3EF4A

Crystal structure of native pseudoazurin from hyphomicrobium denitrificans
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
AEHIVEMRNKDDAGNTMVFQPGFVKVEAGDTVKFVPTDKSHNAESVREVWPEGVAPVKGGFSKEVVFNAEKEGLYVLKCAPHYGMGMVVLVQVGKPVNLDQIKEYKATGLAKKRLDGEIAKVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structure of pseudoazurin from the methylotrophic denitrifying bacterium Hyphomicrobium denitrificans: structural insights into its spectroscopic properties
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Blue copper protein
total genus 31
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ef4A00
4A66A 4DP0X 1DZ0A 3NSYA 1NZRA 3H56A 1BQ5A 1JXDA 3JT2A 5B3SB 3PXLA 1KBWA 2IDFA 3AZUA 1HAUA 3NSFA 3NJFA 4Q8BA 4KO5A 2YXWA 3OM3B 1ET5A 4N4YB 2FT8A 4DP1X 3FU7B 2X88A 2YQBA 3NP4A 2IWEA 2EIMB 1B3IA 4RH4A 3OD3A 3ZIYA 3QJUB 2P80D 2IDTA 2N0MA 2I7SA 2IDQA 4KO7A 1ADWA 4Q89A 1IBYA 2OJ1A 1ZIBA 1PCSA 1GSKA 2PPEA 1PZAA 1J9TA 3T71A 1BYOA 4NB7A 4FAAB 2BO0A 2EIJB 2IDUA 3TASA 1AS6A 1SJMA 1OE1A 3D12B 4G71B 4YSSA 4YSUA 2EINB 1E65A 2ZOOA 2XV0A 3AG4B 2XYBA 2B08A 2VSKB 3FQ2A 5LDUA 2HXAA 1N68A 1ZDSA 3ABGA 1AAJA 1RZQA 4M4RB 1SF3A 1E5YA 1W6LA 5TK4A 5D4JA 4A2DA 1YLBB 3IBOA 3NJHA 2DWSA 1L9TA 3QJVB 3UGEA 3NP3A 1L9PA 3UAAA 2MRYA 3H4HA 1GY2A 5D4IA 3N2JA 1L9SA 2UXTA 4YVUA 2YAEA 2AVFA 1W8EA 2DYRB 1ZIAA 5F7AA 2JKWA 1A3ZA 5FC9A 3S3CB 2FT7A 1L9QA 3WG7B 4E9RA 3ASNB 4GP4B 2BP8B 4A68A 2EILB 3AY2A 1SFDA 1JVOA 1PMYA 2IH9A 3CG8A 2YAHA 3EH5B 3NJKA 4HAKA 3ZBMA 1PF3A 1WA2X 2FQDA 3GXUB 3NT0A 1BQKA 1M9WA 4KO9A 4E9SA 3S8GB 1FFTB 1FWXA 5TK2A 1SHXA 2GB2A 2J56A 5I6NA 1NTDA 4W9ZA 2XWZA 1ZV2A 3X1BA 2Q9OA 3TU6A 1EZLA 2UXVA 1JXGA 4DPAX 1X9UA 2XU9A 2Y69B 1AANA 3H4FA 1AZCA 3FS9A 5I26A 2BZCA 3FSZA 3NJJA 1CYWA 4M3HA 4JHVA 4YVNA 1NINA 1QNIA 1WA1X 1E67A 4AKOA 1J9SA 1KYAA 2IH8A 2BW4A 3SBQA 3NJLA 4ENZA 1MG2C 2ZWNA 3CVCA 3NJIA 2J5WA 1ASPA 2J57A 2BHFA 1BXAA 3QJRB 4BXSV 1TU2A 4E9VA 3SBRA 3HB3B 4X4KA 4HHGA 2PPFA 2QT6A 2HRGA 2W88A 2PPDA 1SDDB 2GC4C 2HX9A 1PLCA 3FPYA 1IUZA 3GDCA 1BXVA 1J9RA 2A3TA 2OCCB 4BWUA 4P5RA 4A2HA 2XX1A 1MZZA 2FWLB 3X1NA 1J9QA 3PAUA 3EHBB 2VSMB 1NIAA 4E9QA 4KOCA 1SNRA 1WAEA 2VW6A 3FU9A 3QPKA 3FSWA 3WI9A 5I5MA 1TKWA 3NYKA 2GI0A 3HEIB 4YSEA 3PLYA 3CVDA 2WSDA 1AZUA 4QLWA 5I28A 3V9CA 2FT6A 2UXFA 3NJGA 1UATA 3IEAA 2CJ3A 3FYEB 1ET8A 1PLBA 2WO2B 3T6VA 1M56B 1JZEA 2DV6A 1W6WA 2Y1AA 5I6PA 4G70B 1KV7A 3U25A 3WNJA 2BP8A 2FQEA 2B3IA 3BQVA 1TEGA 3KW7A 2IAAC 3CVBA 1IC0A 2P80A 3L45A 5E9NA 2CBPA 1ID2A 2I85A 5I6MA 4HALA 4YSDA 1AG0A 1AG6A 4F2FA 2UX6A 4L0PB 4BXVA 3S3BB 2X87A 1SF5A 1WS7A 2XUWA 1JXFA 1NIBA 1JOIA 4DP5X 2CAKA 1KBVA 3FPXA 2VMJA 2DYSB 2QDWA 3SBPA 3WKQA 3AG1B 2PP8A 1XMEB 1OE2A 3WNIA 2NRDA 8PAZA 2QDVA 2GSMB 1AR1B 1EHKB 2FTAA 2IWKA 1OV8A 1NPJA 3OMAB 7PAZA 4QKTA 2CALA 3S3DB 4A2FA 3MX0B 1GS6X 3IE9A 3QJSB 2BWDA 2HRHA 2BW5A 3FQYA 1RKRA 1KDIA 4W1TA 1JVLA 2R7EA 2YXVA 3T6WA 4A67A 4CSPA 2YAQA 4F2EA 4E9XA 5PCYA 4DP8X 4ZK8A 1XB8A 9PCYA 3X1GA 4YSTA 4F7KA 2DY2A 5EHFA 1JZGA 1KDJA 1WA0X 3G5WA 4PAZA 1PNCA 3AG3B 1ZDQA 4TXVB 1BYPA 1SDDA 2GC7C 1MZYA 1V54B 2BP0B 5AZUA 4HHWA 4UAHA 2OV0A 5I5JA 5B1AB 1PLAA 4YSRA 3FSAA 2HX8A 1IKOP 2GHZA 1BAWA 1GR7A 3DIVA 1AZNA 4GYBA 1I53A 5B1BB 3AW5A 4HIPA 3WIAA 2IWFA 1V10A 2PPCA 4GP5B 4DP2X 2AFNA 4E9TA 1NIDA 5A7EA 1OCOB 2R7EB 4HZ1A 1XB3A 5I6LA 1PY0A 1OCZB 2PPAA 3RYMA 2YARA 1L9OA 2QPDB 3NSDA 3FU8A 2VN3A 2VM4A 5AFAA 1GYCA 4KNSA 4AI7A 2DWTA 3PAVA 4NERA 2BP0A 3PCYA 3EH3B 3T6XA 2JXMA 4AKQA 2CUAA 1JZJA 4KOBA 1DYZA 1OE3A 2Q5BA 1QLEB 2FJSA 3ZX1A 4JHUA 3CDZA 4AX3A 2PCYA 1E30A 1A4AA 3QJQB 2IDSA 3V9EA 1T5KA 4A2GA 2I7OA 1HFUA 3TBCA 5I6KA 1FA4A 3MBWB 3NSCA 1BXUA 2TSBA 3UABA 1X9RA 1GS8A 5F7BA 3GYRA 4HCIA 5B1JA 4G72B 4NAJA 1A4BA 4PCYA 1J5CA 2PCFA 3OQRA 2H5UA 1JERA 5B1JC 4DP6X 4YSQA 2E86A 5I6OA 3S8FB 5AKRA 4KO6A 4KNUA 4KNTA 2LLNA 2FQFA 1AZRA 3T9WA 3DTUB 4YSOA 2QPEB 3UAEA 3TA4D 1AZBA 2RACA 4CSZA 3FT0A 1AS7A 3N55A 3CDZB 4G7RB 5B7FA 1A8ZA 2CCWA 1CYXA 1NPNA 3FU7A 3OMIB 2AANA 1HAWA 1ASQA 1ETJA 2HZHA 3QQXA 2XXFA 3TBBA 4YSAA 4BWWA 4HCGA 4WTQA 1CURA 2VM3A 1RCYA 4EF3A 1NIEA 3T6ZA 1GY1A 1IBZA 1ILUA 2XLLA 1RZPA 2BWIA 4UANA 2XX0A 3FSVA 3ABKB 2PLTA 6PAZA 1R1CA 3X2QB 1ILSA 2H3XC 1NWPA 1JZFA 5IY5B 3WKPA 3IN0A 2VW7A 2EIKB 1NDTA 1BQRA 2PP7A 4WKXA 4AZUA 5B1KA 1NWOA 1AS8A 4G7SB 1ET7A 1WS8A 1ZPUA 4GY4A 4DPBX 4BDVB 1M57B 3OMNB 