3EF4A

Crystal structure of native pseudoazurin from hyphomicrobium denitrificans
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
b'AEHIVEMRNKDDAGNTMVFQPGFVKVEAGDTVKFVPTDKSHNAESVREVWPEGVAPVKGGFSKEVVFNAEKEGLYVLKCAPHYGMGMVVLVQVGKPVNLDQIKEYKATGLAKKRLDGEIAKVVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper protein
publication title Atomic resolution structure of pseudoazurin from the methylotrophic denitrifying bacterium Hyphomicrobium denitrificans: structural insights into its spectroscopic properties
pubmed doi rcsb
molecule tags Electron transport
total genus 31
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ef4A00
3AG1B 1JZHA 4YSAA 5I5MA 2EILB 1J5DA 2BP0A 1E65A 3QJVB 3L45A 5PCYA 3S3BB 2TSBA 4DP8X 2CUAA 7PCYA 3DKHA 1TEFA 1PNDA 3EH4B 4KO7A 3U25A 4DP6X 5D4HA 4FAAB 1W8EA 2GB2A 3T6VA 3NSCA 2IDQA 4AX3A 1N70A 2E86A 5I6MA 4DP7X 2VN3A 2UX7A 1L9QA 2QDWA 1L9RA 2XV2A 5I5JA 3WIAA 3V9CA 4KOCA 1JZFA 1GYCA 2VW7A 1FWXA 3BQVA 2GBAA 1VLXA 3NJKA 1AACA 3QJQB 3ZIYA 3JT2A 1OCZB 4G71B 1JZJA 4YVNA 1ZV2A 1AZCA 1NPNA 1AOZA 4AKOA 1R1CA 4EF3A 2R7EA 1NDTA 4UANA 2PCYA 1CC3A 4L0PB 4K9JA 4G7RB 1JXGA 1OF0A 5I6NA 3CG8A 3TASA 2YXWA 1AZUA 1ADWA 1GY1A 1QHQA 5B1AB 1NWOA 1PAZA 1NIAA 3HB3B 1SDDB 1BXVA 4AKPA 1V10A 1ZPUA 2VW6A 4GP4B 4A68A 1T5KA 3WNIA 1MZYA 2YAPA 3GYRA 3NJJA 4X4KA 3NP4A 4HCFA 3NJIA 1ZDQA 2VM4A 3FSAA 1SF5A 1GS8A 1RCYA 4QKTA 3FSVA 4KO6A 1ZIBA 1RZQA 4CSZA 2YAFA 5TK2A 1PLCA 2YAMA 2DWTA 1BYPA 2J57A 2ZONA 1IUZA 4BWTA 1OE1A 4P5SA 3ZDWA 4G7SB 2FWLB 4A66A 1ILUA 1AZRA 4RH4A 2DY2A 5I28A 3PAUA 1BAWA 4E9TA 1ILSA 1GS7A 1J9RA 3QJTB 1BQ5A 2I7OA 3BVDB 3T6ZA 3QJSB 1RKRA 1OCRB 5I6LA 1B3IA 1NPJA 4GYBA 4UF7C 1RZPA 3ZX1A 2PPCA 2IAAC 1SFDA 1PLAA 2YARA 2GSMB 4JHVA 5B1BB 2XYBA 1AR1B 1IKOP 2IWEA 4ZK8A 4M4RB 2XU9A 1WA1X 4DP9X 1NIDA 2IH8A 2PPFA 3X1FA 2CBPA 4A2DA 3SQRA 1ID2A 2BZCA 2HRGA 2PLTA 6PCYA 3H4HA 3FS9A 3IEAA 1L9OA 1ASOA 3FU8A 1HFUA 4G70B 2GHZA 2FQEA 3FQ1A 3X1NA 2XXFA 1ET5A 5TK4A 1DYZA 2P80D 3H4FA 1GR7A 1OE3A 2FNWA 1ZIAA 1OE2A 4BWUA 3MBWB 4HHGA 1AZBA 2JXMA 2GC7C 5FC9A 4BWWA 2B08A 2HXAA 3KW8A 2UX6A 2IDFA 1OOWA 4DP1X 1IBZA 1AIZA 3X1GA 1XB8A 2XLLA 2BHFA 4N4YB 1QLEB 2H5UA 2WO3B 3TBBA 2CAKA 1V54B 2XUWA 4N8UA 1MG2C 3GDCA 4YL4A 3ZBMA 4DPCX 4Q89A 2QDVA 3CVBA 3FU7A 4KO9A 1E5ZA 2TSAA 4NB7A 1SDDA 2VSKB 2H47C 1M56B 3UGEA 5EHFA 4HHWA 3ABKB 2OJ1A 2XX1A 3PPSA 5IY5B 1GY2A 1PNCA 3OM3B 3S8GB 4NAJA 8PAZA 2BWDA 4YSTA 1A4AA 1XMEB 4F2FA 4F7KA 1NTDA 1YLBB 2IH9A 3EHBB 1CURA 2BP8A 2EINB 3JTBA 1NIEA 4A2GA 5LDUA 1NIFA 2FJSA 3G5WA 1A8ZA 2ZWNA 4YSOA 4GP5B 5E9NA 1A4CA 3N2JA 3NP3A 4E9XA 1SF3A 3SBPA 1EHKB 2AANA 3WNJA 1KDIA 1M57B 1UATA 2UXGA 3OMNB 4FA7B 1JXFA 1SFHA 5I26A 3CDZB 1JXDA 3AY2A 4G72B 1GW0A 4HALA 1ET7A 3FU7B 4G7QB 2VMJA 3S8FB 4AKQA 3GXUB 4DP5X 1AQ8A 2FQDA 3EH3B 2FT8A 1SNRA 2EIJB 1ASQA 2XXGA 4A2HA 1BYOA 3T9WA 2GIMA 1AANA 4YSRA 5B1JA 3NT0A 3IN2A 2Y1AA 1OCCB 2HX8A 1W6WA 4HIPA 3QJRB 2AVFA 3QQXA 3WG7B 2OV0A 1OV8A 1X9RA 1PF3A 2X87A 9PCYA 1ETJA 2FQFA 3X1BA 2BP8B 2P80A 4YSDA 1KDJA 2BW4A 2XX0A 1GS6X 1E5YA 2NRDA 1TKWA 4WKXA 2UXFA 4JKNA 2DYRB 4W1TA 2IDSA 4BXVA 1IC0A 1L9TA 3S3DB 1ZDSA 3UADA 5B1JC 1BXAA 1AG0A 5I6KA 2PPEA 1I53A 3CVDA 3FPXA 3ABGA 1CYWA 2I85A 4PCYA 2IWKA 2J5WA 2WSDA 4YSSA 1NICA 1HAWA 2IDUA 1ASPA 2CJ3A 5AZUA 1PZAA 4GP8B 2IDTA 3AZUA 4QLWA 1KGYE 4KOBA 3X1EA 3KW7A 2AZUA 2CCWA 3PAZA 4HZ1A 1KV7A 2FTAA 3S3CB 3N55A 1A4BA 2QPEB 2YAEA 1PMYA 4UAHA 1F56A 2PCFA 2GC4C 3QJUB 2MTAA 3NSDA 4KNSA 2BWIA 1TEGA 2X88A 4E9SA 2FT7A 1TU2A 3C75A 3NJHA 3X2QB 1JZGA 1CYXA 2AFNA 3TA4D 1AZNA 1URIA 2BZ7A 2A3TA 2XV0A 2PP7A 5B7MA 3V9EA 5I6OA 1IBYA 1OCOB 3FSWA 2DWSA 4JHUA 1V55B 3CDZA 4YSEA 1M9WA 2WO2B 5D4JA 2XV3A 2YAQA 3SBRA 4A2EA 4YSCA 1SHXA 3CVCA 3FSZA 2J55A 1QNIA 3H56A 2LLNA 4DP2X 2PP9A 3NJMA 4KNUA 3ABLB 1WA0X 3PLYA 4HCIA 3T6XA 1EZLA 1BXUA 3NSYA 4YSPA 4DP4X 2DV6A 3OMIB 3FQ2A 5B7FA 2HRHA 2H3XC 1E30A 3FT0A 1SJMA 4F2EA 1J5CA 2XWZA 3EF4A 2PPAA 1E67A 2VSMB 4A2FA 4DPBX 2MRYA 2UXVA 3ERXA 2EIKB 2I7SA 4BDVB 1JOIA 4E9YA 3D12B 1J9QA 2ZXWB 3OMAB 3HEIB 4MFHA 1L9SA 4PAZA 2FQGA 4GXFA 1WAEA 5I6PA 2Q9OA 3WI9A 2ZOOA 1MG3C 2VM3A 5A7EA 1AS7A 2YQBA 5B3SB 2XVBA 3AW5A 3FYEB 5B1KA 6PAZA 3AG3B 3NJFA 1ET8A 4E9RA 2Q5BA 4HCGA 5ANHA 2IWFA 1PLBA 3AG2B 4DPAX 5B7EA 2BP0B 3AG4B 4AZUA 3OQRA 2B3IA 3FYIB 3DTUB 5I5IA 1WA2X 1HAUA 4GY4A 1AS8A 2JFCA 1CUOA 4KNTA 1NINA 3OD3A 2GI0A 2QPDB 4Q8BA 5AFAA 2W88A 1KCWA 2FT6A 3IN0A 4BXSV 4M3HA 4AI7A 1L9PA 1W6LA 2HZHA 3FPYA 1BEXA 3NJNA 2Y69B 7PAZA 2JKWA 4CSPA 3TU6A 3ASNB 2J56A 2UXTA 2EIMB 4W9ZA 2N0MA 3NJLA 4KO5A 5AKRA 3T6WA 1FFTB 1BQKA 4A67A 1AS6A 4YVUA 1WS8A 1NZRA 2BO0A 3FQYA 3TBCA 2R7EB 1J9TA 2BW5A 1A65A 2HLEB 3EH5B 1FA4A 3UACA 2AZAA 1AG6A 2YXVA 1KCBA 3UAAA 1KBVA 4YSUA 4E9QA 3PAVA 3WKPA 1AAJA 3IE9A 4DP0X 1A3ZA 1GSKA 3QPKA 3PXLA 4WTQA 1JVOA 1MDAA 1KYAA 1PZBA 2W8CA 5D4IA 3UABA 1SHWA 3NSFA 1JVLA 4P5RA 4TXVB 1PZCA 2DYSB 2HX9A 4YSQA 1DZ0A 4NERA 2YAHA 5F7BA 3RYMA 1N68A 3CZUB 4ENZA 3IBOA 5PAZA 1J9SA 3WKQA 4E9WA 3NYKA 1NIBA 2YAOA 4BDVA 4BK5C 5F7AA 2OCCB 1NWPA 3FU9A 3ASOB 1WS7A 1BQRA 2VW4A 3ABMB 3SBQA 4E9VA 1JZEA 3UAEA 1MZZA 1JZIA 3T71A 1PY0A 4HAKA 2CALA 2HX7A 1XB6A 3MX0B 1X9UA 1PCSA 1XB3A 2RACA 1JERA 2QT6A 2PPDA 3PCYA 3NJGA 3DIVA 2PP8A 1KBWA
