3EF4A

Crystal structure of native pseudoazurin from hyphomicrobium denitrificans
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
AEHIVEMRNKDDAGNTMVFQPGFVKVEAGDTVKFVPTDKSHNAESVREVWPEGVAPVKGGFSKEVVFNAEKEGLYVLKCAPHYGMGMVVLVQVGKPVNLDQIKEYKATGLAKKRLDGEIAKVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper protein
publication title Atomic resolution structure of pseudoazurin from the methylotrophic denitrifying bacterium Hyphomicrobium denitrificans: structural insights into its spectroscopic properties
pubmed doi rcsb
molecule tags Electron transport
total genus 31
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ef4A00
4YSOA 4UF7C 2HX7A 2OV0A 1GY1A 1JZHA 2Y1AA 2BZCA 1M56B 2DY2A 3MBWB 4AX3A 1L9RA 4GYBA 2PLTA 1ET7A 2QPDB 2ZWNA 5B1JA 1BXVA 2WO2B 3X1GA 5B7MA 1JZFA 2PP8A 3NJJA 2CCWA 3SQRA 2IH9A 5I26A 1QHQA 1I53A 5LDUA 1W6LA 1MZZA 5AKRA 2N0MA 4DP9X 2QDWA 1A65A 1E67A 2GC7C 2ZONA 4KNSA 1PNDA 4KOBA 1JZIA 4GP8B 3CVDA 3GYRA 1WS8A 4QKTA 5EHFA 3ABKB 3T6ZA 1NIDA 1NIFA 4ENZA 1NIAA 1AZNA 1WA2X 2HRGA 2IWEA 1JXGA 5A7EA 4L0PB 1URIA 2MRYA 2BP0A 1TU2A 1BAWA 3OMNB 4BDVA 1BYOA 1NICA 1RKRA 2QDVA 1OE2A 4YSSA 4E9RA 3S8FB 1AAJA 3OMAB 1OCCB 4G7RB 2FQFA 2FT8A 2R7EA 1JERA 4WKXA 3QJSB 1HAWA 1NZRA 2W8CA 1NTDA 4DP2X 5I6LA 2PPFA 4AKOA 1PAZA 4EF3A 2XWZA 3BQVA 3NJMA 1IBYA 2IDQA 4YSEA 2UX6A 2X87A 3NSDA 1UATA 2FNWA 5TK2A 2XVBA 2YXVA 3AG4B 3NJGA 4X4KA 3QJUB 3UAEA 2VMJA 2GC4C 3ZX1A 3IBOA 1HAUA 2GI0A 1BQ5A 1ID2A 2BO0A 3EH5B 3OM3B 1OV8A 3OMIB 3V9EA 1AS8A 3ZDWA 1J9RA 4KO9A 1X9RA 3NJHA 3L45A 4M4RB 4BWUA 1WAEA 5I6PA 6PAZA 2LLNA 1YLBB 3SBQA 1GS6X 3C75A 1ASQA 2FJSA 1KV7A 2YAPA 1OCOB 1RZPA 2ZOOA 2Q9OA 2XLLA 2I7SA 2FQEA 4NAJA 3D12B 4AKQA 2IDFA 3PAUA 2P80D 4KNTA 2VW6A 4GP4B 2HXAA 3FSWA 4KO6A 3EF4A 1GW0A 4N4YB 4A67A 2UXTA 3SBRA 3WG7B 3X1EA 1ZIAA 1CURA 1PLCA 5B1BB 1JVLA 1KGYE 4W9ZA 3PCYA 1A3ZA 1RZQA 2JXMA 2WSDA 2VM3A 4HIPA 2IDTA 1L9OA 2CJ3A 3TASA 3H56A 1GR7A 1AS7A 5AZUA 3N55A 3BVDB 2XV0A 2UXFA 2AVFA 4GXFA 5B7FA 2BWIA 4E9QA 2YAMA 1ZIBA 2XU9A 1HFUA 2TSBA 3AY2A 4YSCA 3EH3B 3EH4B 1IKOP 1PMYA 4YSQA 1DYZA 1V10A 3FS9A 1AQ8A 3ASOB 1JVOA 4GY4A 4E9YA 5D4IA 4E9VA 1BXAA 2H3XC 3TBBA 1ET8A 1KDJA 4UAHA 3ABLB 3S8GB 1PLAA 2BW5A 1WA0X 2BW4A 3EHBB 2PPDA 3IE9A 3X1FA 2J56A 1TEGA 4KOCA 1N68A 1XB3A 2X88A 1X9UA 1GS7A 3FQYA 3HEIB 3H4FA 3FU7B 5B3SB 2CUAA 2CAKA 3FSVA 1QNIA 4K9JA 3RYMA 2W88A 1IUZA 3WNJA 1SDDB 2UXGA 2J57A 1JZJA 2YAEA 2VM4A 6PCYA 4BK5C 1B3IA 3CZUB 2EILB 1CC3A 2MTAA 1L9QA 3HB3B 4YL4A 4YSDA 1OCRB 1L9SA 4YSTA 3UGEA 2GHZA 1OE3A 5F7BA 4FA7B 4UANA 1GS8A 4DP5X 1AIZA 2AANA 1PF3A 2BP8A 4CSPA 1KBWA 5B1KA 1XMEB 2GIMA 4BXSV 4A2EA 4DP7X 2AZUA 3QQXA 2HX9A 4BWWA 4HCIA 1MDAA 5I5JA 1AANA 2IDSA 2YAHA 3QJQB 4DP6X 1PLBA 4A2FA 4F2FA 5I6OA 4TXVB 2VN3A 2XYBA 4DP8X 5TK4A 1W6WA 3ZBMA 1KCWA 3T6XA 3MX0B 3CG8A 3CVBA 1AOZA 1DZ0A 3FYIB 1AZBA 2BWDA 4DPBX 2EIKB 3PPSA 3U25A 2VW7A 2YQBA 1R1CA 2HZHA 5I6NA 5IY5B 4A66A 4QLWA 2DYSB 2CBPA 4HCFA 4CSZA 2VSKB 3ASNB 3DIVA 3H4HA 3PLYA 3T9WA 1NWOA 4NB7A 2BP0B 3X1BA 4F2EA 2IWKA 1JZEA 1GYCA 2BP8B 4HAKA 4BDVB 3AG3B 1NPNA 4HHGA 1NPJA 4E9WA 1AS6A 1MG2C 3NP4A 2J5WA 1SHWA 2R7EB 1PZBA 1NINA 2PP9A 1E5YA 1NIEA 3S3CB 4ZK8A 1E5ZA 2DYRB 1ADWA 1ZV2A 2GBAA 3T6VA 2FT7A 2NRDA 2PCYA 3ERXA 2WO3B 3NJIA 9PCYA 1IC0A 4JHVA 4E9SA 4F7KA 2PPEA 3NSYA 2UXVA 2P80A 1GY2A 3QJRB 4A2HA 4KO7A 1BXUA 1ZDQA 3FPXA 1TEFA 3TA4D 2XXFA 1BEXA 3FPYA 3NSCA 1FFTB 3ABMB 1NWPA 4AI7A 7PCYA 1SJMA 1E65A 3QJTB 1AG0A 2YXWA 1CYWA 5I5MA 3X2QB 1AZUA 1L9TA 4DPCX 3T71A 1BQKA 4PAZA 3FYEB 4BXVA 2B3IA 3QJVB 5AFAA 2QT6A 2HRHA 3NSFA 1XB6A 2GSMB 2ZXWB 2DWTA 3WNIA 2UX7A 3ABGA 4FAAB 3JTBA 1A4CA 2FQGA 2IH8A 1KCBA 3GDCA 1JOIA 1J5CA 3FU8A 4G7QB 5I6KA 1BYPA 2RACA 4MFHA 1ILUA 1PY0A 1SFHA 1PCSA 2Q5BA 1TKWA 3X1NA 4YSRA 1WS7A 3UACA 4YVUA 3NJFA 1F56A 4Q8BA 5B1AB 5D4JA 3JT2A 1PZCA 2VW4A 3KW7A 3S3BB 1FA4A 2EIMB 1J9TA 1VLXA 2IAAC 1A8ZA 2OCCB 2HLEB 2IWFA 5PCYA 2PCFA 3DKHA 3DTUB 4G7SB 5I28A 1OOWA 1XB8A 1NIBA 3G5WA 5FC9A 2E86A 3SBPA 3WKQA 2FQDA 4G70B 4PCYA 1J5DA 4JKNA 3S3DB 2PP7A 4WTQA 1CUOA 2AFNA 4AKPA 4P5SA 1V54B 1AR1B 4P5RA 1AACA 1SNRA 1A4AA 3AG2B 3NT0A 4GP5B 5PAZA 1QLEB 1KDIA 3FQ2A 4G72B 7PAZA 1PNCA 4DP4X 1JZGA 3AW5A 4YSPA 3TU6A 1MG3C 1CYXA 2JKWA 1T5KA 3CVCA 5E9NA 1EHKB 2FT6A 3T6WA 2BZ7A 5F7AA 1KBVA 2XX0A 2YAFA 3OQRA 4A2GA 4DP1X 3NJNA 2DWSA 4RH4A 5ANHA 4HHWA 5I6MA 1OF0A 3IN0A 2B08A 4W1TA 2GB2A 1V55B 1SF5A 2XUWA 4BWTA 2DV6A 4A2DA 2OJ1A 1SF3A 2EIJB 4DPAX 2CALA 1JXDA 3OD3A 4HALA 5B1JC 2BHFA 2QPEB 1ZPUA 4KNUA 2VSMB 4AZUA 4YVNA 1EZLA 1AZCA 2H47C 2A3TA 2H5UA 3NYKA 4A68A 3AG1B 3NJLA 1ASOA 2JFCA 3ZIYA 2YARA 3FSZA 3UAAA 1AZRA 1SHXA 3AZUA 3CDZA 3PXLA 1J9QA 3WIAA 4M3HA 2PPAA 3N2JA 1N70A 3FSAA 3WI9A 4E9TA 1AG6A 3IEAA 1BQRA 1ET5A 1M9WA 1ASPA 4YSAA 3PAZA 3NJKA 1J9SA 3FQ1A 3GXUB 2PPCA 4HCGA 1NDTA 4HZ1A 3UADA 1JXFA 4KO5A 2XXGA 1WA1X 4DP0X 1OE1A 3NP3A 2AZAA 8PAZA 2TSAA 2IDUA 1IBZA 3V9CA 1ZDSA 1RCYA 4YSUA 3WKPA 3PAVA 5B7EA 2YAOA 1OCZB 1M57B 1MZYA 2FTAA 1PZAA 1GSKA 3CDZB 1W8EA 3QPKA 1FWXA 4E9XA 4G71B 2XX1A 4Q89A 2HX8A 3FT0A 4NERA 5D4HA 1ETJA 3TBCA 5I5IA 3FU7A 2Y69B 2I7OA 3IN2A 2YAQA 2XV2A 3UABA 1SDDA 1SFDA 1L9PA 3KW8A 2EINB 2FWLB 2XV3A 3FU9A 1E30A 1ILSA 2J55A 4JHUA 1KYAA 2I85A 4N8UA 1A4BA
