  5IT9 Z;  3KET A;  1TNT A;  4M72 A;  2O8X A;  5KK1 A;  3EYY A;  3GFL A;  3HRS A;  1U2W A;  4LD5 A;  3NRV A;  4HV6 A;  3ELK A;  1ZLK A;  2VON A;  2WV0 A;  5FLX Z;  1BI0 A;  2PI0 A;  4BYY A;  2G7H A;  4AD9 A;  3CUQ C;  3LAP A;  5CVU A;  1Z9C A;  3L5Z A;  1XMA A;  5CYV A;  2L4M A;  4HAM A;  1KU9 A;  4NQW A;  1S6L A;  2KIF A;  4I0B A;  5DCM B;  1D8K A;  1XGS A;  1I5Z A;  1KYZ A;  4HBL A;  1I1S A;  1TBX A;  2YU3 A;  3L2C A;  3C1D A;  3CNV A;  1O3Q A;  2KJB A;  4WXC A;  1QBJ A;  4ESJ A;  4FT8 A;  1QGP A;  3VFZ A;  2W84 A;  2RA5 A;  1K78 A;  1C0W A;  2A07 F;  2HDC A;  3HYI A;  1FSE A;  2P6T A;  4M74 A;  4WCG A;  1WI9 A;  1G3T A;  5D5U B;  1T6S A;  3GX4 X;  2HWV A;  3QRF F;  2FBI A;  2QQA A;  4ASN A;  1R23 A;  5LLQ A;  1YS7 A;  5F64 A;  2A61 A;  3GEZ A;  1W5S A;  3B02 A;  3MEX A;  1RI7 A;  2QZ8 A;  4CDG A;  1G1B A;  4P9F A;  4BQA A;  2DK5 A;  3I59 A;  2BGC A;  2V1U A;  4EJU A;  1FWZ A;  1QZY A;  3TKY A;  2M1B A;  2WWY A;  1J7K A;  3QAH A;  1FOK A;  3ZPL A;  3E6M A;  1STZ A;  4ZZL A;  2NRA C;  1D5V A;  1QNT A;  5BMZ A;  3F22 A;  4ZYD A;  1FBQ A;  4L5I A;  2JRT A;  4YII A;  3V8K A;  4LLG F;  4ENJ A;  2IJL A;  4I98 B;  2R3S A;  5EEH A;  1Q1H A;  4XSZ F;  4GYI A;  3T5X A;  4HOB A;  2PJP A;  3VOD A;  4HQE A;  2E7W A;  3BPV A;  1IN6 A;  4BH9 A;  2A3S A;  4GCV A;  1L3L A;  3ULQ B;  1SMT A;  2GXG A;  4HLY A;  5CLS A;  1I1G A;  2F5D A;  1YYV A;  4IF4 A;  1NHA A;  1GXQ A;  4ON0 A;  1SMY F;  2XAQ A;  1YW9 A;  2NYX A;  2OQR A;  4XRF A;  2ETH A;  5L3F A;  5ILV A;  2V9V A;  2ZBK A;  2MC3 A;  3F8L A;  3ZMZ A;  4S05 A;  2QM3 A;  2V1X A;  2Q0O A;  2UXN A;  3GFI A;  4NHJ A;  4WXD A;  5DCF A;  3MAJ A;  3WGG A;  5ERI A;  4HX4 A;  3TOB A;  4ZH4 F;  3LFK A;  3E3V A;  2PG4 A;  4O3M A;  4GO1 A;  4UNO A;  1G81 A;  1IRF A;  3FWE A;  2DPD A;  1D8J A;  4ETS A;  1T38 A;  3F8M A;  1U5T B;  3QP5 A;  1QZZ A;  2UWM A;  3DP7 A;  1BM9 A;  4WF2 A;  4A2U A;  2FA1 A;  3KP3 A;  4KN7 X;  4LJZ F;  3SHF A;  3GW2 A;  3LA7 A;  1L0O C;  1UB9 A;  2A5Y B;  2OA4 A;  2W24 A;  2A6H F;  4KUM A;  4LB5 A;  3ABT A;  1MZB A;  2D45 A;  1FZP B;  1ZLJ A;  2BEO A;  4KA4 A;  5HS7 A;  4P5O A;  3FMR A;  1WKM A;  2HTS A;  4TV7 A;  2K27 A;  1ZYR F;  4LLN A;  2MA3 A;  2PN6 A;  2G7U A;  4EGZ A;  3RIR A;  3IC7 A;  3V4G A;  2HFH A;  2LF8 A;  1UFM A;  3GLX A;  4Q4Z F;  2JPB A;  4KIG A;  2H94 A;  1A04 A;  1OPC A;  2KJC A;  4P9U A;  3RKX A;  2HGC A;  4MHG A;  3TDU C;  3F8B A;  5K5O A;  5ICG A;  4BHC A;  1OMI A;  1XCV A;  2O3F A;  2CWE A;  1YS6 A;  3RDI A;  1XCB A;  2DK8 A;  4UHT A;  1GXP A;  3I64 A;  3IHU A;  2OGG A;  3KP4 A;  2M45 A;  2PEX A;  2ZJ2 A;  1KQ9 A;  2O6G E;  4EJO A;  3PFI A;  1P4A A;  3QU3 A;  2DO7 A;  2XRO A;  1S29 A;  2W57 A;  3DEU A;  1FBU A;  1KU2 A;  2HQR A;  5ICF A;  2AHC A;  1B6A A;  4UVC A;  2WC2 A;  3G73 A;  1Z6R A;  3J80 Z;  4HX7 A;  2OOI A;  2XAG A;  4JK1 X;  2NNY A;  3ECH A;  5H20 A;  2JPC A;  3WU0 A;  1TQP A;  2KRF A;  3P9I A;  3U9G A;  2E1C A;  5H6Q A;  1IRG A;  2RNJ A;  1OYY A;  3QPT A;  2IA2 A;  4MEX F;  4L9N A;  3R61 A;  3WOD F;  3K69 A;  4HDU A;  4HQM A;  3NQO A;  4G6Q A;  4UV8 A;  1B1B A;  1ZN2 A;  4L0Y B;  2FEZ A;  2EK5 A;  3MWM A;  4BAY A;  2NWI A;  1J2X A;  4IJA A;  2M30 A;  2PMH A;  4HDV A;  1IF1 A;  3KZY A;  4L9T A;  1Z05 A;  3DPL C;  2DPU A;  4WX9 A;  2VOP A;  4HZF A;  1R1U A;  2PMU A;  3WE3 A;  1P6R A;  1MDM A;  3P7N A;  1BI3 A;  1LJ9 A;  1TNS A;  2X4H A;  4HW0 A;  3GZ5 A;  1XDU A;  3U2R A;  5F6F A;  3ZP5 A;  4HF2 A;  2EV0 A;  1IN8 A;  5E17 F;  3F23 A;  3E6B A;  4RAZ A;  2RDP A;  1IN4 A;  3C3W A;  2PQ8 A;  2HS5 A;  4M9Z A;  3ABU A;  1OYW A;  3FF5 A;  3GYH X;  2H09 A;  3LST A;  1FP1 D;  4U0W A;  4ZYH A;  1YO5 C;  1R22 A;  4Q48 A;  4OIO F;  1ZH5 A;  5J8F A;  1W4M A;  5LGN A;  1TTY A;  3DFG A;  2V6C A;  4BHP A;  1YLF A;  2RQP A;  1BI1 A;  5D4S A;  1P92 A;  1J9I A;  4F7Z A;  4ESF A;  1K6O A;  4I09 A;  1TLH B;  3ISP A;  4NB5 A;  1IZ1 A;  4A6E A;  3CO7 C;  3TO6 A;  4LFU A;  5L3D A;  3GVA A;  2ELH A;  3V7C A;  1YQA A;  5D4R A;  4P96 A;  5JR3 A;  1B9N A;  4KMU X;  1AOY A;  3FMQ A;  1XD7 A;  3HRU A;  1O3R A;  5E1W A;  4RGU A;  3IRR A;  1XGM A;  1DUX C;  3LHE A;  3EUH A;  3BJO A;  3SZP A;  3RPU A;  4M71 A;  2K4B A;  2VOO A;  3WTS C;  1IW7 F;  1K7A A;  2RV8 A;  4IHT A;  1JE8 A;  1RNL A;  3EYI A;  2XVC A;  2XAH A;  3WTX C;  2PKH A;  1JHF A;  3RPQ A;  3HRT A;  2XHK A;  4K2E A;  1LDK B;  2FBK A;  4KIB A;  5LHI A;  4ZSK A;  3ZMU A;  3VB2 A;  3RJP A;  2VOD A;  2GQQ A;  5LRR A;  5BQT A;  1I27 A;  2P6S A;  5L3B A;  3EET A;  3ZMS A;  3GWZ A;  5BOX A;  2OD5 A;  5EEG A;  1EH8 A;  2LDU A;  5FFX A;  1FBS A;  3KP2 A;  3J81 K;  2GWR A;  4MQV A;  4ZSI A;  1YG2 A;  2HEO A;  2QUF A;  1P2F A;  2EA4 A;  2BV6 A;  1XDS A;  4N9I A;  2DI3 A;  2STT A;  3RTR A;  4E70 A;  2EFN A;  2ACJ A;  4ENK A;  1TQI A;  1U5T A;  1F4K A;  4EVI A;  4A0X A;  1BN5 A;  2BYV E;  1SFU A;  2STW A;  2VXZ A;  1YW8 A;  4CO8 A;  2HOE A;  1UCR A;  5LGT A;  3I4P A;  3I54 A;  3RKY A;  3VOE A;  4AIJ A;  5J6X A;  1MDM B;  4I7H A;  4HYE A;  5D6E A;  1XMK A;  3VEP A;  3V8L A;  1R5G A;  1SFX A;  1JGS A;  4B09 A;  2CW0 F;  3I0T A;  2QBY B;  1TT8 A;  1W7P D;  3OOP A;  4IRG A;  2R7F A;  3GF2 A;  1S8N A;  4ESB A;  2GXB A;  3ROU A;  2XAF A;  3DF8 A;  3EDP A;  4U88 A;  5HLI A;  2PFB A;  3TOA A;  1VTN C;  1R36 A;  4EM1 A;  4JQF A;  3FXQ A;  3KLN A;  1ODD A;  3ZMT A;  5AIP A;  3GZ6 A;  4M73 A;  4IRH A;  1HW5 A;  2Q2E A;  4RS8 A;  4RB3 C;  3R60 A;  4CZZ A;  1BOA A;  2MBF A;  1G6N A;  2L01 A;  2YX7 A;  3H3U A;  2Q8K A;  3J81 Z;  2P5K A;  5A2Q K;  2K02 A;  3R0A A;  1Z1D A;  4MEY F;  2K7L A;  1HKS A;  2FU4 A;  5HS8 A;  4L18 B;  5K1Y A;  4YIF A;  2P7C B;  3MQ0 A;  2NAZ A;  3TO9 A;  5LEK A;  3CUQ A;  3HRM A;  3LWF A;  3I58 A;  1R1V A;  3K1M A;  2M8E A;  4CYD A;  2ZXJ A;  1LEA A;  5HDN A;  4KNY A;  2EB7 A;  2Y0M A;  2Z5U A;  1WQ2 A;  4YFX F;  1FYK A;  2OZU A;  1IXR C;  1WWX A;  1ZG1 A;  5HVQ C;  3FM3 A;  5D5X B;  2P5V A;  2QWW A;  1HXD A;  3KZZ A;  1B59 A;  4O6J A;  2QQB A;  3Q5F A;  3HHG A;  4A0Y A;  2XUB A;  1LEB A;  1BI2 A;  4AIK A;  2E1N A;  5BPI A;  2DAO A;  4G8X A;  3Q9V A;  4Q47 A;  1YTY A;  2H27 A;  5E18 F;  3ML6 A;  1CGP A;  3GUD A;  2QQ9 A;  3HHH A;  1JXS A;  2NNN A;  2QEN A;  2FBH A;  3F21 A;  2VBX