chains in the Genus database with same CATH superfamily
4YFLI 4WWID 1KTCA 4I1PA 4ODXB 3LQAL 3VX1A 1AQDB 4GBXA 4F80A 5I1KL 1I3VA 4MCZB 4A2MA 3IFPB 1U8CA 1B2YA 2VERA 4MDIB 4YE4L 2Y06L 1NMAH 1CLCA 3Q1SH 1HNGA 3ARGA 1I31A 3MNWB 4HC1A 4OD1L 4LQ1A 4KXDA 4R90L 4Z7WA 1T89C 3VD9A 4PD4J 4GQPH 2R2BA 3PV6B 5E56A 2E86A 2GSIB 1H5BB 5GGUA 4OV5B 4W9KC 5TE4L 1ZVHA 3SD2A 1A7PH 5F7DA 2APVA 3LRKA 3WIAA 3WN6A 3MRQB 2A2QT 3TJPA 2LU4A 3GTTA 4R4ND 5CIPB 3HUJB 1EGJH 1IBHA 4J4PD 3GXTA 4M56A 5GPRA 4DGUA 1R3HA 2OSYA 1R1CA 2NDGA 2R7EA 1S7UA 1S7RB 1TUPA 1CC3A 2D7OA 1X5FA 2F53A 2VDKH 3KWWB 1IKNA 2HTKD 1AQHA 1XTMA 2KS0A 4X2UA 3CG8A 3GFUA 2WWKO 1PPIA 5GXBB 2WLIA 3VD4A 4N8CH 4CN6A 2QADC 3QDGD 1JGVL 1NIAA 4Y4FD 3UJIL 4HS3B 5DEJA 5I0XA 2WYHA 2DMCA 1C12B 3C5JB 1UOLA 2FWOB 1QI5A 4HUKB 3MBEC 2WWMD 4JRFA 1MJUL 5IB1B 2P24B 2Q76B 4HF5L 5A2CA 3JSSA 1SOKA 4N2OA 3IJ7A 4W9JC 4UILL 1RUQL 5L2KB 4MMYB 3R4DA 3HN3A 2BC4B 2FB4H 2YAMA 1UM4H 2YD1A 2C1OA 1MFAH 1L7TL 2ZONA 3II3A 3NDYE 3RGBA 4BQ8A 3VU2A 3N50A 1CGXA 1BEYH 1E28B 1KPUA 4G6JL 4NJAL 1R5IA 5IROD 4HAGA 4AITA 3QJHB 1CE1L 3EDJA 5I9QC 5IZ7A 1Z66A 2W9DL 3I6SA 2NYKA 3ZRFC 3QJSB 3EYOB 3UBFA 1N8ZB 1PU0A 2W5PA 4J3UA 4IRSB 4KFZC 2AHIA 1SFDA 4M4PA 2LVCA 4LLYB 3FH5A 1P0SE 1M1XB 3QHTC 4PCSA 2NOYA 1JGDB 4PMEA 3FCGA 1U3HB 4FMVA 4WY7H 2BS9A 3RIFK 3QUZC 4PVLA 1TMCB 2CBPA 1J8HB 3ZMEA 5D7JA 3GRGA 5ID0B 2Z35B 2BY2A 1CFQB 1YNLL 3ARBA 2XETA 4ANVA 4R7LA 5E9DB 5BRZB 2ZCHH 5IB2B 2B4CL 2OQJB 1TFPA 2ZSWB 5JHLA 2JCCA 2H9GB 2GITA 1JV2B 5EORH 5IR1B 3HG4A 4JFFE 2CM6A 4JPVL 1A9BA 2MKWA 2Y0SA 2R39A 4RMQA 3FH8A 1S3KL 4IRZL 1BECA 1E8XA 3FU3A 4W9IC 1Q9LA 3IJ9A 4N8PA 4BZ1A 4D9RD 5C0CD 1ZHNA 3F12A 5HXMA 1J5HA 3UBXG 2IDFA 3N6YA 4A7GA 2P5EE 2P43B 1MUJA 5TDPB 3ELAT 2CMRL 1QFOA 5F3HA 1RXLA 4HISA 3TJEL 3MTRA 5DDHB 2FBOJ 4X4XB 3LZOA 2YA1A 4Z76B 4N8UA 4ZPTA 5C08B 4MMZC 2VO8A 4JX0A 5D4QA 4MJHA 1Z1WA 4JFDA 3VYNA 4YDKH 5L6YH 2DQIH 1OKEA 2J1ZA 4W9DC 4XXCA 3MUJA 3HHSA 2BVEA 1RP8A 2V2TA 5JYMA 3U4KA 3HC0A 5JMOC 5T1KD 5D6DC 3B6SB 4BQCA 1E4HA 4PB9L 3MRPA 3LQZA 4HJGA 8PAZA 2E75C 4NQCB 3RDTB 2QSCH 4PWGA 1ETZB 1KUMA 3LRHA 5DXWA 5LGJA 3L5JA 1EO8H 3INUL 1IJ9A 3WTVA 1CDCA 4MB5A 2GQHA 3QJFB 5DJAA 3NVQA 1UYWL 4LB8A 2AJSH 4NCC1 2Z92A 3CSTA 1FQ9C 1Q1PA 1SF3A 3NJXA 4TNGA 1CFVH 1JZ2A 3HNTL 4PHXA 3FB5A 4D3CH 2UXGA 4XAWH 1SFHA 3ALXA 4MD4B 2IDCA 5EOCL 3VXOB 5HYQA 4FCAA 3VCLB 2HKAA 1KGCE 2ZAGA 3QUXA 2YEVB 1H0DB 2HT3D 4ZT1A 2EZ0C 4LLQA 4P07A 4UT7H 5HGAA 5GGQL 1K2DB 3GLDA 4WUUB 3M7FB 1I8KB 4YDJA 4HWEL 4LBEA 3V6FB 2H1PL 4LRIC 3HVNA 4ODBD 4W68A 4YXLL 2AAVA 3QJXA 2VDLL 3L3DB 2DB8A 2AEQL 2WO4A 3DV4A 5CZVH 3O45A 1WUZA 3BAEH 4F3FA 5DFVD 5LAPA 3E8UH 4LSRL 4JFUA 3NBNA 1CI3M 1QX1A 5JZ7D 4OI7A 1KCRL 5DD1H 1E5YA 4PCKA 2QGEA 2J88L 3QC5X 5EZPA 4PJBF 1RMFH 4X6CF 3VXRB 3R1GL 2BZDA 1OL0A 3MRFA 3OZ9L 4JHAL 3C8HA 4OT1L 2KPNA 1UXWA 1NBCA 3ILQC 1CK0H 1LD9B 5T1MA 2I9TA 2XYCA 2V5MA 2AMGA 2GSGB 3QCUH 4MQSB 1RK7A 4Y1AE 3EJZD 5HHPB 1KB5H 4P4KC 4PCYA 4U3SA 4EI6B 2HFGL 4Q9QL 3BKJH 4RNRB 2QV2A 4N2EA 4YDIH 4D9LH 1GA2A 4IU2B 1X4ZA 1XF3B 5JYLA 3VJ6B 2ALWA 3QZBA 3ESUF 3ZJAA 1BYNA 4FLOA 4WWPA 4RVBA 5IHLB 1VFAB 4ALAC 3IKCB 5HHNA 2ZKWA 5DJ8B 3VD0A 1CGSH 2VDPH 3UZVB 4GRWB 4XX5A 2CGRH 3VFUB 2X38A 4ZUSB 5IHHA 2I9LB 4IBLT 4GW1B 3FUJA 3G08A 4ZFFA 4ALAH 4CJ1A 2NYZA 3MSPA 4G8GE 4PJGF 1NUFA 3NDZE 2WNGA 4TLKA 1N5YL 2AJZB 1JZGA 5DD3L 2E74C 3K74B 2B1HL 1AZNA 2XV0A 2I26N 4G6AC 4JCMA 4XBEH 4RAHA 5F7FA 4AQOA 2MQ3A 3BEWB 3OAYK 2NY7H 3E3QE 1BP3B 2GJ6B 5CM1A 5IFJB 2ZF9A 4YSEA 1RIHL 2NY0C 4R7DA 4J3OF 1WCBA 2NY5C 3AITA 5AVRB 5DHVH 2DN7A 4YSCA 4KJWD 1SHXA 2E8YA 1TO4A 5E1HB 5B38A 3FSZA 2BOCB 1WFJA 4KXAA 5F21B 3GRWH 2NY5H 4GG6A 2NYYC 2DKUA 3EFDH 4DP2X 4KK6D 4UNTA 1E90A 4QRAA 3ABLB 2FO4B 1VZGA 2WLLA 3IMTA 1DVTA 2O5YH 3UG5A 4Z7QE 3MLVH 4JFPA 1BXUA 1JGUH 2GABA 3K72A 4BGDA 1B2WH 3U46A 5LBVA 3GMLB 2ZX9A 1QQDB 1W0YT 3QIBD 5LHDA 4ZQTA 3GXFA 4PBVC 3FQWA 1X5HA 3SSGA 3MRIA 2LLLA 3D5OF 3E2HB 3MRMA 1NEUA 1U91A 3RIAK 4P3DA 4OZGB 2BRRL 2VZTA 2JIXD 3TZVD 3M8OH 3JTTB 3WXVH 1KNOA 2ZXWB 2YMXH 3GJFK 3W5NA 5DZNA 4JUSA 2CG9X 2R1WB 2WKOA 5GRJH 5ISZA 1J5IA 4XCNA 1AS7A 4OF6A 4PI2A 1CD1A 1D6VL 3Q6FB 4YHPB 2XVBA 3CFBA 5E95B 3EGSB 5HGBA 5I18H 3LX9A 1YMHA 2J8OA 3S2CA 5ANHA 1TTAA 3ZTNH 5LWYL 4QCIB 1MNUL 2P1YA 3KS0J 3M7OA 2WW8A 3C8DA 4TULL 1YNTA 4IOFD 5TQ0H 3SDAD 1FUNA 3K2KA 4JY5H 4FQLL 5BMFH 4A7TA 1KBGL 4NJ9H 2OYPA 4K3EH 2Z34A 4C4KT 1I3RA 5EBLA 4I2XB 5A7BA 1OK8A 1WVZA 5AFAA 2XWTA 1EJ8A 3QIUC 3WLWD 1P69B 1K3ZA 4HD9A 2ZWSA 1F97A 1KYFA 2LFEA 3H2PA 4IU3A 3H3PH 5ICZB 3GBLA 4FN0A 3KJ4C 1UZ6F 3RWGB 3UGUA 1DBKL 1OARL 4R83A 1HEHC 2ICWB 1GHFH 2GTQA 2JKWA 2YEZB 3GPSA 4KVCL 1KFAH 1WLHA 2RQ8A 5HVHB 3PP3H 4JQIL 2WLKA 4XP1H 2V9UA 4TQEH 3GHBH 4Y1TA 3VFPA 1IGML 3L95B 2C4FU 3FQYA 2XPGA 1R19A 1PD0A 1ZT4B 4TQ8A 4QXGL 1TZHB 3NIFE 4OGXL 3QUKB 1R3IH 1FAKT 1D5MB 3SBWC 3ZRSA 3PXJA 4J7RA 2R69H 1QLRA 4XC3L 1EJOH 1XH2A 4G2AA 3W37A 3QDHA 1F5WA 4YBQC 2DQFA 2FX8L 4ES8A 2EDFA 4OIFA 4RGMB 4XHQA 3R0MA 1U30A 1J88A 