chains in the Genus database with same CATH superfamily
4Q9RL 1LEGB 4B9CA 3QIBB 1O9WA 1TTFA 3MTXA 3PDOB 5ACMA 3HMWL 3PABB 4X7EC 5DMIL 5CGMA 3SDXA 1DQDH 3GIVB 3WNMA 4WFFE 1S3KL 3ZDYF 2GCYA 1H15A 3NEXA 3BDYH 3DX4A 5K69A 1C5CL 3VXPA 1JDCA 5DRXA 5ANME 4KX9A 3IDJB 2BXZA 2PETA 5BUGA 3SE8L 1FPTH 4V2CB 4F80A 3CX5J 5H4ZA 1SOKA 4CMMA 3VXSE 2D3LA 1JDDA 1EIBA 4CN4A 3TONA 5T1JA 3NIFF 3BO8A 2VL5B 1NGQH 3GBEA 4U6TA 2R2HB 5EHFA 2CRIA 4M48L 1GH7A 2OX5A 4ENZA 1XXDC 4HWNA 1AZNA 2P8MB 3FQTA 2F08A 1GRWA 4GXUM 2DKMA 1URIA 1MWOA 2GIXA 4Z77A 3WUWG 5L7XH 4PRHB 4M3KB 4N2KA 3JWOL 4HWZB 3GJEB 4GRMA 4R5VA 3V7AG 1OGPA 1IAKB 2ERJB 3TIDA 2DQUH 3SBWA 3HG1B 3V79C 1XEDA 2XTJE 4M5ZH 2CR6A 3AT8A 4A39A 5IR1B 3L9RB 4C56A 1EVUA 4EN3D 1RUPH 1RUMH 4P3WA 1IBYA 1Q9OB 2ARJA 3QR1A 3ARFA 1FFOA 3AG4B 3RE0A 1E4WL 4AT6B 3BC9A 3VRIB 3MNVA 1S7VB 4I3RH 5MEQA 3T65A 5KSUB 3T5WA 1D9KC 4F7EB 5CF3A 1UM5H 4YLCA 3BIAX 1ID2A 2X12A 2WZPA 4CW1B 4LSRH 4N0UB 4URKA 1JGVL 4JM4H 5F7EL 4DGVL 1JG9A 5TD4A 1MLCA 1MPAH 1CDIA 2Y2YA 3CMOH 3ZE1E 2QKIB 4JMXA 1GS6X 4IIQC 4LLUA 1G7LB 1OCOB 3D9AH 4DESA 3KLHC 3LPOA 2CBTA 4IGBA 3JWNH 4NHUB 2PMZA 4OAWA 1B0WA 1YUKB 4FJYA 4KKCC 3VDAA 4QRPA 5HY9B 1MREH 3ZE2E 4OV5A 4PY7A 1V7ML 5E6IA 1KBBA 3PWPD 5GISL 5ICZA 2JTDA 3P73B 4WWKC 4QYOA 1CLZH 4FHKA 4UM9B 2ZP0T 5IVZB 4NQCD 2KS0A 2Y5QA 3FN9A 3EO9L 4HX1A 3EFOA 1D5MA 4HUXA 1CU4L 2F54A 1SJHB 3GSNL 1T0OA 3NZSA 4XO3A 3SE4C 1LE5A 1KGYE 1BGXH 2QTVA 1IVLA 3PCYA 4YUEH 5D1QE 5TF1L 3RWFA 3PXHA 2FJHB 2AK4D 3ARRA 5IOPB 2CJ3A 2C7FA 5MEND 4IRSD 4U3SA 3C5SB 1NMAH 1F5WA 1JNLH 3DXAA 3L3KA 5LBSH 2ADGB 3DPDA 4OM0H 4PGCA 5FR3A 5I71C 3U2IA 3L5WA 3IJYA 2K6ZA 5ALCL 3MFFA 4YBHA 4YE4L 4LKCB 5FO9A 2GUOB 3OAZH 2GSGA 4C8XA 5I1IL 8CGTA 5SWSA 3ALPA 4N1EA 3KGUA 4LP5A 3GQFA 2KBGA 2O26U 1YEDB 4TVPL 5KJ4A 3LQAH 5D4IA 2GBVA 5ESQB 2DKSA 2FATL 2O6PA 4LU5L 4NKIH 4E9VA 3N91A 3MMEB 1LJMA 3TURA 3G9AB 2ALWA 4OSUL 3C09B 3OKDA 1XCQB 4XP9L 5CINL 4A1RA 4KK6D 1E5CA 3TJEL 3A6BL 2VMDA 2W59A 3QUXA 3A4FA 2IJ0C 3ZOAA 5D55A 4JX0A 3F7KA 3V6ZA 3ARTA 3U82B 1UA6H 3AS0A 3DGGB 3PL6C 5CJOL 1JSYA 4MJIE 5H35B 1T66C 1VF5C 5L88L 4AL8H 3SD2A 4BK8A 4BQBA 4XVUD 2VO5A 4N9GB 1H9DA 1V27A 4ICWA 4BH8A 1CFVH 4NQDE 3AUVA 1ITCA 1L9SA 5BZWB 1BV8A 2MPAH 4G1MA 2DH3A 4FI8A 3WFEH 4L8BA 4LLQB 5EUOE 2J1WA 3K1KC 5KUMA 2AANA 2MNJB 3I75B 4N8VB 4D3CL 4G7VL 4HUKB 4NO0A 5TQ0H 4Z7NB 3RIAK 3LY6A 4AV5A 5HD8D 1IBHA 3KPSB 3CLFH 4W4OC 4PJHA 3ATAA 4QTHA 1UB5B 1E9OA 2AQNA 2F5AL 4K55A 3D2TA 5GGRA 4WHDA 4JHZA 1A3RL 4AE1A 3DX7A 1DR9A 2OJEB 4FFWC 1IV8A 4XOAA 1UZ8A 3K74B 3EDFA 3MLZL 2R59A 3FTZA 4J6RL 4ZXBA 1UOVA 5HDQH 3MOBL 1YCSA 2EIKB 5E1HB 2IWGA 5IY5B 2G5BB 4P3DB 1D5BB 3MRLA 2A6DB 2PYEA 4BE6A 4HCFA 2X3AA 2VSKB 2X28A 2HWZL 3U0PA 2V9RA 2EE6A 4MLSA 1HL9A 2ISDA 2CUIA 4HULB 4K94H 4U1LA 1Y6NR 1ACZA 1JNHA 4JHAH 4FQ2H 2QZQA 1ZY9A 4IU2A 4YK4C 3U4AA 4X8JA 2VABA 2OMUA 2VLLA 3CWGA 4RGND 2MCAA 4E9WA 4N22A 1LQBC 1Q1PA 2RBLA 5FFGA 1BQHG 4RBPH 3RWCA 3RZCC 4I0KA 4N2FA 1D5IL 2CIIA 5G5DA 5DZ9A 5I17A 5LQBH 1OP5K 4L23A 1NCWH 4HHAA 2XFGB 1ZV2A 5C0CA 2DOCA 1BWMA 2IOMA 1NEUA 4GIAA 1ORSA 4X5XB 2EYRB 2TRHA 2GJZB 1ZT7A 2FRGP 4K23L 1EO8H 2NMSA 4OFQA 5KS9E 4MB3A 4UNTA 5HDRA 3ZRFC 4M8UA 4WW1A 4XNBA 5TE4L 1T5WB 2NZIA 3M1BB 3WNLA 4BFJA 2VM9A 1HHKA 1HKFA 1KTLA 3ETBJ 1EJOL 2XQYK 1IBFA 1YDPB 1OD7A 2HLAA 3ENEA 4G11A 4K3GA 4R0LC 1VADB 1R3LA 2W5PA 3VFMB 3LCYA 2Q2LA 3EHBD 2P45B 3VFVA 1T80A 5AVXB 3UO1L 3ZHLA 3QJVB 4KK8D 2VUKA 4V11A 1WBYA 1IZKA 2GY7B 5DK3A 3LKNB 3VAEA 3VNYA 4Y1AA 2DWTA 5KBDA 1WGOA 4Y16B 4JKPL 4PW9A 2FD6L 3QO0A 3JUYA 5I6KA 5IUSA 2Z65C 1TYRA 3GSNA 3UIYA 5A2JH 1PY0A 1DBBH 1ZKAA 2AJZA 1E7VA 3RWEA 2YGPA 4LXFA 2GJ6B 1OGTB 2H0FA 2G0LA 2NXZB 1A6VL 2R69H 4QYAA 3Q06A 3L7FB 2GJJA 3KYMB 3O3BB 3HKZA 1I7RA 1UQSA 2XYCA 1A8ZA 2J4WH 2OCCB 3IU3B 1EUTA 1LGVA 3R1GH 4BFFA 3EYOA 1JJUA 3MLUH 2VIRA 4UQ3B 2XRAH 5E9DD 2Y07L 1UM4H 4XCNB 5CCJA 5JLZB 2WNWA 2AJYL 3CLWA 4KY2A 5I8OL 3QI9C 4GSRA 4XR8C 1RK1B 1XX9C 4FXGC 2R0LL 2YD9A 3CVHL 4KH2A 2VDMB 3CZGA 1Z0NA 3QG7H 3Q8BA 3C2AH 1I8IA 2C3GA 3THMH 5HGAA 3NT0A 1UZ6F 1QLEH 4O9HH 4JQIL 1JV5B 2VXQH 4PJ9A 5J11B 2FBJL 4YDIH 3MLVL 2OSLA 1RH8A 4WW2A 5DS8A 1DVQA 5DJYA 1G7IB 1N9PA 1TLKA 5EBMB 2P46B 1O5PA 2CIKA 2J88L 1WWCA 4HKZB 4Y5VA 2VDOB 3R18A 3MLXL 5I8EA 5E9NA 1XF1A 5DHVA 2HJLB 1LHZA 5HHVL 3EZJB 4FABH 2A77H 4KITB 1OF2A 3QG6B 1G6RB 2Q3XA 4MNGA 3B9KD 5IUCA 3MA7B 2A74A 1PZ5B 1NGZA 1YNLL 3GDBA 4ZTPL 4LCYA 3PYCA 4IIQB 4HFUL 3F6IA 4R26H 3FTUA 1KBPA 3LZPA 4GI8A 4P59H 4PWEA 1KN2L 4JFOA 3PUUA 3PG2A 4RIRB 2ZG3A 4N8CH 2A3TA 3L4WA 2ZF8A 9CGTA 1B4JL 1OZTG 3IETB 3R06B 4NX0A 4UV4L 5CAYB 4TL5A 1HQ4B 1S7TB 1TYEB 2GJPA 4NQED 2X5PA 2IOOA 3C6LA 3GMLA 2GFBB 2P24A 3OAZK 1VFMA 4MAYD 4XC1L 4WGKA 3UTTB 4GPVA 2D7OA 1BCIA 4YEFA 4BUHA 5IKCB 5FYKL 5DJDB 4PRIB 3VD0A 4GW1A 1TENA 2ZX5A 3QUYA 2K6YA 3AREA 1LTXA 3BCFA 4V2BA 5CGYD 5D1ZB 5EA0H 3VRJA 2D0GA 2WGNB 3QULB 2GABA 2EYTB 3ARGB 4J1UA 5L4JA 4MAZA 3MJ8A 1HXMB 3QK0A 4U6YB 2IEPA 2Z92B 3SBWC 3FF8A 4FQCH 2H1LM 5CCGE 4BFBD 