1SHWA 3ABLB 1L9RA 1AIZA 4YSCA 3EF4A 4YL4A 1F56A 2YAOA 4MFHA 2W8CA 5I5IA 1BEXA 4DP9X 1GW0A 2FNWA 2FQGA 4G7QB 1PZCA 2BZ7A 1E5ZA 3JTBA 2AZAA 1SFHA 2GIMA 1OCCB 4E9WA 2XXGA 3X1EA 3PPSA 4JKNA 3UACA 2ZONA 1TEFA 1JZHA 2XV2A 4K9JA 3SQRA 1J5DA 4HCFA 5ANHA 3FYIB 1JZIA 1V55B 7PCYA 1MG3C 1PAZA 2HLEB 4A2EA 4GP8B 2UXGA 3PAZA 2VW4A 2TSAA 5D4HA 4P5SA 1AACA 1OCRB 3BVDB 4YSPA 3ABMB 1MDAA 1KCBA 1KCWA 3ZDWA 3C75A 2YAFA 4BK5C 1N70A 2XV3A 2UX7A 1CC3A 1NIFA 2ZXWB 1URIA 1KGYE 1NICA 3IN2A 4BWTA 2AZUA 4FA7B 4UF7C 2HX7A 2YAMA 3QJTB 4N8UA 4DPCX 2GBAA 4DP7X 1VLXA 1A4CA 1OOWA 2XVBA 3DKHA 3ERXA 1GS7A 6PCYA 3UADA 3EH4B 3FQ1A 1QHQA 1A65A 4E9YA 1AOZA 1AQ8A 4GXFA 3ASOB 2J55A 3CZUB 3X1FA 4DP4X 1CUOA 2JFCA 2PP9A 5B7EA 2MTAA 3AG2B 3NJNA 1XB6A 4AKPA 1PNDA 1PZBA 3NJMA 1ASOA 2WO3B 2H47C 2YAPA 4BDVA 1OF0A 5B7MA 5PAZA 3KW8A
chains in the Genus database with same CATH superfamily
2FCBA 1AKPA 1NZRA 2BP3A 3CSYB 3QZPA 4JLRA 1BVNP 3Q48A 5DZLA 4BZ2A 2R9HD 3BVNA 4W9LC 3BH9B 2IDFA 3ZKNC 1OAUH 1RZJL 2Z4QB 3QAQA 4PJHE 4BQCA 1TJHH 4CMHC 1TF4A 3ARYA 1IGFL 2VZ3A 4FE9A 4HIXH 5I17A 3O0LA 3MGOA 4UWQB 5DLML 3UZEC 4G1EB 5ETUB 1HHIA 1B0GB 4XMKH 2QQNH 5IJKC 1UJTA 3FQUA 4M62L 1D9KC 3GHEL 3LQZB 2FJUB 3CPLB 3QDGA 4GMTH 1BMGA 4P2QD 3DECA 5ANME 3F00A 5F7EH 4JO5A 1KBBA 1ZOXA 4AT6B 3CXFA 5C0FB 2R83A 1JGLL 4XCEA 4DGIL 1MJJA 4UZSA 4FXKC 1DLFH 1JHTB 1KYDA 2X3CA 1E28B 2P5WB 4MD0B 1KLFB 2DI9A 4V1DB 4U4IA 1DBMH 5BS0B 4GG6F 1OM3H 5KYXB 1DVFA 2NSMA 1NUNB 5DRNB 4M5YH 3MV01 4CVZB 4NYLB 1T03H 3EGSB 2H3NA 5T5FL 4PJEE 1J1OL 1UD4A 3UGEA 3HE7D 5E6IA 3BZ4A 3OC8A 2EVIA 4YHKL 1T2JA 2BMKA 1U8HB 3SDCA 1HOEA 4YUEH 2K9FB 2D3LA 1X5ZA 4YEEA 2X09A 5EC2A 1MVYA 1SY6A 3L3HA 5JHDB 1OHQA 5HGGS 1XSIA 1ZIAA 4W4OA 3P54A 4DKDC 3DNKA 4PRHD 1DBKH 4G9DB 2BP8B 4JFHD 4EUPA 1TU2B 5C0CE 4L5FH 1SFDA 4AEIH 1O9ZA 3BWAB 3C5JB 4MHHG 4WGVB 2BJML 3OWRA 4HIHA 4P5TC 4PJ7E 4PJHB 4LCYA 2R4RL 1MCKA 3JXAA 1RZKL 5HDLA 4N8CH 5JW4N 5FA3B 4MCYB 5C0DA 5DURD 5EC1A 4AVKA 4POYA 3QUMA 1WBXA 5B1CA 1UM4H 4JDEA 2YD1A 3Q1SL 3ZDXF 1VZIA 2CKBB 2MQ3A 2ROXA 5CINH 4S1QL 1INEL 4FYTA 2XWZA 3X1BA 4C56B 3I74A 3U79A 4DK3A 3P69A 4OJDH 3LXUX 1IARB 1BQUA 4OI7A 2Y36L 4XCYB 2OMZA 4WTXA 2Y69B 2BX5A 4ONHB 1BQLL 2ZD0A 4JPKH 1T89C 5TH2B 5D1QD 1FNSH 5I73B 3VFRB 1YEJL 3SHSA 5IBLD 2IPUG 1KPVA 4ZPTA 2Y7QB 5KVGE 1KYAA 2LU7A 3CZEA 1AGFB 2GTZB 3MRGA 4EN3B 5LLIC 3PJNA 4LRIA 1MG2C 2AKRB 3GQFA 2HN7A 4NWUL 4ELKB 4B53A 3SKNA 4DZ8B 1ODAA 3SBRA 4OGZA 1N59A 3CFNA 1P7KB 2PABA 4WHDA 4P05A 4B7LA 3QDJA 2M1KA 1TZAA 5IBLC 2G3MA 2GC4C 2X3AA 1DQIA 5IJVB 3VXMB 4CMMA 3N41B 4ZX4A 3HS0C 4IMKC 4UOZA 1N12A 2ADGB 2D9CA 2YBGA 2HRPH 2ZYHA 3IM1A 5KSAD 3T0ED 1YA5A 3QNXB 4O2FB 4DK6A 2QLVB 3H2QA 3NIDF 3K91A 4E9QA 1YEDB 4X8JA 5GRXG 4LMQE 3WI9A 3D07A 2QPUA 5CJQL 2QADB 2HJKA 4X5XA 3I9GL 3QWRA 1G7QB 5I28A 3RWFB 5AD0B 1TJMA 1XGPA 1SOXA 3X3FH 1QUNA 2WZ0A 3QIUB 3SJVD 5DS8B 4IRSB 2GBVA 1PAMA 4KRPB 3U36B 4HG4J 3MCYA 4PVBA 2Z0BA 4WCYL 2K78A 2KDGA 1MCOH 3NGBC 4KKBD 1ZLUH 4MCZA 2RTTA 1J86A 3CVBA 5CU9A 3WLBA 4U6TA 4KJPD 1F45A 1ZS2A 3WAJA 3KLQA 2ZTBA 4GRWH 2WJ5A 4CRPA 3L5WA 4Y9CA 5CMAB 2VABB 3MRFB 5D8JL 3BSZH 1MFBL 5I6XC 2J43A 5C08B 2YRPA 3UIZA 3QBTB 1MEXH 4O02B 1JOIA 2YA1A 5IOKA 3B8YA 4NRYB 2NTFB 3D4GA 1F02I 2VXTH 3S4SA 1XMEB 3MXWL 3O3EA 3N1PC 5C3IA 1WK0A 5BW7A 1ZHNB 4PI2A 4Q4IA 1I82A 4HU2A 4FADA 2PW1B 3WKML 4K7PH 2F5BH 5AQ0A 1ZKAA 4KVCH 2EUXA 1E5UI 1MHHA 5D2LA 1QLFA 5T5FA 2BWDA 1I7RB 2F53B 3FQYA 4XWGL 4YNYA 2ZF8A 2MKWA 3HUJE 4HIXL 1R17A 2UZXA 3IPBA 5CD3A 5D70L 4FA6A 1H9DA 4K07A 4MMZA 1MAJA 3C5XA 4ZK8A 2J25A 5I1JL 3FONA 1Z3GH 2AW2A 5A2BA 3CC5A 1SMDA 2DY2A 2W9DL 2Y7QA 5BUGA 2NXZC 3ILPB 4CSSA 3KWXA 3A67L 3B56A 1NGPL 4GNKB 5AOZA 4ZSOE 1SLVA 4ODVH 4FTVE 4M7KL 5LQBL 4AXWA 3MRRA 4GW1B 1I8UA 4EOWL 3VRLF 4D8OA 5INCA 1WCQA 4EN3D 3EFDH 1HXYB 3W2DH 2ITDB 3TNMB 1JZ6A 4P06A 1F4XL 3G04A 3ROOA 1DL7H 3G5ZA 2HX8A 4N90E 4K2UL 4NLHA 1G7LB 1XEDA 3GKZA 3IRPX 1HZLA 1P5UB 3GSQB 2HWZH 2AMUA 4G6FD 4Y0GA 3QWRD 5E2UL 5K9QI 2F7PA 3U1QA 5D7JA 3OXRA 4BYHA 1F58L 4U6YA 5JORB 2VLRE 4LRNL 1ZPLA 3MRQB 4R0LA 2EADA 4ANWA 4PWFA 4PRPE 3SJVA 5HI3C 2EIBA 2G9HA 2Q8BL 4L4TA 2H32H 3WE1A 2HJLA 2YUZA 4FTVD 5C0BA 3V8OA 1OSZB 1X5AA 4F57H 3FT3A 3F7VA 3OSKA 4IMKA 3RYMA 3ME0A 4XTRD 1JGDB 3IDXH 2VQ4A 3NSDA 1A7NL 3EOTH 4LCWB 1DBAL 2FX8H 5EORL 3K72A 1N3NB 5HI3D 2YFOA 4FQHA 4M7LT 4CVWA 2UWEF 4FQXB 3N91A 2JXMA 