A;  3JSO A;  4AIH A;  5A2Q Z;  3FX3 A;  3LA2 A;  1CF7 B;  5DUK A;  2CQK A;  2WTE A;  2FML A;  4PGH A;  1RZ4 A;  4DQ2 A;  3FMS A;  3REO A;  1SFE A;  2RKH A;  4H0E A;  4BNC A;  3ECO A;  2ZNZ A;  4KYW A;  2XGX A;  3QP6 A;  3J80 K;  1XSD A;  4XLP F;  2VBY A;  4HA8 A;  5CVI A;  4R8H A;  3M8E A;  4WWC A;  3J7A O;  3L09 A;  1XGN A;  2MH9 A;  2FMY A;  4WK8 F;  2FXA A;  3BDD A;  1U8R A;  2V79 A;  3F3X A;  2GA1 A;  1LB2 A;  2EWN A;  4U7D A;  4FX4 A;  1O7F A;  1XGO A;  2IA0 A;  2JTV A;  3COA C;  1HBX G;  1V4R A;  1QPM A;  1DP7 P;  3M1E A;  5ILS A;  5AON A;  4RGR A;  1J5Y A;  5CVR A;  3LAJ A;  5L3G A;  3PQJ A;  1LDJ A;  4KMF A;  2DLL A;  1DPR A;  5FD6 A;  2VC1 A;  1FY7 A;  2IRF G;  3F72 A;  2P4W A;  2DFI A;  2XRN A;  3HFI A;  3GFM A;  1O3S A;  4EJT A;  2EJR A;  4A6D A;  3R0J A;  3CUQ B;  5ILU A;  3KEQ A;  1F9N A;  1ZAO A;  4U0Y A;  3BWG A;  5D6F A;  5JI6 A;  2RVC A;  2DQL A;  1Z7U A;  3KFW X;  2LF7 A;  5LRS A;  1IAW A;  4IXA A;  3MZY A;  3IL2 A;  2P19 A;  4A5M A;  2D2W A;  4LMY A;  1EH7 A;  5H6R A;  2YX4 A;  1EV7 A;  2DU9 A;  3W6J B;  1XB4 A;  1G4D A;  4L9J A;  4LB6 B;  5DUI A;  2K86 A;  5FD5 A;  4OOI A;  1YIO A;  2YSR A;  4RAY A;  1MJB A;  2ESH A;  4L9V A;  4MNU A;  4ZZD A;  5DYM A;  4YFN F;  4AWX B;  3WGI A;  3WU1 B;  1LQ1 A;  3E5U A;  2HQN A;  2VBZ A;  2ZME B;  2P7V B;  3SXY A;  2AXL A;  3RKW A;  3SZT A;  4XLN F;  3DPT A;  1G3W A;  5D8L B;  1KQ8 A;  2ISZ A;  4QLC U;  2CFX A;  2G9W A;  2FRH A;  2EFO A;  3KLO A;  4M6Y A;  4IPA A;  2K4J A;  3WG9 A;  2QBY A;  2W25 A;  2QYO A;  3M8F A;  2ZO4 A;  3CDH A;  1S7A A;  3KE2 A;  4Z2Y A;  3MZH A;  4HF1 A;  4EM2 A;  2CO5 A;  3K2Z A;  4O5V A;  4IHS A;  2VE8 A;  2UZK A;  1J75 A;  1IXS B;  3HSF A;  1IXC A;  3KP5 A;  3I5U A;  2FNA A;  1R58 A;  4A0Z A;  2JT1 A;  1BC8 C; 
#chains in the Genus database with same CATH topology
 3TO7 A;  1T98 A;  3CES A;  4IO9 F;  3KZI C;  1WJD A;  1B4A A;  2MC4 A;  2M87 A;  1TW2 A;  4ZYE A;  4YEL A;  3JSP A;  1QHH D;  1R6R A;  2OAZ A;  2QLZ A;  3FZV A;  4BDZ A;  2MLK A;  2XRL A;  1ZQ3 P;  2H8R A;  4I2O A;  1MH4 A;  3JRI A;  5ED4 A;  2R5Y A;  5J3L A;  3ZN1 A;  1R1T A;  2E5N A;  3MCZ A;  4FX0 A;  1SD4 A;  3JRE A;  5LHG A;  1SD7 A;  1XX5 A;  3KYD B;  1DDN A;  1WJ5 A;  3MKL A;  1WJC A;  3HTS B;  2VC0 A;  3KCC A;  2YPR A;  1S7O A;  2L5Q A;  2F5C A;  1Z3Y A;  3DV8 A;  3AFH A;  3CMA I;  2RNG A;  2X51 A;  3OYB A;  2IP2 A;  3B73 A;  3I3L A;  4EJV A;  4PJ0 C;  4A3K J;  1Z21 A;  3M9A A;  1TQM A;  1B9M A;  2JJ7 A;  1I3A A;  4Y33 A;  1RET A;  5IT3 A;  4KT6 A;  4RAF A;  2ZC2 A;  1LNW A;  4ZJZ A;  3QU6 A;  1DP3 A;  3WTY C;  2W85 A;  5IYC J;  3H0D A;  5DEQ A;  1Y8R B;  3CJN A;  5L3E A;  2Z9O A;  3E6C C;  5K7H A;  3CCL I;  1OJL A;  4F92 B;  1U5T C;  1R4N B;  1FX7 A;  2XF5 A;  1SD6 A;  1ORK A;  3KP6 A;  3JRH A;  3GTJ J;  4XBF A;  2M5W A;  1EF4 A;  1JTX A;  4L0Z B;  4IEJ A;  4YG2 F;  5JVT A;  3TGN A;  4UB8 C;  5GTI C;  2EV6 A;  4W97 A;  1VQ8 I;  1O3T A;  1FTZ A;  2XAJ A;  2JZY A;  3VYS B;  4E7K A;  1MGT A;  2B0L A;  5HLH A;  5M3M J;  5JHF A;  4BE1 A;  1Q1V A;  5J4V A;  1WGX A;  2GOX B;  2VT3 A;  3BJA A;  3VPR A;  4BDY A;  1HKT A;  4ZTJ A;  3LSR A;  3BZ6 A;  5GAG J;  4A3F J;  1TT5 B;  3S1N J;  2BHZ A;  4D0P A;  2FOW A;  4A3L J;  3DEE A;  3ZQ7 A;  3DQV C;  1VQP I;  5HOD A;  5EGO A;  3K4N A;  2EPF A;  1E3P A;  5J1R A;  3HDD A;  2FNP A;  2MFZ A;  3JAM K;  2EFP A;  1SAU A;  2LSO A;  3S32 A;  1FW9 A;  2F5E A;  1AA7 A;  3LQR A;  1T95 A;  2L9R A;  5LHH A;  3FHZ A;  3JCU C;  5DD4 A;  3LOC A;  2LR8 A;  2RAE A;  1O7L A;  1RRJ A;  2V9K A;  3W2A A;  1X4P A;  1W5T A;  2OZ6 A;  2HYG D;  3ERM A;  3ZQG A;  3SEZ A;  2MG4 A;  4EM0 B;  2VQH A;  2EIN H;  1YW7 A;  1LFU P;  2E2I J;  3HKZ N;  5HLG A;  5E1X A;  3K2A A;  3SJM A;  1MJ9 A;  2ZNY A;  2C6Y A;  4GGG A;  2JSC A;  3OY9 A;  4KFC A;  4XRM A;  1ZRC A;  4R1H A;  1CF7 A;  2OUM A;  5LEJ A;  2EFW A;  1R5H A;  1P4X A;  2Y31 A;  1O57 A;  4LG0 B;  3IH4 A;  5K5Q A;  1YJN I;  1PUE E;  4EGY A;  4BEH B;  4L5J A;  1ONV A;  5DM7 F;  1K6Y A;  2ZXI A;  2KIQ A;  1G3S A;  1K4T A;  3N4M A;  1XSV A;  2O61 A;  5E1Z B;  1LVA A;  3K4K A;  2A69 F;  2KL4 A;  4XLH A;  4J01 A;  1IRZ A;  1HCR A;  1D3Y A;  1FP2 A;  2UXX A;  5IYB J;  3DTE A;  3JW4 A;  4HST A;  3TMO A;  1T0F A;  3A0B C;  3ZRG A;  3AG4 H;  5M5X J;  1N75 A;  4PZJ A;  4ZDL A;  3GTG J;  4CHU A;  5CVJ A;  2VT2 A;  3A1Y A;  4UV9 A;  4J00 A;  2XV4 S;  3C18 A;  2MAB A;  1QHG A;  4UXN A;  2X9D A;  4DJA A;  3DU6 A;  3IWF A;  2BE5 F;  3LL7 A;  1R49 A;  1DGR M;  4XLA A;  5TIS C;  3SFZ A;  4OMZ A;  1U78 A;  1OCO H;  2R0Q C;  2PBI A;  1EA3 A;  1HSJ A;  3OIQ A;  3O6B B;  4GYG A;  3ZMD A;  4J19 A;  2VL8 A;  2Y48 A;  3PIO F;  1I3Q J;  3HTU A;  3BCB A;  2KMU A;  5E8G A;  3L9F A;  1SD5 A;  4HNU A;  3FXL A;  4QSH A;  1RES A;  3RYR A;  5DD8 A;  3CCR I;  5E8I A;  4BHB A;  2COM A;  1LFP A;  4IRI A;  1WSU A;  2VKE A;  2VQG A;  4M9S A;  5HS9 A;  3QOE A;  1MBH A;  3H5N A;  3R4K A;  4BL0 B;  2V1N A;  4RGS A;  5M5Y J;  1FIA A;  3D5L A;  3JAM Z;  1X19 A;  4I01 A;  1ZRE A;  1SAN A;  2LNB A;  4GFB A;  2HOA A;  4LIU A;  3C2B A;  2IEK A;  1ZRD A;  2GIV A;  2WY8 Q;  1FNN A;  4II3 A;  3F9K A;  4KN4 X;  4M3B A;  1HW1 A;  3DTK A;  1W7P A;  4QWQ A;  2VKV A;  3OMY A;  4MQ9 F;  4PGG A;  1G2H A;  1TL8 A;  3CTA A;  5HDG A;  3ZN0 A;  3E5X A;  3IV5 A;  2K9L A;  1U6G A;  1UG0 A;  2HR3 A;  2R5Y B;  1FPQ A;  2EIK H;  3OR2 C;  3QPH A;  1RIO H;  3BR3 A;  2CG4 A;  3BJ6 A;  3PUF A;  2Z16 A;  3IKV A;  3SFI A;  1IG7 A;  3L00 A;  3CJT B;  3LQQ A;  1HST A;  2EV5 A;  4XKC A;  5LBQ A;  3H9J A;  5TRD A;  1WJB A;  4RB2 C;  1WJA A;  1IV8 A;  2CU7 A;  2XAS A;  2YR2 A;  4CA0 A;  4IZZ A;  2M0M A;  4UY8 I;  1FYM A;  3I53 A;  5D8K B;  1YHQ I;  4N4O B;  2IS6 A;  2NS0 A;  1FC3 A;  3TDZ C;  4F3Q A;  2Y9Y A;  3M7G A;  5EG0 A;  2IW5 A;  3VDX A;  2HZT A;  2KIU A;  5CJ9 A;  2Z33 A;  3BY6 A;  2HI3 A;  1RPW A;  1FEX A;  2F2E A;  2M8G X;  5IOY A;  1MMG A;  5JFR A;  1FLI A;  1XPX A;  2E35 A;  2UUZ A;  4HSR A;  5CVV A;  2L2O A;  4KT5 C;  4MGR A;  2V7F A;  1LE8 A;  1E2X A;  4G9Y A;  1VQ7 I;  3PQK A;  3PSF A;  3CMM A;  4YFK F;  4IVN A;  3WGH A;  2FA5 A;  1P9Q C;  4DYR A;  2XB5 A;  2KFD A;  2VB6 A;  4XOT A;  1XLR A;  4CGZ A;  1TW3 A;  4CZC A;  1OQY A;  5D5W