1OPGH 2IFGA 4KO5A 5JHDA 1DBJL 4W9LC 2BOBA 5T3XL 2VWEC 4RWYL 5BS0B 2IFFH 3T2LA 4BEIA 4Q2ZA 5EO9A 4Z7UF 4E5XB 2XZZA 4JFDB 5B21A 4LOUD 4HIIB 4HFWA 3TA3B 1ZGLP 5B7EA 4NCC2 1ZK9A 4FNUA 3P3RA 2CR3A 2H8PB 2OYMA 3MNMA 4M7KL 2XIIA 3VE0B 3L54A 3QIUB 1JMXA 1DL7L 1E28A 2QQKH 4L4VE 3K4DA 3WKNA 5EC1A 4HQQL 1FO0H 4PRBA 4CAGA 4BK4A 5DURB 2R0WL 4H26A 1ETJA 3K2UL 3U4BH 3LZQA 4NENB 1BQSA 3TBCA 3X11A 3L3JA 4FG4A 4LRNL 5HTSA 3AS1A 2C4FT 4H1LB 4M7LL 2H3NB 5DFVC 3VA2C 4PVMA 3DUUA 3L4VA 4HLZH 3US0A 1FRGL 4IGBC 3OKKB 4I89A 1CLYL 1V3JA 2H3KA 4WQOA 5EH1A 2F74B 2ZYIA 4A55A 2A6KA 2WGXA 4GFTB 3I6KA 3H7BA 5GS0H 3PDGA 5F9OH 2OV0A 3SJVE 3MV7E 1T1YB 3ZO9A 2RFXB 1L9RA 4H5SA 2YQ3A 1WRFA 1RJLA 4AQOA 1IC5H 2YZ1A 3BWSA 1NUFA 4X0KB 2P7TA 4ABUA 4JW3A 2C3XA 4DO5A 5C0DA 3NJJA 1XIWA 4E41A 4HKXB 1MRCL 4NRZA 2AJSH 1QRNB 2YEZA 4UOQA 4ELME 5AKRA 1WFIA 2N0MA 4JVWA 5KVMC 2YMTA 4MA1B 1M3JA 5IMKA 2AVGA 1NGYB 3D4CA 4GW4B 4RBPK 4ZQKA 3UPRA 1A1OA 3GBDA 4P2RB 3NIGE 4RISH 1X7TA 4A6YB 1TTCA 4JBSA 1CT8A 2CJSA 2FE0A 1GKEA 3EGDB 1MI5E 3MRRB 1T7ZA 3N0PB 2IWEA 3ZDXF 2YBRB 1MW0A 1C5DB 2I5YL 4L4TE 2NY0D 3RHWF 2CUMA 5BV7L 3RGBA 5EO0B 1NBCA 3HI1A 3NCYP 4S1RL 4OD1H 1E43A 5E8OA 2YKKA 3CVHA 1XHHA 4FNLH 4OF7A 5LAXA 3V4VL 4UNVA 4PWJA 1PY9A 3RDTD 4YK4B 2XPYA 2VISB 2Z31A 4JQIA 3DA0A 5BJTB 1RZKC 4RCAA 4JFVA 2OL3H 3RZWA 2FNWA 4MCNA 1VB9A 5F7LB 4FFVC 3FU3A 5A43C 3SDDA 2VE6A 2NY5C 1KG0A 2F1EA 3HE7D 2AGJL 2XTJB 2V8LA 4NWUL 3BWAB 4R90L 1J05A 5D7EA 2JWYA 1D5ZB 2NCEA 5D7LD 4GSUA 4PREA 4HS6A 2JTYA 5DVPA 4JFSA 4AWJC 4XMXA 4F2MB 3M7OA 2G0KA 5JOFA 3J2PA 2OMNA 4XPHH 5B39A 4AH2A 3FCSB 4I5BB 1RZ8B 1LDSA 5EUKB 3BEWB 2XJLA 3CNKA 5GGTA 2OXGA 1Z3RA 5DEZA 4WFED 5EIVA 1P0SE 4I2XA 5FW6A 2E9GA 4G8EA 2KLRA 2FR4A 1H3TA 2JK5A 2VJ0A 4OQ1A 4X99B 1PEWA 5CMAB 2WIIB 3VGHA 3VM5A 1DZBA 4L3EB 2F1AA 3RL2A 3HNSL 2DF3A 2FSEB 3T6QC 1KSRA 1GXEA 1NL0H 3BDYL 3HUJF 4FMKA 4QF1B 4ZXBC 1YAZA 1KYFA 1Z6JT 3RUGE 4NXSA 1I7TB 2RAMA 1JVLA 3GXMA 4U1JB 4W9ZA 4CU6A 3CLEL 1FPTL 1OEZW 3HRPA 3RB5A 4G82A 3FDWA 3ZE2B 4K2UL 3SGDH 3LAFA 1PDKA 4XMPL 5GS0D 1X9QA 3C60D 3BVDB 1ZEAH 3CPLA 3TT1L 2HJFB 4OGZA 3MRMA 2DBJA 5HHMD 5B7FA 1JIBA 2WZ6A 1QBBA 3H9YA 1ZIBA 2MHAA 1UWXH 5C0AD 4Z8FH 1SEQH 3Q2LA 2BK8A 5FOJA 3AY2A 5JW3H 2PUQT 5SWZE 1E27B 3S35L 4JNXA 3EH3B 5F9WB 4G8IB 4QRQB 4K5PA 4QTFA 4Y0GA 3BEVB 1FYHB 2P5WD 3BKCL 3RWDB 2ZD0A 3QFJE 4YJZL 4RDBA 4N6RB 1YPZB 4P5MA 1JZ7A 1YPZF 3SGEI 1CFMA 2XHNA 4PI2A 2C9UA 3WFZA 4S0SD 3BYYA 3TYFA 3DV4B 1TVDA 5I9QC 4UTBL 4ZAKA 2XIDA 1OB0A 2IC2A 4JDTL 5I1CH 2PPDA 3B5GA 4PLJD 3VXUD 3FUDA 2LOEA 1XB3A 4AM0B 2HTLC 2F18A 5D1ZI 4IBVA 3KHQA 5INCB 1LE9B 4WHCA 3WTVA 5HHOE 4EDXA 2WNGA 5JORB 1HTYA 2XPZA 3FAXA 4ACTA 5AD0B 4DKDC 4GOSA 2XVLA 1VACA 3FK3A 5HGBA 3RX5A 5MERB 4ALAL 2MTAA 1TZGH 1DBAL 2DS4A 1KCRH 5F7BA 4U0RC 1DSFL 2XZCL 3PP4L 1GS8A 4M8QA 3K8MA 1J1OH 1F41A 3KM2A 2OCFD 4WWOA 3DUHA 4DP5X 5DUPL 4LGSB 1WGVA 12E8H 1ACYL 1CZ8H 5D71L 3M46A 2RCSL 3SDXB 3SDXF 1RAMA 1S8DA 1L0YA 1VAHA 3II1A 4BWWA 1H15B 2WQSA 1CICB 1K5NB 5DRXB 4A2FA 3TNMA 3DX1A 2E27L 4CMMB 1U8IA 4PHXA 5GJTL 3KPLA 4N2MA 2QL1A 3BO8B 4JFZL 5EEXA 4MDIB 2RIKA 1X5GA 3K6NA 4IRZA 2V0AA 1AXSB 4UIKH 1JHTB 1BPVA 1MVUA 4PJ5D 1CVRA 1QUPA 5EZLA 4OLWH 4KJWD 1NUNB 1T7WA 1UFGA 4Z77B 7FABH 4FQIL 3MTRA 3HAEG 2ZXQA 4GAGL 1DVFA 5DD6B 3CZFA 3V4VA 4OCYH 2CLVA 2OMBA 1L7TL 1O7DC 1NPJA 3UJIH 3QPQD 4X7SL 3TIDB 1YEKL 4CSTA 3LTVA 4IRJA 2PWFA 3SYAA 3KJ4B 1WBZA 4MNHB 3OQ3B 1TJGH 4PJ9C 5FYLH 2Z4QA 3ZVVA 4CVWA 2GUYA 2UZIH 4XPGH 5J7CC 4WW2C 3VXME 4BSVA 3UYRL 4LCWD 5FYJL 1T0NA 2X1WL 3ARFB 3HZYB 1FFOB 1DVZA 5F7WC 5D70H 1T1WA 4Y5VC 4I3SH 5C08E 1OB1A 1ZHLB 3MNWA 3T65B 3O2DL 4H25B 3QJRB 3WFCH 4A2HA 3WO4C 1NFKA 4ZFQA 5AOZA 4KTEL 4N6QA 1RSYA 5K9KA 1JPTH 4NQCA 3A4AA 3TEZA 3TBYA 3ABMB 3MV8D 2A74C 2EICA 1UA6L 4H0HB 3MBEB 4DGIH 3O6MH 4TSBH 3HBPA 1BEYH 2ZUQC 1PYWA 3V4PL 2Y7QA 3B2MA 4OBSA 3BDXA 5DVMA 4KVNL 3UJJL 3V7MA 4A04A 3PU7A 2WXQA 5E00A 5DZAA 1XGPB 4IRSA 5IHWA 1F8TL 3VFSA 2YPLA 3DJ9A 3CZEA 5E6IB 5GS3A 3REVB 1IGYA 4N2OA 2XQYA 2N1KA 1XGYL 2K7QA 1FGVH 1AXTH 3DHMA 4G7QB 3MXWL 3WBDA 3C6LC 3N40P 5EWIH 5AOIA 3IKCA 3HB3D 3EFOB 1D5MB 3BFQG 4HUXB 3QUYC 2J8UE 4Q8BA 3RWFB 1A7OH 1BP3B 2VAAB 1BIIA 3IMBA 3GMRA 4LVOB 1J9TA 1OT4A 4U3SB 3IVKA 4Z7OF 5LKNA 3NJVA 4Y2NA 4XVSL 3L5WB 1GZQA 4AJ0A 1KXTB 1AQKH 4OZHB 3BVXA 1IM9A 2DDQH 3DJTA 1J0IA 1RZGA 2P5PA 3ZT6A 5J9PB 2GSGB 2MH4A 3GKWL 1UURA 1I9RL 2EABA 3EO1A 2D9QB 4KJQC 5A6LA 5CLWA 2DLTA 5L4IA 3OKYA 2VKWA 4U1SA 1ZLUK 2R4RL 2GK0B 2ZKXA 4YFDB 1T04B 2NQCA 2PWEA 3CDYA 3D85A 4FX5A 1INQA 5KBLA 1FAIL 3AG2B 3LKSB 5J8OA 5I6XB 5ECJE 2D7MA 1QWHA 5H4YA 5ISZE 3FJTA 1P2CA 1AI1L 3EYSL 3F8UB 4QRBA 4MBOA 2WINB 4LQFH 4HPOL 3LNFA 3QUXB 1WWAX 3LX9A 5TQ2L 4ODUA 5FF6A 3GMNA 4U1MB 4IW4C 3V6ZB 5GGVH 5HGDB 1BF2A 4NSKA 1OQOA 3S2AA 1OTTC 3JQOB 2Q6WB 1SXNA 3AWFA 1EEZA 2WKGA 4DP1X 1AHWC 4IJ3C 3AAZB 4IEFA 1BJ1J 2O5YH 5ANHA 3ALWA 5KJRH 3OTTA 4NAQA 4IQHA 4DO4A 2O5ZH 3NCCB 3O6LL 1A7BA 4ODBD 1G9MH 2PTTA 2CALA 3COOA 2R83A 5KVEE 4PU2A 2AP2A 4NO0B 2WYIA 2X6VA 1XIWC 2GYSA 1PG7X 4QXVA 3SD5A 4XVJH 3KWTA 4PJHF 3MRDB 3RVTD 4AIXA 3QIWA 3NA4A 1E9OB 4YO0B 2W9EH 1UWXK 