4FQXB 3JWNC 1BAFH 2JE8A 3FB8A 2WVSA 4OVVA 3B2PA 4TTDD 2AXFB 4KI5F 4FX5A 3BUYB 5DJ6B 4X98B 3EO9L 2G9KA 3JWNH 4FG2A 2Y22A 5L2JB 2ETWA 4Z5RA 5JMRA 3HS0A 3UCRA 4HT1L 2P45B 1NEZG 3BLKA 4YHPA 3FU9A 3TCLB 1B0GA 2VDNH 1AMYA 4YGVA 1YEGL 2ARJB 2XZCH 3BDXA 4JG0L 3EJCA 1FYTA 4G43B 5I16B 1XGTA 1MZZA 5TF1L 5I8CB 4QRPB 1LEKA 1L3WA 4KVNH 5L7XL 3MX0B 4YHOL 3VWJB 3BAKA 15C8L 4NKOA 5AB0A 4P59H 5E4EB 1G5GA 1E42A 1DTUA 3RWJA 1LHZA 5IBLD 1Z0MA 5HDRA 2JKTM 1BOGA 1JCVA 5EZJB 3UAJA 4UU9A 3DJ9A 3ILPA 3HMXA 3TYFA 1YDPB 2H8PB 3KYKH 3PDGA 5K59F 3C9NA 3DECA 2EDNA 5LBSH 4XAKE 1WFMA 2LT9A 2IXQB 1TZOA 3HNVH 3IJSB 3O0RH 1I1AA 3EO0B 2VDQB 4JFFD 2RFXB 3EH4B 2J8UF 5CWSA 1Y0LA 2JV6A 1LYQA 2NZIA 2QQQA 4FI8A 4PS7A 4WWKA 5D4HA 2VDLB 3W39B 2F7QA 3SE8H 1R17A 4JM2C 3BUBA 4HCRH 1F58L 1JGIA 5E8OA 4FTVE 4M3JA 1YAZA 1FWXA 2N7BA 2GBAA 4RWYL 1OP9A 3JT2A 1QEWB 3NCJL 4JPWL 3DO7A 2HKFH 1N8OE 3FJTA 4J23A 5CLYA 1D5IH 5K9JH 1E6OH 1EX0A 2XPZA 3CUPA 4ELMA 3IDXL 2R1XB 1CU4L 1NDTA 2W9EL 4K8RL 2H2PD 4BFIB 4LGRB 3O3EA 1Z5LA 1PFOA 4JQXC 4U1MB 5LUMA 4FXGB 3BIKA 4GQ9L 4LASH 3VFGL 2V9QA 1FFPA 3MOAH 4FF9A 4ONGL 3ULUF 1JZ6A 3Q7JA 4MZIA 4ZO9A 1M2VB 4X6DB 2NNXA 5AVYB 2CPCA 4N9GA 3ZT7A 3QNZA 3TT1H 4KKAC 4TVPH 3ZL4H 1ADQA 3CFIC 1FN4B 2FEDD 2VC2L 1FH5L 3QCTH 2ZX8A 3RURA 3U0TA 5DVKA 4Q6KA 2ADGB 1AKPA 1FAIH 3RPIA 4R4BB 3O6LL 4NNPH 4X99A 4CMHC 4M5YL 1CB4A 5EU4A 2W9LA 4HWBL 1RZQA 4E41B 1OAQH 4DEPB 3B1UA 5D2LA 3B5TA 2P5PA 1HL5A 4TSCH 4YHIB 4HIIB 2EEBA 3UERA 5KANG 2M26A 2O6CA 1KGCD 3PDOB 1TJXA 2F74A 5DI8A 2PW2B 2YBGA 5E7FA 3VI3A 4JO4H 2NY4D 2MOGA 3W9EA 1MJ8L 4CN4A 4A66A 5T1LA 4G9DB 5EO0A 4S0SD 2R0LH 5I28A 4OV6F 1AIFA 4UOQA 2OMYA 3ARDB 1AD9A 1ILSA 4PG9B 4O2CB 5JQ6L 5HVFB 1BMWA 5EN2B 1KWGA 4ODXA 3EZJB 3CHPA 4C56B 3CZSA 5MI0C 4MCZA 3MNVA 2PPCA 3IFPA 4MDIA 3RI5K 4PGDB 1Q9WB 4JHVA 1DQTA 2N7AA 4A55A 2XYBA 1AR1B 3LS4H 5HHME 2W0KA 2K70A 3MNWA 4UNUA 5HYSB 3FSOA 4DP9X 1UFGA 1RZGB 2YGOA 3H2WA 5AVXB 3PV6A 4IS6B 1IVTA 5KYUB 2GSIA 1H5BA 5HDOA 4OV5A 1TQTA 1FVDA 1R6VA 4JREB 3VAEA 4KKBD 4L1TA 1DYZA 4LL1A 4U1HB 1QPPA 1TZAA 5DD5L 4WTZA 3MRQA 1INDL 4Y1AD 4I0PB 5DZ9A 2F8VA 2R51A 3ELQA 2E8ZA 3PS6A 5I1EH 3ZGHA 1PG7H 2BOBA 3FC8A 4Y16D 1YEIH 3C08L 2EKJA 4X8GA 4JFQB 2MOQA 1FBIH 3D85D 5JOFA 2XT1B 1OOWA 1G9HA 4GRMB 4RSVA 1V5JA 1QUNA 4H8WC 4NZ8A 3KWWA 5DS2A 1FG9C 4FQHA 4JMNA 2KBGA 2CAKA 1IGJB 4FZEL 5BRQA 3AQYA 4H8WH 1KGXA 4PTTB 5C6TH 4GRLB 1XGPB 1F90L 1BVKB 4HS3A 5SWZB 1U8KB 4G8GD 2ENQA 3OG6B 4LLVB 3TV8A 1C12A 3C5JA 2VUKA 2FWOA 4EI5C 5LDSA 3PPSA 3GMQB 2W0PA 3UBXB 5IB1A 2P24A 2Q76A 5BJTB 2ZG3A 1C16B 4BZ2H 2XSKA 4YSTA 4PB0H 5E4IA 3IDGA 5L2KA 4MMYA 3Q06A 5L8LB 1DQJB 2BC4A 1CFTB 2QGCA 4KKNA 5IMMB 3EHBB 5H4YA 1CURA 3N41F 2O30A 5DHYB 2BP8A 5LDUA 1A3LL 1I9EA 4UTBH 3NQIA 3NZUA 1E28A 3U1PA 1AP2B 2XTJC 1GGBL 3L5WB 3GJEB 3QJHA 2J1KA 3D3VB 5T5NF 4Q4IA 1JHLL 5CMAB 2PWFA 4CAGA 3NPSC 2X6UA 4KROC 4E5XB 1N6QL 5EDXA 1N8ZA 3KGRA 3X17A 4KUZL 1AE6L 4AKQA 4IRSA 1NFDF 1M1XA 1PCXA 1JGDA 2PABA 3GLZA 3M07A 5GRVL 4Z7IA 1QR1B 1U3HA 1AANA 5D93C 1ZLWK 1Z2KA 2Q2LA 3NT0A 4IJ3B 4WV1B 4ZFZB 4Q9RL 1KYOJ 1Z9PA 2FJGB 1J8HA 1JRHL 1CDJA 1Q1JL 3BMVA 5ID0A 2Z35A 2AGJH 1A5FL 1CFQA 2OW6A 3QJRB 4RAVB 4BKTC 4GAFB 5E9DA 5BRZA 3UDWC 5EA0H 5KVFL 1YO4A 2WOYA 3QXTA 3U36B 2OQJA 1H6FA 1X5AA 4Q14A 2H9GA 4CSTA 1JV2A 1MVUB 3ZDYB 5IR1A 3MJWA 1UB5B 3X14B 5KYNA 4PJFF 4P5KB 3NCCB 1TENA 1EEYB 1KGUA 5C3IA 1F6FB 1AO7E 3T77B 2YD6A 2UZYA 4B6ZA 4F5CE 1SLUA 4PJ7B 5TDPA 1HHHA 4L9LB 1MCNA 3SJVE 3TA3B 1CICD 3LEVL 3O0LA 1XCQB 4X4XA 5MEPA 4Z76A 1Q38A 3B2VL 5C08A 2JMRA 5HYJB 4J3OG 3FUEA 5AYUH 4QTFA 4NZUL 3K0WA 2XACC 3VH8G 3TYGH 3EDEA 5D70H 3VTTA 3EYUL 1V05A 4RMSA 1U92B 1YEKL 5B21A 2K3TA 4G3YH 4ENEC 4EOWH 5HHVH 4EIGB 4K3GA 4XRCB 2B16A 2XVKA 3BN3B 3CIAA 1DBML 1ORQB 3S3CB 1XR9B 1XWVA 3B2UC 3CK0L 1ETZA 1R47A 1DANU 1MPAL 1YPZF 1UM5L 1JD9A 1UWXH 3EFFB 4FGMA 3WHE0 4BSWB 4LCIL 1XGYH 4PV8A 5FFGA 1NGYA 1TEGA 4QAWA 4P06A 3LXAA 3S37L 2MNUA 3T3PE 1XH0A 1M6UA 1W9XA 3QDJB 4FDWA 4MD4A 5IOPB 4PUBH 1ZXQA 5D4JA 2OMXB 4AJWA 1OF2B 3VCLA 3SDDB 4XMTA 3L2LA 2FBRA 4N87A 1RZKH 3CDYA 4BEIA 1HSAB 1HL9A 1TG8A 2EO9A 2MNWA 3RWFB 1E5UI 2VDMH 3QWRA 4WHYH 4R4NC 1K2DA 2A77H 2VLKB 4WUUA 4DO6A 1M53A 1JXKA 2AMUA 4FE9A 3NJMA 3H7LA 3V6FA 4KKCD 2K9FB 5B7FA 3CPUA 3ULVD 2HRHA 1JFHA 3ZTDC 2VC2B 4AQ8A 2HTKC 2ZKXA 4Z0BL 2V7HB 5G5DB 1FE8L 2Z31B 1ZVSB 2AW2A 2JJSA 3NIGF 3B56A 3D12B 3MI6A 1MAMH 2ZKMX 3PGFL 3VXRA 3L6FB 5GISH 2IC2A 4WWNA 3RTQB 3FHEA 4ZTEA 5A7EA 1RUML 3TBVB 1BQHA 1S78C 2WWMC 4HOXA 1NCAL 1LD9A 1OGPA 1ZLVH 2GSGA 3NJFA 3NZSA 4XAKD 5EU6E 4DOHE 4EI6A 4ICWA 2P5WB 1LDSA 4Y2LA 1O7DE 5EN3A 4EUPB 5HPOA 4DPAX 3PU7A 1EK3A 1HE8A 1ZTMA 2EJ1A 3AAZB 4IU2A 1WBXB 4HJUA 1XF3A 3GHEL 3KBHE 3NIDE 5IVZB 5DVMA 3VJ6A 2VMFA 3BOVA 3OR6B 4ODVL 4ADJA 1T80A 1I9RL 4G82A 2OL3L 1VFAA 2X4QB 3IKCA 4FTVD 4PIRF 4GKNB 1TQSA 3KHQA 5EU3B 5DJ8A 3VTMA 4JM2F 4C57C 4B3EA 1IQWH 3GS0A 2F7OA 1BOYA 3B7RL 3UZVA 3VFUA 2W88A 4ZUSA 4C83A 1RVFH 2I9LA 2Q3XA 4GW1A 4LGPB 3UMNA 4NO0B 2CK0H 5HHOE 4UQ9A 5CCKL 1MW2A 5EDSA 4IMLB 3UTTB 5F8QC 3D25A 3NPZB 3VW3L 2ZUWA 5F93C 1K5WA 4CSPA 3TU6A 3UH8A 1FLRL 3BEWA 3K8KA 