B;  4EJW A;  3S14 J;  4U0V A;  4HF0 A;  4YRV A;  2QA4 I;  2ZKZ A;  4RA2 A;  1IC8 A;  2R7O A;  5TJJ A;  3LNQ A;  2L4A A;  3DKW A;  5EDN A;  3RI4 A;  2L54 A;  3T1B A;  1P4W A;  3HUG A;  5D5V B;  2JA5 J;  4BQO A;  1DPU A;  2ME6 A;  4FAS D;  5JVG F;  4KIC A;  2RN7 A;  2IVM A;  4LK0 F;  2VPL A;  3S1R J;  1D1A A;  2A68 F;  3D0S A;  4BBR J;  2M2E A;  2LKP A;  2CW8 A;  2FF4 A;  2Y0S N;  2Z3Y A;  4NC8 A;  4N0B A;  2KIM A;  3LSP A;  4G7H F;  2V6E A;  1IDZ A;  3KYL A;  2I5U A;  3PJR A;  1ZK8 A;  4DOZ A;  5KAF C;  3HSE A;  2ZME A;  3L2V A;  2HKO A;  1IN5 A;  3GTM J;  3HM5 A;  1E3O C;  3G3Z A;  1FJL A;  5K7Z A;  2BBY A;  2DA5 A;  1G3Y A;  1RR7 A;  2L3D A;  5FKN A;  3WU2 C;  4B43 A;  3CLO A;  3AL0 C;  2MGQ A;  4WXH A;  4D1Q A;  3KYC B;  4ZSB A;  3OYM A;  5ICC A;  1R4M B;  2FOK A;  2HVR A;  2WV1 A;  3JTG A;  2FSW A;  2J5P A;  3P5J A;  4P55 A;  2TDX A;  1X1B A;  3WTU C;  2MD5 A;  2DJI A;  2V1D A;  3NEU A;  1BR4 A;  3FXR A;  3F8N A;  3RYP A;  2HKX A;  3CCE I;  1T33 A;  3GTL J;  4Y15 A;  1BIB A;  2MD0 A;  3MKZ A;  3HOT A;  3BPX A;  4OIR F;  2DT6 A;  4MTD A;  4EAT A;  4PJJ A;  1BIA A;  2NVQ J;  1T39 A;  2KZV A;  2DQR A;  9ANT A;  2LMD A;  2AS5 F;  2ADU A;  2FE3 A;  1U9O A;  2DOD A;  3MMY B;  3L2U A;  1K79 A;  3S15 J;  5C44 J;  2XKP A;  3CCU I;  3F8C A;  4S04 A;  3G71 I;  1YRN B;  3RKQ A;  3CCY A;  3BG3 A;  4EQQ A;  1EH6 A;  5J8C A;  1PUF A;  3GBG A;  4CXF A;  2BY2 A;  1SFK A;  1GHC A;  1J59 A;  1ON2 A;  4UUV A;  2OBP A;  4N9H A;  2LG4 A;  3F6O A;  1KYW A;  1KA8 A;  3QWL A;  1ZAR A;  3V8J A;  3WE2 A;  1LDD A;  2QSF X;  5LGU A;  3BRO A;  4PUS A;  4QIW N;  1QQI A;  5JHU A;  1ETY A;  2DFH A;  3BG7 A;  4KIF A;  1X3U A;  4NQW B;  2FUG 2;  3BR0 A;  5E3M A;  4G7Z F;  3I4N J;  3GXO A;  4RB0 A;  1AKH B;  4DNC A;  3DBL B;  4E7H A;  2XF7 A;  1X3Z B;  1XSX A;  3IUO A;  1AHD P;  3LA3 A;  1H9G A;  1REP C;  3A0H C;  1D0Y A;  1R7J A;  3F6V A;  1T2K A;  3HOX J;  2EZK A;  2NS8 A;  2AQE A;  1I6X A;  1UST A;  4LLL A;  1KQ0 A;  4BKX A;  3AAF A;  3DXJ F;  1P7I A;  5FB2 A;  3EUA A;  3K1N A;  1UEL B;  1F5T A;  1FSH A;  3MZ8 A;  1TT0 A;  4I02 A;  2DW4 A;  3GFJ A;  4CCN A;  1HQC A;  5IP6 A;  2D5V A;  5FO5 A;  4RGX A;  1TP4 A;  1V54 H;  1W7P B;  5L3C A;  1H9T A;  2IGK A;  2KHM A;  4HLX A;  1WVR A;  2J5O A;  4XN0 A;  1K78 B;  4XON A;  3HIF A;  1BBY A;  2O7O A;  2NS7 A;  2HOS A;  3HOY J;  2M9H A;  4NDL A;  4LGW A;  3DLL F;  1UMQ A;  2K85 A;  1AU7 A;  3AG1 H;  3CCJ I;  1XS9 A;  5DDG A;  4Y17 A;  2E1M C;  2M7A A;  3HSR A;  2IPQ X;  1SAX A;  2E19 A;  4LK1 F;  1XN7 A;  3KX2 A;  1WPK A;  2JMW A;  2MW8 A;  4G12 A;  2IGO A;  4HV5 A;  4AYB N;  5HDK A;  1IUY A;  2ZFW A;  2EIM H;  4XOR A;  1YFH A;  2IKK A;  3RZO J;  1V5E A;  3OL3 A;  5KVR A;  5KNL A;  1Z3X A;  3FXU A;  2F6C A;  1MSE C;  4MTE A;  1UHW A;  5FKO A;  4ZDP A;  1OKR A;  1H88 C;  1S9H A;  4PK4 A;  4KDP A;  3A02 A;  1ZG3 A;  3K9T A;  1Z91 A;  3HKZ A;  4XSX F;  3A4C A;  3GO5 A;  2DT5 A;  4R79 A;  2KKO A;  3I59 B;  3S17 J;  4D5F A;  2DBB A;  4G6D A;  1JKP C;  4OIN F;  4C30 A;  1DQU A;  3QYB A;  2RGV A;  2ZJR F;  3ZMV A;  1XC5 A;  3E97 A;  1ZGJ A;  4HX8 A;  5F1R A;  1FYL A;  3OYF A;  3U1D A;  1KZH A;  3FM5 A;  3JTH A;  2VXD A;  4ZYG A;  3CUO A;  2BW3 B;  1ETQ A;  2RRE A;  1S5L C;  3V7R A;  4A69 C;  4E7L A;  3P9K A;  2DMN A;  2DDB A;  3GTQ J;  3JRA A;  1IO2 A;  1U3E M;  2WA0 A;  4LOC A;  3G1L A;  2Y75 A;  4OIP F;  4E4H A;  1HW2 A;  6PAX A;  1MD0 A;  2IXS A;  2XIG A;  2O03 A;  1DU6 A;  3F8F A;  2E2H J;  5K7F A;  2Q1Z B;  3S2W A;  2GAU A;  3DEW A;  5AIQ A;  1RC9 A;  2JA2 A;  4IOA F;  1W36 C;  3IRQ A;  3BR6 A;  4PCQ A;  2EZL A;  2FJ1 A;  2E7X A;  3IKT A;  2QF7 A;  2DFF A;  4LG0 A;  5ICE A;  4BEH A;  1W0T A;  1WCM J;  1ACI A;  2R7R A;  3KEO A;  3TP3 A;  3J7Z I;  4UB6 C;  2GBY A;  4D5C A;  3DU5 A;  3L7W A;  4JBA A;  5M3F J;  5B1A H;  2W4S A;  4C3J J;  3S3O A;  4UVB A;  2RC4 A;  1BJA A;  5K5R A;  1AWC A;  2OQG A;  4EMS A;  3E6D A;  2LKX A;  3WTW C;  2ZJP F;  3O3K A;  3Q0V A;  2A6E F;  1W5C C;  1JUS A;  2MH2 A;  3TL4 X;  1ZHF A;  2HTJ A;  3KP7 A;  2KIS A;  3V7S A;  5BPD A;  2QVO A;  2H6C A;  3A03 A;  2B9S A;  3E5Q A;  1KU3 A;  2DOE A;  3CME I;  2MYS A;  4C2T A;  2VN2 A;  2XAU A;  1WRJ A;  3O2P E;  5M5W J;  1VF9 A;  3DWL E;  1T56 A;  3QPL A;  1J0R A;  2F5F A;  1V3F A;  3QPS A;  2VQC A;  1TWF J;  2ESN A;  3EQL F;  3I71 A;  3T0Y A;  2JSP A;  2IT0 A;  5E3O A;  5HOO A;  4I0A A;  2OC6 A;  2OU2 A;  3ZQH A;  1ERD A;  2N8G A;  2ZCW A;  3L2R A;  1ZGA A;  5DCM A;  2DMP A;  2K9N A;  4G94 A;  3W6K B;  2VBW A;  1QO0 D;  3RSN A;  3AG3 H;  3ZCO A;  1F1Z A;  5GPC A;  1JI8 A;  3BG6 A;  2X0L A;  2EFQ A;  1Z6T A;  4B8X A;  1HC8 A;  4M9X A;  2XKO A;  4G7O F;  1D1B A;  1S3J A;  3ZR8 X;  1OCC H;  4RB1 A;  3H3Z A;  4EEF G;  3ERE D;  1MMN A;  3HOS A;  1VQ6 I;  3W6V A;  1MMD A;  2Z99 A;  3BQY A;  1FMW A;  2M0C A;  3H35 A;  1RUO A;  2EA2 A;  3Q9S A;  1ULY A;  5FFZ A;  1B8I B;  5FLV A;  2ZXH A;  4Z6Y A;  3P9C A;  3C7J A;  2ISY A;  3EPZ A;  1W36 D;  2P8T A;  3TBI A;  1Y0N A;  4E7I A;  3BOQ A;  1CQT A;  4BQN A;  1Y0U A;  4UUT A;  3O8G A;  2EQR A;  3TP0 A;  3IAS 2;  2VUM J;  3H92 A;  1OYI A;  2ICW G;  5IT9 K;  4Y13 A;  4A12 A;  3SQN A;  1JGG A;  2XDV A;  1X2N A;  2GZW A;  1O4X A;  3R6S A;  4A3I J;  2ECB A;  4A3J J;  1K61 A;  3BTJ A;  5E79 C;  4XQF A;  1MND A;  4XOP A;  3CCQ I;  1GUU A;  1MKM A;  4XKV A;  2V9P A;  1VQK I;  4UVA A;  3KIO A;  5BS6 A;  1G8X A;  4I76 A;  4XLC A;  4HNT A;  2GM4 A;  4BQQ A;  4OMY A;  3LSK A;  4GXO A;  1YX5 A;  2HYJ A;  1ITY A;  1USS A;  2EZI A;  2X1E A;  4AC0 A;  1JJ8 C;  5FLX K;  1UJ8 A;  1R00 A;  2CSO A;  4EV0 A;  1IRX A;  4U7B A;  1N25 A;  1KU7 A;  4OU0 A;  3LSJ A;  4KIT B;  1KGS A;  2QSH X;  4PDK A;  2R7D A;  4IOC F;  2K9Q A;  3OOU A;  3RPU D;  1A5J A;  3JRB A;  1WHU A;  2NVU B;  4ENN A;  3T8T A;  2AQF A;  1MNM C;  3WTZ A;  3G4S I;  1MJA A;  3AG2 H;  5DV5 A;  1H0M A;  3LSH A;  2R7U A;  3K1P A;  3T8R A;  1MW7 A;  2R7Q A;  1PDN C;  2P5L C;  1Y6I A;  3QOP A;  1E17 A;  3ASO H;  2FX0 A;  1WJE A;  2EZH A;  2MLG A;  3CJR B;  3B6A A;  3DDV A;  5FGM A;  1T0F C;  3BP8 A;  1U8B A;  1HKQ A;  3JRC A;  2Y0S A;  4CIC A;  1ZG5 A;  2JA6 J;  1W0U A;  4DYQ A;  1PP7 U;  4FHT A;  2PLY A;  1FT9 A;  2GA2 A;  2O0Y A;  