4FQXD 4Q4EA 2O4EA 3PAYA 5EIIG 2JKTM 4JEGB 1NDGA 1SHXA 3AZUA 3RTQD 5I23A 5FYKU 5J1SC 1CD8A 5KN5A 1RZJC 1UZ8B 3OR6A 2I9TB 5DLML 3N85L 3LNIA 1LK2A 5KVFE 3D39D 3CFTA 3ZKSD 1J9SA 2GTQA 3BGMB 3UTQA 5LBSA 4Z7QF 1RXLA 1LDPH 3MYJA 4N90D 3U0PB 4N2AA 1O7SA 4OJFL 5CEZL 4GG6E 1E2WA 5HHPA 3T1WA 4G9FA 4S1QH 1UTDA 1BAFL 1JHLH 2VLLB 2WZ0A 3KPPB 2Z31C 3RWCB 2WYHA 3BKYH 1H3VA 3QDAA 1CQYA 5G5DB 5L2KA 3EOBB 1IU1A 1LO0L 1QEWB 3DARA 4UNIA 3WKPA 1JZ6A 1H5BA 5C0CB 4HJJL 2ZXAA 1RI8A 1ORSB 3W81A 3SGJA 4QHUA 3SDDC 4P06A 3CDZB 3O2DA 4QHKJ 4YX2L 3ZL2A 1Q0YL 1IIIA 2ZT9C 4CMHB 4WRLA 4FXTA 4FGMA 4BRJA 5MENE 2Y69B 3QFDA 5DJ2A 1HHKB 2CO7A 3LJ3A 3EBIA 5JPNA 3V4PA 1L9PA 5C6WH 3SIKA 4L4VB 1QWNA 3SDYL 5GZND 4KHXH 4QIRA 1R3LB 3S88L 3LKRA 2AEPH 5GRUL 4KBPA 2NT1A 1ORQA 3VFVB 5E08H 1WT5A 2NQ3A 2OS7A 5DEFA 3SDCB 3STLA 1M1SA 3K6SA 4F24A 1S7QA 2H1PL 4AX3A 4Y1AB 2LVEA 1IIKA 1LK3L 1N4XH 15C8H 1UOLA 4NO2B 5F97E 3IT8D 1E4HA 4L1BA 1MHEA 2PLTA 2X1XR 3ZHFA 2WO2B 3O11B 43C9B 1USQA 5E9DA 2HRPL 4AVJA 4JY4B 4XMTA 2H6UA 1AHKA 2AJZB 2YD8A 4HS3B 2K70A 1S7SA 2CLRB 5BZXA 4DP9X 2BVQA 2GC7C 3K4ZA 2ZONA 4ODVL 3II2A 1CI3M 4PSPA 4UYQA 3SJVB 5C8JA 2OAAA 2W95A 2X0WA 5LCVH 4HIJA 3HA0A 5AVQB 5LBVA 4Q52A 4KKAC 4H20L 1HHHA 1C7SA 3EO0B 3DX9B 4NI3A 3C08H 3KJ6L 1ZVNA 4H2AA 1I3RA 2HRGA 1SYVB 5A7EA 5L0QB 2HFFA 4EVNA 4DETA 4GSQA 2VDQB 3GMOA 5KSBF 4YGVA 3D0LB 4F3FA 2EVGA 4BDVA 2WMPB 2RB8A 3EJRA 1CD0A 1AAJA 3UAJA 1FF5A 1E3XA 5F0LB 4PJ6A 1NZRA 3RPIA 1NTDA 3HZMA 5AB1A 1TQCC 2Z7ZA 4ZAKC 4W4NA 1U8NB 1HI6A 1MI5B 1KCVH 2JCCF 2K4AA 2NR6C 2Y6TE 2QSCH 3BQVA 1FZMA 1I8IB 5IJCC 5JOPD 4HUCA 3NSDA 3BZ4B 1KF9B 1E90A 2IANB 3RLSA 4X4KA 1YJDL 4PJ9B 1E42A 4FNTA 4PY8J 5ILTL 4WW2B 4WW2F 4G80A 1A6AA 1HAUA 1MCDA 1TTAA 3ARBB 4PYGA 1IGIH 4AQ1C 5IB2A 4DHLA 3HE6D 1HEJC 3OM3B 1A6WL 2CIKB 1IJ9A 2I69A 4XBEH 1FIGL 1A7PH 5K39A 5I8EB 1FP5A 2H2PC 4QRFA 2E6JA 5DHVB 5F7NC 3MBXH 4JN1L 4N9OB 4NQEA 1PZSA 1EK3A 2YR3A 2FJSA 2X4UA 5AW7B 1OAQL 4FHJA 4PJEE 3WL9B 3PWVA 2A74B 4ZMVA 1ZK5A 5CLTA 5IFHH 2CGRH 4KFZC 4RGNE 2R27A 3HNVL 4DGWC 3FTXA 4QOKE 2X2HA 3KWXA 4PJGA 5DVKA 1CGSH 1R6VA 1B9ZA 4OVVA 1MAKA 1QW8A 4HW6A 4P2AA 3FO9B 2ZCHH 5C9JA 4GP4B 5AVTB 1CDBA 3LN5B 1KCUH 1DCEA 3DVNB 3O2VH 1MIML 4HKJB 4NIYE 3IYLW 3AXLA 5F7HA 4EXKA 1ZIAA 3ZDZB 2Y22A 3GMLB 4I1NB 1CDYA 2P24B 1S7WB 4KK5D 4DERA 3CN0A 3NN8A 4HIPA 4PIBA 3KWUA 1ANUA 1G9NH 2HVJB 3QUYB 4KKBD 1QSZA 1HDMA 3AREB 3VRJB 3WAJA 3WU1A 1JGLL 1DVFC 2KERA 3BGAA 4WDIB 4J12A 1CDJA 5BCAA 2LQRA 3EJYD 1FL5B 1F4XH 2WKOA 1Q90A 3MJ8B 2CJUL 1NA8A 3FQWB 3UGUA 3BFOA 2FYYA 2DQJL 1JAEA 1NCBH 4XNYH 4IRJC 3S5YA 5C6PB 3D4GA 4NUPA 4G42A 2EXTA 4BGDA 2BOBB 1V10A 3EKCA 1AQ8A 1DN2A 4Q2ZB 4GY4A 4MQXC 1M2OA 5HYSG 1CR9L 4Y2DD 2O5XL 3AS3A 1T7YA 1KIQA 2W60A 3QR2A 1KPUB 3TBBA 4LFHG 3S5LG 1MH5B 1YMME 3BPNC 4D2NA 3O3AB 2VXQA 5SWZB 1QBAA 1KJVA 4KOCA 1N68A 2JXMB 2OL3L 2QJDA 2VRKA 4PRBB 1FE8H 2CDEA 4QHLA 4S1DC 2CH8A 1X5FA 4GKNA 3LPGA 3QFJB 1CXFA 3X11B 1L6ZA 3L3JB 4D7PA 5BOPA 2R29L 4K9JA 2IALB 2XJKA 5T1KD 4L3CA 2CNZA 2LR4A 4ONFL 2QZ5A 3DUUB 4UUJA 3F6JA 1OT1A 3C6SB 1KYDA 3B8YA 1X5IA 1TJHL 3MODL 4LLMB 5T33H 5KSAA 4NZTL 5A2AA 5F88A 4JFWA 3HS8A 3DOHA 1A9EA 4XPHL 5I0YA 2A6KB 5E2JA 3I6KB 2GQHA 4GKSA 1MCWW 3F58L 4RWHA 2PABA 3GS7A 1PF3A 3KBHE 5BUAA 3PQYE 4TV3A 3TN0A 1NFDA 4X0NA 3SCMA 2GKIA 5IG7A 1EHNA 2HUEA 2BVYA 2G3ZA 4LSUH 4TOYL 5ITBH 2H6OA 2P7TB 3IXAB 4N0YH 3T3ME 1N7ML 1E4XL 1XIWB 5C0DB 4E41B 2EVJA 4G6AD 5GZOD 1HL4A 4KFMA 4TXVB 1WK0A 3BP4B 3JT0A 2MFNA 5DZOA 4Q6YA 4WFGD 3TV8A 3RDTA 1OXYA 3I6GA 4XP6L 3BKJL 3GSQB 4MQ7A 2IGTA 3UPRB 5I75B 4J8QA 3REWB 3T8VA 1CT8B 4MSWA 1VGKA 1QBML 3LVTA 1S9XB 1WAAE 3I02A 5J56B 3QWRD 3HE7A 3RDJA 1V7NL 3HI1B 3CFCH 1M6OA 1SEQL 5E8OB 1JNNH 4KX7A 1HT6A 5LAXB 2XA8H 3NP4A 2IQ9H 3HHSA 4N26A 4XCFH 1IM3D 4Y4FB 1AY1H 5FYJU 5FPIA 1TSRA 4HV8A 4M00A 5T5FH 4YGAB 4N87A 2PCYA 2WO3B 4X9FA 2X2JA 3V0FA 2H41A 5C97A 2ZPKL 2I32A 1CGTA 2A4EA 3QXUA 4HGWB 1MJ7H 4A7GA 1FO0A 2X6MA 4PLKC 3W5NA 2EDOA 1ZJBA 4ZDHB 1TEFA 1XGTA 4KKPA 5JPMB 5I1DB 5DTFB 4LVNC 1J05B 2ZOLA 4PJIE 3RVVD 1JI1A 1JYNA 2D2CC 4Z23A 1YY8B 5I30H 3QEQD 5CR8A 1D2OA 2OMXA 4KROD 5DGRA 5JOFB 4M3JA 5B39B 5CD5C 4KRPC 3A24A 3GSOB 1AZUA 1RHFA 4AH2B 2D7TH 4DPCX 3CSGA 3MGOA 1NLDL 3ZTDC 1XBRA 3VD1A 3C60A 5SV3A 4PG9A 2VNCA 3NSFA 4I2XB 2GSMB 1IGTB 1YYLL 5KYYB 1TCMA 3RVUC 1NAMH 4NHCH 5BMFH 3L1FA 4JPKL 5KZCD 2FR4B 2JK5B 3QIWC 3NDZE 1WC7A 1A1MB 2ADFL 4KPHH 4Y5YB 3A67L 3KYAA 2NSMA 2X9ZA 1TFPA 2VLRE 3ULVH 3P4MA 1T2QH 5J06A 2YC1A 4MJIA 1MNUH 4Z7OB 3DX8A 3VB9A 1CFTB 2QSTA 4GBXD 3VRLF 3UACA 3GRWL 3H6AA 1BVLB 1GGBH 1C7TA 2WBJA 4M4PA 4GIOA 2OZ4L 5B4MD 2XN1A 3SOTA 1A5FH 4GEIA 3GSUA 3BD5A 5EUOA 3TCLA 1GJUA 1DSWA 2BIIA 4LP4A 4X8CA 1Z5HA 2EE9A 1Y0LA 4L9DA 2IPTL 4YNYB 3VXUA 2HFGL 4JKLA 5FC9A 3VG9C 4OLWL 5DO2C 4LLAA 3UTOA 1R3HA 1U8MB 4QRAA 2J8UB 1OCWL 2ICEA 1MCEA 4OZIA 1T22A 1H5BC 1HEZA 2IPUG 4JKNA 5GSVA 2CUHA 3TBVA 3MUUA 1LYQA 3L3HB 4RA3A 1TR7A 2N01B 4YZFF 3LZFL 1GIGL 4LIQH 2ZF9A 4M93B 2DQHL 3R0NA 3UAFA 3ZL4H 4HJIA 1NC2D 1MCIA 1Z9NA 1M2VB 2CGYA 2OL3A 2L7EA 4C59B 1JZ4A 3I84A 4NS0A 1RJYA 4NQVA 4NC2B 3QHFH 3AW5A 2OQJB 4HK0A 4XRCA 