3LRGA 5E2UH 4IEFB 2G2RB 5GGTL 2GJ6A 4PIBA 4PGBB 3TTSA 2VZ3A 5IFJA 4JE4B 5EZOL 2YD2A 1AD0B 4JRWA 3RFRA 3B34A 4K71C 5I8EA 4KK5D 1FNSH 1CE6A 4MQ7B 1MQ8A 2BOCA 1NCWH 4PGZA 2Y5TA 2FEEL 1DVFB 4NWTL 3WNLA 3NACH 3NMEA 4ZW8A 4YSUA 1E5BA 4FQCH 4ILDA 1PSKL 1IAKB 2CIIA 3AXLB 4KX9A 1AAJA 1E8WA 1KZQA 2FO4A 2ZX6A 3C5ZB 4RETB 4I4WB 4JZJB 4RIRB 5DTFB 4LVHB 4U3XA 4AIZB 1ZS2A 1PZCA 1X3DA 2FX9H 1ZVYA 3GXDA 1Q9KB 5F7BA 1QQDA 4LSSH 4G6FD 2NT0A 2YKKA 2QKIC 3WKQA 1ZANH 1PLGH 3OJMB 5C3TA 3H42L 4FJYA 5LAXA 3ZGIA 4OZGA 1NCDH 1H8SA 1U21A 3LY6A 4AYFB 4N22A 3JTTA 4AXWB 2XZQL 3FUHA 4L1HA 4MS6A 2C5DC 4YXKH 2R1WA 2OMZB 2CALA 4FC3E 3Q6FA 3K6FA 4Y5VC 1JFQH 1KPRB 3C6LD 3EGSA 1CZ8L 2A0LC 2DWEB 4FS0A 4M7JL 1PCSA 4L4VB 1A6UL 4HSQA 4TSBH 4HLEA 1FG2B 1JERA 5HHMD 2NQ3A 3EJYC 4QCIA 1HIMH 3L4WA 4HWZA 1JNNL 3BIBX 3L1OH 5BVJB 4HD5A 2FJFB 3EZ8A 2W65A 3VB9A 1NEZB 1U8OB 4MCYB 4UOZA 1HILB 3BGMB 4U6VH 5IB3B 5FW8A 4DKEH 2X53A 2E7HA 2WVVB 4I2XA 4HS6B 4P46A 1RK1B 3VQ2C 4M1GL 4P2OB 4UBDD 5DQDH 1I4FB 3FTUA 5ICZA 3GSNH 1E2WA 1FZOA 3RWGA 1EZVX 5EUKB 3QYNA 1KC5H 1R34A 3WFHB 2MCAA 5JHDE 3ZVVA 2ICWA 2Y4SA 1GOHA 4TQHA 3T8MA 4Q97A 2YEZA 4DAGL 5JHAA 3BESR 4X9BA 4IRZA 3HLAA 3CX5K 5IQOA 3EFOB 4AIEA 1IAMA 3FCUB 4Y2NA 5A1AA 4AENB 3L95A 1ZT4A 4HKXA 4XNDA 5DFVC 4XOBA 3PY9A 3UMTA 5EF0A 1ECZA 3MA7B 5I15L 3QUKA 3PL6C 2I32A 2VJ8A 4XX1E 1VAHA 1D5MA 5EULV 2FWSA 5I30H 3RILA 5JZ7C 4KQ0A 3FN0L 3C60D 2PYEE 5DHDA 2WIMA 4M6ML 1DVQA 1NC4B 4TUOB 1J0YA 2C9VA 4HU2A 3HB3B 3MV8B 4QHUB 3LS5L 4FQXA 4MRBA 4ZDHB 4OFYA 4KKQA 5EPMB 3ULSB 3EG9B 4EAEA 5KVDH 1GZQB 3BUYA 5DJ6A 5EU5B 3EJZC 4X98A 4MKTA 5AENA 2IBGA 4MB4A 3BVVA 4N2HA 5F1IB 3GSQB 4ISVB 1A22B 2B77A 2EQDA 3TCLA 3Q1SL 2ORBH 3EDFA 4JGUA 2ARJA 3KPQB 3RBSA 3FTSA 5I16A 4G43A 1OE1A 3F7PC 1FL3B 5TPWH 5I8CA 5DZVA 4QRRB 1NSNH 3MX0A 3VWJA 1A7PL 1GPOH 4LOUD 3S0PA 2MTPA 4F8LA 4RH4A 2HRLA 1SMOA 2V6HA 1HOEA 3LVEA 1K9TA 2FCBA 1NL0H 1EGJL 5EZJA 3P1VA 1QTPA 2XJLA 5FYJH 2B5IB 5J0BA 3PFQA 2LGNA 1YDPA 4J3SA 1BZ9A 2H8PA 4NUPA 5AAPA 2OK0H 4L8SB 2IPTH 3MXWH 4ABQA 3V0HA 1GOGA 2IXQA 1OQXA 4JHWL 1IE5A 3EO0A 4WFHE 3VI4F 2RFXA 2VDKL 1JDAA 1ES0B 1FNEB 4NNXB 4WNJA 4CN1A 5TDNB 2YGVA 1AO7D 3QZLA 2AK4E 5AWNH 5DUPH 4KJWC 4YR6B 3KBFA 4MA8L 1IFRA 4N8CL 5CN3A 5J1AB 4NC0B 3X1NA 4KK8D 2FQEA 3DVGB 3CXFA 5BUAA 1MFCH 2P80D 3SJVD 3MC0A 3WCYA 1BPLB 2AQRA 2FNWA 2BWQA 1QEWA 1ZIAA 4G8IA 4M6NH 3D4ZA 2CA3A 5KS9F 3N5AA 4NM4L 4APQA 2ZUQB 3OGOE 1DSFH 4YHNB 4LOFA 1EHLH 4O9HH 2QZQA 1J0ZA 2R1XA 3BLBA 2IAMC 4P05A 3QIBC 1GMEA 2BVOB 3QJOA 2FB4L 4BFIA 3BZ5A 1UM4L 1PKQE 3ZL2A 1XB8A 1MFAL 3OKMB 5HGDB 3VXME 4MNQB 4U1MA 1HYSC 4LAQH 3SY0B 2VMCA 2QVIA 4FXGA 3BRFA 4UAOB 5CEXB 3WFDH 2WXOA 5FA3A 2V33A 3LHPH 4PRHD 2OR8A 1M2VA 5ACLA 4X6DA 2F2HA 4PYGA 5D7KE 2F61A 2I24N 3LRSB 4XVJH 2OL3B 3EOAB 2YD0A 2ADGA 3ZMNA 2CU9A 4HH9B 1KIPB 4R4BA 2Q7AA 3MACH 1QWHA 4LHUD 3RVWD 1P4UA 1WG3A 3TOPA 2X09A 4E41A 3S8WA 2V5TA 1QFHA 3OC5A 1IEAA 4IOFC 3SDAC 4ERSH 4OBSA 3G6JF 4CGUB 4YHIA 5AW5B 4NUMA 2NNAB 2C7UB 4H88H 3BKMH 1NIEA 2QELA 1XX9C 2XVGA 3PDOA 2ZWNA 1N2RB 2PW2A 5E9NA 5TFSH 5TQ2H 1JZ4A 2ZCHL 4WENB 1P7HL 4G9DA 2HJLB 3WLWC 2YLKA 3PWUB 4I1RA 4TNFA 2VZVA 2E27H 3ARDA 3OMNB 4NC2B 3CDZB 4O2CA 5HHXH 5AZ2H 1SMDA 1KJ3H 1QNZH 3HC4H 2APSA 2ICCA 4HVBA 4IIZA 4PGDA 1Q9WA 1IBGH 3U0PB 3UTSD 3O4LB 1I7UB 3QRFM 3DYOA 4OFPA 1NLBH 3HE7B 3V0AC 3WJMB 1RZGA 3VRIB 2NUTB 2HAZA 5AAWA 4IS6A 4JDEA 3O9WD 2PCPB 2H32B 3L9EA 3WMQA 2H26B 4OCSH 4PJBB 4YDKL 4RFNC 1MRDH 4U1HA 2DQIL 3UTZB 5L6YL 2V3FA 1INQB 4PJCF 5EU6D 4I0PA 5CLTA 2V8MA 3VA6A 3K71B 4WK2B 1Q90A 2Q2EB 4OKVB 1JNJA 2VLJB 4JFQA 2JSFA 4BXVA 3ULUL 4KJQD 2BFVH 3N1MC 4GRMA 4KRMB 4MDRA 4TTDC 3THMH 3ZLQC 3VD1A 1N7MH 1EO8L 1YA5A 2QQKH 5MENB 3DSNB 1CYWA 7FABH 1IGJA 4FLQA 3HZVB 1EEZB 3WLBB 2X6CA 5D1XE 4AYMC 1PG7X 4PTTA 3WO4C 4PJ6A 1XTLA 1CFVL 2V4LA 1XGPA 4PJ9B 3WFEH 4D3CL 5IK3B 5EB9A 1BVKA 5C8JA 2JJTC 5C0BE 1U8KA 4WI5A 5HHOD 1B0RB 5CSZB 5SWZA 4LLVA 1WAAA 4PJGB 1AGBA 4XMLH 1P4IH 2NXYB 2XWDA 3GMQA 3UBXA 4C4KO 3ARFB 5BJTA 1C16A 2FTAA 2BSCA 4UT7L 4KQ3H 5IBLC 43C9B 1A4BA 3GMOB 3QUMH 4AMXA 1DQJA 2LOEA 1CFTA 3AVEA 2HJKA 2F54D 2XTSA 4ZOAA 3VH8B 4PH8A 1SJEB 4JPSA 3W5MA 1KFGA 4K23H 1CGWA 1SY6L 1AP2A 2A3TA 4IMKA 4F9PA 5CZVL 2FDBP 3BAEL 3GJEA 4PBXA 2XIBA 4Y2DD 3D3VA 3K7UA 4JQIA 5LQBH 2E7LC 5CMAA 1CGTA 1ZE3C 1E4JA 4FQ2H 2X4UB 4TLSA 3VWKC 5DD1L 4E5XA 4YXHH 1JPFB 3P3SA 3RFZC 3J7HA 2VISB 3EF7A 3L81A 3WNMA 2BCKA 3FO1A 3M46A 2J55A 3AB0C 4R3SB 4KK9D 2NQCA 3JBG7 1QR1A 1CK0L 1DJSA 1NCGA 5D7LE 1WGOA 3QCUL 4ZFZA 3L54A 2FJGA 1KB5L 3BAIA 3T4AC 2NY2B 5I76B 1H3GA 3P54A 4OKDA 4RAVA 3C8KB 3BKJL 5D6CA 3BPNB 4D9LL 4YDIL 2E7MA 3ZDXF 4WW1B 4DWHA 2ADYA 4WI4A 1MVUA 4LL4A 3MV9B 3V10A 1UB5A 3X14A 5EIVA 3ERXA 1FZJB 3CMOH 1EEYA 3VM7A 4P5TD 1IL1A 4JFYB 3FKUS 5I2IA 5EOTB 1CGSL 4JAMB 4H1LH 2VDPL 4Q2ZB 1TDQA 1LL1A 2PCXA 2CGRL 4PJ7A 1K4DB 1KPVB 3IRPX 4L9LA 1BWWA 4ALAL 4OGAD 2YQBA 3TA3A 3STBA 1XCQA 2DD8H 2E46A 2LTQC 3GZPA 4E9RA 2CSPA 4GI6A 4DGYH 4XBEL 4AEHH 2H2SC 4JM0A 1U3YA 3K1DA 2NY7L 2GJJA 4F7CB 2VAAA 5KBLA 1T6WA 1U92A 2B3IA 1QSFB 2NY4C 3S35L 2D7QA 4P48A 1G7IB 1IBDA 3WS6C 2HP4A 5J1TC 3AU1B 5JHDD 