2QEX I;  3CO6 C;  2JRM A;  3IWZ A;  4A5N A;  2DTZ A;  1U9N A;  3PNV A;  4OIQ F;  1OR7 A;  1WI3 A;  4RDU A;  1ZRF A;  5IPA A;  3SDG A;  3LSM A;  2L9V A;  3KEY A;  2H6B A;  3HC7 A;  1LUJ B;  1LKX A;  2DTR A;  1UZC A;  4V2G A;  1PP8 F;  1IN7 A;  2FQ3 A;  4CCO A;  3WTV C;  3WTT C;  4BXU A;  3LFU A;  3VYT B;  4RAG A;  1TWH J;  2ECC A;  3ZQQ A;  2X48 A;  1D0Z A;  4Y3O A;  1RUN A;  5E20 A;  3W3C A;  2LD5 A;  4C3H J;  1GV2 A;  3MFK A;  4IX7 A;  3BTL A;  2IA1 A;  1MSF C;  4Q5S F;  5FKL A;  4AVP A;  2L9S A;  2HYF A;  3N97 A;  1OCT C;  5J4Y A;  4ENM A;  1APL C;  5DS9 A;  2CGP A;  1ETK A;  1UHM A;  4AUX A;  1JHH A;  2VE9 A;  2D1V A;  2CYY A;  3H0G J;  3OV8 A;  1GVJ A;  3S2D J;  2L02 A;  1BC7 C;  1ON1 A;  2D1H A;  3HJE A;  3K0L A;  3TQN A;  1JD3 A;  4M6X A;  2BVL A;  2PX9 A;  2DYR H;  3SEQ A;  2E34 A;  4XRS G;  5IT9 Z;  1MNE A;  4CYC B;  5CQE A;  4IL6 C;  4CH7 A;  3KET A;  4IKF A;  4Y52 J;  1TNT A;  3CCV I;  4M72 A;  2VJ5 A;  3WHC A;  1OCP A;  2YU9 J;  2O8X A;  1MBJ A;  5KK1 A;  3EYY A;  3GFL A;  3HRS A;  1U2W A;  4LD5 A;  2QGU A;  5TGT A;  3NRV A;  4HV6 A;  1UG2 A;  3ELK A;  1ZLK A;  2B7E A;  1W1W E;  2GXA A;  1E3H A;  1I6H J;  2VON A;  3GTP J;  2WV0 A;  3AKZ A;  5FLX Z;  1BI0 A;  3S3M A;  2IS1 A;  3N05 A;  3FK6 A;  3K7A J;  2PI0 A;  4BYY A;  2G7H A;  2KLO A;  1MBK A;  2Y69 H;  4AD9 A;  3CUQ C;  1ETO A;  1D0X A;  1YRN A;  2HXI A;  3LAP A;  3OL4 A;  2X6X A;  4W1U A;  5CVU A;  1Z9C A;  1NTC A;  3L5Z A;  1XMA A;  5CYV A;  2L0K A;  1JTY A;  2L4M A;  2LVS A;  2KRH A;  2DJN A;  4HAM A;  1BOB A;  1KU9 A;  4NQW A;  5FRM A;  2F48 A;  1S6L A;  2KIF A;  2OTL I;  4I0B A;  5DCM B;  1D8K A;  1XGS A;  1AKH A;  4I99 C;  1I5Z A;  1KYZ A;  1X2M A;  4U87 A;  4HBL A;  3ESW B;  2X6O A;  5F0C A;  3TW7 A;  2DDA A;  1I50 J;  1Y39 A;  1I1S A;  1TBX A;  4X0G A;  2YU3 A;  2W48 A;  2L7M P;  3L2C A;  3C1D A;  3CNV A;  4DBR A;  2HDD A;  1O3Q A;  4LG3 A;  2KJB A;  4IQJ A;  4WXC A;  3OYL A;  2ZSI B;  1QBJ A;  4ESJ A;  4FT8 A;  1QGP A;  4F52 A;  2Y2Z A;  3VFZ A;  4AYB A;  1IDY A;  2QQ8 A;  4Y4R A;  2W84 A;  2RA5 A;  4UUS B;  1K78 A;  2DOA A;  4N4N B;  5KCM A;  1C0W A;  1UHS A;  5F27 A;  3FK7 A;  4XN3 A;  5FJ8 J;  2ZME C;  2BXZ A;  2LY2 A;  2A07 F;  4BBS J;  2HDC A;  2R7Z J;  3HYI A;  1FSE A;  2X6Y A;  2P6T A;  4M74 A;  3I56 I;  4WCG A;  1WI9 A;  1SC7 A;  1G3T A;  1PYV A;  3QYE A;  1T6S A;  5D5U B;  3GX4 X;  2HWV A;  1HDP A;  3QRF F;  2FBI A;  2VI6 A;  2QQA A;  4ASN A;  1R23 A;  1FOX A;  5LLQ A;  5EJC A;  1YS7 A;  2HVQ A;  3HOW J;  5F64 A;  2A61 A;  3GEZ A;  1W5S A;  2MSY A;  5KAI C;  3B02 A;  3MEX A;  1RI7 A;  2QZ8 A;  4CDG A;  3DBR B;  1BL0 A;  5IY5 H;  1G1B A;  4P9F A;  4BQA A;  2QCO A;  3VSL A;  3K70 C;  2DK5 A;  3I59 A;  1A31 A;  3U21 A;  2BGC A;  2HPI A;  1Z77 A;  2V1U A;  4EJU A;  1FWZ A;  2IBD A;  3RZD J;  1QZY A;  5GAH J;  2ZB9 A;  3TKY A;  2M1B A;  2WWY A;  1J7K A;  3QAH A;  1FOK A;  1QVU A;  4A3M J;  2BW3 A;  3ZPL A;  2E1O A;  3E6M A;  1STZ A;  2PMZ N;  4L5E A;  1RKW A;  5DTD A;  4ZZL A;  4XNF A;  2NRA C;  1D5V A;  1QNT A;  2CW7 A;  5BMZ A;  1FBQ A;  4L5I A;  4YII A;  4ZYD A;  2JRT A;  3F22 A;  3V8K A;  4LLG F;  4ENJ A;  2IJL A;  4Y7N J;  3CD6 I;  4I98 B;  3CJQ B;  2R3S A;  2ELK A;  2OPT A;  5EEH A;  1Q1H A;  4E6K G;  5IP9 J;  4XSZ F;  1F43 A;  2L7K A;  4GYI A;  2BY1 A;  3T5X A;  4RLQ A;  1Y8Q B;  1X58 A;  3QOD A;  4HOB A;  1XG1 A;  2AXT C;  2PJP A;  3HOU J;  3VOD A;  4HQE A;  2E7W A;  1F36 A;  1IN6 A;  3BPV A;  4BH9 A;  2A3S A;  4GCV A;  5IP7 J;  1L3L A;  3A2K A;  4XLE A;  3ULQ B;  1SMT A;  3OYE A;  2GXG A;  4HLY A;  3L2W A;  4GDF A;  5CLS A;  1I1G A;  3OS2 A;  3HOV J;  2F5D A;  1YYV A;  4IF4 A;  3BR5 A;  2EBI A;  1NHA A;  1ZKG A;  3I9V 2;  2IAI A;  1FOW A;  1GXQ A;  3GZN B;  4ON0 A;  2CQQ A;  3RQ4 A;  4FTH A;  4B44 A;  1SMY F;  2XAQ A;  1YW9 A;  2NYX A;  3FXJ A;  1P7J A;  2OQR A;  2VJJ A;  2ETH A;  4XRF A;  5L3F A;  4HNV A;  5ILV A;  4BE0 A;  2V9V A;  2NVX J;  1SEU A;  2ZBK A;  2OTJ I;  3JRF A;  2MC3 A;  2ZJQ F;  2L7F P;  3F8L A;  3ZMZ A;  2K5C A;  4S05 A;  1BW5 A;  1WH5 A;  3PNY A;  1Y1V J;  2QM3 A;  3HG9 A;  1KON A;  2V1X A;  2Q0O A;  3K70 D;  2UXN A;  3O8H A;  3GFI A;  1VQO I;  4NHJ A;  3DKY A;  4WXD A;  5DCF A;  1NG7 A;  1VZ0 A;  3MAJ A;  3ASN H;  3BTI A;  3WGG A;  4B3A A;  5ERI A;  2ME0 A;  4HX4 A;  3TOB A;  2E71 A;  4ZH4 F;  1A6Q A;  1VQ4 I;  5J47 A;  3LFK A;  4BUP A;  5FKM A;  3E3V A;  2PG4 A;  5CKT A;  4O3M A;  4GO1 A;  4UNO A;  1G81 A;  1IRF A;  3HXL A;  2LRD A;  3FWE A;  2KQR A;  2DPD A;  2H1K A;  3H9G A;  5LD2 C;  4ETS A;  1T38 A;  1B8I A;  1D8J A;  4ITV A;  3F8M A;  3HZJ A;  3BZC A;  3CCM I;  3HB9 A;  1U5T B;  1DU0 A;  1VQ9 I;  3QP5 A;  1QZZ A;  2UWM A;  2XPU A;  3DP7 A;  1BM9 A;  2LC2 A;  4WF2 A;  3H5R A;  3ABM H;  4BY7 J;  2BY3 A;  4A2U A;  2FA1 A;  3KP3 A;  4KN7 X;  4LJZ F;  4MIM A;  1TWC J;  2O5R A;  2Z2S B;  4IQ4 A;  3SHF A;  3GW2 A;  3LA7 A;  1L0O C;  3H36 A;  2JVG A;  1UB9 A;  2A5Y B;  3K4C A;  2OA4 A;  2W24 A;  1NK3 P;  2A6H F;  2LY9 A;  1OLT A;  3Q0U A;  4KUM A;  5EYR A;  4LB5 A;  3GTK J;  2DMQ A;  3ABT A;  1D1C A;  1MZB A;  2D45 A;  1FZP B;  1ZLJ A;  4RM3 A;  1K4S A;  2LYC A;  2BEO A;  4KA4 A;  5HS7 A;  4P5O A;  3FMR A;  1WKM A;  5EZG A;  2LK2 A;  2HTS A;  4TV7 A;  2K27 A;  1ZYR F;  4LLN A;  4MFD A;  3VSK A;  2MA3 A;  2PN6 A;  4YEJ A;  4MO7 A;  3MD2 A;  2G7U A;  4EGZ A;  5B66 C;  3Q0W A;  3RIR A;  2RQQ A;  3IC7 A;  1A36 A;  5JLW A;  3V4G A;  4M3G A;  2HFH A;  2LF8 A;  1QVT A;  1UFM A;  4NC7 A;  2L9N A;  2W1O A;  3C2G A;  3A01 B;  3GLX A;  1YX3 A;  3WHB A;  2WAQ N;  3NWT A;  2JK3 A;  2NOG A;  4Q4Z F;  2JPB A;  2F4M B;  4KIG A;  5GAE J;  3OIP A;  2H94 A;  3G1O A;  2XC7 A;  1MH3 A;  1J09 A;  1A04 A;  1OPC A;  2E36 A;  2KJC A;  2JUG A;  3SYT A;  2Q2E B;  2CS3 A;  4P9U A;  3NAU A;  3RKX A;  2HGC A;  4MHG A;  3TDU C;  3F8B A;  1MIJ A;  5K5O A;  5ICG A;  1NH3 A;  1A35 A;  2IGN A;  2DA6 A;  2QSG X;  3ZXS A;  2A5W A;  2XSJ C;  1K83 J;  4BHC A;  1OMI A;  3DCF A;  1XCV A;  2O3F A;  2CWE A;  3MN2 A;  1YS6 A;  1H89 C;  2ZSH B;  3RDI A;  1XCB A;  2DK8 A;  1JT6 A;  3OYC A;  4UHT A;  1GXP A;  3BCA A;  3I64 A;  3PO3 J;  3IHU A;  2IS4 A;  2OGG A;  2X1C A;  3KP4 A;  4ZC3 A;  5GP9 A;  3FXM A;  1HOM A;  2M45 A;  2HQ5 