3WE1A 4AM0Q 5HGHA 4BZ2H 4N8VG 2R29A 1U6AL 3AWGA 4IBZA 1YEJL 5AZ2L 3F7RA 2JKWA 3IMVA 4EDXB 3BKMH 3DYOA 2R8SL 1JVKA 1HINH 2EEFA 4ODSH 1HCFX 1X5XA 1IT9H 1OTSC 1VACB 2WLMA 4RH4A 3SYCA 2YMXH 3WIHL 3ZHNA 1YEHH 2B08A 3I9GH 4CKVX 3O6ML 3CHQA 1V55B 1G1KA 1Y07A 4CVXA 4M8QB 3ROOB 3BMVA 1U8HB 3BYTA 4G6KL 5IW1B 5IV2A 3CVIL 2UZYB 4LCIH 2FHBA 3U4EB 1HNYA 3EBAA 2VSMB 4YVNA 2I27N 1S8DB 3T1FA 3OWRA 1DBMH 3WFDL 1KBGH 2AKRA 2A0LD 3IDGB 4H0IA 4H0GA 3OX8B 3QQ9D 1J8RA 1JWMB 4YQXL 2KI6A 2WBXA 3FB7B 1H19A 4TQHA 1T4WA 2C5DC 4M6NH 4O58H 5DC2A 4XPTH 4B9KC 1OAZL 1J9QA 3QORD 3L2LA 3TJPA 3KPLB 3KDPB 2G3MA 5D7LE 3T3PF 4OD3L 4EN3B 4HMDA 5E0FA 2NDFA 2YGQA 1SXCA 1MVUB 3EUDA 1BOGA 2RJMA 1VCAA 4EI5D 1T0MB 2DTML 1OP4A 1BWWA 3UAJC 3AQZA 3DETD 4MS8D 5D72L 3CZFB 4NPKA 3BPCA 4R7VA 3ZO0A 3ULVD 3ZMRA 1OE1A 2JKLA 8PAZA 2IDUA 4G7YL 4MVBD 5T1DH 3G3LA 4ZUWB 3VI4E 5DRNA 5DJXA 4YMPA 5KBNC 2BH0A 4YPGA 4KMTL 1YEIH 2A6IA 3FTYA 4OT1L 3GUTB 1PD6A 3FBQA 2W80C 2MQ0A 5C0FB 3OZ9H 2Z4QB 1AGCB 3WMQA 4CRPA 5EZOH 4DZ8A 4BSVB 1X6LA 3PRZA 1CO1A 2XI9A 1D7CA 2ARJQ 5J6GA 4ZPVA 1T1WB 3MREA 4OLXH 3CU1A 3MNWB 3VI3E 4BELD 1FSKC 1TO5A 3NCJL 4OGYH 1F13A 3X14A 2LVCA 3PWPB 2N7SA 3KLKA 4JPWH 5FCUH 5LJYH 3NFSL 2H26B 1XF3A 4JZNB 1CL7H 1N18A 3P40A 5K9KB 3V5HA 4NQCB 5HVHB 5HHME 1H9VA 4EKXA 3LSOA 4WO4A 4AGLA 4PJDE 1AR1D 3KW8A 2OTWA 4NJ9H 1MAMH 5EBWB 1NC4A 4QXWA 1N5YL 2G3XA 3PGDA 3BH4A 1PYWB 5E1GA 4NKOA 1MKFA 2AEQH 4QRRA 4R7LA 2I85A 5AKSA 4XNMA 3EADA 2AK4B 4HGMA 5E00B 3SPVA 2ZXBA 3AXIA 2Y5TA 4IRSB 2O5ZL 5MENB 4OFKA 1MCOL 1X5ZA 2MCG1 5AVUB 2CO6A 2HVKA 1TG8A 5A2KH 2E74C 1IGYB 3LVEA 1HQRB 5IB4B 3O4LE 1ET7A 4BKSC 1XAKA 2QPDB 5BVPH 5JIQA 4OKDA 5HDBF 4BQ8A 4EZKA 4OGXL 5EOCJ 3SQRA 1CLVA 4KMQA 3VFRB 3GRWA 1GCYA 4HXBH 4Q9BA 3AS2A 4JFFD 5F89A 4L8DB 5IM7A 2ADYA 1ERNA 4NFDA 4AXWB 4X6BB 3I50H 2Y23A 3CVDA 2CHWA 4L0ZA 4QKTA 3ABKB 1BIIB 4B97A 3MA9L 4ANUA 1OGAD 5DJZA 3N9GH 2FB4H 4BE5A 3FTGB 5AVSB 1UKQA 2GW5A 4DFHA 2F58H 4O2CA 1H8LA 4PM1A 4TNEA 5CEYA 5JOEA 5D7SH 1XF4B 2NNAA 3ORJA 1EMTL 2Z7YA 3F85A 4J3OG 3DX3A 1XTLA 1OCCB 3OPZH 1LWJA 3EO1B 2C9RA 1U8KA 2D03H 5MEOA 1IE5A 2D3VA 1I8LA 2CM6A 2LHAA 2PPFA 4U1SB 4AKOA 4JDVB 1BFOA 3FO1B 1SOSA 3U1SL 3ZHKA 4GUOA 3DO3A 1OIOA 2HFEA 1WPCA 4NDMA 1INQB 2VL4A 4E36A 2MJWA 4TTGA 5FWQA 1JV2A 2VXSH 1P2CB 3IBOA 4ABWA 2VQ1A 5I1KH 4WWPA 3OMIB 5AYTA 5CWSB 5LO7A 4O5LH 5K9JH 3QUZD 1FFNB 4YHNB 1OWWA 3GSVB 4G5AA 5KSAC 4G8FB 4YHKH 2AXGA 1THAA 1K8IA 2ZXEB 1K8DA 5JW4M 4IEFB 2ZOOA 1D5RA 3O45A 3RTQA 5E4AA 2A2QT 1YN7B 2EADA 1DUZB 3KYOB 4OY9A 1WZLA 3TN0C 5BW7A 4WK0B 5ICYB 3B7RL 4OV6F 2WQ8A 3SCMC 3D39A 2PTTB 2W65A 1UACH 2FO8A 5L8LB 4DQOL 1N8OE 4LLWA 1D7FA 3CD4A 2VR7A 4JUSA 3NA9H 4FEIA 5IEHA 3V4UL 2Z7WA 4ZW8A 3F64A 4LCWE 3MRKA 4LDEB 4OKVA 2FK9A 4NKQB 2WVUA 1N4XL 5AUMB 1BFSA 1TPXC 1TQBC 4AGMA 3P4OB 4S2SB 3X1EA 4HMEA 1DHKA 5DHEA 4RGNB 4X5WB 4XHJC 4U7KA 2ATPA 3V5KA 4ABVA 3L17A 2F19L 1NDGB 1KIRA 1MHPH 3D34A 3KE0A 3QH3B 4LEBA 1Z9SA 2A7BA 2NXYC 1FZOA 5KN5B 1P7KB 2QEJA 1R0AH 1V8HA 3E6FA 2H6PA 3H56A 3V5DB 3MV8E 5FB8A 2AABL 3T0ED 5KW9L 3UFIA 1I82A 3OJMB 2AVFA 1QACA 4JRXD 3RI5K 4GXFA 3HE7C 3UTQB 5CJ8A 3DUSA 4YHOH 2MQ3A 5F9AC 3FMGL 3C08L 1HFUA 3MOAL 1AKPA 3MV7A 1KT2A 2WLJA 3OAUL 5E5UB 1SQMA 2B9BA 3LH2L 2CWRA 3UTSD 1MFBL 1REIA 2H9GB 4RQQA 4LPXA 4PRPD 4JO4H 4IKLA 2O30A 1OHQA 3KPQB 4X5RA 4WI0A 4BUGA 5CLZA 4KRLB 3L4YA 4WUKH 1YJDC 4XPAL 4U6HB 2XXMB 3VUAA 4ELMA 1BXAA 4TLUA 3E0GA 1UD6A 2UYLA 3DC0A 5GZNA 4NCC1 5IVXF 1IGMH 3CXDH 4GRWF 4X4ZA 2BW5A 3EHBB 1WA0X 4R8WH 4EUPA 2HH0L 2P5ED 3KCWA 5K59F 2YXFA 1SXZA 1AE6H 4TL4A 4PJBA 4D0BB 4H8UA 1GHFH 2HG5B 1NCCH 6TAAA 3EYFA 1MCNA 4J3UA 4KHTL 5JPNB 3AFLA 1TEYA 3TEWA 4GAYA 4BFOA 4YFLI 3EBGA 4KQ3H 3WDIA 3GXPA 3MZTA 3V7AE 1FVEA 4PYHA 1N3NA 5D7JD 4CILA 1OT2A 3LKRB 2YD6A 3ATBA 5CJQH 3O9WA 1AIZA 4IDLA 3GK8H 3WS3B 2O6FA 3SPCA 1UD4A 2HUHA 1S7QB 1LP9E 4WTZA 2B1AL 3F7YA 1XO8A 4JZJA 4A2EA 1SLUA 1QVOA 3QQXA 3WJLA 1UWGL 2KDYA 3DI2B 3B9AA 4NM4L 2YAHA 5E9DB 1PLBA 1QR1A 3WHXB 1RPKA 5LGHH 4OIIL 1PU0A 2Q76B 2WBJC 3KDMA 1A25A 4GQ9H 1VCBC 4X80L 2OR9H 3H9SD 1S7SB 3ZKNC 2VLKD 1WFJA 1U91A 4RSYA 3GUFA 4KQ0A 2R0KH 3CH1A 3DIFA 3U46B 2Q3ZA 3HBZA 3BZ5A 1RVFH 4QLWA 2DYSB 2P42B 1OGSA 3RWJA 2WXRA 1S78D 3BN9C 2ICEC 2PXYA 2ZAIA 1VFOA 3ZTNH 3GMOB 2LLGA 5FGCB 3PV7A 4L05A 5CSGA 4WGVB 4YGVB 5JZ7C 1F4XL 1OP9A 4BDVB 4KQ4L 3GB7A 4HHGA 5CBEA 3HRZA 1MXGA 3IDIB 3T0XA 1NBQA 3JTTA 3L6FB 3HZMB 3RPIB 3CSBA 3RUGA 3FHQA 4L8SA 1S5IH 1HI6B 3B9KB 4HUUA 3SPJA 3WCYA 1GW6A 4ZD3L 4Y4HC 9PCYA 4M02A 4MXQD 3SY0B 5CZXD 3TEYA 4UDTA 3Q1SH 4FF9A 1IC0A 2VDLL 5CGTA 5AKTA 5FUZH 4NJAL 2DLIA 2X4QB 1NLBL 3DPBB 1IAIL 1K9TA 2LAGB 2BIOA 4AMKH 3LKQA 1NMCB 4DW2L 1N6UA 3IWVA 3BHBB 1QO3A 1FSKB 4TQEL 5H2BA 2IG2H 1A3LH 3TH4T 3VQMA 2APSA 1XL6A 2PTVA 4YS4A 4N90E 3M6DA 4W68A 3JV5A 3T0AA 4NQEB 3DX2A 2X4UB 2O6CA 2BS9A 2SEBA 1N6QH 2D9CA 4MAYB 5GSRA 2QHRL 3MUZ1 3RA7H 1WFUA 3T71A 2A9AA 4GI9A 4PJGF 3RWGA 4AW7A 4L29B 4R7NA 3NIDB 2ESVA 4YHYB 2OW7A 3JTBA 1G43A 3OHXB 1VESA 3U1QA 2EH8L 2D31A 2IH8A 3DURB 4OLEA 1J0ZA 5J1TC 4JJ5B 4DK6A 4U6VH 5LVEA 3GZQA 4FFTA 3G5XA 3E80A 2X4OB 3INUH 2F8IA 4N0YL 3UG5A 