2VN4A 2WBXA 4BKLB 4L3CB 2EKJA 1XGUB 5TFSH 4KOBA 1P7KA 2XFXB 4FFYH 3BRDA 3BPOB 3C6LD 3OAYK 2NNRA 1LDPL 4XTRC 5EZLB 3SYQA 3SKJH 2WZPA 1WICA 2YGOA 5GJSH 4HUUA 5HHNB 1DFBL 1N7ML 2DIAA 1J1PL 1DVQA 2EVFA 3LN4B 1F1DA 1RJYA 2CO7A 4OT1L 5MERB 3IJEB 3AWFA 3KBFA 4LIQH 4Z76B 1WAAF 1UD2A 4R26H 2R56H 2XT1B 1QRND 4UDTA 1EO7A 4IOIA 3BT0A 3V5DB 2AJZB 4HK3J 3NZHH 4NSKB 4GKZA 4PJ5E 1DJYA 1KGCD 3R7RA 4JRXD 4JDVB 1SXCA 4Z0BL 3HI1B 3O6FA 4KO6A 5DHYA 1XD0A 1CTMA 5DS8A 2JKIS 4KKRA 3JWNG 4QHKI 2NY4D 3ZR6A 5FGRA 2BSRB 3KWWA 5HI4C 4MSWA 2ENQA 4P5MB 3HR5B 3N55A 4Y4KA 3NCWA 3UJTL 4LVNB 2K45A 4LSSL 4PJFA 1NLBH 4QRUA 5C6TH 3G6DL 1F1GA 4QJ3B 1SXBA 5HGAB 3FU7A 4U1GB 4UM9A 3UERA 4BH7A 1MFAL 1OO2A 4EZJA 4HULB 4U7MA 3NTCH 1LK2A 3F12B 1TETL 2HG5A 3SYAA 2E9WA 2VMFA 3P11H 3FO1A 5D1QE 3A5VA 3GXPA 2H0EA 4GSDH 4IRSC 5DRZA 1IBZA 5ITBH 2I69A 4WFFD 1WBZB 3L7EB 5FYJU 2W95A 5ADPL 3DX1A 4LO9A 2JH2A 2IG2H 4JPWL 2M2DA 3HS0A 4LP4A 2PTVA 3RBGA 1KENL 4P2QE 4NUJA 5IY5B 5J9PA 5BPPA 1A6WH 4NOFA 1HNFA 3IFOA 5BO0D 4K5LA 4NN6C 3QISA 1D2OA 5IOPA 4GRWB 3T0EE 5AZ2H 3L5JA 2V7HA 4BE5A 3CSYA 1LD9B 3H9HB 4MA1B 2MCMA 4AMWA 1CK0H 2Z8SA 3RX5A 2ZX5A 3NEEA 1VA9A 4M9PA 1OP3K 4DPBX 1SDAB 1XGRB 5JPMA 1ACCA 1E4KC 1MF2L 2D7QA 4BE6A 4HLEA 1P5VB 2R4RH 1QTSA 4G5ZL 3DRQA 4PCSA 1INQA 2JK5B 2X6AA 4YZFF 5ACZA 3HS9A 5I5IA 1ZA3B 4WI0B 3C2AL 1MCQA 1RURL 1YMHA 4L4TB 1JPSH 3Q5TA 2O5NA 3RLSA 3L3DB 5HHXH 2DTMH 1KB5B 1PPIA 5BV7H 1PGRB 2GT9A 3OKKB 1AGEA 3K7UA 3WYRA 3HBQA 3U6RB 4HMCA 5FM4A 3BDYH 2LV4A 4X7SL 1QQDB 1WHOA 3D4YA 1CB4A 2R27A 4HXAL 4L4TE 4ZOEA 1QABA 5HJ3A 2P5WE 4V1DE 4QYOA 1PAZA 2ED7A 3LD8B 4JG0H 6FABL 5BMFL 1KUMA 1MCWW 1S9XB 5DEZA 2BHZA 4IU3B 2R2CA 5D2LE 5F88B 3MJ8B 2XVKA 4MNGB 3HFML 3VX0A 4KTYA 3BZ4B 3T0EB 4NQEE 3OMZA 4MX7B 4NIYE 3VI3A 2B1HL 3QXDA 3VYOA 3EZJB 3FB5B 3ZKQD 2V9QA 1VENA 1OOWA 5CZKA 1MI5B 3AMLA 4ZX5A 5I1CH 3FT3B 4Y4KD 4F3FB 3G5XA 3WFHB 3A6BL 4IBTA 3MDJA 4NRXB 2DMHA 1CICA 3KBHE 3P0VH 1T21B 4LVNC 3RU8H 4BKLA 3NJMA 4S0SD 3AREC 3IDNA 3NA9L 2V2WA 5IFHH 3BP7B 5DFAA 4BDVA 5DYOA 4K73A 4TNVK 2NY4B 2PR4H 1MHCA 4MD4B 3B34A 4JZNA 3QORD 4TRPL 5EA0H 2Q10A 2WXHA 1LDSA 2VDQH 1A0QL 3VGBA 4QNPF 4E41B 5B3SB 3MRJA 1FAIH 1X5JA 2F6AA 5CBAA 1U4FA 1GGUA 4IGBC 4FLHA 4HJSA 3B6SB 3WN5B 4X2UA 5HXMA 1LP9A 2PW2B 1QFWM 2H1XA 4HFUL 5IESH 4ODXA 1T20A 5CEXA 2DMBA 3X3GH 1G7IB 1H3UA 4ODUA 3B9EA 4POZC 4KVPA 4F15B 2GTZA 4EN3A 4G8FB 2Y72A 5F2FA 2VDPH 3SDAA 1TLMA 1UEYA 2XKNB 1FORL 4XX1E 1BYOA 4HX1A 4NB7A 3K8MA 4K7FA 3CBJB 3S3SA 2O6PA 1OTUC 4Y1SA 4FQXC 2WWKT 5JPMB 4FFYA 2C1OA 4N2FA 5D7JD 1T1ZA 1XR9A 3GNMH 2A6DB 5D4QA 4HHAB 3FQ2A 5HYSA 1ITBB 4L5FE 1N68A 4QAWA 4XXWA 2FWSA 2A1WL 4ZUSB 2HG5B 5EO1B 3LPOA 4OCRL 3V0HA 3LEVL 3AT0A 1IGCL 5FYJL 3JUYA 1A6TB 5HDBF 1SXAA 1KBPA 2MQ0A 3SGJC 4CVUA 4QKXB 3W0WB 4DO5A 4QOKE 1UUSA 2HH0L 2B5IC 3VB8A 1J8SA 5KVEE 5I1EH 3R0NA 3OBAA 3L16A 5IESL 1MW2A 4NQEA 4O5LL 4PJHF 3OKDB 4M56A 4U6HB 2JCCF 1JHLL 2AEIT 2HTKC 2J1XA 1KFAL 1AP2B 2DYRB 5JZ7D 2XPGA 4PYHA 4K0OA 3SPVB 4ES8A 1JZDC 2YBRB 3T0VA 3BVWA 4HKZB 4O02L 2AK1H 1TZOA 4JO4L 4WVRA 5C0AE 5BO1L 3NSXA 1BBDL 3NFPA 3SCMB 4ZW8A 3IXTA 3O2VH 3E80A 3E1ZA 3BIBX 2DQDH 1CFQA 3N85L 5I0VA 3J7HA 5ADPH 3VCLB 3GZKA 5FYLE 3GGWB 4PW3A 1I9RH 1JWSB 2AJXL 1NTDA 1MFMA 2C9UA 2WNXA 4LFHG 4OBRA 1U92A 3UTPE 3MV7D 1XZ0A 2L3BA 4OAWA 4PW9A 5DJ8B 3UAJC 3FCSA 3RAJH 3EZ8A 3LZOA 4RDQF 4PRNB 3FOLA 2OLDA 1AANA 2DL2A 3VGGA 2BZCA 1IGJB 1TT6A 2WOBA 1FLTX 2YJQA 5HJ3B 5IEKB 3QFDB 2GJ6A 2VR5A 1DP0A 3P4LA 2OL3B 4YFLI 3D85D 3UTSB 1ASPA 4ZAKD 3RA7L 5C9JA 2JIXD 3PABB 5CEZL 2EDLA 2B8OT 4I18B 1NCHA 5BO1H 3VFNB 3FB8A 2F61A 3KJ4B 4DGUA 4DW2H 1QLEH 4TV3A 4CN1A 4AOFA 3GMRB 3V6ZA 4JO1L 2VDRB 3LKQA 3AY4A 4WWPA 1PLCA 1W16A 3TO4B 4GMTL 3WY3A 1UFGA 1KJ3H 1T04B 3SOTA 4ETQB 5I8CA 4FQQB 2CXKA 3JYBA 3D3VB 3T0BA 4KHTH 2AXJA 3FOMB 3Q6FA 4LLQA 1H19A 5J6SA 4PJ5D 1R3IL 1XH1A 5J0BA 4LIQL 2NLJB 5IMLB 4FG6D 1QUPA 3PWVB 1OP3H 5DD6A 2HVKA 2EVHA 3DTXA 3HEIB 3EYUL 3E8UH 4A6YL 3CVDA 4QLWA 2XTSA 2W9LA 3NG5A 4ODTH 4WI4A 3GBML 3W0WE 1W0VA 3IEAA 1X5LA 1T1ZB 1XR9B 2BVQA 3GD1C 2IV8A 5A2JH 2A9DA 4I13B 2ZX6A 3UZQA 3GXIA 4KC3B 1WFOA 3GINA 3LDBB 3WIFA 2B3IA 3SYPA 3LV3B 3KW7A 1W80A 3WEXA 2G0LA 2Y0SA 4Y2DB 5I8OL 4UT6H 4K3EH 4YXHH 1N8ZA 3FQXB 3O6LH 5E9NA 1P7BA 3IYLW 3ZKSD 1CLCA 4HBQA 3ARWA 1AG6A 4HAFA 2VL5B 4HJGA 3A4FA 1DJIA 5AVVB 3HZVB 4QHLA 4NQXA 1MIEH 3NUKA 2JJSC 4U7KA 