A;  2PEX A;  2ZJ2 A;  3ZGK A;  1KQ9 A;  3D1N I;  2O6G E;  4EJO A;  4XIC A;  3PFI A;  1P4A A;  4HPQ A;  3QU3 A;  2DO7 A;  2XRO A;  1S29 A;  2W57 A;  3ZOB A;  3DEU A;  1FBU A;  1KU2 A;  3GCM A;  2HQR A;  3BQZ A;  4CYC A;  5ICF A;  3QQA A;  3W2W A;  2LTP A;  2AHC A;  1B6A A;  1GLN A;  4UVC A;  2WC2 A;  3G73 A;  1Z6R A;  3BR2 A;  3J80 Z;  2KDZ A;  2CQ7 A;  4HX7 A;  3RCO A;  2OOI A;  2XAG A;  4DIQ A;  3LSI A;  4JK1 X;  2NNY A;  3ECH A;  2R7T A;  2HDW A;  5H20 A;  4DGW B;  2JPC A;  3WU0 A;  3FHN A;  1TQP A;  2KRF A;  2XGC A;  3P9I A;  3U9G A;  3HBL A;  2E1C A;  1N78 A;  5H6Q A;  1IRG A;  2A05 A;  2RNJ A;  1OYY A;  4XR6 A;  3QPT A;  2IA2 A;  3H3V K;  4MEX F;  3F0C A;  4L9N A;  2LRE A;  3R61 A;  3WOD F;  1G59 A;  2R7W A;  1WH7 A;  3K69 A;  2F4O B;  4HDU A;  4HQM A;  3NQO A;  4G6Q A;  4UV8 A;  1MBE A;  1B1B A;  1ZN2 A;  2KZG A;  4L0Y B;  1YIT I;  2FEZ A;  2EK5 A;  3MWM A;  4BAY A;  2NWI A;  1J2X A;  4IJA A;  2M30 A;  2PMH A;  4HDV A;  1IF1 A;  4A3G J;  3KZY A;  4L9T A;  3IH2 A;  5HLT A;  2E5Z A;  1Z05 A;  4AU7 A;  3DPL C;  2DPU A;  4WX9 A;  5GAD J;  2VOP A;  4HZF A;  3IH3 A;  3OSF A;  1R1U A;  2PMU A;  3WE3 A;  4C9Y A;  1P6R A;  1MDM A;  4FIS A;  4CUG A;  1Z7L A;  3P7N A;  4BJT A;  1BI3 A;  1LJ9 A;  3HEF A;  3HL2 A;  1TNS A;  1ENH A;  2X4H A;  4HW0 A;  1GDT A;  3GZ5 A;  1XDU A;  1XTA A;  4II2 A;  1OR7 C;  2CMP A;  2DN0 A;  2X1D A;  1IV6 A;  3U2R A;  4CCL A;  5F6F A;  3ZP5 A;  4HF2 A;  3PO2 J;  2EV0 A;  2CV2 A;  1IN8 A;  2BVM A;  3MKW B;  5E17 F;  3F23 A;  3E6B A;  4RAZ A;  4AID A;  2LY1 A;  1JUM A;  2CH0 A;  2RDP A;  1IN4 A;  2BHY A;  3OYH A;  3C3W A;  3W2V A;  2PQ8 A;  4JX4 A;  4UUS A;  3OS1 A;  2HS5 A;  4M9Z A;  3ABU A;  2DMU A;  1OYW A;  3FF5 A;  3GYH X;  2H09 A;  3CC4 I;  3LST A;  4IHW A;  1FP1 D;  4U0W A;  4ZYH A;  4JYK A;  5KHD A;  3HGY A;  3FKI J;  1YO5 C;  4FET A;  3PIP F;  3OYK A;  3Q3S A;  1R22 A;  4Q48 A;  1HDD C;  2GIZ A;  4OIO F;  3BG9 A;  1ZH5 A;  5J8F A;  1OFC X;  1W4M A;  2F5V A;  5LGN A;  2OV7 A;  2R5Z A;  1QRY A;  1TTY A;  2CQN A;  3DFG A;  2WB1 N;  2LLK A;  2V6C A;  4BHP A;  1ZEL A;  2KDO A;  3UKG A;  1YLF A;  2RQP A;  1BI1 A;  5D4S A;  1P92 A;  1J9I A;  2PMZ A;  1U0J A;  4PSW A;  4F7Z A;  2NVY J;  1TWG J;  4ESF A;  1R9T J;  1K6O A;  4I09 A;  1GVD A;  3ZQF A;  1B72 B;  1VI0 A;  5C4J J;  1TLH B;  3ISP A;  4NB5 A;  4JOM A;  4BXX J;  1IZ1 A;  4A6E A;  4C3I J;  2CFO A;  5F0F A;  3S8P A;  3CO7 C;  3TO6 A;  4LFU A;  5L3D A;  3GVA A;  2ELH A;  4XKB A;  3CQZ J;  3RQI A;  3ZQL A;  3V7C A;  1YQA A;  5D4R A;  5F04 A;  4P96 A;  5JR3 A;  2NOJ B;  5B5E C;  2M4G A;  2ZFU A;  2HPM A;  1XMX A;  2YS9 A;  2V26 A;  1B9N A;  3PFY A;  4V19 K;  3AL0 B;  4KMU X;  1AOY A;  4RM2 A;  3BTC A;  4KJZ A;  2WAE A;  3FMQ A;  1MMA A;  1XD7 A;  5GPA A;  3X2Q H;  2EH3 A;  3HRU A;  1O3R A;  2KT0 A;  2ELJ A;  2XPV A;  1SVO A;  5E1W A;  2AO9 A;  2H8W A;  3ABK H;  2LH9 A;  4RGU A;  3IRR A;  2DA3 A;  1XGM A;  1DUX C;  3LHE A;  2TCT A;  3EUH A;  3BJO A;  3SZP A;  3RPU A;  4M71 A;  4PFO A;  2K4B A;  1NK2 P;  2DFE A;  3OWT A;  3M8J A;  2O9L A;  2VOO A;  5FRO A;  3WTS C;  3JRD A;  1IW7 F;  5J1U A;  1K7A A;  2M3A A;  2RV8 A;  4IHT A;  1JE8 A;  1EJ9 A;  1SFO J;  1RNL A;  1S7E A;  3EYI A;  2XSD C;  4IHV A;  1EKE A;  2XVC A;  2XAH A;  1R5I D;  1N77 A;  3E0J B;  1ETV A;  4B3X A;  4PFP A;  4QPO A;  3WTX C;  3E7L A;  2PKH A;  1BA5 A;  4RBO A;  3VYU B;  1JHF A;  3RPQ A;  3HRT A;  2XHK A;  4K2E A;  1LDK B;  1QPI A;  1MBG A;  3S1Q J;  2FBK A;  3CZ6 A;  3OYN A;  4KIB A;  2R7X A;  5LHI A;  4PJL A;  4ZSK A;  3ZMU A;  3CF2 A;  3VB2 A;  3RJP A;  1ETX A;  2JN6 A;  2VOD A;  2GQQ A;  5LRR A;  5BQT A;  1I27 A;  1M1E B;  2P6S A;  5L3B A;  2P0W A;  3EET A;  2LBF B;  3ZMS A;  1QU3 A;  2OJE D;  3GWZ A;  2VKH A;  5BOX A;  2OD5 A;  5EEG A;  2Y9Z A;  1EH8 A;  1X3W B;  2LDU A;  5FFX A;  5BNG A;  3H9Q A;  5EZH A;  1FBS A;  2JUC A;  3KP2 A;  2UV1 A;  3J81 K;  4AM3 A;  1SVM A;  2GWR A;  4MQV A;  4ZSI A;  3H5A A;  1I39 A;  1YG2 A;  3FBN B;  2HEO A;  2QUF A;  1P2F A;  3HPH A;  2M7B A;  2EA4 A;  4ZTF A;  2R93 J;  2LFB A;  2BV6 A;  1XDS A;  4LIV A;  4XMY A;  4QTR A;  4N9I A;  4X1E A;  3OYG A;  2DI3 A;  2STT A;  2XGD A;  3RTR A;  1Y1W J;  4OWR B;  2WY7 Q;  4E70 A;  4XKW A;  2OCE A;  2EIJ H;  4ZDO A;  1GV5 A;  2DMT A;  2EFN A;  2WAF A;  4BXF A;  4ENK A;  1TQI A;  3IP4 B;  2ACJ A;  4HRI A;  3OIO A;  4D9J A;  1U5T A;  2BZT A;  1F4K A;  2K9S A;  4EVI A;  4A0X A;  4B4C A;  1BN5 A;  2DYS H;  2BYV E;  1SFU A;  4A3C J;  2STW A;  2VXZ A;  4ANJ A;  3G1M A;  4BJ6 C;  1JKO C;  1YW8 A;  4CO8 A;  2B63 J;  2HOE A;  3G6E I;  3CC2 I;  1DGW Y;  1UCR A;  4MFE A;  2X85 A;  2E2J J;  5LGT A;  3J7A Y;  2PJR B;  2E1M B;  4YIR X;  3I4P A;  2EIL H;  3FXK A;  3M4O J;  3I54 A;  3RKY A;  2DT7 B;  3VOE A;  2OCC H;  1UAA A;  4A3B J;  4AIJ A;  5J6X A;  4FCY A;  1MDM B;  4I7H A;  4RLF A;  4HYE A;  3LSG A;  2WAQ A;  5D6E A;  3I4M J;  1XMK A;  2VJI A;  2Z1D A;  3VEP A;  3V8L A;  2VPR A;  1R5G A;  1SFX A;  4BS9 A;  2VKD A;  1JUP A;  1JGS A;  1T08 B;  3OYD A;  4B09 A;  1RR8 C;  5J40 A;  1YOV B;  2CW0 F;  2M4K A;  3I0T A;  2QBY B;  3B6C A;  3FIS A;  5C4X J;  1W7P D;  3OOP A;  1TT8 A;  4IRG A;  4F93 B;  2R7F A;  1JT0 A;  1LPQ A;  4GRI A;  3GF2 A;  4PJN A;  2DA7 A;  4NNJ A;  1S8N A;  4ESB A;  3A01 A;  2GXB A;  2XAF A;  3EDP A;  3DF8 A;  4U88 A;  5HLI A;  3ROU A;  5FRN A;  2PFB A;  3TOA A;  2DA4 A;  3ABL H;  1VTN C;  1R36 A;  4CCJ A;  4EM1 A;  4JQF A;  3FXQ A;  3KLN A;  1OCR H;  1ODD A;  2DXI A;  2R7V A;  1X4O A;  5AIP A;  3ZMT A;  3GZ6 A;  2P81 A;  4M73 A;  2V4J C;  4IRH A;  4FE7 A;  4BJ5 C;  2YUS A;  1Z0X A;  1WJF A;  2LKS A;  1HW5 A;  2Q2E A;  2G0E A;  3GME A;  4RS8 A;  4RB3 C;  5HNF A;  3CP2 A;  4XID A;  2XF6 A;  3R60 A;  4CZZ A;  2R5Z B;  1BOA A;  3K6G A;  2MBF A;  1G6N A;  2L01 A;  2YX7 A;  2KP6 A;  3H3U A;  2Q8K A;  4BAC A;  3J81 Z;  1SVL A;  3PSI A;  5JLX A;  3UR3 C;  2P5K A;  5A2Q K;  3BG5 A;  2K02 A;  4DZJ A;  4CCM A;  3R0A A;  4B47 A;  2CUF A;  1Z1D A;  5C3E J;  2ID3 A;  4MEY F;  3V42 A;  1D5Y A;  2K7L A;  2HQA A;  1HKS A;  1LVK A;  2FU4 A;  3U1K A;  5HS8 A;  4L18 B;  2LOO A;  5K1Y A;  5CPR B;  4YIF A;  2P7C B;  3MQ0 A;  2BY0 A;  2NAZ A;  4S0H B;  2LP0 A;  3TO9 A;  2QKM B;  3BC8 A;  