1IFHH 5BUPA 4I87A 1PZUB 4R3SA 4Q6IA 2WLZA 3ZSTA 4JPQA 3BUIA 2XG5B 3NN8B 5EZPA 5E4OA 2P47B 4KI1A 2IAAC 5F72S 4D9LH 4I9XA 4FULA 5IGXH 3TWCH 1XR8A 2IWFA 2VXUL 3JV6B 4HD5A 3RNKB 5IHZA 3E8UL 4M1DL 4ONGH 3OKEB 3L08A 1ZPLA 4R4ND 2P28B 2WKOF 4ELDA 4IU3A 3HN3A 5I1JH 2X4NB 2XN9A 4BQCA 2VDPH 4OF5A 1KJ2L 2F0CA 1MWAL 1NM4A 1I8KB 4L1DA 2MCPL 5AAWA 2EDLA 3SQOH 5D93B 5I5RA 1FNLA 2LAAA 4KI5D 4OFIA 3V52H 1F4AA 2JB5L 4JO2H 1B6UA 2YWYA 4BGLA 2W60B 5CJ5A 3EYUL 2QFPA 1DDTA 1XCTA 4ZZFA 2WUCL 1YYMH 1PX8A 1ECZA 3N0AA 2Y7MA 1F1GA 1QLEB 4YXLH 1OAXH 4ZODA 4EJ1C 5L4FA 4QCIA 5L2JB 1F2QA 2EDJA 3V6OE 4FZ8L 5AG8A 2XICA 3HN5A 5KVFL 3AY4A 2CDEB 4GKNB 2E4FA 1K6QH 4OLUL 4WO4C 3I3EA 3WTWA 1SBSH 4O02H 4A37A 3D18B 1S2EA 4G9DB 4L3CB 4LHUD 4NZUH 2E9JA 2QQLH 4QXUL 2LFEA 2ZWYA 2HKAA 1FQ9C 3H0TA 2Y3NA 2ED8A 4WENB 1ZA6A 5I30L 2JJUA 3Q2NA 3A5VA 2BVEA 4Q0XL 1ZWIB 1M42A 2TAAA 1MSPA 5HI3C 3ECBB 1T20A 3WFHA 4FQLL 5FFOA 4MNQA 3UYOD 3PNWB 4RX4A 5IT2H 5T3ZH 4P48A 3MCG1 1ZPUA 4JO1H 3HLAB 5J3HC 1NFDB 5C08A 4AZUA 2WXPA 5JOPE 3VDCA 2DQGH 2NY0B 5BMFL 5CSZA 3X13A 4LSTL 3QZPA 5I0ZA 5KG9A 4JLRB 1PKQA 1HKLL 2CPUA 2NUTB 1F02I 3WN5C 5F3BA 1ND0A 1I4FA 3MLRH 5D6DC 3ETBF 4N2DA 2QVFB 3WIAA 1NCAL 3N44B 3ZE1F 3RDTB 3CC5A 4LQ1A 1ETA1 1FNEA 1QKZH 2PPAA 2FGWL 4WK2B 3I9PA 2EYSA 4UZGA 3P3TA 4DTGL 4Y88A 1A1NA 5C0JA 4QD2E 3PHQA 1S9YA 5GXBB 3FQ1A 4KK9D 1VGKB 1SJXA 3FSOA 4C4BA 2GTZA 3I02B 1CF1A 1E8YA 3MOQA 1MFVA 3I74A 3RWHA 2YEQA 3HE7B 5C7ZA 4LBEA 1ZLSH 2J1XA 2ZCKH 4OQTL 3DHUA 1M6OB 4MJ5B 5BVJA 1LWHA 2DLHA 1IBZA 3P3YA 5D7LB 2HN7B 1TZOA 2VYRE 1M7UA 3HHSB 5AW1B 3G08B 5I1AB 4TYUA 4PS7A 1CXKA 3Q3GB 2YAOA 1M57B 3Q5YA 3MBWA 4HV8B 4LGRB 2IQAA 1R3JB 1PZAA 4B9ZA 4LIQL 5F7FA 2ADJA 2WXLA 1KMGA 3ZL4L 1JGUH 3II3A 4A7GF 5C71A 1BVNT 1A64A 1FO0B 2C4FU 3SKOA 5BQ7A 5D1XE 3KXFD 3WIFB 4FADA 1XGTB 2Z35A 5G4NA 2VB5A 1JD7A 2ZOLB 4ZRGA 2YJQA 3RTQC 1XGZA 2BX5A 3UEQA 4XWGL 2OMXB 4FNPA 4Y7OC 5SX4H 4GBXA 2B0SH 5BW7C 4X98B 4JHUA 3QAQA 2QV4A 4TVSa 2A99A 1YEHL 2B1HL 1A8JH 1SJEA 3FQXB 3ZTCC 5ADOL 5A40E 1R5IB 1EHXA 2EXSA 3C60B 5GGSB 1JZHA 5FKPA 3FOMA 2H2SC 3O8XA 4DAGL 5FA3A 1TTUA 3LKPB 3T4AA 5ISZA 5HHMB 1FI8C 2V2TB 2X4RA 1V5JA 3SGKC 2AJ3B 1CDHA 1CD1A 4AG4H 1KC5L 5C0AB 2BVPB 1WC7B 1M7DB 2OBGA 2QGCA 5EU4A 5I76B 3TFKD 2APFA 2Z8WC 3P4MB 1I53A 5LDUA 1ZVSA 2YC1B 4Z7WE 4AQZA 3VXOB 2P5WB 3LHAA 2PR4L 5IQ7H 2PO6D 5C2BH 4ZUUA 4L8CA 2VC2L 1AGFA 1CK0L 4X5LA 1NC2A 1YNKL 2B4CL 3W1ZA 5KYWB 1F4WH 4P23D 5F7KC 4LESA 2W0FA 3G6AA 2VN4A 3GSUB 1H8NA 3C5ZA 3TVMD 4OJYA 5EUOF 2Z0BA 4GUQA 1J1XL 4L3AA 4QHMB 3VXUB 1I9JL 1KJ2A 3K71B 4DEWA 3BLPX 1MWAA 4OLVH 3P54A 1RKRA 1OE2A 1ZHKA 1UB6A 3PIQB 3VW3H 1JWUB 2FT8A 4OZIB 4OZIF 3MRJA 5GSVB 4KC3B 3TBVB 5I6LA 2V2WB 4XWOD 2Q10A 4QJ5B 2XWZA 4RZCA 2YRZA 3S3PA 2ZWLT 4WU7A 2HKHL 5HGGS 2VH5L 2EDNA 5T5FA 4L48A 5HYEA 4EOWL 3U48A 4JG0H 4IS6A 1FH5H 2X4PA 2BDNH 1EHAA 4JG1H 3SKUD 2VJ8A 1B0IA 3DJZA 2CKBH 2GI0A 3AACA 4HK0B 3UJTL 2YA2A 1OV8A 5HGHB 1KPRA 4PJ7A 4OLXL 1E6JH 4WV1A 5E8DH 3X3GH 5DRZB 1UJTA 1WD8A 1C1EL 3FCTB 4K3JL 4W70A 1L9MA 4FFZH 5J13C 3QNZA 1WAEA 1U3HD 5G55A 3PHAA 5B22A 1JYVA 5JIDA 4YHMH 3O9WC 4WK4B 5FDWB 4JKMA 4PJXA 3S34L 5L9DL 1LO4L 5I15L 4F7CA 2FIKB 2BNRA 1TF4A 3P9WB 3N3EA 4JZJC 3L3IA 4P2OD 2XKNA 2NY4C 2V6HA 4YWGH 3WJLC 1ROWA 2WAHA 4PJ5B 1ZSHA 3DRQA 1NAMA 1SYSA 2OSWA 4AZ8A 2VW6A 3FSWA 2AKRB 5F3HA 3AABA 1KB5H 5ETUB 1GW0A 5F1IA 5HVFB 4R7XA 2RA1A 3N6YA 1NCDL 1YG9A 1LO3H 4LKXA 1YNTA 1C16B 5LDSA 3RNQA 4G6MH 5FO7B 3H9HA 2G9HB 4I85A 3AMLA 4K15A 3RG1C 1T1ZB 1TETH 4LLYB 3PP3H 4BHUI 4I7ZC 4FOMA 2WB1A 3QEQE 4LCWB 3X3FH 2PXYC 5J12C 5BRPA 4L2LA 1IVTA 3OBAA 3A23A 4I18A 1PKOA 2J7LA 1QLFA 5TDPA 3N9GL 5TDNA 2APXA 3QZNA 4OQTA 1ZTMA 3HRZC 2X3BA 4UMGA 5E6SB 2AEIT 4XB7A 1IKOP 4PJFB 3BPCB 4P4KD 1U95A 3H53A 4WI8A 1Z7JA 1JL8A 2BIMA 3PGCA 3ASOB 2X6CA 5D7SL 4F37F 2EVFA 2NYYC 3MV8B 5DHYA 5DJXB 4R96A 3IMTA 4WHTA 5DRNB 3RU8L 2QADD 3P9MB 2A6IB 2AI0L 4G59C 1WQVT 2VITA 1T03L 5GGQH 2WUBL 1DJXA 1UFUA 1KDJA 1TJIL 2K9FB 1GPOH 4OR1A 4WF7A 4Y9GA 1ZXKA 2J56A 1U33A 4UT6L 3WXWL 3S8WA 1M7IB 4I8DA 1L9NA 3V6FB 5J6GB 3MREB 1IKFH 4AYFA 2QGBA 3SOBH 2HB0A 4FFYH 3IDYB 2X09A 1PSKL 3HEIB 2CK0H 2VXSL 4BZ2A 1BPLB 1RU9L 4HH9A 3X14B 3ZR5A 5B3SB 2CUAA 4S0HA 1U8CA 4RMSA 1BA9A 3UOAB 3V5HB 5LXVA 1H0DA 1WIPA 6PCYA 1ODAA 2YEVB 1CGYA 5ALBL 3DJRA 5A2IH 1EZVY 4FTDA 1L9QA 3HB3B 4HZAA 3PGDB 4OI9A 1JTPA 4LO9A 4L9LB 5KVGH 4KTDL 2AQPA 3EDEA 5HP5A 3ILEA 1HWWA 2JLLA 4NKOB 1A6PA 1H3WM 4XNMB 2EJ1A 3SPVB 3QR0A 2ZOTA 1FZKA 2ZKHL 2CO6B 1MFEL 2HVKB 3I6SA 4NN7C 3ZJAA 2VDKL 3IPFA 1XL4A 1B4TA 1KN4L 3OKOA 3TV3L 4UQEA 3KR3H 4JFQA 3IDXH 1AANA 3QNYA 3LD8C 2EDRA 2ED6A 3SE3A 1UD5A 4F2FA 5AVVB 1D6VH 4B9IA 4B9JA 1OLZA 1DQLH 2N56A 5F89B 1IGCL 1IILE 3AM8A 1XH2A 3EGXB 3OWEA 1MIEH 2DD8H 4KRNA 3VWJA 3FYIB 2QVKA 5ITFA 4RAHA 4PJEA 1IJNA 4I9WD 2CRMA 4ZX4A 1DDHA 1FV1B 1DUYB 2C3VB 2VDNH 4MTMA 5F9JB 2C4XA 3KLAB 3IJHB 1SM3L 1MQKH 1Z66A 3CBRA 4FC3E 2DRUA 2VDRL 1NWOA 3CSTA 5DUMH 4O51A 4BKLB 4EDWH 2AV1B 3U9UA 1QSEA 2J6EL 5JDSA 1SVZA 4O2CB 4LVEA 4JGMA 5AAWC 3KYKL 3CFEA 4Q9CA 4GSDH 3P4LA 5BRZE 3ELAT 2OK0H 3GBNH 4YDMA 1BM7A 4YDKH 3HN8A 2A9NH 