4GXVL 4OSUH 4JHZA 5I19L 4FNTA 4UM8A 3U0TA 4DP5X 3HE7A 2OMYA 3L4VA 4JFTA 5E6ID 5AKSA 1RU9H 2BNRB 1D9KD 5FGCB 2NXYD 3RGVB 2UZIH 4R90H 3VXUA 3WKQA 2E7CA 2YBRA 4F7PB 1HN1A 3O3AA 1OE2A 3WNIA 1NCWH 3BVNB 4KX7A 3ZYIA 1CDCA 5T1KA 3Q3GA 5DR5H 4P59L 3QNZA 5D7KD 1BPLB 3OKOB 4TVPH 3PHAA 5KZCB 2CALA 5DRXB 4LFHD 1AVAA 1SHSA 2NZ9D 3PJSA 5I73C 1GS6X 4UBDD 1RULL 3KYNA 5DZPA 4Z76A 5L7XL 1T0NB 3GGWA 4Z7OF 4LPYA 1QHOA 1KCRL 2BIHA 4X4XA 3SGDH 1WIUA 4HBCH 4PJCB 1F3DJ 2N7BA 4JRYA 4TQEH 4MAUL 3D2UD 1R5IB 2WVUA 4Z7WE 5PCYA 4MXVE 4FP8L 4ODWB 5E1AB 1XB8A 1NCCH 2XDHA 3IETB 1ZT1B 4Z7OB 2X05A 5GS1A 3NCJH 2PWDA 3B4NA 2W0LA 4UQ9A 4HLZG 1OM9A 4PTUB 2XQYA 4ECNA 4AMXA 3AG3B 3HG3A 4R90L 1PW3A 2QQKH 1SDDA 3V4VL 3PL6C 1AQMA 4ADIA 2BP0B 2NUTA 4DCQA 2R23A 3MNDA 5D1QA 1JZ5A 2VE6B 3HZKB 5LBSH 2ZOLA 3FBKA 5DR5L 3IJYB 4RVBA 4LBAA 4N8VG 4D0BA 5AG8A 1LO4H 3QWOA 2DQJH 3MXWH 3WS6A 3MLUL 5D6DC 3HI5H 3H7BB 4JY5H 1KELL 2V0AA 3I02B 5DEFA 1M7DA 4PJXF 4YGVB 3ZKMD 4OCMC 3RZCC 4YBHA 5CJXC 3VVWA 1CFMA 1WZMA 1R47A 2CLRA 3NCMA 5D71L 4BFFA 1W0WB 1V10A 4DP2X 3CGTA 5FEBA 4TSAH 2AFNA 5IT2H 4JFVA 4ELDA 3L6FA 5IFJA 5GZNC 2HVKB 4R0LC 4KXCA 3S98A 1MWAA 1HINH 1F11B 1GRWA 3BP5A 2WD0A 2JKLA 3EO0A 5HPMB 5JIDA 5F9OH 1F3JB 5D7IB 2XWJA 4YC2C 1P69B 1PYWA 5F9JB 3EH3B 1S7XA 5C0CA 4GG6A 5GZND 2BVPB 2NUPB 1U4EA 2C7UB 4X8CA 4L8BB 2Q5BA 4QT5A 4N2MA 3UBXB 2X6VA 1KCVL 1UQSA 3QJQB 3NAAL 2GHWB 3H0TA 3RL1A 2XZAL 1ZD6A 3EYQD 3L1OH 2VLKD 2EKSA 3CFBB 2DEXX 5AZEL 1S7RA 3VWJC 1CS6A 3Q43A 4U1KA 1HEJC 1FF5A 1S9WA 3DXAB 1FAIL 5FGSA 3WNPA 1PY9A 1MFCL 5I75B 4NKMB 1L0PA 2J7LA 2WBJC 4U1SB 3OHXC 5JYLA 3FTUA 2W0FA 4MS8C 3KPLB 1KCSH 1OWWA 2YOAA 1LO2L 1P7QA 4YSQA 4ICXA 4TLTA 3RTQC 5KJ4A 2CUMA 5JQIB 2XICA 1IC7L 1IC4H 3WTSA 4QTHB 5DJDA 3MGTB 1XO8A 3ARDA 4XO4A 3B83A 5FFGA 3BAEH 3TV8A 5C07A 5JIQA 5D7JB 5JORA 2QPEB 4PJXE 4FMFA 3HZMB 5I0XA 1VGEH 32C2B 3DO3A 3HKZA 3QIBB 2KQMA 3CDZB 3LQAL 4JHAL 3B7YA 1KJ3L 1H6FA 1FVEA 3IDXL 2XBDA 2IEPA 2ADFH 1NPNA 4IS6B 2XWTA 4CGTA 2X4UB 3U4BL 2XQBH 3T2OA 4GLRH 3QQXA 1G9NC 5EF0A 3UCRA 1ZLVK 1R3LB 3V4PB 1PZ5B 3FNKA 3ARPA 1VGKA 1KT2B 3DX4A 3V5HB 2BS9A 2A99A 4AYDC 1YPZA 2A9NH 1NGQH 4OZ4B 1A4KA 1YYML 4I3GA 4KZDL 1KC5H 3BO8A 1G0XA 3ECUA 5E5MB 3BUIA 4B9YA 4G9FD 3WXWL 3DVNB 4JG9A 3SDDB 2IGTA 4J3BA 4YE0A 3D52A 3LH9A 2GSIA 3QRLA 4YHKH 3BP7A 2G2NA 1CDBA 3Q3GB 4JREB 4HUUB 4N5UA 5HHNA 2NXZD 1TQCC 4UNVA 4C8XA 2RH0A 4HKJB 2VAAB 4JDZB 3F7LA 4HGKC 4UT6L 4PSPA 1M4KA 4TUKL 4OFIA 3OKNB 2XZCH 5TF1L 4X5QA 2JCWA 4PJAE 5DJCB 2Y22A 4FEMA 4B0MM 4EVNB 3B3BA 5CBEB 2MWCA 4XXDA 2VITB 1XH3A 1M57B 5KJRH 4JFHE 2P5PA 3O2VL 1QATA 4Y5YA 3TBWB 2A6KB 4IBZA 4MFHA 5EZIH 1MFVA 3TZVB 3VM5A 1DQJB 1R6VA 1HKLH 4L3AA 2Q1EA 4FERA 4N1HB 2DQ6A 1MWAB 4D0DA 3GUTB 1W72H 1WZAA 4DEPB 4Y1AB 4B7IA 1LLAA 3J27A 4KMTL 5L9DH 2O6EA 2UZYA 4MBRA 3GC3A 1OQOA 3PUUA 3ROLA 4UQ2B 3SQRA 4HCFA 4IYKA 7PCYA 2NPLX 4OZGB 1OCWH 1W72B 2HLEB 2OR7A 5KYUA 4ZFOA 1T83A 3SYCA 2A6JA 4LIQE 1AACA 1DFXA 3CLWA 3RHWK 2OW6A 4BD4A 2P5EA 4M8VA 5DRZB 4J2XA 1DANT 1PL3A 4NPYA 4WUUB 1N70A 2AJ3B 3D69B 4HYTB 1JHKH 3MOAL 3MRMB 4F9PC 1NIFA 1QFWI 2W92A 4PJGF 1JK8A 2PYEE 2XKSA 5DFTA 3MLSL 3GSXA 3P9MB 3L81A 2P44B 5INDB 3P77B 3V0DA 2JF1A 1IGIL 5C6TL 1MJUL 3KPSB 2V17H 2P9RA 2GY7B 5BOJA 1A65A 5DVPA 4PJGB 15C8L 4I87A 4Z7UE 5D6CB 3BFWA 4P9HL 2R8SL 1HI6B 1S2EA 1AGBB 3EF7A 4IU2B 4MDIA 1SJEA 5B21A 1NUGA 4TVPD 4NC1C 5E5RB 4FNLH 5BRZB 3PHQA 1LO4L 2NQCA 4G42B 4L37A 3F84A 2C4FU 2JK5A 1G6RA 3LRSB 3VXMA 2WLYA 3C8DA 2OMZB 3B5TA 1PBYA 2R1YB 2RMNA 2X42A 3PWPE 1FCCA 1QBAA 4AH2A 3LB6D 3NSYA 1FNHA 4HG4K 2XJKA 3D2UA 4XMLL 1JWSA 3B2MA 1WH0A 4MQXD 4XO9A 5D55A 2LGNA 3IJ7A 4N2KA 4Q9QL 1NANH 3NJFA 4LPUA 3Q8AA 1BD2B 2WLZA 2P52A 4XNMB 3ATFA 4ODSH 4JHWH 3T8XB 3EFFA 4A7TA 2Q3AA 3W9DB 3FUNA 4NFCA 4FN0A 4BFRA 4EQ3A 5F0MB 2OL3A 2LE9A 3WJLA 1UKQA 3FZUC 5HHMD 1M1XA 1ADWA 2CDGB 1WFMA 4BSVA 4Q0XH 1Y1UA 2GEEA 4J1UB 4KKCC 1CLOL 4J4PA 3C8HA 4MQTB 2I25N 2DYPD 5CWSB 4YN3A 6FABH 1OE1A 1JPTH 5KVMC 1SUJA 2ERJC 4WO4B 5C0JB 1BWMA 1A7RH 4Z7VB 2CUIA 2I9LB 4ZO6A 1KTLB 4NNYB 3VGFA 4Z3GA 5L0QC 4HXAH 1FO0A 2BVYA 2WLKA 1WITA 2EXWC 1DJHA 3TVMC 2BVOB 5BMFH 4PBXA 1MQ8A 4WKZA 1IAIH 4X7EC 4Y16D 5DJ0A 1VRSA 2MRYA 3DVNA 3F05A 3D18A 1CDHA 1FSKC 4Q9RH 4KHXL 2WANA 5EOCH 4RMUA 4JHWL 3OB8A 4Y1AD 4G82A 2ZNWA 4XGZA 4PHZA 1DN0B 3DBXB 4YVUA 5AW7B 4N2NA 1W72A 3RU8L 1A3ZA 4FI6A 5KVEL 3IF1B 1FE8H 