5LEK A;  3CUQ A;  1PVE A;  3NAR A;  3HRM A;  2DCE A;  3LWF A;  3I58 A;  5E3L A;  3NWS A;  1R1V A;  1BR2 A;  3K1M A;  2M8E A;  4CYD A;  2ZXJ A;  3CC7 I;  1LEA A;  1VQL I;  2X6W A;  4DZP A;  5HDN A;  5DM6 F;  4KNY A;  1S72 I;  3D5S C;  3LMM A;  2EB7 A;  4HEA 2;  2Y0M A;  2Z5U A;  1X1C A;  4E7Z A;  1WQ2 A;  2K9M A;  4YFX F;  1E0E A;  1IJW C;  1V5F A;  1FYK A;  4XLF A;  1HLV A;  2OZU A;  1IXR C;  2W00 A;  1WWX A;  3HGG A;  1ZG1 A;  5HVQ C;  2I8D A;  3FM3 A;  3S3N A;  5D5X B;  3DBH B;  2W82 A;  2I10 A;  2P5V A;  2QWW A;  3OR1 C;  1HXD A;  4E7S A;  3JR9 A;  3KZZ A;  1X1A A;  1B59 A;  3VWB A;  4KIS A;  1FTT A;  3BLY A;  1OIS A;  4JX6 A;  4O6J A;  3SZG A;  3CLQ A;  3ZQC A;  2QQB A;  3Q5F A;  3DKX A;  3HHG A;  4A0Y A;  2WAD A;  2XUB A;  3FIW A;  1BI2 A;  1LEB A;  5EGO B;  4AIK A;  2E1N A;  2CRG A;  4FQG A;  4FE4 A;  2ZXW H;  4PJM A;  3UNG C;  5BPI A;  2DA2 A;  2CJJ A;  2DAO A;  4G8X A;  3Q9V A;  4G6T B;  4Q47 A;  1YTY A;  3DTI A;  1TWA J;  5FLM J;  5F0H A;  2H27 A;  3TED A;  3K10 A;  5E18 F;  3ML6 A;  5F1J A;  1PJR A;  3OYI A;  4B48 A;  1CGP A;  3GUD A;  2QQ9 A;  3HHH A;  1JXS A;  2NNN A;  2QEN A;  4BE2 A;  2HVS A;  1YE9 A;  2FBH A;  2O8K A;  3OYJ A;  3F21 A;  2VBX A;  3JSO A;  3M1C A;  4BU2 A;  4B1R A;  4AIH A;  3J7Y J;  5A2Q Z;  3FX3 A;  1R71 A;  2WBM A;  3LA2 A;  4QPQ A;  1CF7 B;  1IGN A;  3EUK L;  1JKR C;  5DUK A;  2VLA A;  2CQK A;  2TRT A;  3PL8 A;  2WTE A;  3E1S A;  1V5G A;  2OF7 A;  1TC3 C;  2FML A;  2XGE A;  2VAS A;  4PGH A;  2WB1 A;  2JA7 J;  4AVZ A;  4X6A J;  2IS2 A;  1RZ4 A;  4DQ2 A;  3C2H A;  3FMS A;  3REO A;  1SFE A;  2BXY A;  2RKH A;  4H0E A;  3OYA A;  4BNC A;  3ECO A;  4BGD A;  2ZNZ A;  5LFA A;  1A6I A;  4JP0 A;  1HF0 A;  4KYW A;  4P1W A;  2XGX A;  3OSG A;  5B1B H;  3QP6 A;  2HNH A;  3PM1 A;  3SDB A;  3J80 K;  2W7N A;  4NC6 A;  1XSD A;  5IOZ A;  1ZR2 A;  4XLP F;  1WZ2 A;  2VBY A;  3K4M A;  4HA8 A;  3JRG A;  2L7Z A;  5CVI A;  4R8H A;  3TW6 A;  4PSX A;  3PNT A;  3M8E A;  4WWC A;  3J7A O;  3L09 A;  3MKY B;  1XGN A;  1X1D A;  3S2H J;  2MH9 A;  3S1M J;  1B72 A;  2FMY A;  4WK8 F;  2FXA A;  3BDD A;  5EF6 A;  2DOF A;  4A3D J;  1VND A;  2XPW A;  4E7J A;  1U8R A;  4XM3 A;  2V79 A;  3F3X A;  2CUE A;  4V2F A;  2HXO A;  1VQ5 I;  2GA1 A;  1LFB A;  1LB2 A;  1MMS A;  2EWN A;  3ONQ A;  2JWT A;  4U7D A;  1JJ6 C;  4A93 J;  2FD5 A;  3KPH A;  1O7F A;  4FX4 A;  1QA6 A;  2Y30 A;  1XGO A;  2IA0 A;  3VYR B;  2R92 J;  1YJ9 I;  2JTV A;  3COA C;  1HBX G;  2K40 A;  1FOY A;  1V4R A;  1QPM A;  1DP7 P;  1YJW I;  3M1E A;  5ILS A;  5AON A;  4RGR A;  1GT0 C;  1J5Y A;  4D7N A;  5CVR A;  2HZD A;  2CV1 A;  3LAJ A;  5L3G A;  3BZK A;  3S93 A;  3PQJ A;  4DYC A;  3FBI B;  3M3Y J;  1LDJ A;  1X1P A;  5E3N A;  4KMF A;  2DLL A;  2AHQ A;  3I55 I;  1DPR A;  2ID6 A;  4XK4 A;  3OS0 A;  5FD6 A;  2CUJ A;  1YIJ I;  2VC1 A;  2A6T A;  1FY7 A;  1FMV A;  2IRF G;  3F72 A;  2P4W A;  2DFI A;  2XRN A;  4M3E A;  3HFI A;  2NXN B;  3GFM A;  4ZYA A;  3CDL A;  1O3S A;  3K4L A;  2KPM A;  3CP8 A;  1T8I A;  4EJT A;  2EJR A;  4C2M J;  4A6D A;  3R0J A;  2HU9 A;  3CUQ B;  4IHY A;  5ILU A;  5EG0 B;  4NBQ A;  4F55 A;  3KEQ A;  1F9N A;  3BR1 A;  1ZAO A;  4U0Y A;  5CQG A;  3DPU A;  3BWG A;  3L2Q A;  5IYD J;  5D6F A;  5JI6 A;  3DLA A;  4LIT A;  2LBF A;  3QYF A;  2RVC A;  1ETW A;  2JVH A;  2XB0 X;  3FKJ A;  5EEA A;  2M34 A;  2DQL A;  2VJ4 A;  1Z7U A;  3HPG A;  3K4B A;  3GTO J;  3KFW X;  1ZGW A;  4CCK A;  1LE8 B;  1VFC A;  2GLO A;  2HOT A;  2QKL B;  3M07 A;  2LF7 A;  5LRS A;  3CMY A;  1IAW A;  4DBQ A;  4IXA A;  2NVT J;  2COB A;  3K4J A;  3HOZ J;  3MZY A;  1QZE A;  1Y56 A;  3IL2 A;  2P19 A;  1POG A;  1WFX A;  4A5M A;  2D2W A;  4F91 B;  4LMY A;  1EH7 A;  3GLL A;  4IHX A;  3S16 J;  1FIP A;  4RMN A;  1OCZ H;  5HNH A;  2CV0 A;  5H6R A;  2YX4 A;  1EV7 A;  2DU9 A;  3W6J B;  1XB4 A;  1G4D A;  4L9J A;  4LB6 B;  5DUI A;  2K86 A;  5FKK A;  5FD5 A;  2GOM A;  4OOI A;  3WG7 H;  2R7S A;  3PUB A;  2BOL A;  5F08 A;  2E60 A;  1YIO A;  2YSR A;  3HUG B;  4RAY A;  1MJB A;  2ESH A;  1IUF A;  1JKQ C;  4L9V A;  4MNU A;  2H1L A;  4M3D A;  4ZZD A;  2JA8 J;  5DYM A;  2CQX A;  4YFN F;  4XRS A;  4AWX B;  4C2U A;  3FDY A;  3WGI A;  1HA8 A;  4JX5 A;  1BJZ A;  3WU1 B;  1LQ1 A;  3E5U A;  1TZL A;  3CF5 F;  2JQ7 A;  2HQN A;  4BY1 J;  1ZTR A;  3G2B A;  2VBZ A;  2ZME B;  4D7M A;  1VQM I;  4DW6 A;  2P7V B;  3SXY A;  4M6V A;  2FQ4 A;  2AXL A;  1YI2 I;  3RKW A;  4CSW A;  2PJR A;  3SZT A;  2K3P A;  4NUB A;  4XLN F;  3DPT A;  3ZQI A;  2F4I A;  1G3W A;  5D8L B;  5J1Y A;  1KQ8 A;  5B3S H;  2IGM A;  2ISZ A;  4QLC U;  2CFX A;  4ABZ A;  2R4G A;  1VQN I;  2DA1 A;  2G9W A;  2KRC A;  1MBF A;  1V55 H;  2FRH A;  2EFO A;  2VIX A;  4H4K C;  3KLO A;  1H8A C;  4HG2 A;  3EUH C;  4M6Y A;  4IPA A;  2K4J A;  3BT9 A;  3D5R C;  1NG6 A;  3WG9 A;  4MLO A;  2QBY A;  2W25 A;  2QYO A;  2VQL A;  3H1C A;  3M8F A;  5GTH C;  1ZR4 A;  1RKT A;  2ZO4 A;  1BW6 A;  3CDH A;  1S7A A;  3KE2 A;  4Z2Y A;  4M3F A;  3MVP A;  3MZH A;  4HF1 A;  4A3E J;  3L1P A;  3FXO A;  4XL9 A;  4EM2 A;  4I6Z A;  2CO5 A;  3K2Z A;  4O5V A;  4IHS A;  2VE8 A;  2UZK A;  3CDI A;  4OAZ A;  1J75 A;  5H2F C;  1IXS B;  3HSF A;  3IAM 2;  1IXC A;  4OAY A;  1Z67 A;  1BR1 A;  3KP5 A;  2K3F A;  3I5U A;  2FNA A;  1R58 A;  2CUZ A;  4A0Z A;  2JT1 A;  3CCS I;  1BC8 C;  1PUF B; 
#chains in the Genus database with same CATH homology