2VDKB 3DWTA 2JJWA 2E6QA 3IGFA 4XRCA 4Y0GA 4KZDH 1ORQA 2EO1A 1U33A 1S2EA 1SBBA 2NY5L 3CU7A 2CD0A 1F3DH 3EFDL 2ZOTA 5JPMA 1AGDB 4IBUA 5SV3A 2E7BA 2O5YL 3DLQR 4BSWA 4NCDA 3MLVL 3ALWA 3KZ8A 4ZMXA 1JUFB 3LN4B 1KENH 5BCAA 5K9QI 3GMMB 3KPRE 4P2QE 1K72A 2QADB 3ATBA 3M6DA 3KWUA 4UMGA 5I75C 1RZFH 3GXPA 3QDJA 4MXVF 4U3HA 2I27N 5IOPA 4A67A 1XGUA 1DQQB 2OMXA 1CF8H 4W9CC 2ICWJ 4LPTA 3SDDA 3MBEB 5AEAA 4KKBC 3A0OA 3OKDB 4FFWD 3WXVL 2YMXL 3RWFA 3NRFA 5GRJL 2YXVA 1ORSA 2H0PA 2VLKA 1UA3A 1VA9A 4LRNH 4Z7VF 2MPAH 1LVEA 3ARRA 3PWVB 3T2LA 1G84A 1GSKA 5I18L 1EZVY 1VSCA 4GAGH 1PZBA 4L37B 2F8XC 3ZTNL 4L3AA 5DFWH 1DHKA 4ORGB 4I5BB 5DZAA 5I24A 3D4CA 2NX5B 4DTGH 4JY5L 5G5DA 1SXZA 3BSGA 3LKNB 3B1TA 5BMFL 4N0FB 4NJ9L 3T8XB 1UXSA 2Z31A 1U9KA 1ZVSA 3F00A 3FUDA 4K3EL 1LO5B 4WWOA 1NBVL 2AP2A 5DD0H 4HWBA 1DZBA 4F7PB 1BAGA 2LU7A 3WTWA 2Z9TA 1MCKA 4X5PA 1QZNA 3LEXA 3U4AA 3US1A 3L6FA 3PP3K 1QEXA 5DMIH 5CGMA 2ISDA 3S88H 5DRNB 1EIBA 3DO4A 3H3PL 3TBVA 1T1YB 3FUNA 3RY4A 3G5YB 3P2DA 4R84A 3EW3B 4NQVB 4WFHD 2P5WA 1GHFL 4EUPA 4PQXA 2J8UB 2Y7SA 1KFAL 1WP6A 4IKNA 4IHBA 4EBQH 1U6AH 2AK4D 3AAZA 1YN7A 1WBXA 1KZYA 4XP1L 5GS0D 3GHBL 5IVZA 3ZY7A 3OR6A 3PE9A 5AOMA 2YD9A 4H20H 2ED8A 3ZHDA 3Q2NA 1CLZH 4LHUG 5K69A 3ATFA 2BNRB 3W0WB 5EOCJ 5HD8D 2X4QA 4GKNA 3T5WA 1AQKH 1NC2D 4JQVC 3BQUD 1CVRA 1R3IL 5AKTA 1EFXA 1RSYA 4DP6X 3T0XA 6FABH 4HJIA 5J7CC 3VRJB 1EJOL 4NO0A 3TVMD 1CL7I 1FCCA 3LCYA 4PJIF 4I13B 4U31A 1NGQH 4CDHA 3FZUC 4IMLA 4MMZB 2APTA 3UTTA 3ZO0A 3VXMD 3D9AL 2QQLH 4AZ8A 1ZEAL 3HS9A 3OKEB 3VD2A 1E6JH 1BQLH 2G2RA 3WDHA 4PGBA 4IM8A 1AD0A 5EC2A 1E40A 2ESVB 1QLFB 3ZKSD 3RZCD 5D7KD 3P9WB 4MQ7A 2XZCL 3LZLA 3WSQH 2NNCA 1DVFA 1TSHA 2P52A 3VUAA 3O6MH 1JIBA 3K2MC 1IAKA 3AXLA 4KVNL 4A6YH 3H55A 1BHGA 2P47B 4I4WA 5B1AB 4JZJA 4Z3TA 3HNSH 4P59L 4RIRA 5D1ZD 4AIZA 4Z7OB 3TURA 3CVHH 1TZGH 1Q9KA 1UH2A 1CICC 2VW6A 3JVGA 2R0KH 2C9UA 1Q94B 5CCHE 1D6EB 2WLZA 3KYKL 3EOBB 3A4FA 3ORJA 2D3NA 1MCRA 3V0DA 4QKTA 5LBSL 1XAKA 5GJSL 3HNVL 4MJ4A 1ZIBA 3O0RL 4AYFA 4AXWA 3EBHA 2CCLA 1YRKA 1B4TA 5D1QA 4NZJA 4TF4A 1CTNA 2OMZA 3F7KA 1KJ2H 3SE8L 5A2JH 3TO4C 1KPRA 3SDCA 2DWEA 3WENA 4HCRL 4L4VA 2A73A 2BX5A 1FG2A 2R15A 5FDYA 4OZ4B 5ITBL 5G2NA 1NOFA 1TXKA 3QJTB 3HE6D 2BOLA 2HKFL 1XCXA 2FJFA 4XCYB 3CXHJ 1NEZA 3NFNB 1H15B 1U8OA 4MCYA 1HILA 3BGMA 1JCKA 5K9JL 1E6OL 4N0CD 3ZX1A 4LVOC 2WVVA 1REIA 2G2PA 1T22B 4LDCA 4HS6A 1A1MB 1DFBH 1RK1A 4D0BB 3TLRA 1V3MA 4UYPA 2D3JA 4HBCH 4OF8A 5DZOA 3VG9C 2WMPB 1KB5B 2PPFA 4P2OA 4LASL 5T8IA 3RX9A 4A2DA 3DIDA 1I4FA 3H4HA 3MOAL 2YO3A 4G70B 5EUKA 3I9GH 1OQOA 3WFHA 3TM6A 2O5ZH 3TT1L 3ZL4L 4TVPL 3FU6A 2WLMA 2FL5B 4NQDD 3QCTL 1JPST 4PI0A 3EFOA 1FAIL 2DI8A 3HTLX 2OZ4H 1DJZA 5D1XD 3CZJA 4BWWA 1U41A 2HXAA 2VDPB 3LIUA 4AENA 2HLAB 2KH2B 3TV3L 3B3IB 2JCCE 1JTOA 1OAQL 5C0BD 5T1DH 4TSCL 1AY1H 3MA7A 2J25A 5JDSA 4J5VA 4LOVA 2OXGB 3UTOA 1V54B 3ZBMA 4YL4A 4JO4L 5D7EA 4CKVX 4Q89A 2WXRA 4K3JH 4DCQB 1E3ZA 1IAOB 3G6AB 2VL5B 4I3GA 1NC4A 1V7NH 2R0LL 2R56H 3EIFA 4TUOA 5A6LA 3MV8A 4HYTB 1A7RH 4QHUA 3DSFH 2EEAA 4UNVA 5BW7A 2F15A 3N41B 1YYLH 4ONOA 5DHVB 4ZDHA 3ULSA 5EPMA 3EG9A 4QRTA 4WEUD 1GZQA 5EU5A 4YIQB 3NESA 4Z0XB 1NCHA 4UTAH 1I82A 1P1VA 1PNCA 2NY0B 3DK0A 3P0GB 1YMMA 4JFDE 3KEHA 5F1IA 4LCWB 2GCYB 2YJQA 4ISVA 3FBKA 2WXFA 3LS4L 1AC6A 4PRPB 4PJ8D 3KHOA 5DS1A 2VAJA 3KPQA 2PCFB 3DGGB 5E1GA 2R8SH 3TN0D 3JTBA 3VXPB 1XVSA 3GLAA 5E7BA 5CINH 1OGTB 1NFDB 3QQNA 4WO0A 3SBPA 4O02H 1EHKB 2KZBA 1KDIA 4N90D 5D7LD 3TJHD 2ID5A 1LP9F 1L9NA 3NZHH 5FOBB 2XBTA 3UX9B 4Y8DC 4D2NA 4UM9B 5I1EL 1PG7L 3H9YA 4OAWB 5CS7A 1YEIL 3GIZH 5DC4B 2E9GA 1QBMH 3FU7B 1JF5A 4L8SA 3GXUB 1FBIL 1SLVA 1T66D 5DWUH 2YN5A 1JNHB 2CLVB 2WNXA 1HZHH 3NCYP 4RA3A 2LVEA 2B0SH 4CILA 2X4SA 4NUQA 1B4JH 1ES0A 1FNEA 1JPSH 4ZUWB 4P9HC 4PJFB 5B39B 1JAEA 5TDNA 3TWCH 1ND0A 3QORD 1Z9OA 5K93A 4ATWA 3ES6B 4KK5C 4Y7OC 4YR6A 1NCUA 4H8WL 2HWZH 4HJTA 5J1AA 5C6TL 4P9HH 3DVGA 1X9RA 2E4TA 1PF3A 9PCYA 4QXTB 3OKYA 4G6MH 4R7NB 5EC1B 1A4JB 1TMQA 1KIQA 2L04A 2XX0A 1HEJC 2QTVA 4YHNA 2G2NA 4NRYA 4W1TA 4PB0L 5I1IL 1F4XL 5IHWA 3A4AA 2BVOA 3QI9A 4M1DH 2IOOA 4PVMA 4ZAKD 1BJ1H 3LJ3A 3QIUB 5HGDA 3DOSB 4MNQA 4UTBL 1GL4B 1Q72H 1IC4L 3P30H 5AZEH 3WD5H 1HH9B 2DWYA 2I85A 3GKZA 1VZHA 2V5RA 4JRXB 3KJ4B 5CEXA 4ZXBD 3QWNA 1EZUA 1O6TA 3IKKA 4YX2H 2DIJA 1ASPA 4UB0H 4YQXH 5DVLA 4CC4C 1O9WA 2XN9B 3EDKA 1R3JB 2MSPA 2A74A 1ML0A 2D0HA 3ECWA 3LRSA 1YYCA 4KOBA 2OL3A 3X1EA 3KPRD 2PKDA 3EOAA 4P2QD 4HH9A 1KIPA 5C07B 3PAZA 4L5FE 4OD3H 4OU3A 1R24A 4YLQT 4BA0A 2ZSVB 3O2VH 3L7EA 2BIIA 4AM0B 1BZQK 1JPTH 1NPUA 5J12C 2OMTB 3QJUB 2NNAA 2C7UA 3LXBA 2AGJL 2GJPA 1N2RA 3EOYG 5E8PB 1B9ZA 5IJVA 3IJHB 4M1CC 1MHPH 1GJWA 2ZKHH 4F37F 1E5CA 4H8HA 1XF5B 1MWOA 2HJLA 4BJLA 1WT5A 3PWUA 5ESVB 5GGTA 3O6FA 1CD8A 4P3CH 3TPUB 1OTSD 4FG6C 3QQ9D 2V37A 3CDZA 1LO0H 3ECQA 2ZYSA 1KEGH 2WIIB 4HUXB 2WQAA 5CEZE 3X13B 4XPHH 4URTB 2GVYA 5TE7H 3U0PA 2AXWA 4YC2C 3O4LA 1I7UA 4YFEA 2DL9A 4GKOA 5CJXA 3HE7A 3MROB 3WJMA 3VRIA 2NUTA 3NIGB 2EABA 4ZOEA 4NM8H 1CL7H 2PCPA 2H32A 5AYUL 2H26A 1RULH 3D2UB 4PJBA 2VRAA 4X6CA 3TYGL 4GG6E 3MO1B 5D70L 1UWXK 3N3EA 3UTZA 2AQSA 2XWZA 1J5CA 3D1MC 1INQA 