4I48A 3TO4D 2YEZA 1PKOA 3O4LE 3B9AA 2GUYA 3A6BH 5L2JB 5I74C 4UT9H 3I2CH 1UB6A 5TE7L 3MHZA 5BZDB 5CAYB 2WWMD 2VERN 2W91A 4K3DL 3EH5B 5I0YA 2R59A 3NJKA 1EJOL 1WA2X 3QJFB 3OGCA 2Y5TB 5IFHL 1OGAD 5HD8D 2OMUA 1CD0A 4LSPH 3P77A 3KXFE 3FAXA 1C16A 5EEWA 4PJAF 1SLWA 1TR7A 2WIMA 1T1XA 2XTJC 3SDAB 1S7SA 5E00B 5FA4A 3UJIH 3JWDH 2XKUA 1F58H 1TCRB 3ARDD 4LCCC 5GS0L 2FR4A 2PCFB 2ATKA 4N2BA 1IX2A 3S35H 1IEBA 2XU9A 4CADB 2FGWH 1E6JH 1YN7A 5D96C 5KS9E 1U8JA 1F86A 3VSTA 4BHUA 2Z3FA 2PKDA 4ERSL 1RIVL 1P5VA 2HP4A 3E3QE 3L17A 2V33A 2JQZA 3DSFH 1H8LA 3HG1A 3BAKA 4FCAA 5C0IB 3WS3A 1D5XA 3PF2A 3VYNA 3CC5B 4R7DA 2WZ5A 2O6DA 4LDEB 1PDKB 3ARUA 1Z1WA 1KB5A 4GXUN 1FIGH 4LLAA 1JD7A 3MA7B 3TBTB 3D0LA 1HKLL 5IB5B 4XOBA 4NM8H 1JYNA 2F74A 4PEEA 1EJOH 4I3RH 1ACXA 3BD5A 4OLXL 4RMQA 1HXYA 1CVSC 1Q38A 2XWDA 1D5ZB 2OCCB 1U8QA 3RG1C 1QWHA 3L1FA 5D2LB 5EV7A 1O6SA 4JM4L 2AEQH 5DVLA 4XPTH 1JZ3A 1F90L 3Q2NA 4LU5H 1JK9A 1N19A 1I1YB 1KGJA 1JHLH 3H9SE 3DJTA 4HUNB 5DJYB 1LO2H 2IFGA 3MA9H 4E5XA 4OLVH 4B5EA 2E74C 1E4KA 1U8PA 3K4DA 3C08L 4HWNA 4PRDA 3CFDA 3RWCA 4TSCH 2CO6A 4BFGA 4Z78A 5C0JA 1BM3H 4OB5H 2WO2B 1U3YA 3JVFC 2YD6A 2AS5M 3F3HA 1IM3D 3WY2A 4AH2B 2Y1AA 1BHGA 1H6UA 4Q6IC 4KJQD 4LPXA 4TQPA 1OL0A 4WO4D 3L4ZA 4N1CA 1R4XA 4GG8A 4JFEE 4MMXC 1P84K 1IC0A 2XTJE 3OB0K 3ROOB 3LZRA 2C3GA 2NNCA 5F7YC 1FLRL 4M8QB 4NM4H 3D33A 4OZFA 3SE9H 4BFBD 2Y9RT 1J5OH 1HXKA 1YRKA 2WXIA 4JGMA 2Q8AL 4P04A 5CR8A 3H9ZA 5LGHL 1CU4H 1A9EA 3O4LA 1WT5A 4HUKB 3BUTA 1TZGL 3FU0A 3CMOL 2VMCA 4NC2B 3GMLA 3FHEA 2QQLH 1SOSA 4LARL 1G4RA 3QH3A 4GSDL 1C5BL 4OD2B 3SE3A 2WJ7A 4OCXL 4LMQI 1KJ2L 3L3OB 5CBAB 3U9WA 4Z7VF 3FCUB 3L4CA 2MCG1 4AE0A 4APXB 1JGVL 1X5MA 1V7NL 5FM5M 4LLYA 1VCBC 1VPOL 1SEBB 1A5FL 3L3OC 3N44F 2W65B 3S36H 2F19H 1Z9OA 4FXLA 3G3LA 1QMUA 1U21A 4MWFA 2IANA 4LOEA 2VLJB 4N9GA 3BCDA 4XC3H 2QTVA 4PJ8A 4HK0B 12E8L 4JY4A 3QIWD 4G59C 4LDLB 1HX0A 4YE4L 2F5AL 5HGAA 2VDQB 3KMDA 3AM8A 4ACTA 4QRPA 1YQ2A 4JM0A 3QAZB 1EXUB 5ITFA 1J10A 3KR3H 3SDXF 3VXMD 1FQ9C 1OT2A 1GIGH 5JHAA 3FF8A 5FLUA 3VFSB 1N8ZB 3FQXA 4WI6A 1IE4A 3HI1A 3O6FB 1VACA 3SKOB 2HLFC 4HHWA 4M02A 3BDYL 4LBEB 5I1IL 4ONHA 1II4E 1ONQA 2FEDD 3MFFA 1B4LA 4L8SC 2CLVA 5G4OA 4H8QA 3U4EB 3EOBB 1R3LA 3V4PA 1NQBA 1EHNA 4PWEA 2YHGA 5T5FH 5FOBA 1OTSD 3V6OE 4ELKA 4HIJA 3FFDA 3T2NL 3GHEH 1AE6L 2X40A 5EU6D 3SKUD 1SBSL 4TL4A 2WB7A 4M03A 4OIIH 1HL5A 4LAQL 2OQJA 4JPIB 1FZKB 1NIDA 1P2CB 1MY7A 1OCOB 4N2GA 1BVLB 1ZT7B 3B1TA 4HZ1A 1XB3A 3CHXA 2VXQH 2OYPA 4NLAA 4FFYL 1PY0A 2Y07H 1OCZB 5K9OA 5DRXA 3ARGB 1EVUA 4DKFH 3V79C 1BECA 4ZOBA 3SPJA 4N2EA 5FK9A 1GYCA 4JFDE 4TOYL 1YYLL 1V05A 5HHVH 2YZ8A 4AEIL 5T3XE 5HGDB 1AD0B 1UCBL 3QWQB 2WAQA 1D2PA 2CBTA 2WXGA 2VITA 2RR3A 3IGUA 1F2XK 5IQ9A 3WEMA 3RPIA 1XL6A 3EGDA 1WPCA 4U3SA 1AXTH 1U92B 2FJSA 3QUZA 3WFEL 2CGRH 1JNJA 1G0DA 4ODHH 3L2LA 4XAWH 5CZXD 5BOPA 3EUUA 3IETA 1ZS8B 3VFMA 2PNDA 3O6ML 3WIIL 5CCJA 5IEKA 2EYTB 2AI0L 4FZEH 3GMNA 4LXFA 4N0CC 5F7BA 3SDXE 4Y1AA 3D9AL 2VC2B 5CCGE 1UXWB 5DJAB 1I8AA 1J8RA 1TTAA 2ARJB 3FSOA 2DS4A 3VWJD 1JERA 3KE0A 4P3DA 4R4BA 1DDHA 2PO6D 4P2RB 3TJEH 4QRSB 4M43L 4BZ1H 1QLRB 4Z7WF 2DQIL 2V2XB 5HJDA 4HEPG 4KNUA 3GFUA 3EJJX 3ILEA 4APXA 1K85A 2Q86A 3IGAB 3MGAA 3REWB 1M3JA 2VOTA 1L3WA 2GSGB 3GM0A 1AZBA 4KY1L 2JKTM 3KD4A 2X5PA 4G7RB 4QF1A 3WNKA 4F37F 1XF2B 5B7FA 1MQKL 3QPXL 1MCLA 4XNXH 5L88L 2YMXH 5C2BL 3D87B 3W9EA 2NZ9C 4Z7AA 1ETJA 2BSDA 4JY4B 2YA2A 1ND0A 2VXQA 4UBDC 2XXFA 4P4KC 2AABL 2Y7SA 4MKTA 1CURA 2W94A 4NKIH 3W81A 4BELD 3AQXA 4IOSD 2K0RA 4MD4A 2AJVH 4I9WE 4JANB 3WNNA 1GMEA 4S0HA 3TVMB 4I4WB 2GBUA 2R1XA 3MI6A 1DUYA 4PQXA 5CGMA 4WW1A 5EBMA 3IDIB 4PP1D 3WIFB 4KI5F 4G7YH 2XG4B 2MCAA 2R2HA 4CL7A 4UMSA 2P24B 3KXFD 1HH6A 4FNRA 1H8SA 5DJZB 4OV5A 2O5ZL 3V5KB 1AHMA 4TSAL 4DEUA 5T33H 3CFBA 5EO1A 4E36A 4KJWD 3JWNE 3ISYA 3N06B 4OJEH 1MCOL 1R3JA 4AM0Q 5EBLB 4P9MH 1DUZA 4GRLA 2H32A 4J6IA 1B9KA 1FZJB 2IJ0C 4GAYA 1RZFH 1NCJA 5DC0A 1DEEA 2A4CA 4BDVB 1NPUA 3MCG1 5F1OB 3BGMA 3HUJF 2WBWB 3VGAC 3COOA 4I3SL 5KVDL 3EF4A 1X6LA 4L8DB 3RILA 3Q8BA 1HESA 2D3VA 4WY7L 1WZ1H 2WLHA 3OQ3B 4YBLC 4Q6IA 1HVXA 4HKXA 2OXGB 1XVSA 1E5ZA 4M1GH 4FCHA 3B9KB 1TTRA 1BZDA 4PJDA 2R2EA 3WCYA 5KYWA 2D4FA 4AQ8C 2X2UA 5DJXA 5K1NA 4HOMA 1TJGL 5CEXB 1H3GA 2VJXA 2XN9D 5C8JB 1IIIA 2CNYA 3KLKA 1WLHA 1UJ3A 4Z7VA 2F7OA 3QHTC 2CBMA 3K71B 2QGEA 2XTLA 5D4HA 3JWOL 3PGDB 3BE1L 3WXWH 1UYWL 3F7QA 4XC3L 1X3DA 