 3TO7 A;  1T98 A;  1B4A A;  2M87 A;  1TW2 A;  4ZYE A;  3JSP A;  2OAZ A;  2QLZ A;  3FZV A;  4I2O A;  2MLK A;  5ED4 A;  3ZN1 A;  1R1T A;  4FX0 A;  3MCZ A;  1SD4 A;  5LHG A;  1SD7 A;  1DDN A;  3HTS B;  2VC0 A;  3KCC A;  2YPR A;  1S7O A;  2F5C A;  3DV8 A;  2IP2 A;  3B73 A;  4EJV A;  3M9A A;  1TQM A;  1B9M A;  5IT3 A;  1LNW A;  3QU6 A;  3WTY C;  2W85 A;  5DEQ A;  3CJN A;  5L3E A;  2Z9O A;  3E6C C;  1U5T C;  1FX7 A;  1SD6 A;  3KP6 A;  4XBF A;  2M5W A;  4L0Z B;  4YG2 F;  5JVT A;  3TGN A;  2EV6 A;  1O3T A;  2XAJ A;  2JZY A;  1MGT A;  2B0L A;  5HLH A;  2VT3 A;  3BJA A;  1HKT A;  3BZ6 A;  4D0P A;  3ZQ7 A;  3DQV C;  2FNP A;  3JAM K;  2EFP A;  2LSO A;  1FW9 A;  2F5E A;  3LQR A;  5LHH A;  3FHZ A;  5DD4 A;  1O7L A;  1W5T A;  2OZ6 A;  2HYG D;  4EM0 B;  1YW7 A;  5HLG A;  5E1X A;  1MJ9 A;  2ZNY A;  2C6Y A;  4GGG A;  2JSC A;  4KFC A;  1ZRC A;  4R1H A;  1CF7 A;  5LEJ A;  2EFW A;  1R5H A;  1P4X A;  1O57 A;  4LG0 B;  5K5Q A;  1PUE E;  4EGY A;  4L5J A;  1ONV A;  1G3S A;  3N4M A;  1XSV A;  2O61 A;  5E1Z B;  1LVA A;  2A69 F;  1D3Y A;  1FP2 A;  2UXX A;  3JW4 A;  1T0F A;  4PZJ A;  4CHU A;  5CVJ A;  2VT2 A;  4UV9 A;  2XV4 S;  3C18 A;  4UXN A;  3IWF A;  2BE5 F;  3SFZ A;  4OMZ A;  1U78 A;  2PBI A;  1HSJ A;  3O6B B;  4GYG A;  3ZMD A;  2Y48 A;  3HTU A;  5E8G A;  3L9F A;  1SD5 A;  3RYR A;  5DD8 A;  5E8I A;  4BHB A;  2COM A;  4IRI A;  1WSU A;  4M9S A;  5HS9 A;  3R4K A;  4RGS A;  3D5L A;  3JAM Z;  4I01 A;  1ZRE A;  2LNB A;  1ZRD A;  2GIV A;  1FNN A;  4KN4 X;  1HW1 A;  1W7P A;  4QWQ A;  4MQ9 F;  4PGG A;  3CTA A;  5HDG A;  3ZN0 A;  3E5X A;  1U6G A;  2HR3 A;  1FPQ A;  3QPH A;  1RIO H;  2CG4 A;  3BJ6 A;  3IKV A;  3L00 A;  3LQQ A;  1HST A;  2EV5 A;  5LBQ A;  5TRD A;  4RB2 C;  2XAS A;  2YR2 A;  1FYM A;  3I53 A;  5D8K B;  2NS0 A;  1FC3 A;  3TDZ C;  3M7G A;  2IW5 A;  2HZT A;  2KIU A;  5CJ9 A;  2Z33 A;  3BY6 A;  2F2E A;  5JFR A;  1FLI A;  5CVV A;  4KT5 C;  4MGR A;  1E2X A;  4G9Y A;  3PQK A;  4YFK F;  4IVN A;  3WGH A;  2FA5 A;  1XLR A;  4CGZ A;  1TW3 A;  5D5W B;  4EJW A;  4U0V A;  4HF0 A;  2ZKZ A;  5TJJ A;  2L4A A;  3DKW A;  3RI4 A;  2L54 A;  3T1B A;  1P4W A;  3HUG A;  5D5V B;  1DPU A;  4KIC A;  2RN7 A;  2IVM A;  4LK0 F;  2A68 F;  3D0S A;  2LKP A;  2FF4 A;  2Z3Y A;  4N0B A;  2KIM A;  4G7H F;  3HSE A;  2ZME A;  2HKO A;  1IN5 A;  3G3Z A;  2BBY A;  2L3D A;  1G3Y A;  3CLO A;  4WXH A;  4ZSB A;  5ICC A;  2FOK A;  3JTG A;  2FSW A;  2J5P A;  4P55 A;  2TDX A;  3WTU C;  2MD5 A;  2V1D A;  3NEU A;  3FXR A;  3F8N A;  3RYP A;  2HKX A;  4Y15 A;  1BIB A;  3HOT A;  3BPX A;  4OIR F;  4MTD A;  1BIA A;  1T39 A;  2DQR A;  2AS5 F;  2ADU A;  2FE3 A;  1K79 A;  2XKP A;  3F8C A;  4S04 A;  4EQQ A;  1EH6 A;  5J8C A;  4CXF A;  1GHC A;  1J59 A;  1ON2 A;  4UUV A;  2OBP A;  4N9H A;  3F6O A;  1KYW A;  1KA8 A;  1ZAR A;  3V8J A;  3WE2 A;  1LDD A;  5LGU A;  3BRO A;  1QQI A;  5JHU A;  4KIF A;  1X3U A;  4G7Z F;  3GXO A;  4RB0 A;  4DNC A;  1XSX A;  3LA3 A;  1H9G A;  1REP C;  1R7J A;  3F6V A;  1T2K A;  1I6X A;  1UST A;  4LLL A;  1KQ0 A;  3AAF A;  3DXJ F;  5FB2 A;  3K1N A;  1F5T A;  1FSH A;  4I02 A;  2DW4 A;  3GFJ A;  1HQC A;  5FO5 A;  4RGX A;  1W7P B;  5L3C A;  1H9T A;  4HLX A;  2J5O A;  1K78 B;  3HIF A;  1BBY A;  4LGW A;  5DDG A;  4Y17 A;  3HSR A;  2IPQ X;  1SAX A;  4LK1 F;  1XN7 A;  4HV5 A;  5HDK A;  1IUY A;  2ZFW A;  1YFH A;  2IKK A;  5KVR A;  3FXU A;  4MTE A;  1UHW A;  1OKR A;  4KDP A;  1ZG3 A;  3K9T A;  1Z91 A;  4XSX F;  3GO5 A;  2DT5 A;  4R79 A;  2KKO A;  3I59 B;  2DBB A;  4G6D A;  4OIN F;  2RGV A;  3ZMV A;  3E97 A;  5F1R A;  1ZGJ A;  4HX8 A;  1FYL A;  3U1D A;  3FM5 A;  3JTH A;  4ZYG A;  3CUO A;  3V7R A;  3P9K A;  1U3E M;  2Y75 A;  4OIP F;  1HW2 A;  6PAX A;  1MD0 A;  2XIG A;  2O03 A;  3F8F A;  3S2W A;  2GAU A;  5AIQ A;  3IRQ A;  4PCQ A;  2E7X A;  3IKT A;  4LG0 A;  5ICE A;  3KEO A;  3L7W A;  4JBA A;  4UVB A;  2RC4 A;  1BJA A;  5K5R A;  1AWC A;  2OQG A;  4EMS A;  3E6D A;  3WTW C;  3O3K A;  2A6E F;  2MH2 A;  1ZHF A;  2HTJ A;  3KP7 A;  3V7S A;  5BPD A;  2QVO A;  2H6C A;  3E5Q A;  1KU3 A;  2VN2 A;  1WRJ A;  3O2P E;  1J0R A;  2F5F A;  1V3F A;  2ESN A;  3EQL F;  3I71 A;  3T0Y A;  2IT0 A;  5HOO A;  4I0A A;  2OU2 A;  2ZCW A;  1ZGA A;  5DCM A;  3W6K B;  4G94 A;  2VBW A;  1QO0 D;  1F1Z A;  2X0L A;  2EFQ A;  1Z6T A;  4B8X A;  4M9X A;  2XKO A;  4G7O F;  1S3J A;  4RB1 A;  3H3Z A;  3ERE D;  3HOS A;  2Z99 A;  1RUO A;  2EA2 A;  3Q9S A;  1ULY A;  5FFZ A;  3P9C A;  3C7J A;  2ISY A;  2P8T A;  3BOQ A;  1Y0U A;  3H92 A;  1OYI A;  5IT9 K;  4Y13 A;  4A12 A;  3SQN A;  2GZW A;  3R6S A;  1MKM A;  4UVA A;  5BS6 A;  4OMY A;  4GXO A;  1USS A;  5FLX K;  1R00 A;  2CSO A;  4EV0 A;  4U7B A;  1KU7 A;  4OU0 A;  1KGS A;  4PDK A;  2R7D A;  4ENN A;  3T8T A;  3WTZ A;  1MJA A;  5DV5 A;  1H0M A;  3K1P A;  3T8R A;  1PDN C;  2P5L C;  3QOP A;  1E17 A;  2MLG A;  3DDV A;  5FGM A;  3BP8 A;  1HKQ A;  4CIC A;  1ZG5 A;  1PP7 U;  4FHT A;  2PLY A;  1FT9 A;  2GA2 A;  2O0Y A;  3CO6 C;  3IWZ A;  4A5N A;  4OIQ F;  1OR7 A;  1ZRF A;  2H6B A;  1PP8 F;  2DTR A;  3WTT C;  1IN7 A;  2FQ3 A;  3WTV C;  4BXU A;  1RUN A;  5E20 A;  3MFK A;  2IA1 A;  4Q5S F;  4AVP A;  2HYF A;  3N97 A;  4ENM A;  2CGP A;  1UHM A;  1JHH A;  2VE9 A;  2D1V A;  2CYY A;  3OV8 A;  1GVJ A;  2L02 A;  1BC7 C;  1ON1 A;  2D1H A;  3K0L A;  3TQN A;  1JD3 A;  4M6X A;  5IT9 Z;  3KET A;  1TNT A;  4M72 A;  2O8X A;  5KK1 A;  3EYY A;  3GFL A;  3HRS A;  1U2W A;  4LD5 A;  3NRV A;  4HV6 A;  3ELK A;  1ZLK A;  2VON A;  2WV0 A;  5FLX Z;  1BI0 A;  2PI0 A;  4BYY A;  2G7H A;  4AD9 A;  3CUQ C;  3LAP A;  5CVU A;  1Z9C A;  3L5Z A;  1XMA A;  5CYV A;  2L4M A;  4HAM A;  1KU9 A;  4NQW A;  1S6L A;  2KIF A;  4I0B A;  5DCM B;  1D8K A;  1XGS A;  1I5Z A;  1KYZ A;  4HBL A;  1I1S A;  1TBX A;  2YU3 A;  3L2C A;  3C1D A;  3CNV A;  1O3Q A;  2KJB A;  4WXC A;  1QBJ A;  4ESJ A;  4FT8 A;  1QGP A;  3VFZ A;  2W84 A;  2RA5 A;  1K78 A;  1C0W A;  2A07 F;  2HDC A;  3HYI A;  1FSE A;  2P6T A;  4M74 A;  4WCG A;  1WI9 A;  1G3T A;  5D5U B;  1T6S A;  3GX4 X;  2HWV A;  3QRF F;  2FBI A;  2QQA A;  4ASN A;  1R23 A;  5LLQ A;  1YS7 A;  5F64 A;  2A61 A;  3GEZ A;  1W5S A;  3B02 A;  3MEX A;  1RI7 A;  2QZ8 A;  4CDG A;  1G1B A;  4P9F A;  4BQA A;  2DK5 A;  3I59 A;  2BGC A;  2V1U A;  4EJU A;  1FWZ A;  1QZY A;  3TKY A;  2M1B A;  2WWY A;  1J7K A;  3QAH A;  1FOK A;  3ZPL A;  3E6M A;  1STZ A;  4ZZL A;  2NRA C;  1D5V A;  1QNT A;  5BMZ A;  3F22 A;  4ZYD A;  1FBQ A;  4L5I A;  2JRT A;  4YII A;  3V8K A;  4LLG F;  4ENJ A;  2IJL A;  4I98 B;  2R3S A;  5EEH A;  1Q1H A;  4XSZ F;  4GYI A;  3T5X A;  4HOB A;  2PJP A;  3VOD A;  4HQE A;  2E7W A;  3BPV A;  1IN6 A;  4BH9 A;  2A3S A;  4GCV A;  1L3L A;  3ULQ B;  1SMT A;  2GXG A;  4HLY A;  5CLS A;  1I1G A;  2F5D A;  1YYV A;  4IF4 A;  1NHA A;  1GXQ A;  4ON0 A;  1SMY F;  2XAQ A;  1YW9 A;  2NYX A;  2OQR A;  4XRF A;  2ETH A;  5L3F A;  5ILV A;  2V9V A;  2ZBK A;  2MC3 A;  3F8L A;  3ZMZ A;  4S05 A;  2QM3 A;  2V1X A;  2Q0O A;  2UXN A;  3GFI A;  4NHJ A;  4WXD A;  5DCF A;  3MAJ A;  3WGG A;  5ERI A;  4HX4 A;  3TOB A;  4ZH4 F;  3LFK A;  3E3V A;  2PG4 A;  4O3M A;  4GO1 A;  4UNO A;  1G81 A;  1IRF A;  3FWE A;  2DPD A;  1D8J A;  4ETS A;  1T38 A;  3F8M A;  