1B2WH 2MOGA 2JIXD 1BBJB 3IJEB 2CG9X 5A6IA 3L9EA 5EOCL 1TSHA 4YPJA 2NY6D 5DQ9A 2YO3A 3VWKC 2BSEA 4EI0A 2HFEB 2WYZA 5EV7A 4NXKA 5T5NG 3AY4C 1GOFA 4E9SA 4FLRA 4GXVH 2OMVA 5F1NB 3LKOA 4ONHA 3V2AR 2VQ1B 1RSFA 1OZUA 5D2NA 1ZDQA 4P9MH 4YDLB 5GQBA 3OKNB 4YHZL 1CQKA 3NSCA 1Q4NX 3VFPB 3GC3A 2YD7A 4FG2A 5KBKA 3QRBA 2AXGB 3BE1L 5HSFA 1K8IB 1A7QH 1OO2A 3HFML 3QJTB 4FQXB 1K8DB 4YL9A 1W0YT 1WISA 1QABA 1YUHA 2W1NA 1MW1A 4FDWA 1KV3A 3S96A 3MXVL 4JDZB 5E99H 3O45B 4X6CA 4NC1E 3ROLB 3RTQB 1BQKA 2XQBH 3ULVE 4S1SL 3QAZB 4YBLB 3GHBL 4OCRL 5AFAA 5DJ8A 3S4SA 2L3BA 1RV6X 3R0MA 4K3EL 4N2CA 5AW9B 1P4BH 3A4DA 3D39B 5G4OA 1XB6A 2W65B 4JRXA 4M56A 3T2NH 1ZGLB 3N1MC 1DQJA 4ZT1A 3DVGA 4UTAL 3SKMB 4AITA 3Q44A 3D25A 2XG4A 3QQ4B 4YLBA 5IEHB 2EDBA 3EJPA 4N2HA 4AV0A 3BZFA 1RZ7L 2WO4A 4OKVB 2EZ0C 3WO3B 5A3IC 3UTSA 2CU9A 2NNRA 3HI5H 1BREA 5E2VL 2ETWA 4OH2A 4KY1L 4YSRA 3V5KB 2ATPB 4MA3A 1JPGB 3A6CL 1KIRB 1FZOB 4UAOC 3GI8L 2Y36L 5EOQL 3E6FB 2H6PB 2HG0A 3ZK0A 1R17A 2R0KL 1YMHB 3IJ9A 1AD9B 4R97C 3DUSB 1MFAH 3NZUA 5KAQF 4Z3JA 2UWEA 3DBXA 3PQYA 4NKDA 3TWYA 3WLBA 5HHXH 4EAEA 5GS1B 1KT2B 2E86A 1F58H 3DECA 4AY0A 2IBGA 5C6TH 4WJG3 1KTBA 2AXWA 5FHAH 4KROC 1JFHA 2FZ3B 1HCZA 2YUZA 1D9KD 4G8GD 1GOHA 4P5SA 3O6FA 2H32A 1HNGA 1TYJA 1JFQH 3WENA 1URZA 4ELMF 2FHFA 1SNRA 3PGFL 4DWHA 4FG6C 5D7JA 1TKWB 2DL9A 4UT6A 2BSBA 2QVMA 3OPUA 3NFPA 1P4UA 4XCYB 3GLDA 1HZHH 3RKDC 2EEAA 2W0PA 2NY7L 2X41A 3IFNL 3NIGF 2VOTA 1PNCA 2Y24A 3BN3B 1FFQA 4HBCL 3SO5A 1JZGA 1TITA 1ZRUA 4NQSA 4PJCE 4C4KO 4DP4X 3BSZH 4PJBF 2WN2A 1CGUA 4BM7A 3KLHD 1KOAA 4WI4A 3QWNA 5F9DC 1RFDH 3ULAB 1NGWA 4AEFA 4K7PH 1EHKB 4KKCD 5D2LE 4PFEA 4AMKL 5CIPB 1CN4A 4H8VA 3S36L 4GAYB 2N7AA 2LTQB 3L4CA 4WWKD 4K3DH 3NCWA 4AEEA 3MGTA 5HYJD 1B4LA 1FVEB 4N0FA 3O8XC 5BPPA 3T4AC 2AXHA 4S10A 1MRDH 3TPUA 4UOW0 1FYTE 3H1ZA 3MGAA 4KKLD 5I8KH 4TUKH 4XXWA 1Y1UA 3VD5A 4POZC 5INDB 1DFBH 2ZNWA 4K5MA 4Z0BL 1F18A 1VFAB 4OZGE 5CN2A 2A83A 2IF7A 1EX0A 5DD0L 5C07A 2K3TA 4KUZH 2ZUWA 3ZE0E 5I1LA 1I85A 1ZSDB 2CE6A 3V0WH 4PJIA 4JAMB 3H3PL 4ZTEA 2D4DA 3P0VH 1DQQB 1AG6A 1U91B 2Y2TA 4MXWL 3ZKMC 3CH1B 3C5ZC 1M9WA 1THCA 4JRYD 4R9HA 4UOW1 1ASPA 3VG0H 4OCSH 2BNQD 4MDRA 3V0JA 3UBXA 2J6EA 3CDCA 4UINH 5AWNL 4Y5XB 3RWJB 4BYHA 1F42A 4UZUA 1F11B 1J8HE 3VFGL 1CFNA 3X17A 4MS6A 3WEMA 3HE6B 4ANKA 4PBXA 3B3IB 1CFBA 3QNXA 1JN6B 1RUQL 5J4MA 1U4FA 2BJML 2QR0A 1L7IH 4E9LA 5CBEB 2VDPL 5DVOA 3U30C 2ZG2A 5FGBA 1QFWH 2AJUL 4BUQA 3V10A 2DWEB 3AB0B 4JANA 4M1CD 3VXRE 4ATWA 1IEAA 3HJ0A 3RUGF 2FBOJ 3PL6D 3L4UA 4L8SB 3W0WA 4PTTA 3NH7L 1T66D 4B3EA 2K4WA 4JB9H 4NO3A 4UDTB 4JO8A 4JHWL 4WV1C 5E1AA 1W2KT 2WC7A 2QHLA 1KIUB 4WI2A 2ITDA 5T1MA 3LMJL 3T0EE 3WYRA 2BMKB 2YAQA 3UABA 1SDDA 3PWLA 3UG4A 1QO3B 5H2BB 2QPFA 4RSVA 4HGKC 2GIYA 3KPMB 2PYFA 3G6JE 5FGSA 4FS0A 3QDGE 4HIXH 5ADPL 2SEBB 5E8PB 3S2CA 5I1GH 4HXAL 5GSRB 5CN3A 2OTUA 4NP4H 4NN6B 3NK3A 4ZG1A 3N1GC 3AGWA 3UL4A 4ZFGL 1FDLH 3E1F1 4FFWD 5LG6A 3FUFA 1I3GH 3CFNA 4DNLA 4O4YL 5JHLH 3K2MC 5DJAB 3SSGA 5T3ZL 2ZWNA 1FNSL 2D31B 3IAPA 4FEMA 1DLFH 5K1JA 2C7UA 4TUJB 3POHA 1MF2L 4YHLH 1IGFH 3BD3A 1QA9A 3G5XB 3BT2L 3GZPA 4DKFL 1BM3H 3LD8B 3NVQA 2G30A 5K9OB 1KPVA 4BSJA 4R3SB 4YR6B 4Y2DB 3G5ZA 4Q6IB 4UOZA 1Q9KB 4I18C 5GIRB 1UD2A 3HG0A 3RZCD 1IBGH 3RX7A 1AZZC 2R15A 2HPTA 2YJLA 3B43A 5E9AA 1JXGA 4J4PA 3CSFA 4DN3L 1TU2A 3WN6A 5D9SB 1JYXA 4WU5A 4Z7WB 4O2EA 2Y6SC 2KL6A 4IU3B 3WEXB 2HKFL 1AR1C 5SWQB 1CIDA 1OK8A 1E5BA 4D0CA 4Z3IA 3BP6B 8FABB 4LHUA 4NGHH 4FTVD 1Z0MA 2W8CA 3H7LA 3NK4A 3GIZH 4GH7B 7TAAA 2B14A 4J3TA 3A0OA 4EBQL 4HU8A 3U7YL 3ATEA 4L18A 2C34A 2YFOA 3OB0H 1CBJA 4M7ZC 1EAPB 5CBAB 4QCIB 2ODHA 3H9SE 3QVAA 2VLKE 2NLJB 1FIEA 4HSCX 4LNRA 1TQUA 2I60H 3EOTH 2XV6B 2H0PA 2ZP8A 1B6DA 3VSTA 1TLMA 4UB0H 2HP4A 3J7HA 2E7BA 1LD9B 3NABH 2CRYA 5HPMB 1OY3B 3QPXL 1MRFH 1GSMA 3WD5L 2VZTA 5I1HL 3WFHB 3TM6A 3NCEB 1QNZL 1A02N 3VCLA 2ENSA 2OLDA 4YHPA 3DSFH 1VPOL 3SE3C 3CK0L 4CSSA 4LHJB 3Q1EA 2ODIA 5DMGC 3MJ7B 4A67A 3AM8C 1RJCA 2G9KA 4XX1E 3VWJC 3VX1A 5GJSH 3WIIL 1GYUA 3D3VD 1PKQB 1KBKA 2B4CC 2N3JA 1K4CA 1I4FB 4X6DE 3RJDA 1ACCA 4CADA 5B1BB 1XCXA 2EC8A 1DBKL 4PJDA 4U49A 3FOLB 4HPYH 5HHNA 4E0RA 1RZQA 1EGJH 3CC5B 5ESVA 1IM3B 4QY8B 3MAWA 3QI9D 3GNMH 2J8OA 1A1NB 4C58B 4U1KA 2QV2A 3PHQB 3B2UC 2YAMA 1G7JA 2NTFA 4PD4J 1U2HA 3GSXA 1C12B 3NACL 5C09A 4ODWA 2DWDA 3DYPA 3KXFA 4P3CL 4LBEB 4R97B 4IM8A 3C5JA 3OMZA 4TSAL 2MKLC 4AJVA 4RAUA 3EFFA 4XTRC 3D69A 5C7XH 2AK1H 5MEPB 4I88A 3QEQB 2VERA 3RHWK 4AIZB 4P57A 4KROB 1F6FB 2HT2C 1ET8A 4HEPG 1ICTA 3MLYL 3LDBB 4UAHA 5C0BE 4XX5A 4M43H 1HEHC 5EO1A 1C08A 2PW1B 3LHPL 1MJUH 2ADJB 5D2NC 3LZRA 3NGBB 2KLSA 5IBTL 1WZAA 2OMWA 2JB6B 2KT6A 3Q6FA 3Q9PA 3SKOB 5KYXB 3ARUA 4M9PA 3NG5A 4NWTL 5KZCB 3H4FA 3DX6A 5F1SA 1KENH 4IOSA 2B7DT 4M5TA 3UIZA 3RYMA 2GG1A 4O02A 2ED9A 3SKJL 4DCQB 4XCEA 1BD2A 2WB7A 2Q7YA 2CO1A 3A21A 3M17A 3D0VB 5E0QA 2E0PA 2VO8A 2OPCA 2WJ5A 4GBXB 2PO6A 5JIIA 5AB0A 2DBLL 4UANA 1L3WA 4PSRA 4UILH 4MD0A 1FGNH 3BXNB 2WSPA 2Z91A 1XFPA 1FL3A 4KI5E 5JR1L 3US1A 3D08A 3FOMB 3GI9L 4IMKA 1N0XH 2X9WA 4AVIA 5FA3B 1TVBA 2E7MA 3PPEA 2AZUA 4NUJA 1RZKH 4FQHA 3GBLA 1CD1B 2L7QA 3B34A 1NKGA 3MUGB 3CFBB 