4U6HA 1NMAL 4QRRA 3GT6A 4NAMA 3RZCD 2FK9A 3AT9A 2ZXWB 1N6VA 1Z0NA 4NX0A 4FA7B 2QVMA 3TF4A 4Z7QF 2OR8A 2CHXA 3V6BR 1L0QA 2CHDA 1GYWA 4TUJA 1YNKH 4RA3A 3N40P 1B4JH 1XTMA 5EWIL 3SYOA 1NL0H 1TZHA 2X3BA 3JV4B 4ZFZA 4F5CA 5FHAH 1SYVB 5EZJB 4P2RD 2DWEA 4LPTA 4NQQA 2C9SA 1QBLH 1S5IH 2P7TB 4PV9B 3IGAA 3DX6A 2Q86B 1XGZA 1IM9B 3AG2B 4OFKA 4AV0A 1PZBA 1S7VA 3KCPA 2H47C 3BLKA 3E0GA 1EEZB 3U48A 5ANMA 3DBSA 2QVFB 4YPGA 2EEAA 4LE8A 5F9WB 2P1YA 2CDFB 4KK8D 5ICXA 5C0FA 2AEPH 3ZRFC 2HH0H 4ZUTB 2F8OA 4Q52A 3T0AA 2FLBT 5KJRL 5KSUA 3BSZA 3BQUC 2O26U 3AU0A 4XC1L 1D7FA 1MREL 3GMNB 3NK3A 5CN1A 4LVEA 3ZTDC 4BQ8A 4QNPE 5B4MC 4DEPC 3QZNA 4NQCE 3LVTA 4PJBB 4MXWH 1KFAH 4Q8BA 3RL2B 3WNMA 3DTXB 4PJFB 1WCBB 4N4YB 1A1MA 3WFCL 3JVGC 1JZ2A 1DJXA 4Y2NA 2XG4A 5DFWH 1OAQL 1V7MH 1YNKL 3X14B 1CU4L 4RH4A 4JJHA 4C47A 1FBIH 2ZSWB 5ADOH 3RJDA 2HMID 5LBVA 4A7GF 2O30A 3OGOE 4GI9A 1CGTA 3L3HB 4Q89A 1BAFH 1JS4A 3QUKB 4YHZH 2AJ3A 3V0WL 4EBQH 4XBMA 3UEZA 5L4MA 4KDWA 25C8L 4WDIB 1JNNL 1U2HA 3G9AB 5AVSB 4GAYB 4YSSA 3NK4A 4W9KC 4Z3TA 1WWAX 1X5KA 1KJVA 2COVD 5FA3A 1M9SA 2HKFL 3TTSA 4L1SA 4J28A 4AITA 4XZUA 5DRNA 1G7JB 4MMXB 1S7TB 2P8MA 2YUXA 3QDMA 1W0VB 2XIIA 5K9JL 3PYCA 1C5CL 2AKRA 2F68X 4IU2A 2DWSA 1MREH 1XTLA 4UI2A 2KZKA 4XNQA 2N1KA 3NP3A 1L9PA 3B7TA 3OXSA 5DMGD 4AL8H 5J56B 2AQNA 4J6RL 2ITCB 4A37A 3ULSA 1JD9A 5KVFL 1BZEA 4K7PY 4MAUH 3UG3A 5CKGA 2ADGA 4ZFQA 3BX7C 4ZG1A 1UD3A 1TMQA 3ETBJ 1QHPA 4Z7UB 5EU5A 1IKNC 2V4LA 5IQ7L 2G2RB 2ZUVA 3IJ9A 2OMYB 5DK2A 3R8BB 1PMYA 3S2CA 3GS0A 1NA8A 3EJYD 3GRWH 4MCYA 4CU7A 4POUB 3VFOA 4MJID 3T8XA 1GC1C 1G1OA 1R5IA 4HAKA 1HEZB 3VXRA 1HL9A 3RTQB 3BKJH 3RJOA 3K5RA 1R3HB 3WUZA 2CJSA 5JQ6L 1Q90A 1RK0A 4JM2C 3WE6A 3LEYL 3AGVA 3D34A 3BAYA 5FS5A 4ZODA 4BSVB 5KAQF 3VWKC 1CN4A 4XCYA 1SBSH 3QORB 4B97A 4F80A 1RI8A 5IHZB 1J11A 2WLIB 1IM3B 5IMKA 5I1AB 5IGXH 3CV5A 2YXFA 1GJUA 3QUXA 1PD0A 4EMZA 2I07A 4NUPA 3UO1L 4PJFE 1BZQK 1SRDA 1Z5HA 4WK0B 3VWKD 1TO4A 2BW4A 3MGOB 4BRVA 1I1AD 4ALAL 3SBQA 1J05A 1TZ8A 4ZFFA 1NFDE 4FL4B 5E0FA 1X5GA 4FKHA 4OGAD 1BXAA 4AENA 4L2LA 3QEUA 5E4EB 2WM0A 3K6SA 4M4PA 4D0DB 5CJOH 5J13C 2ATAA 3BGFB 1DR9A 3WJJC 4GXVH 1N26A 2DLIA 1JGLH 1BV8A 2QT6A 2YZ1A 3BFOA 4KAQH 4PW4A 2AXGA 2YWYA 2DLHA 2LOEA 4GEIA 1EPFA 3D85A 2E5EA 2NY1D 3EYUH 4Z0XB 4ETYA 5I1DB 4OCSL 2WTOA 1KIPA 1J9QA 2ZCHL 3ZKXB 4F33B 1V3LA 4LKCA 1XH2A 4PGDB 3D9AH 4FFWC 2FDBP 1BFOB 5GGTA 4IBQA 4WW2C 2HT2C 3OLEA 3S4SB 3NFSH 4OGYL 3O6LL 4IBYA 3RX8A 2QKSA 1M56B 3K5SA 1A3RH 3MFGB 2VZOA 4AQ8A 1FYTD 4E41E 1ZK9A 5J6HB 3CZFB 2B0SL 1U3NA 1VESA 2WBKA 3NESA 1BLIA 2R29L 4HSAC 1H8OA 2ZCLH 4X5RA 1CD8A 2X1OA 3ARBB 4WFGD 3DSFL 2H0JA 2CBPA 1ZSHA 2RCSL 4OQTL 3DO4A 3HN3A 2ERJB 2KZWA 3NA9H 4WO4C 4EDWL 5I6MA 4HUVB 2APVA 2UV3A 4L0PB 2YQ2A 4OI9A 4ICWA 1PQZA 1WSST 5J7CC 3TVMD 5JO5A 3VFTB 5HVGB 4GI8A 1RXLA 3ECVA 3ILPA 4MMZB 4DF9A 3P0VL 3HLAA 2I60L 3HC0A 3TYGH 4U1KB 5ICUA 2XN0A 1N8OE 4X5WB 2C9XA 1TTUA 4HS3B 1OB1B 4DUXA 2Z31B 3RQ3A 5HJBA 1O6TA 4TTDD 1NCTA 1XF5A 1FC1A 1P7QB 1G7LA 5D7SH 1JPGB 4XMUA 3RWDA 3B9VA 5D71H 3ME0B 2MFNA 4PB0L 4YHPA 4FTVA 1Q9LA 1R24A 1D9KA 3LN9A 3N43F 3QUXD 1J5IA 4NQVB 5T3XH 4QRRE 1QNZH 3LZPA 3NCJL 3SJVB 3GBLA 3QDJB 2H2PD 3V2AR 5SWZE 4HFUH 5DO2C 3B5GA 1R34A 4LF3B 4HIQA 3U2JA 1HYSD 2VLME 1BBJA 2MJWA 2D8KA 4XP9H 5FAAA 3ZQXA 3P4NA 3UP6A 3BQUA 2GG1A 1U8LA 2GCYA 4WJG3 2ZG3A 5CU5A 4YFEA 1TG8A 5EN2B 1RUKL 1KDJA 3IFPA 5J5EA 3REWA 1QO3B 5FCSH 4ZXBB 3MNZA 3QZOA 3W1ZA 1KT2A 5F3BB 2E7BA 3UBXI 5AYUH 5GRVL 4MS6A 1YCSA 2J6EA 4GAJH 5ACMA 5GRUH 3T09A 1HWHB 5E6ZA 2OTPA 2EXTA 1PLAA 2XFGB 3QR1A 1QFPA 4M93B 3MLPA 1OCWL 5BRZE 2JI1A 4TLUA 3KVQA 2V5RA 3UYRH 4PRAB 3OLDA 4H4NA 4QRTB 5D93C 2HLAB 3H53A 5M7QA 3TN0B 1Q94B 1O7SA 1D5IH 1MHEB 2PPCA 3SQOH 3BPLC 3QR0A 1EHAA 3WO4C 3L4UA 2HUEA 3VU2A 4YX2H 3PIQB 1PKQE 4I89A 4TS6A 2AXFB 3GLDA 5ESQB 3FU8A 4PPTA 1TIUA 2Q3XA 4FRWA 5FECB 4X0NA 5HDQL 4WUUA 1WBYA 1IBBA 2ZXGA 3EBGA 3PCYA 4NC1E 4OUUA 4Q58C 3T6XA 1KULA 3ZHFA 2FWOB 3LN5B 3RVWC 3TM6A 3KG5A 4JKPH 2EVJA 1QLEB 4PTTA 1XAKA 2V9RA 1E8YA 4NZRL 2VWEE 4NBYB 3IDJA 1OWRM 1L9MA 2XWBA 1M71B 3NMEA 4YHLH 4A2GA 4Z7WB 4LHUG 4BJLA 2BRRL 2YUVA 3PDOA 2KBGA 3S96B 5C0NC 4GW4A 3HG1B 1J0ZA 2BK8A 5IBUG 1PS3A 3L4TA 1CD9B 4H2AA 1GC1L 3D39B 2H0PA 1WBZA 1IAKB 3L7EA 5I6OA 1SY6L 5DQDL 3UTOA 2HAZA 4G80A 3BXNB 4WV1A 5SV4A 3T4AC 1NGWB 3U9UB 4AM0B 5HVWA 4YHMH 4MCMA 1G1YA 1TO5A 4FQCH 4AZ8A 