1U5T B;  3QP5 A;  1QZZ A;  2UWM A;  3DP7 A;  1BM9 A;  4WF2 A;  4A2U A;  2FA1 A;  3KP3 A;  4KN7 X;  4LJZ F;  3SHF A;  3GW2 A;  3LA7 A;  1L0O C;  1UB9 A;  2A5Y B;  2OA4 A;  2W24 A;  2A6H F;  4KUM A;  4LB5 A;  3ABT A;  1MZB A;  2D45 A;  1FZP B;  1ZLJ A;  2BEO A;  4KA4 A;  5HS7 A;  4P5O A;  3FMR A;  1WKM A;  2HTS A;  4TV7 A;  2K27 A;  1ZYR F;  4LLN A;  2MA3 A;  2PN6 A;  2G7U A;  4EGZ A;  3RIR A;  3IC7 A;  3V4G A;  2HFH A;  2LF8 A;  1UFM A;  3GLX A;  4Q4Z F;  2JPB A;  4KIG A;  2H94 A;  1A04 A;  1OPC A;  2KJC A;  4P9U A;  3RKX A;  2HGC A;  4MHG A;  3TDU C;  3F8B A;  5K5O A;  5ICG A;  4BHC A;  1OMI A;  1XCV A;  2O3F A;  2CWE A;  1YS6 A;  3RDI A;  1XCB A;  2DK8 A;  4UHT A;  1GXP A;  3I64 A;  3IHU A;  2OGG A;  3KP4 A;  2M45 A;  2PEX A;  2ZJ2 A;  1KQ9 A;  2O6G E;  4EJO A;  3PFI A;  1P4A A;  3QU3 A;  2DO7 A;  2XRO A;  1S29 A;  2W57 A;  3DEU A;  1FBU A;  1KU2 A;  2HQR A;  5ICF A;  2AHC A;  1B6A A;  4UVC A;  2WC2 A;  3G73 A;  1Z6R A;  3J80 Z;  4HX7 A;  2OOI A;  2XAG A;  4JK1 X;  2NNY A;  3ECH A;  5H20 A;  2JPC A;  3WU0 A;  1TQP A;  2KRF A;  3P9I A;  3U9G A;  2E1C A;  5H6Q A;  1IRG A;  2RNJ A;  1OYY A;  3QPT A;  2IA2 A;  4MEX F;  4L9N A;  3R61 A;  3WOD F;  3K69 A;  4HDU A;  4HQM A;  3NQO A;  4G6Q A;  4UV8 A;  1B1B A;  1ZN2 A;  4L0Y B;  2FEZ A;  2EK5 A;  3MWM A;  4BAY A;  2NWI A;  1J2X A;  4IJA A;  2M30 A;  2PMH A;  4HDV A;  1IF1 A;  3KZY A;  4L9T A;  1Z05 A;  3DPL C;  2DPU A;  4WX9 A;  2VOP A;  4HZF A;  1R1U A;  2PMU A;  3WE3 A;  1P6R A;  1MDM A;  3P7N A;  1BI3 A;  1LJ9 A;  1TNS A;  2X4H A;  4HW0 A;  3GZ5 A;  1XDU A;  3U2R A;  5F6F A;  3ZP5 A;  4HF2 A;  2EV0 A;  1IN8 A;  5E17 F;  3F23 A;  3E6B A;  4RAZ A;  2RDP A;  1IN4 A;  3C3W A;  2PQ8 A;  2HS5 A;  4M9Z A;  3ABU A;  1OYW A;  3FF5 A;  3GYH X;  2H09 A;  3LST A;  1FP1 D;  4U0W A;  4ZYH A;  1YO5 C;  1R22 A;  4Q48 A;  4OIO F;  1ZH5 A;  5J8F A;  1W4M A;  5LGN A;  1TTY A;  3DFG A;  2V6C A;  4BHP A;  1YLF A;  2RQP A;  1BI1 A;  5D4S A;  1P92 A;  1J9I A;  4F7Z A;  4ESF A;  1K6O A;  4I09 A;  1TLH B;  3ISP A;  4NB5 A;  1IZ1 A;  4A6E A;  3CO7 C;  3TO6 A;  4LFU A;  5L3D A;  3GVA A;  2ELH A;  3V7C A;  1YQA A;  5D4R A;  4P96 A;  5JR3 A;  1B9N A;  4KMU X;  1AOY A;  3FMQ A;  1XD7 A;  3HRU A;  1O3R A;  5E1W A;  4RGU A;  3IRR A;  1XGM A;  1DUX C;  3LHE A;  3EUH A;  3BJO A;  3SZP A;  3RPU A;  4M71 A;  2K4B A;  2VOO A;  3WTS C;  1IW7 F;  1K7A A;  2RV8 A;  4IHT A;  1JE8 A;  1RNL A;  3EYI A;  2XVC A;  2XAH A;  3WTX C;  2PKH A;  1JHF A;  3RPQ A;  3HRT A;  2XHK A;  4K2E A;  1LDK B;  2FBK A;  4KIB A;  5LHI A;  4ZSK A;  3ZMU A;  3VB2 A;  3RJP A;  2VOD A;  2GQQ A;  5LRR A;  5BQT A;  1I27 A;  2P6S A;  5L3B A;  3EET A;  3ZMS A;  3GWZ A;  5BOX A;  2OD5 A;  5EEG A;  1EH8 A;  2LDU A;  5FFX A;  1FBS A;  3KP2 A;  3J81 K;  2GWR A;  4MQV A;  4ZSI A;  1YG2 A;  2HEO A;  2QUF A;  1P2F A;  2EA4 A;  2BV6 A;  1XDS A;  4N9I A;  2DI3 A;  2STT A;  3RTR A;  4E70 A;  2EFN A;  2ACJ A;  4ENK A;  1TQI A;  1U5T A;  1F4K A;  4EVI A;  4A0X A;  1BN5 A;  2BYV E;  1SFU A;  2STW A;  2VXZ A;  1YW8 A;  4CO8 A;  2HOE A;  1UCR A;  5LGT A;  3I4P A;  3I54 A;  3RKY A;  3VOE A;  4AIJ A;  5J6X A;  1MDM B;  4I7H A;  4HYE A;  5D6E A;  1XMK A;  3VEP A;  3V8L A;  1R5G A;  1SFX A;  1JGS A;  4B09 A;  2CW0 F;  3I0T A;  2QBY B;  1TT8 A;  1W7P D;  3OOP A;  4IRG A;  2R7F A;  3GF2 A;  1S8N A;  4ESB A;  2GXB A;  3ROU A;  2XAF A;  3DF8 A;  3EDP A;  4U88 A;  5HLI A;  2PFB A;  3TOA A;  1VTN C;  1R36 A;  4EM1 A;  4JQF A;  3FXQ A;  3KLN A;  1ODD A;  3ZMT A;  5AIP A;  3GZ6 A;  4M73 A;  4IRH A;  1HW5 A;  2Q2E A;  4RS8 A;  4RB3 C;  3R60 A;  4CZZ A;  1BOA A;  2MBF A;  1G6N A;  2L01 A;  2YX7 A;  3H3U A;  2Q8K A;  3J81 Z;  2P5K A;  5A2Q K;  2K02 A;  3R0A A;  1Z1D A;  4MEY F;  2K7L A;  1HKS A;  2FU4 A;  5HS8 A;  4L18 B;  5K1Y A;  4YIF A;  2P7C B;  3MQ0 A;  2NAZ A;  3TO9 A;  5LEK A;  3CUQ A;  3HRM A;  3LWF A;  3I58 A;  1R1V A;  3K1M A;  2M8E A;  4CYD A;  2ZXJ A;  1LEA A;  5HDN A;  4KNY A;  2EB7 A;  2Y0M A;  2Z5U A;  1WQ2 A;  4YFX F;  1FYK A;  2OZU A;  1IXR C;  1WWX A;  1ZG1 A;  5HVQ C;  3FM3 A;  5D5X B;  2P5V A;  2QWW A;  1HXD A;  3KZZ A;  1B59 A;  4O6J A;  2QQB A;  3Q5F A;  3HHG A;  4A0Y A;  2XUB A;  1LEB A;  1BI2 A;  4AIK A;  2E1N A;  5BPI A;  2DAO A;  4G8X A;  3Q9V A;  4Q47 A;  1YTY A;  2H27 A;  5E18 F;  3ML6 A;  1CGP A;  3GUD A;  2QQ9 A;  3HHH A;  1JXS A;  2NNN A;  2QEN A;  2FBH A;  3F21 A;  2VBX A;  3JSO A;  4AIH A;  5A2Q Z;  3FX3 A;  3LA2 A;  1CF7 B;  5DUK A;  2CQK A;  2WTE A;  2FML A;  4PGH A;  1RZ4 A;  4DQ2 A;  3FMS A;  3REO A;  1SFE A;  2RKH A;  4H0E A;  4BNC A;  3ECO A;  2ZNZ A;  4KYW A;  2XGX A;  3QP6 A;  3J80 K;  1XSD A;  4XLP F;  2VBY A;  4HA8 A;  5CVI A;  4R8H A;  3M8E A;  4WWC A;  3J7A O;  3L09 A;  1XGN A;  2MH9 A;  2FMY A;  4WK8 F;  2FXA A;  3BDD A;  1U8R A;  2V79 A;  3F3X A;  2GA1 A;  1LB2 A;  2EWN A;  4U7D A;  4FX4 A;  1O7F A;  1XGO A;  2IA0 A;  2JTV A;  3COA C;  1HBX G;  1V4R A;  1QPM A;  1DP7 P;  3M1E A;  5ILS A;  5AON A;  4RGR A;  1J5Y A;  5CVR A;  3LAJ A;  5L3G A;  3PQJ A;  1LDJ A;  4KMF A;  2DLL A;  1DPR A;  5FD6 A;  2VC1 A;  1FY7 A;  2IRF G;  3F72 A;  2P4W A;  2DFI A;  2XRN A;  3HFI A;  3GFM A;  1O3S A;  4EJT A;  2EJR A;  4A6D A;  3R0J A;  3CUQ B;  5ILU A;  3KEQ A;  1F9N A;  1ZAO A;  4U0Y A;  3BWG A;  5D6F A;  5JI6 A;  2RVC A;  2DQL A;  1Z7U A;  3KFW X;  2LF7 A;  5LRS A;  1IAW A;  4IXA A;  3MZY A;  3IL2 A;  2P19 A;  4A5M A;  2D2W A;  4LMY A;  1EH7 A;  5H6R A;  2YX4 A;  1EV7 A;  2DU9 A;  3W6J B;  1XB4 A;  1G4D A;  4L9J A;  4LB6 B;  5DUI A;  2K86 A;  5FD5 A;  4OOI A;  1YIO A;  2YSR A;  4RAY A;  1MJB A;  2ESH A;  4L9V A;  4MNU A;  4ZZD A;  5DYM A;  4YFN F;  4AWX B;  3WGI A;  3WU1 B;  1LQ1 A;  3E5U A;  2HQN A;  2VBZ A;  2ZME B;  2P7V B;  3SXY A;  2AXL A;  3RKW A;  3SZT A;  4XLN F;  3DPT A;  1G3W A;  5D8L B;  1KQ8 A;  2ISZ A;  4QLC U;  2CFX A;  2G9W A;  2FRH A;  2EFO A;  3KLO A;  4M6Y A;  4IPA A;  2K4J A;  3WG9 A;  2QBY A;  2W25 A;  2QYO A;  3M8F A;  2ZO4 A;  3CDH A;  1S7A A;  3KE2 A;  4Z2Y A;  3MZH A;  4HF1 A;  4EM2 A;  2CO5 A;  3K2Z A;  4O5V A;  4IHS A;  2VE8 A;  2UZK A;  1J75 A;  1IXS B;  3HSF A;  1IXC A;  3KP5 A;  3I5U A;  2FNA A;  1R58 A;  4A0Z A;  2JT1 A;  1BC8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...