4JPKH 3JUZA 3K6SB 4OW6A 5I71C 3OC8A 4TOYH 3C60C 2O93L 4G3YL 2JQZA 4EOWL 3K71A 5IMOB 5H8DA 5ID1B 3F5WB 4BDVB 4M7KH 2VLJA 3HEIB 3UYRH 1WK0A 5FF6A 3RLSA 1T7WA 3T08A 1MG3C 4LP8A 4PLKC 2HPOA 3RE0A 3ZQWA 4OD2B 3V0FA 5MENA 2EDWA 3DSNA 4XO5A 4N6QA 5AG9A 1M4KA 2NCEA 4MX7B 3HZVA 1EEZA 3WLBA 4JM2B 5T5FL 3H9ZA 1S7WB 4BCXA 1NOLA 4PJ9A 3APDA 1X5YA 4GBXD 5KUMA 1RP9A 1B0RA 3B9KA 3N85H 4PUBL 5CSZA 3QDMB 4HWUA 3LXCA 1A6VH 4PJGA 5GJTH 3F6IA 4WO4C 1P4LB 1RZKL 2DQDH 1WA2X 1HAUA 3ARFA 3Q2VA 4WU5B 4MLIA 2HN7B 5KSUB 2VDML 2QPDB 43C9A 3QHZH 3GMOA 4ZZFA 3WY2A 2CR6A 3TO2B 5FV1L 5DGRA 1W6LA 2OJEB 3VH8A 1U8MB 4KTEH 1SJEA 2HZHA 3S9DB 3IPBA 3NJNA 1ESOA 1RU9H 1IB5A 1M7DB 4NXSA 3EAKA 1A6PA 2ZOKB 3KPOB 1RSFA 1XH1A 2CQVA 3N9GH 1K8IB 1P4BH 3CDGB 2VXSH 1ZLVK 1OK0A 2X4UA 1NCIA 3CFQA 1WTGT 2EE3A 4GKSB 4KK8C 1JPFA 1UADC 2BO0A 2F53D 3U2JA 1CXEA 1MAML 2N7SA 3V95A 3MMEB 1A65A 1FO0H 2P44B 4JCWA 4CMHB 3ESPA 4AJYV 1MCBA 5GISL 2AZAA 3H8NA 4Y88A 3SGKC 2X41A 4N2MA 1DEEA 4X5WB 3UAAA 3QIWB 4R3SA 3CCHB 1U8IB 3CH8A 4NKIH 3QPKA 2D9QB 5JPNC 1XSIA 1BV8A 1UT1A 1JVOA 2B14A 3QUYC 5I76A 3V79C 3C8KA 5E0FA 1H6EA 1NCNA 3K3QA 4BV1A 4WW1A 1U8HB 3MV9A 1OAKH 1S8DA 1IBFA 3VDBA 1ACCA 2YAOA 2B7DT 4Y9CA 4JFYA 5LCVH 5MI0B 3ASOB 1GKOA 3DTDA 4Q2ZA 4NN6C 4XNAA 1PTZA 2LU5A 3S5LG 1PEWA 1RVFL 1K4DA 1KPVA 1S7QB 2ICEC 2CO6B 2CCVA 2CK0L 1AMXA 5AW7B 2WINB 3IMRA 3GMRA 5JIDA 5CSBA 3X3FH 2FWUA 1NKOA 2B2XH 3RVWC 3J07A 4MQTB 2E0PA 3QFJB 2FUTA 1EGJA 4DKFH 5B3JE 3B5HA 2F5BH 1FYTE 3D39E 5E2UL 2GTZB 4NN7C 4RFOL 3TXAA 4F7CA 3QJVB 4LNRB 5CJQH 2EDQA 5CNHA 4NKDA 4QRSB 4MD5B 3J8F7 3VXSB 2X89A 2WOBA 3MLYH 1G7IA 1NFAA 1SMAA 2DIBA 2ZXGA 3BUDA 3AU1A 2JI1A 4NI3A 4C4BA 4TLUA 4BUGA 5AYQA 4AIOA 1NCWL 4MA1C 5IIEB 1BFVH 1VESA 2VRKA 5D7JD 3NACL 3ARBD 3CV5A 4XBMA 4FQCL 1AGDA 4N5ED 3U7AA 2MPVA 1X7QA 3LN4A 1KTDB 3HI6H 1RUKL 3U4EB 1IBBA 1OD9A 2FX9L 1RIUH 2VW7A 1K8DB 3SB3A 4LSSL 2DQGL 4F27A 3VFRB 3R06B 1DBBH 1VZIA 1ZANL 1PLGL 2RMNA 4YVNA 4N2AA 1DQQA 4EI5B 5DJXB 4TUKH 4Z3HA 3QEHB 4B27A 3OKDA 2X44D 3QT2A 2DJMA 4HX1B 5D1ZI 4AT6B 1CQYA 1TTBA 3WDJA 1F0LA 2VABB 1JFQL 4FXLA 1O7DC 3PWVA 4R4FL 4JFDD 4YPJA 4TSBL 4JO3L 5AVQB 5IQLA 4ELME 4Z8FH 4L37A 4EMZA 1HCZA 2ED9A 3NCBB 1HIML 4AKPA 4ORGA 2XTJB 2HJFB 3L1OL 3A3YB 4GP4B 1NGZB 4CRPA 1T5KA 2NX5A 3GYRA 5EO1B 4I88A 3NPSB 3PQYB 3L17A 2WQSA 4U6VL 3LKNA 2A6IB 3FSAA 4DKEL 1M9SA 2Z3FA 1GS8A 1LO5A 4WJ5B 3V7AE 2D7TH 2EACA 4F7PA 3MCYA 5ALBH 4DNLA 1QI4A 1M3IA 3DOIA 3LV3B 4XPFH 5DQDL 4BWTA 5DRNA 1LNUB 1T1YA 1WD9A 3S34H 1AYOA 3B2XA 3GSNL 4XMZA 4XMVA 3SDXF 1SHMA 4TL4A 5DURB 1DBJH 1KC5L 3S7GA 4NQVA 4XVUD 1BAWA 5KJ7E 2ENYA 5D2LE 3VI4B 4AUJA 1E7VA 2J8UA 2YMTA 1GOFA 1UWFA 3IM1A 3BVDB 1JP5A 3QUXD 4TV3A 4K0OA 5FUZH 3VI3E 4IBWA 1NPJA 1TIUA 1RZPA 2AJUH 4W4OC 2OYLA 3W0WA 2VSCA 3TEXA 3HBGA 3BUIA 4Y2DC 1H3TA 4JE0A 4ZK8A 3V5HB 2OBGA 1W0VB 3DRQB 5EEUA 4IRJC 4OJFH 3FT3B 1MCJA 1CFBA 3RVTC 2WYTA 2K6YA 2XBZA 5KS9B 1ID2A 2XDHA 4S2SA 5T3ZE 4PG2C 1ZOXA 3HBPA 3A6CH 4MMZA 2W60A 4AVHA 1KSRA 5AOLA 3FQRB 3OKEA 4FFZH 4Y4HC 5KVDL 1DDHA 4R2GC 4UWQB 3PV7A 1MIMH 3BFQG 3FO9B 2R0ZH 1SXCA 4FMFA 2ESVA 1QLFA 3RAJL 5D6DA 1Z5YD 1P6AB 3E6HB 4DP1X 2ORBL 1JYNA 1LM8V 2DTSA 2B15A 3X1GA 2WCGA 1T1XB 3ZU8A 1ECYA 2JTYA 5FWRA 5TPWL 1XGRA 3N1GC 4DPCX 1NSNL 1V3LA 4R26H 2Q8BH 1GPOL 4GAYB 1LE5B 4DH2A 3U6XS 3L3IA 4QHLB 1GCYA 5IW1B 4PJXF 1I7RB 4M8QB 4NQEB 2EVIA 3G6JB 2QZ5A 4MYPA 1NL0L 4OGAC 2Z0UA 4UOW1 5FYJL 1UM6H 1Q94A 2A9CA 2P8LB 1D6EA 2LFGA 3B37A 2OK0L 3EOBA 4AEIH 2VDMB 2IPTL 4U1NB 3MXWL 2WZ0A 1S9YB 2DQTH 3KDMB 1A1NA 2XQYK 4F8PA 5DR5H 1OT1A 4H1LG 1NKRA 5HYEA 5CU9A 4KQ4H 1TTGA 2O26U 2NY3D 3JXAA 4N0RA 1PVHA 4TYUA 3QFGA 4MNHB 5AWNL 1SY6A 4BSVB 5L0QC 5CEZD 2JELH 1MFCL 5L2KE 1EQWA 3DHJA 2AANA 2GT9B 3T0BA 4OZ4A 4PMFA 1YUHB 5I26A 4MMXC 3SPVB 3QO1B 4XCYA 5I74C 3NFNA 1H15A 1X7TA 1EHLL 3EH3B 1EVTC 1D7DA 1T22A 4KRPC 1A1MA 2EVHA 4D0BA 1YY9D 2FX7H 3FUMA 2WMPA 4KV5F 5JLZB 4LAQL 2KC0A 4KHTH 4I0KA 4WJG3 3ESNA 2HX8A 4OF0A 5H4ZA 3ATAA 3H9SB 4WKZB 4AC4A 3IXAB 4FFWC 5KBDA 3LHPL 3CN2A 3U2IA 3QO0B 1EAOA 1K5NB 3APMA 4LSPH 1J0IA 2AV7B 2ALAA 4ANWA 2FL5A 3BAWA 2YGPA 2M2DA 3ZSTA 2VSDA 2BSEA 3HPLB 5ISZD 2HLAA 2LV4A 3G5VB 1EXUB 3B3IA 2B8OT 3CFEB 2DJSA 3SY6A 4ERSL 4M3KB 1I53A 5DVPA 1FV1B 4H88L 3CVDA 3BKML 2NT1A 3JUYA 1T20B 3F64A 2G5RA 2QSQA 5TFSL 5TQ2L 4DCQA 1IAOA 1VB9A 3G6AA 2VL5A 1TITA 1RPKA 3NG5A 2E27L 4JANB 4XTRD 4GT0A 3BGAA 5AZUA 3DUSB 5DHVA 5AZ2L 1KGYE 5C08E 4XR8C 2BMKB 4N2FA 2NMSA 4YIQA 1KJ3L 4Z0XA 1QNZL 3HC4L 3KW7A 4OZIB 3TF4A 5DC0A 5GS1C 4XVSH 2KERA 2WVTA 4AMWA 1IBGL 4K71B 4I18B 4PRPA 1PMYA 1NLBL 4LK4A 2DI7A 4E0RB 5GS0C 2PCFA 3DGGA 4HZAA 3IDNB 3VXPA 2FVNA 3WMPA 4JGNA 3BRDA 3FTXA 5HD8C 4OCSL 1OGTA 4J6RH 2I60H 5GS0H 1WC7A 1NFDA 1MRDL 2X12A 3GS7A 2N4IA 4F57H 1DSYA 3D0AA 3WUWG 3NOIA 3TVMC 5JORA 5FOBA 2KUTA 1T0PB 2M1KA 4M8RA 4UM9A 3SBRA 3IMBA 2EKSB 1ZPLA 4OAWA 3MLZH 2BFVL 4JRYB 5E5RB 3ZDXB 4WFFE 1RPUA 3THML 3W2DL 1N7ML 4X8CA 3X12A 2IMNA 2QQKL 1VCAA 3FQTB 3IFLH 4PJFA 2CXKA 2X1WL 5DC2A 4ZUWA 5B39A 5HDLA 3MRGB 7FABL 1ZK9A 4HJ0D 3CC5B 3MLSH 4Y5VB 5DJ2B 3ES6A 1IGCH 2ZICA 3CX5J 1BVLA 3WFEL 2NZ9C 2VLRE 4QDGA 