3VRJB 1NGPH 1SM3L 3H9HA 2WVSA 3VFUA 4G6JL 4DHLA 4GIAA 2BNRE 2GYSA 4NQCD 5FUCE 2ETWA 1KLGA 5J6GA 2J20A 3DI3B 4JKMA 2OX5B 1DE4A 2XWEA 4X0KA 2WSKA 3UXFA 1RZKC 4O02A 4HZLA 2A74A 2ZG2A 4H5SA 5I2IB 4FQLH 4YSAA 4MQSB 4DGVH 1GPOL 2VM3A 2YKLL 1NIEA 4JFFA 2CDGA 3A23A 1N64H 4YDKL 4B60A 4LPCA 5TQ2H 4R7NA 5LQBH 3JV6A 1FVCB 4BKTC 1HE7A 2J1WA 5KS9F 3IFOB 1NWPA 1CXLA 2EAEA 4LLWB 2DM3A 1M53A 3LIZA 1I75A 5IOPB 1MY5A 1UOLA 3NZUA 3BYYA 5AOIA 3M17A 1KYOK 3N40F 3U7WL 2HWZL 2QGDA 3NPSB 3K8KA 2Y6SC 5SX5K 4F8OA 3BVXA 4JQIL 3IVKA 1ET7A 3CAFA 3GSVB 5DZJA 1GJIA 5FGBA 2UZXB 3GIZH 4DUVA 2H2SD 1XGUA 3RL2A 4LL4A 3U7YH 3LKNA 1OY3B 4DERA 2E7MA 5GJSL 5IMOB 1U58A 1TEYA 2AJYL 2JWYA 1BLNA 2VDML 4Z95L 4CAGA 1NAML 5AB0A 1OAZL 1XCQB 2WCSA 2DTSA 2V3EA 3GJFA 3VA2C 3HAEA 2ZSWA 4FG4A 3PIQA 5F7HA 1JFQH 1SHMA 3BMVA 3MNWA 1Z5YD 3NSJA 4BH8B 1CTOA 4NN5B 4E42A 4RFOL 4ZX3A 4UDTB 5IW6B 3PUCA 2WWOA 1U0QA 2XXGA 5CLYA 4QXGH 2IFFL 1GCFA 3ARFC 4L3ED 1TFHA 3QQ3B 1A3QA 1LO3L 1SLXA 1HS6A 3GSQA 4F7EB 5DHYB 2NDFA 3ZKMC 3EGXA 3K0YA 1LVEA 4YXLH 3RWHA 4A7VA 3UPRB 1NAMB 5C0BD 4B9FA 4Z3IA 3LOWA 3DGGB 1F3JA 3ARFD 5D7IA 4PR5B 5T3ZL 4EDXB 2CKNA 4WNSA 5GGQL 1EERB 1RIUL 4MJ6A 2AABH 3IN2A 4BCYA 2CCLA 1YEWA 3H85A 4P59H 2FX7L 2YMXL 5CP7B 1KIRA 1GS7A 4FQIL 4FX5A 3C6LA 3G6JA 4XVUC 5AYUL 3FQ1A 3QHFH 4YQXL 3T0EC 3VXSD 3VXUE 5BV7B 1QI5A 3OZLA 1K3ZA 1A6TA 3O3UN 5EU5B 4YO0A 1TENA 3IMVA 4MKMA 5DDHA 3VRJA 3QQNA 4DETA 4MHHI 4R3SA 1C12A 2Y1ZA 2I26N 5G2NA 4OM0L 2N0KA 1ZEAH 3QYNA 4M7ZB 4W9HC 4XPAH 5I1LA 2JI3A 1TCRA 4LASL 2FR4B 1E2ZA 1ZGLB 3V4VA 1IEBB 2J1ZA 4FDWA 3H1ZA 4WFED 2IWGA 5EIIB 2DZEA 4L48A 1FHNA 4DVBB 5LCVA 2C9AA 3PXLA 2IIJA 3WFDL 5F9OL 3DI2B 3KH4A 4NN5C 1PVHA 4GFXA 2OJEA 5C8JA 3X12B 2X89D 3MV9B 3VRLE 2AK4B 5K33A 4D9RD 5AYQA 2V2TA 2BSEA 3LPWA 2IPTL 1A6WL 1HK6A 1KJ2B 3MYZA 5IWLC 3OD3A 5JA8B 1KB5H 3GSRB 4WEUD 5HYQA 2C3VA 4XN8A 4H8WC 2BS8A 3W5NA 2WKGA 4M61A 1U8QB 2WKOA 4HX1B 3MUY1 5SX4H 3T71A 4F1SA 4OM1L 3RNKA 4N85A 1BW8A 3AM8C 1BVZA 1E6OH 3IJHB 1EBPA 3HPLA 1TQSA 3RI5K 2ZX7A 1UCTA 5MEPA 1RUQL 3BW9B 4Y2DC 3ABGA 3M6DA 1GCYA 1WUNT 3RWCB 5D4JA 2GJ6D 5GRYA 4FHJA 4PLKD 4I1PA 5GGUA 4CILA 4LKCB 5C08D 1MFBH 2QQQA 1OLLA 5MENB 3W37A 4JS7A 4PH8A 4NENB 1GY2A 3FB5A 4TNEA 4TUUA 4J8RA 1CDGA 3N9GH 4MD5A 5DFVD 5BRPA 2XZAH 2VXTL 1SEBA 4L9LC 5D1ZC 5HGHB 4K3DH 4K3HA 3LEXB 3WTUA 4ANKA 5AOLA 1KXTB 2G3NA 5EMYA 3WN6A 3F7PC 3CZFA 2L7JA 3IU3B 4PJAB 3RWIB 4JCMA 5AWNL 4QXTA 3P9LA 1BF2A 1XF4B 1T7VA 5EU6E 2F5BL 2A2QT 4A7QA 3FB6A 2DKUA 3TF7C 1GH7A 3JWDL 1PF3A 2IGFH 5BRZD 4PJ6A 4I18C 5IVXE 4TLKA 5KSBA 2B1AH 1KG0B 1ZVYA 4PJBF 3MRJB 3CLEH 2NSQA 5IMLA 3IRCA 4Z0BH 5KBMA 2V6HA 2AV7B 3WHXB 1JMXA 1X7QB 5FYKH 3ULUE 3LIZH 4TNGA 5C0GB 1FZJA 1QZ1A 1FYTB 1X9UA 3FUKA 3QO1A 4R3SB 3G5VB 3TCLA 5JW3L 4I77H 4ODXB 1CBVL 1S9XA 4JHVA 3MROB 5K59E 4IJ3C 3VSVA 4KUZH 4AYMC 3SGKA 4P99A 5C09A 5AOMA 1VCAA 5GQBA 3NJLA 4P49A 4CC1A 1TQTA 1WWBX 2GIYA 2R0WL 3KLAA 2BHFA 4PGJA 1W72L 2BSED 2DIBA 2OW7A 2ZKHL 5TE4L 1QP1A 3EG9A 4ZSOA 3K2UL 2ZYRA 1MI5A 2WXRA 3VD9A 1PKQA 2VL5A 3NDYE 4HJGB 5TH2A 25C8H 3HG1D 3GDCA 2CNZA 3FT2A 4GT7A 1E4WH 2A3TA 4OVVA 4ZPTB 1S9KC 4LCIH 3ZDZB 4PB9L 5IZ7A 5KBDA 3CFJA 4KGLA 5HDBB 4OLZH 1IAMA 3IFPB 1I9IL 3EJSA 4JN2A 1SPDA 2NY1C 3TURA 5I5MA 1JYXA 3K6OA 2Z6FA 3I3DA 4JPVH 4YHOH 3FZUD 5T1KB 3FTSA 3SODB 1IQWH 4XNMA 5AW4B 1HEZA 4UU9A 2UXFA 3PWJA 2B5IB 3T0DA 3FYEB 3VFMB 1MJJB 1I31A 4NRZA 4XHJD 1KLFA 4M6NL 1IKFL 1CZ8L 4JDTH 4HKZA 3WDIA 5GJTL 3I6SA 2XZQL 4LBEA 1U8IA 5I8KL 3L45A 1U2CA 5I1EL 4E41D 2VE6A 4YSDA 3ZUCA 3NZ8A 4D2NA 4ZAKB 1PZUB 4P4RB 3QDMD 5IHUL 3T6QC 1KJ2H 1DDTA 2O6CA 3HE7B 4MB1A 1MCFA 5BJTA 3WN5C 2FYVA 3QB7C 1NKRA 2KMWA 3R18A 2EYRA 4JO8A 2C9VA 3AU1A 3GMOA 3RFRA 5I1IH 1P4LB 2GSGA 5CHNB 3REVA 1J87A 2X4PB 4WKZB 4U0QB 4K23L 5D72H 1ZA6A 3MOQA 4YPJA 3P0GB 3S36L 3SDYL 3ZDYB 3TT3H 1XCTB 3CFCH 1CMOA 3NN8B 5I1GH 4H25B 4FQ1H 4PV1C 5DQ9B 1MFDH 3GJFK 1RY7B 2E6PA 1F4YL 3NRPA 4QKTA 2E47A 1AOHA 3OR6B 1NAKH 3EJYC 1BAGA 4F58H 3CUPA 1T6WA 5T3ZE 3QDGB 5H2BA 1RKRA 3HHSB 4ABUA 1WEJL 2ZXAA 5JOFA 3QUKA 2P49B 1K6QH 1KDIA 3LKQB 3IFLL 1JMZA 2ZOKA 3ZDZF 1RUML 1CGWA 2JELL 4MD0A 3UYPB 1N2RA 2K6WA 4QLRA 3T3PF 1S7WA 3WXVH 3GLEA 4NKOB 3Q6FB 3N3EA 4J3XA 4XVSH 1JZGA 2IAND 2ZUTA 1HHKB 3NGBB 1MHHB 1PNCA 4ZUWA 5G4NA 3SDCD 4CBPA 5FW8A 3EJZC 4BK5A 5DI8B 5KBPA 1SEQH 2GC7C 4KK9C 3U4AA 2DAVA 4BA0A 3QIUC 1ROCA 4QRPD 1CICC 