2EDEA 3I6LD 2NYZA 3RY6A 3MYZA 1HH6A 3KPRA 4JY6A 4TQPA 4U1NB 5DEGB 3EIFA 4NM8L 1XZ0A 5LG1A 3DROB 5GS2H 4ZUUB 1DZ0A 1AC6A 4ODTH 5AW0B 4L8CB 1BMGA 3QZBA 1ZTXH 35C8L 4OCLC 4RRPM 4C56D 1NC2B 4WCYL 4Q9RH 1G5GA 1F90L 2IBZY 4I3GA 3PLYA 2WLIA 2APVA 1FORH 3HMWH 5DMIH 4BSWA 3GRBA 2XA3A 3ZKXB 4HIQA 1Y7VA 4U6XA 1S3KH 4HUVB 1HOCA 3LRKA 1NSNL 1OSPL 1E7UA 5D5ME 5FIEA 1C5CH 1MJJA 4ORGA 3O6FC 4GQZA 4OW6A 2WZPD 1YC7A 2BY0A 3SE8H 2UY7A 5D7JC 3MRJB 2YFNA 1X5AA 1MCJA 5LN8A 4WU7B 4WJKB 3L4XA 1NEPA 5DFVD 1W72L 1UXMA 3CHRA 2ZNXA 4ZO7A 4KXDA 4M48H 1KGIA 5AVZB 1ZS8B 4P2OA 4IGBD 5GGUB 4IOFC 4ES8A 1OL0A 3B7SA 2IGFL 4QRPD 4LEOB 1HHJA 3FN0H 3HS0A 1IKFL 3JWOH 4PJ7F 2I24N 5E1QA 3TO2A 3FRPB 3WLWC 4GG6F 3QQDB 3F00A 2BVUA 4WWNA 1ZV5A 3T2QA 4AI7A 3QNZB 4MB1A 1E65A 1S6NA 5I66A 4NPJA 3QJOA 4M62L 2F54D 3QORB 5TFSL 4L1SA 4PJXF 2QMJA 4XXWC 3SQBA 3DRTA 3FT4A 4QRSB 2GITA 3T4YA 3L3IB 2XKNB 1WIUA 2J3SA 4E68A 2IV9A 1U0QA 1BMWA 3DRQB 3DXAD 1NAMB 4Z78B 4FAAB 1SYSB 3ECUA 4KVCL 4RMTA 2GEQA 1I85C 4OI8A 4W6WB 4XZ4A 2PWDA 3TLRA 1JGVH 5F7EH 4DGVH 4F33A 3QUGA 5F1IB 1FCGA 2UZXA 3MDJA 5JW5A 3CX2A 5JNYA 1GZPA 4BZ1H 3Q7JA 5SWSD 4LKXB 4ELKB 3UTZA 3OZLA 4R4FL 3U0WL 5HHQA 1YNTF 3NJFA 4M03A 4XH2B 3WUWA 1KJMB 4K5OA 4ACPA 5CZXC 4LCCA 3HG3A 3BWUC 3QUKA 3QS2A 4FL4C 1BZQK 1NOFA 2X89D 3KG5A 4XNZC 2VZVA 2PCFA 1IMHC 1QTPA 2ENPA 1V7MH 3OB0K 5TDPB 5DUBB 1BVKA 4MWFA 2VXTL 4JZOA 5GISH 3LN4A 1OLLA 1FNGA 5FGBC 1XGUA 1YEEL 1U95B 4FFVD 2ZOKA 3EO9H 5EDSA 2X6AA 2PP7A 4GSDL 1I9IL 3QE5A 5DHYB 1JCKA 4R96B 4WHTB 1CU4H 1AR1B 3GSNH 1SUHA 4YN3A 5GS2D 4V1DA 1M6UA 2VKXA 3VXQA 5TF1H 4PRHE 1HCVA 5E2TL 3ZLQC 3GMQA 1P5UB 2BSSB 2Z8VC 1J5HA 1A6UL 1PL3A 3UDWA 3EJUA 2XQ0A 3B2VL 4OU3A 2FX8L 3HG1E 2CDFA 3CE1A 3HZKA 3P4NB 4N85A 1SXSA 5CCKL 4AYFB 1MCLA 2V9TA 4AEIL 5E94B 5ALCH 4YE4H 2I25N 4HH9B 4XP5L 5F7YC 5FOBA 2EUZA 3O81A 2OSYA 4CC4A 4PVNA 2AW2A 5EC2A 4XB3A 5I1IH 2FT6A 4XNXL 4OFVA 5I73C 5JTWA 1OK0A 4FFZA 4A2GA 3N06B 1H0DB 1ACXA 2B5IB 2X0VA 4HF5L 4ATTA 4IJTA 4FXKC 4TVPH 4XP4L 4JFFB 1R75A 2FATH 3K6OA 2YSSA 3IFPB 4LU5H 5D7IB 4PWFA 3B6SB 3FQ4A 2OMYA 4ZXBD 4OSUH 1TUPA 4XP9H 1UXSB 3HFFA 5CINH 3F01A 1OGAB 4HALA 1SMAA 2WNKA 1FZKB 1MHCB 3A6BH 3TJEH 3L81A 3NBNA 2PYED 3BI9X 3KNBB 4MDJB 3WKML 1KIPA 4JVPA 3PWUA 5D96B 3OKOB 3NYKA 2IH1A 1U42A 1TCRB 2XZAL 5CJOH 4JGNA 3DSNA 5L88H 5IF0B 43CAB 4MJ6B 2UZPA 3FSZA 2I07A 2JIXA 4KXZI 4ES9A 3AUWB 4F57L 3WI9A 3VTTA 2FWSA 5ITFB 1TOXA 1KNOB 4PJEF 4J4PC 2NY2C 1LEIB 5FW7A 4HD9A 4OCNC 3P2BA 3TIEA 1G4RA 4M5YL 4D3CH 1BFVL 3U2SA 4G7VH 2ATAA 4WHYG 2Z64C 2X38A 1GC1L 3TEUA 1A14L 4TM9A 3U9UB 5JA8B 3HC0B 4M1GL 1UH3A 1LL1A 3RIKA 2BVTA 2P49B 4Z5RA 3LS4L 4HIHA 3QUZB 2K1MA 3FB5A 2F5AH 2K0RA 5TE6L 3MHZA 5DWUL 2HTLD 2AQSA 4X7TB 1XZWA 1DQML 3HW7A 1A3RH 4IIZA 1W72A 2NZ9C 2O72A 3MLZH 4J6RH 4QAMB 3NESA 3RWIA 3MOBH 5EU5B 5FECB 4Y9EA 2Q86B 2FAUA 2YBGA 3KPNA 2FJFA 2BOCA 4HCRL 1RHHA 3QEGL 3T0WA 5JO5B 4Q89A 1PD1A 3EFDL 2JNZA 2HWZH 5D4HA 1Z1WA 2AS5M 3M1OA 3CGTA 5D2NB 4LF3A 3FO2B 3MU3A 5I2IB 4FNQA 1MFCL 3CC1A 1LMIA 1UCBL 1YEGL 3F04A 1BECA 2QBWA 3IXTA 3M7FB 3SZKC 4LDLB 5BQDA 2ZKWA 2YOCA 1GYVA 1D5IH 3CFQA 2FWLB 2CNYA 3MRIB 3O41B 3JTSB 3FL7A 3FU9A 4MQSB 3S96B 4NYLB 4X6CB 1KYAA 2FEEI 3D7PA 4EIUA 3BP7A 3QXTA 2VGLM 5EN3A 4HSAC 1P7QA 2IAMA 1W8OA 4K23H 4TVUA 4UT9L 4N2IA 4W9DC 5DJ8B 3T0EB 1CTMA 4JRXB 2FL5B 2X44D 3V6OA 1OARL 1KY7A 1DQJB 3ILPB 3NPZB 5TE4H 2XG4B 5F8QC 1AXIB 1BXVA 3BZFB 3NJXA 2E7LA 5J1AA 5J6HA 3DDGA 3UTSB 2ENQA 3E9UA 5HVWA 1EJOH 4DVBB 1NMBL 4PRPB 1MJ8L 2FEJA 2Y72A 1IAOB 1QI5A 2BIPA 4TVPD 1E67A 4G8GA 4F1SA 2N1TE 1R34A 2ROXA 4MA3B 3K72A 5HYQA 5CZKA 3KPSE 5ENWB 2DLGA 3L2MA 4HETA 5CFAA 3P0VL 1WICA 3UO1H 1INEL 4ZOBA 1NIAA 1BQHA 2K45A 1WYJA 2WHVA 5EG6C 2MRYA 4Z7IA 2Q7AA 4NQXA 2P5EB 3SE6A 3MR9B 4JKPH 1GGUA 2UWEB 5FA4B 2UWEF 3UCRA 5L4MA 1CJYA 2FD6H 5HJ3B 1DSYA 1BYOA 1DN0A 3DV6B 3L1OL 1AZVA 1UH4A 4U33A 1HAWA 3ESNA 2P43B 4PB9L 3T3MF 1JGEB 1LQSR 2ZTBA 3O6FB 3HPJA 5EEWA 4NUGL 4U1GC 5CD3A 5HYJA 2FUQA 1TNMA 5D7JB 2GTWA 3WDHA 1T3FA 1QUNA 3NFPB 3ZPDA 3V95A 4UIMA 3WNOA 4N1CA 2XNAB 1MCKA 4Z18A 3C9NA 1BQ5A 2DQCL 4NQSB 3LEXB 4UQIM 1Q9WA 4HUMB 5DJCA 2AJYH 2PO6C 5I8OH 2PWHA 2C1PB 3GD1C 4JREB 1I3VA 1O9VA 3C75A 5IQ9A 2R0LH 1G7PB 5K9QI 5DF0A 1RZPA 1AGBA 2ZYSA 3AQDA 3ILQC 4NFCA 4RRPG 3HMXL 2FQEA 3H9SB 3C6LD 2Q8AL 2VLKB 1UOKA 1XH3A 3W57A 4IMKC 2X05A 4F7PA 2IPKA 3VJ6B 5C0GB 1KCLA 4FQ1L 3PAUA 2WWMD 3TCTA 4XNDA 2BNQA 2FBJH 3MLVH 4PRDB 4ZUTA 3VGDA 2FBRA 2CXKA 2VZOA 5EU6A 3RY6C 3MLPA 4JFED 1J86A 2J88H 2OMZA 3MLXH 1W0VB 4TS6A 3TP4A 4DEPC 5JHDD 4XPBH 1NEZG 1ZGLM 5HHVH 5C0RL 4APQA 4PJIF 4XZUB 1WBXA 3EG9A 5A2FA 3OKMA 3M45A 1L9OA 3ESUF 4ZTPH 4D0DA 1ZHBA 4PJ8A 3N55A 4KJQD 1YN6B 1P1ZB 2BRRL 4Z1PA 4HFUH 5FO2A 3MV9D 1UT1A 1KTRL 3OGCB 4P9HL 5FUOL 1DLHA 4JPVL 2G2PA 4GNKB 5IW3A 4L5FH 3S97C 3BWUF 1KN2H 3X12A 3EGSA 1U41A 3F7VA 3NOIA 2NX5D 3LV3A 2ENYA 3U7WL 4ADGA 1EERB 4F9PA 3TZVA 2ZXGA 1B4JH 4PBWD 4UV4H 1JVOA 3UXFA 1L5GB 5KJ7E 3LEVL 3D07A 4U3HA 4XC1H 4NGHL 4PVBA 3IM1A 3L5JA 4HLZG 1OTTD 4PTTB 4P2OC 3UO8B 1J0YA 4FN0A 4PV9A 5FYKH 1G6VK 3CXHJ 1T4KB 1DVTA 5JMRA 4XI5C 4F91B 4K71B 3IE4A 5E1AB