4WUUE 2PPAA 4TQPA 2Y1ZA 2BCMA 5FYLD 4QXTA 4R7NA 4XMLL 5EC1A 4XBPB 1A4JA 4HFUL 2VITB 1K4CB 2EIKB 3MV7B 5D7SH 4H0IA 3UIZA 3T3PF 2ZXQA 5D1ZC 1FYTD 2YFNA 3D39D 4BCYA 4KQ3L 4DKDC 3QUML 4X6BB 5ABDE 1WAEA 1U3ZA 1L5GB 2KMWA 5ETUB 3GSNB 2Y5QA 1WF5A 2VUYA 4W9LC 2R4RL 3DOSA 3K6DA 4FHJA 2V8LA 4NQSB 1QLEL 2H0JA 1HH9A 3QUHA 3VYPA 4RZKA 4K23L 4JRXA 3WE6B 2PR4H 3SE4C 4EI0A 3FB6A 5BOPA 4XNQB 3UAJD 4JJHA 2WZ6A 1UXMA 5LQBL 1ZGLP 1YPZA 4Y4KC 3R8BB 1R3JA 4FQ2L 1SPDA 2UZXB 3AXHA 4WFEE 1EUUA 3HUJF 1H9VA 4PRIB 5KSAC 4YXHL 1I1AD 2FE0A 5IQ7L 4LFHD 5M95B 4EN3A 4FLRA 5C07A 2XG5B 3IS0X 5G4MA 3OKOB 3G7TA 4WWKD 1DQIA 1KXTB 3U6XA 4LSTH 1JI2A 1AFVH 4HEPG 3HZYA 5T3XE 5KW9H 2OMTA 1RH8A 1T2JA 3AS2A 3PL6B 3N1FC 4KZCA 2XWJB 3P9MB 1U58B 4IBYA 4Z6AT 4F8QA 2F08A 5E8PA 2ZF8A 3CH1B 5C7XH 3IJHA 2P42B 5C0AB 3V5DB 4GRWE 1XF5A 4DGWC 4Z7VB 5ESVA 2J56A 5CLWA 4PJDB 1X5MA 4LDLB 4KAQH 3MJ9A 1BM7A 3CPLB 1MCPH 3L3HB 3CMOL 4M61B 2CR0A 3GC3A 4JN2A 2WIIA 2ZZUT 4JKWA 3ARED 1J9TA 4HUXA 1NANH 2BW5A 3I9AA 3UXFA 3G6DH 1JZ3A 1DN2A 2F19L 2A4EA 2GJ6E 1IZKA 1KBVA 4F7EB 3MROA 2RCSH 5DHXB 2OAAA 2DD8L 4L3EB 1MDAA 3VFOB 1P5UB 1QKZH 3DJTA 4UIMB 4DGYL 3S98A 4AEHL 4LSVH 3C5XA 3QNFA 3D2UA 5IF0B 1DZ0A 4NERA 1ZHKB 3MO1A 2GBVA 4MNGB 1NOAA 1BF5A 1S7TB 3EJTA 4NBXB 5ESQB 3H0TB 4B9IA 1AHKA 1HI6A 4S1DC 3K6SA 1TJHH 1SVZA 3C6SB 3L4CA 4ZX6A 2K3HA 5IMOA 1ZLUH 3F5WA 4BDVA 4KZDL 2OP4H 1NBQA 4QT5B 5AW2B 2AAAA 3NZ8B 2A9BA 4ONFH 4HMCA 2V7NB 4GO6B 5FYKU 4XNMB 3AUWB 4JVUA 3T2NL 3AROA 4HCRA 4OD2A 5T1LD 4WZ9A 2LAGB 4BQ6A 1KENL 1J0KA 4OZGE 3UC2A 3I2CH 2HFFB 1KBWA 4JM2A 3FQXB 1S7WA 3DTXB 4PJ8C 5FFLA 1J5DA 2ZP0T 5T3ZD 2F1EA 5GZOC 4PJIB 1CF8L 3S3BB 4FG0A 1F8TH 1SJXA 4K15A 2DQMA 1P4LA 4UQ3B 4FFYL 3N43F 3LYRA 3NCWA 3E0GA 2HN7A 3QPXH 4UM8B 4XE5B 2QVFB 5KSUA 1KXHA 3TJHC 5EBGA 1KCVH 4LRNL 2IAMB 3U25A 2MPAL 3QIBB 4EE2A 4X42A 1SN0A 5F1OB 3TO2A 4XB7A 1WWBX 4B95C 3OPZH 4OLZH 4ZTOH 2IDQA 4GAGL 7TAAA 1L7IH 2OJEA 1IGIL 3RHWK 1U8MA 2L3BA 1CG9B 3F7QA 4XI5D 4YHZH 1HTYA 2JIXB 5CBAB 5AW6B 4OF3A 5I5JA 3CWGA 1JNLH 1FL6B 2DM3A 1M7DA 1P6WA 1TTFA 3FFCA 1XF4B 2AS5M 4JCLA 2ZOKA 3KPOA 4DTGL 1K8IA 5B38G 3QORC 3CDGA 3QXAB 5E00B 1X4YA 2VNCA 1ZV2A 5DD0L 1AZCA 3RUGE 3SE9H 1GC1C 1XMWA 2YRZA 1YVLA 4UT6L 3VRLE 2FAUA 3OB0H 1TQUA 3NRPA 3MMEA 4R5TA 2OCFD 2IO5A 1GC1H 3S88L 5E1QA 3UPAA 3QIWA 5GGRY 3CCHA 3NJVA 1U8IA 2G0KA 1GKEA 3MLTB 1JL8A 4KDVA 3BUTA 2CLZB 4UUJB 2VQ1B 4R96B 1CFSB 1CXLA 1KBBA 4EZMA 5F1KC 4Q6IC 1ZPUA 4FNUA 4ZAKC 4EBQL 1U6AL 1HN1A 5AQ0A 4P23B 4DVBB 3WNIA 1U8HA 3Q2WA 1OW0C 1G7QA 2L0DA 1XL6A 4U1SB 2E9JA 3CZFA 4H20L 1CLZL 5L2KD 4ZXBC 1SF5A 4FQIH 5MP6H 5KSBF 1AQKL 1SN5A 1V3KA 1F2XK 2A38A 4EZJA 3COOA 3II2A 4NUGL 6FABL 3T4YA 2CO6A 2XWXA 3WUZA 5AW1B 5HDBF 2WINA 2AXGB 1NGQL 3HZ3A 3HI5H 3IS1X 3WY1A 1QPKA 2YK1H 5J11C 2X1OA 5D55A 2ZIDA 3QFJA 5HHQB 3QQ3B 1BD2E 4U1IB 5D96B 4RFNB 4D0DB 4ZOBA 1E6JL 2GTZA 1BQLL 1BQ5A 1L0QA 3OHXC 4K2UL 2K6ZA 4LNRA 5FCSH 1SM3L 1OCRB 4IRSD 4QRSA 4MD5A 4XH2A 3FHQA 4CVZB 3VXSA 3U1QA 2VT0A 1S6NA 1AYRA 2NR6C 2WCSA 2Y25A 5FO9B 2IAAC 1OM9A 2YARA 4QHKJ 2GSMB 1U3HD 1ZCRA 4WSJA 2VR8A 3WSQL 1HCYA 5IIEA 4M4RB 1J8HD 3QQ9C 5JR1H 2JKXA 1KACB 1NJ9A 4MAYD 4NZDA 3MRJA 3QK0A 4A6YL 5BRZD 3WN5A 1WFUA 4NAQA 3FS9A 5IGXH 1CDUA 1CLYH 1CS6A 3HNSL 4LIQH 1KTDA 2XXFA 1KN2H 3U4EA 4WHTB 1TJIH 2Y7QB 3CVHL 1TZGL 3WO4B 4J39A 1K8DA 5JIMA 5FO2A 2R0KL 1GYAA 4YK4C 4JKKA 4BWUA 3VFRA 5DJYB 3R06A 1L0XA 3IFNH 3IDIB 2XWEA 2GC7C 3KLKA 4HUMB 1A7NH 4EI5A 5DJXA 3QUMB 3AM8A 3KW8A 1X6LA 1J5OL 1K6QH 2BPBA 1IFHH 1T4KB 4RMVA 4NO3B 1H3UA 3DOHA 2WSPA 2YR3A 3WNNA 2BHFA 1YYMH 3E9TA 5C08D 5LB1A 2IQAA 1QLEB 3GJFH 4UTBA 3DHUA 4YBHA 2VABA 2XUWA 4AYID 4FKHA 5BV7C 5KAQF 4MBOA 3RG1C 4P2CG 2IWGA 2CKBH 2BINA 2DLEA 2HJFA 5BV7H 5LGKA 4J3BA 2FR4B 1NDMA 2FATH 3ABKB 4M5ZH 4HSCX 4NIYE 5AYTA 5EO1A 3Q8BA 3DX4A 4OZFH 3PQYA 1BGXH 1GY2A 2BIPA 4G6KH 3VWKB 4WEBH 4NAJA 4WJ5A 1OAXH 2P5EB 4X6DE 5AW0B 3S4SB 4B9GA 1YN6B 3DHPA 3ML8A 3V0GA 3VFNB 1DFBL 1MIEH 1YC8A 3WIIH 4GBXC 3EBIA 4F7KA 1GSMA 2O5XH 4AOFA 1LP9B 4HBCL 4NRXB 5GGSA 2IH9A 3AB0B 3O8XC 3LV3A 1YEFH 4I3RH 3QWQB 3RVUC 5A43C 4EQ3A 5IFAH 4YSOA 2GK0A 1QVOB 5DC9B 4WFFD 1AH1A 3LIZA 3N2JA 4JFHE 4LSUH 2O5ZL 4E41E 3RGVB 1AZVA 2WBXA 4R0LC 4JPIB 3VI4A 2A9AA 2H7WA 3IPFA 1BA9A 4HC1H 1SZNA 1JXDA 4LFHG 1XHHA 2OZ4L 1EFQA 3DO3A 2IFFH 4H1LB 3QXVA 4XC1H 3QWRD 1RD6A 2J6WA 2FQDA 4WUUD 2BM3A 5JW4Q 3RJQB 3PHQB 1SUHA 4C59B 1HDMB 1ASQA 1FL5A 4R4FH 2DMHA 5T1DL 1HL8A 4N68A 25C8L 5CN2A 1AY1L 2ZYHA 3QEUB 3V5HA 1QTYT 3MXVH 1W0VA 3DRQA 4FL4C 3FT3A 5DWPA 5KS9A 4NZTH 4HOMA 2BSDA 3ALPA 4K3JL 2KQMA 3GI9H 2NY1B 4JO5A 2R56L 2CJUH 3GEFA 3WFBH 1XO8A 2LTQB 3I3DA 5ELIA 1A7RL 3S36X 3DSFL 1WD8A 5F7YC 3ESVF 1YYLL 2OXHB 3DROB 5SX5H 4AGNA 3STZA 3JV5A 4N24A 3WAKA 1GS6X 4UTAL 1XCWA 2YOCA 3VXRD 3KLQA 1IQDB 2NY4B 3FO9A 4ZX5A 4QI3A 1S3RA 3IDYB 5KYWB 5J3HC 2C34A 3E6HA 2VM9A 5B1JC 1TNMA 5CHNB 2KZ1B 1L0PA 4WFED 2R8SL 1T1XA 1S4IA 3WKYA 5H94B 4CADA 1H8OA 1MOEA 5CINL 5T5FA 4GAYA 5I0VA 1XDTT 4CVUA 1ZS8B 1AKJB 2FD6H 4QHLA 1KIRB 1QSZA 4PBWD 3GUFA 5DD6B 2RAMA 4Q52A 4NQEA 4K7PH 3G6JA 4TPRH 3NZHL 3RIFF 5I75B 2WJ7A 2HKHH 2P8LA 4R97C 3GIZL 4KTDH 1QBML 5TE6H 2IBZX 3ROOB 4U1NA 5DWUL 4RFEB 1S9YA 3BYYA 2F58L 1HZHL 2B0SL 4YNYB 5SWZE 4RCAA 1JPSL 1B4JL 5FECB 1HZLA 1QHPA 2PXYC 3TWCL 3NCMA 4LQFH 3QH3B 5C0EB 4MNHA 4IDJH 3NJHA 3MLUH 4BSVA 3ZKMD 5D9SB 2HWZL 2QL1A 4V2BA 3VFVB 3S6CA 4P9HL 4HEMA 2WY3B 3CFCH 3D85B 2GJ6D 5D7JC 2ZUXA 4PVNA 2GT9A 3QP3A 5ICXB 2DWSA 1YUHA 1SN2A 4G6ML 3SPVA 4MXWH 3LH2L 4XWOD 4U4IA 4A2EA 2XV6B 4UOJA 4KH9A 4Q74A 4D8PA 3D3VE 2D8KA 1KLUB 4M1DL 1SXAA 2HUEA 4PJCA 4MAUH 3GD1C 3V0WH 2CIKB 1Q72L 3D7PA 5AZEL 3P30L 3T6XA 3D51A 4Q58C 2WQ8A 5F96H 4DP4X 3H9SA 4BZ1H 3GSVB 3IXAA 3FQ2A 2QFPA 5GGRB 3WUWB 4YQXL 4I48B 3N06B 3QO0A 4UB0L 1UD2A 5FM5O 1K5NA 4ZFQA 5B3NA 1NCCH 4O4YH 4QTIL 3IRZA 5JIIA 5AVZB 3MRDB 4OTXH 1OPGH 1HU8A 1QO3B 4OFQA 1JOIA 3DC0A 4ZUUA 3HN5A 3HPLA 4F15C 2WJ5A 2EDJA 3LKQB 3O2VL 1GIGH 5H35B 1JPGB 2FQGA 1EXUA 1EBPA 3ZDYE 1JPTL 1YAIA 5FKPB 3C2AL 4Y2OB 5DMGD 4Z7QB 3U0WH 2FSEB 3DURB 4YH6A 3U30C 1T20A 3KLAB 4BIKA 1MHPL 1CO1A 2OMBA 2ZKHL 4K5NA 1AJ7H 4URKA 1TETH 4PJ7E 2CDEB 4JANA 4KX8A 2H6PB 2VWEE 3DETD 1Y7VA 5IW6B 3DUSA 4AZUA 1LO0L 2OM5A 2NPLX 1AHWC 1U2HA 4LPVA 2OTUB 4NUJB 1KEGL 4P46D 2HTLC 4OJCA 5HP5A 5AB9A 4UINH 4APXA 5L88H 2CBQA 4G42B 1AS8A 2JFCA 4XPHL 5TE7L 3OD3A 3LZFL 4I18A 4A6YB 2ZOLB 1GW6A 3D69B 4GPVA 1KCWA 1IAII 4E0RA 4L23A 1USQA 4YDNA 4BXSV 3LEYL 1L9PA 3C12A 4NM8L 3EXLA 3BH4A 5F0JB 4U6XB 3CVHB 4Y5XB 4YO0B 1RULL 3MDJA 4XPGH 4JPKL 4LT7A 4GH7B 2OI9C 3MUUA 2BVUA 1URZA 1CICB 3S5YA 1FFTB 2EE6A 3CBJB 1D7CA 1QFWH 2YA2A 4YFDB 3OBAA 4YVUA 4FXKB 4U7KA 3RDJA 3ME0A 5HYFA 3PJSA 4KX7A 3JTSB 4HUUB 4M7KL 2CPUA 3RX5A 4JFXB 2BSRB 3K80A 3UYRL 3AWFA 4TS6A 2FBJH 4JRYA 4MZ3A 4X80H 1UA6H 3AWGA 3S3JA 1J9CT 2WXKA 1T6VN 4NGHH 3FQTA 4E9QA 5IMKB 2MNJB 1R9FA 2VR5A 1G1YA 3MQIA 3MRGA 3EKCA 4FQXD 5HI3C 3TIEB 4LP4A 1WWCA 3RNQB 3CC5A 4OB5H 4Y5VA 2BXYA 5D4IA 1UQSB 5DJ2A 5L4IA 3L4UA 3Q1EA 3TO4B 4BYHA 4OFYD 4TXVB 4X6FB 3B7TA 4LNVA 5DK3A 4P2RB 1XIWC 5JHBA 2CRIA 4HFWB 2Y36H 3N85L 4HS8H 3H1ZA 5A3ID 3V6ZB 5GJTL 4X7SH 4XBPA 1IM9B 2VZSA 3MUZ1 4FMKA 1WQVT 2DQDL 1K4CA 4HQQH 4OSUH 3MV7A 2AABH 3QW9A 2KI6A 2OCCB 3KDPB 1BD2D 4LVOB 1OP5K 5CD5C 4X5RA 4M5SA 4E9VA 1X44A 1VHPA 2EDEA 4X6BA 5LNDA 3VWJD 2V0AA 4OI9A 1X9UA 2ILLA 2X3BA 4HIEB 4KTEL 3SKNB 4U05A 3EJRA 1RZJC 3NJGA 3WE6A 1BZOA 4OBRA 2G4GA 3QCVH 3J2PA 5KOMC 1B88A 4XNQA 3N9GL 3IJEB 1P4BL 2VXSL 4J12A 5D71H 1RZJH 2UZXA 2FYYB 3HFMH 4PRIA 4BSJA 4X7FC 3KLHC 2P5WE 4NIKB 1FO0L 3WU1A 5AW4B 3OKOA 1PNDA 2MQGA 1R33A 3I75A 3ETBF 3SN6N 4TNEA 3ZHKA 3D34A 4LU5H 3ZTJH 5CBEB 3WHE1 4DKAA 4NKIL 3U48A 1XAUA 4U1GB 4CMMB 3PL6A 1KTBA 4KKRA 4AX3A 3FONA 2CJTA 2XWJA 3K4AA 3P9MA 2Q87A 3RIAF 1U58A 2XWCA 5AVVB 5I66B 3CH1A 1NCTA 5C0AA 4HV8A 3NJKA 1QWNA 1YY9C 4J3WA 3V5DA 1B90A 1RZ7H 3VFWA 4APQD 4Z7VA 4KJPD 5K33A 3MGTB 1OAKL 4LF3B 4R6UA 4M61A 1NPNA 4QPEA 1WUNT 4BFGA 2AQPA 1NGPH 4EF3A 1G7MB 1CN4A 4ODSH 5LCVL 4RDQF 4HJEA 4LKXB 5ES4B 2UY6B 3T0EA 1MQKH 4LESA 4QRQA 5I8KH 1K3IA 3OZLA 1ROWA 4LEOB 3W82A 4F7EA 4Z95H 4PM1A 5LXGH 4O02B 4L3EA 2B2XL 1P5UA 2WP3T 1KIUA 3FDWA 4UZSA 3KPNB 2AVGA 1BBDH 5IF0A 3GXNA 2HVKB 4W81A 1ZHKA 4MNGA 4NNYB 1S7TA 5CJQL 1IM3B 2J71A 1P9MA 4WLCA 4ICXA 5A6MA 3C6SA 3MLYL 3SDXB 1MLBB 4QR7A 1JTPA 3CSFA 4JFHD 3L9BA 4E41D 4RA0C 1BBJB 2Y1VA 4KKLC 4NYLB 5FGCB 4QT5A 1BFVL 1L4IA 1FI8C 1UA7A 3NZ8A 5FOJA 1X9QA 2V7NA 4P5MB 4OFKA 1DCLA 4XNMA 2D4DA 4DK5A 1W72H 4P5SA 3LNDA 4DFHA 3BWSA 4UV4H 2FWLB 4RBPH 3HI6L 3BVNB 3ARDD 1H6TA 2HFFA 5B1CA 3MYZA 1GS7A 3FQXA 3DTXA 3KVDD 1EZSA 1OTUD 2BXZA 5D1QE 5ADPH 3BCFA 5IWLC 1SQMA 1DBBL 5EZLB 1RKRA 2BVPB 4OJAA 3T04D 4MAZA 3QZPA 4PJIA 2WKLA 4TUKL 3L16A 5INCA 3O2DH 3S5LA 4OVUA 3EYQD 1X7SA 4UQ3A 4HXBH 3WY3A 2YLHA 4UM8A 3M17B 5C0CE 4M48L 4D9RE 3G5XB 5IHUH 3D0LB 2IAMA 2PTUA 1UGKA 4MHHI 4TUUA 1M71B 2E56A 3OSVA 2HRGA 5D5MF 1JTTA 4Z8FL 2IANB 1ASOA 4WI0B 4L8DB 5B22A 2JIXA 5CBAA 1LQBC 3AS3A 1FL6A 1TR7A 2WM0A 1HC1A 1ITBB 3MA9L 3P4NB 4HPOH 1F41A 1XF4A 5ECJE 4FA8A 3FFDB 4S0HA 3QXAA 5E00A 4UT9H 4KI1A 4HJ0C 1AZBA 4ZG1A 5KVFE 1UVQB 3CZEA 5IG7B 4DUWA 3KE0A 4U1JA 5EBWB 4FA6A 2FO8A 4K9EL 2D7TL 2UX6A 1F00I 3P69A 1FNLA 3O3UN 4PJXB 4BKLB 1UHVA 2Z4QA 3P3YA 3MCKB 5F7MC 4XPFL 3DA0A 1O5DT 2WO3B 3ZZQA 1EO5A 3S34L 3MLTA 2O1AA 3US9A 5J12B 2MCG1 1DBJL 3LKSB 1OWRM 2CLZA 1QD0A 2VQ1A 4MB1A 1CFSA 3D48R 5F44A 5SWZD 1TTRA 4BCZA 4S1QH 2QVKA 4P23A 3QS2A 4XNYH 3V2AR 4DVBA 3L08A 3OLIA 1CTOA 3L3GB 4XHJD 4X4MA 4U1SA 1IEBB 2AJUL 5IJBC 1C1EL 3OM3B 1D5ZB 5BUPA 1T3FB 3EHBD 4EVNB 5K9OB 1F13A 4OJFL 1MJJB 4YC2B 1MEXH 3DV6B 1I1AC 2CLRB 2FJSA 1YMME 2AXGA 4GP5B 3IGAB 3D3VD 3A6CL 3NP3A 1G6RL 4ZX3A 3K5SA 2Q6WB 1M57B 5HHQA 1JWSB 4U1IA 4D0DA 2EIBA 3PWPA 1H3WM 1HZKA 5C0FB 3DI3B 2IBZY 1BJMA 2A6JB 2DBLL 3FK3A 1MIML 4CVZA 2R0ZL 5FO9A 3KXFB 4N25A 3MFFB 4ZSOA 3GMPB 1FZKB 1BFTA 1P84J 2Q3AA 4XO9A 4M4RA 1T4WA 4XB3A 1AGEB 5ESAB 5HDQH 4B9KC 3ZR5A 5IMLB 1QG3A 3CNKA 3BWAB 1FVCB 1IAIH 5FM4A 3AREC 1COBA 1LO2L 5FB8B 3KYNA 1DUYB 2BY0A 2OFQA 4WHTA 3B8YA 5ABAA 2Y7QA 3I6GB 1WEJH 4GUPB 4PS4H 1DLHB 1U0QA 1CLOH 4P04A 4F58H 1UM6L 1C7SA 2YPLB 4PW4A 1C5CH 4MA3B 3RL2B 5DJYA 4C47A 1JE6A 4KUCF 4AEIL 3IDIA 3DX8A 2H3NA 2DQTL 3V4VH 1E27B 2DYRB 3QUMA