1E40A 2XRAL 3SDCC 4HQQH 4MA8H 5KSBB 4UV7L 1N0XH 3HG4A 1ZLVH 1QA9B 1BOGB 2CM5A 3AC0A 3DO7A 2DJUA 3CXDL 1VHPA 2WINA 5IK3A 1CG9A 4N0UE 2DQUH 4Z9KB 5DUPL 2X6UA 5IROD 3Q06A 2BIPA 1FVEB 2CJTA 2VQTA 3DX8A 3QFDA 1JI2A 1AY1H 4EUPG 1E28A 2P5WA 3H3KA 4V1DA 3MCLL 3WD5L 3LVEA 3G5VA 2JIXA 1MCSA 3G04B 1YAIA 1TVHA 2C1PB 2WMPA 1SN0A 4JY6A 5CP3H 4L8DA 3LMJH 2YARA 3IK2A 4YFDB 5FIEA 4ZMQA 2VN3A 2I9TB 2VISB 4Y4KC 2VM4A 4KNSA 4YBQD 3ZRSA 1Z9SB 2DWDB 5I15H 3SE4C 2WB1A 4AQEB 4GOSA 2D31A 4TF4A 1PG7X 1GHFL 5HYIA 5I0WA 3ZX1A 4EN3C 2B1AL 1XGYH 3CDZA 5D7EA 1BBJB 2QHLA 5F6HJ 2I7OA 5LWYH 4Z78B 2P48B 4NP4H 5D9SA 4ABQA 2BCMA 4HW6A 2BJMH 3S34L 3I9AA 5IKCA 3UABA 1GS8A 3BN9C 4MZ2A 2Y3AA 1I1FA 1YEDA 2R0ZH 4NN6B 2AITA 5LB1A 2DJMA 2ZP9A 1EV2E 2FD6H 4Z3FA 1J8KA 2IAMD 2E86A 1KTDA 1EEZA 4CMMB 2IPKA 1BZ7A 1A1OA 2X9WA 3OC5A 4XP1L 3FJTA 5GS2H 5K1JA 2OP4H 4OJYA 3SGJA 2FO1A 3WL9B 1E27A 5I76A 4OFYD 3HRZC 4QRTA 1IMHC 4N5EC 2WXLA 4TNVF 5EOQH 5CBEA 4EXKA 3BWSA 4NKIL 4PS7A 1J8HB 1A8ZA 1CYXA 3IBEA 4N87A 3QQ4B 4RGOH 5FKAA 1IU1A 3L48A 3HHSA 3S5LG 4PBDA 4U1HB 5KEZA 3QUXC 5GXBB 4N5ED 1AKJD 4NKDB 3QQ9D 2BNQE 5BXFA 2PWEA 2X9YA 3TBWA 2CGZA 3BZFB 1ZJAA 3I3EA 2V9TA 2B16A 1X7TA 4X8GA 2CHWA 3LKRB 1CGYA 3ZZLA 4ZUTA 5HHOE 1RZPA 4UANA 3SDDA 4AYGA 5T33L 3F7RA 4XVJL 5KTEL 2PLTA 4JEGB 4JRLA 1C8PA 1PIGA 2V5MA 3HE6C 4QTIH 2AJUL 4L4VE 1ADQA 2OSWA 2OMWA 5I1LB 3RX9A 1SMAA 5D2NE 4G6MH 5LBSA 2GBTA 2UVFA 1FORH 5L6YL 4J12A 2P7TA 3MREA 4N8PA 1KB3A 2DLFH 1RSFA 4HIEB 1BSIA 4TNWF 2VRQA 2OULB 1HHGB 3QEGH 4J3UA 5CSBA 3VGDA 2C7UA 3X11A 1JK8B 4MCNA 2ZWKA 2YPVH 3ABLB 1AIZA 3D69A 3H7LA 1ZTMA 4R97C 3FRPA 2EZ0D 5FO8B 4PTUA 5FUOH 2FNWA 2GJPA 4ZMTA 4HJUA 2C1PA 1EGJA 2BIMA 3SE6A 5DLMH 3UDWC 4AV5A 4I2XE 3OZ9H 5KWYC 5MENE 5IJCC 2X4OB 3BUYB 2NY6D 4JHBA 4KQ4L 3FTXA 2LU5A 4OFPA 4DVRL 3PHQB 3OTTA 3RIAK 4DGVL 3N1GC 3I50H 2XN1A 4GXUM 1NBVH 4M1CC 2BVUA 1A7BA 1JDAA 1KJMA 3FU6A 5DEFB 4HOZA 3TIEB 5TFSL 2APXA 3BMWA 3IB4A 5AAMA 2UZPA 4ZNCD 3SDXA 5D93B 4YSPA 3RWGA 4B50A 4DAGH 2AK4D 2R1YA 2ZUUA 3ZE1B 3RDTD 3ARRA 1J1XL 5CUSL 2NXZB 2GFBB 1AD0A 1FO0H 2O5XH 3FUFA 4MJIE 4M93C 4YDLC 4K7PL 5MENA 4UNTA 2YPLD 1KEMH 4FQLL 4U3CA 1USZA 3KZ8A 1H3TA 2XQBL 7FABH 1EWHA 2Q87A 3RJQB 1VB9A 4FFZL 1A4CA 3SY0B 1VIWA 3KM1A 3DKHA 2WMPB 1SYSA 4PJGA 3VFOB 3PWLB 4KMQA 4XO5A 2DLTA 3NZHL 3RAJL 3MV9E 4H40A 3W9DA 1AOZA 3RZCA 1YG9A 1MH5A 4RNRA 4QT5B 5HDBE 3WNLA 2X38A 4FQXA 3HB3C 3Q2LA 3E6FB 3FRUA 1ASOA 3T0EA 2XRAH 2HFGL 4F8LA 3VI3B 5IMOA 4JFQB 1DVSA 3B43A 2VLJE 1TMCB 3HAEB 4NDMB 3M07A 2YA0A 1DZ0A 1Z9PA 2ZXCA 3H56A 3GHBL 4PJDF 4HS8H 3S48A 1QRKA 4C56E 3T04D 2ZUYA 5LN4A 3NSFA 1FO0B 1I85C 3O2DL 4LQ1A 5J12C 1XH3B 2VDKB 2BVOA 3CH1B 4RFNC 1I1AB 2X53A 3W9EB 4YBLB 3ARSA 5F7DB 2CGRL 5EF3A 2W9EH 4PTTB 3T1WA 1W8NA 2R4SH 3TLRA 4UCFA 2BRQA 2N0MA 4KO7A 2PETA 4BQBA 2WIIA 1KIPB 1ZXQA 2E75C 2UVEA 4DK5A 3FQNB 3ZHNA 3MC0A 5CLTA 1HH9A 3ELAT 5AG9A 2OR9H 3D05A 1F4AA 4FG0A 3WHE1 3OKMA 2WNWA 3CFCL 4F7TA 2JV6A 3BYTA 3IMWA 1BGXH 2YC1A 2Z8VC 5GGRA 2JI2A 4QXGL 1WD8A 4P5KA 5I5RA 2XJLA 2H45A 4HP5A 5T1DH 5TK4A 4ZQTA 4A2DA 2BSRA 5DD1L 3FUIA 2WYIA 1UWEL 1UT2A 5J11B 3H6AA 4RLDA 4X6BB 2GSIB 5CJ5A 2NY5C 2LTQC 2OM5A 3A6CH 3DX3A 3V4PL 3WV0A 4APQC 4L9LA 2DTML 5D1ZA 1HQRA 4P23D 3HS0B 4LPVA 4QCIB 4YWGL 1OSPL 4F93B 2X1QA 5EO9B 3IJEA 3FO1B 1KACB 4RMSA 4NRZB 2UXTA 1JL8A 2F1EA 2A74B 4XXDB 4H5SB 4LKXA 2OFQA 1IZJA 4S10A 1SJEB 3ASNB 4TULH 1RUKH 4HIEA 4JPSA 1ADQH 2EILB 1R75A 1EXHA 4WHCA 4I0CC 3VFPA 2WXKA 3BFQG 3GMPB 4NNPL 4ANXA 5C7XH 1J0KA 4K9EL 4QHNA 3TONA 2EDDA 4NZTL 4XN1A 1HDMB 5ISZB 4E5XB 2JB5L 5T1MB 4GKSB 3U1PA 4J8QA 4X99A 4QYAA 5E56A 1QASA 4KH9A 4TLSA 2ZUXA 1KCRH 1HQ4A 1JGEA 1SHXA 4NXKA 1FDLL 3QFJD 4WSJA 2GI7A 3M88A 3I84A 1T6BX 2VO8A 4NZUL 1R24B 3GM8A 1JK9B 2A0LD 4O58H 4QGTA 1E9QA 4K15A 4JE4B 1QSEA 3OR7B 4JGUA 4LSVH 3HKFA 3EO1B 4TQHA 1KLUA 3GF8A 4ZFOB 5KYUB 4TTGA 1M3IA 1E0OB 1H3XA 3NJJA 3QSKB 3WY4A 3I85A 4WFEE 3IU4H 1A21A 3TIEA 2FHBA 4Y16B 1CFQB 1MW3A 1UM5H 2ADYA 1SXSA 4N68A 4PRDB 4XXCC 2CQVA 3DRTB 5FYLH 5I15L 2VKWA 4ELME 5ERWB 2H41A 1OP5H 3MA7A 3TBTA 5HDQH 4A04A 4AYFB 1HSBA 4M7KH 3MRBB 2IH1A 2NY7H 2FBOJ 5D7LA 3UBGA 2ITFA 3U46A 2X4QA 1RUAL 3L95B 3S37L 3D5OF 3JTTB 2R69L 3DV4B 1KIQB 3CN2A 1EAQA 3RE0A 5KVDE 1JTPA 3BAJA 3GTTA 5BZZA 1DANU 1T7WA 5AW3B 1S9VB 2VZUA 1RIHH 5ESQA 4AMKH 3FU5A 3MLZH 4LLVA 5KYYB 2OZNA 2Q7AA 5A1AA 2C5DC 5E2UH 2BNQA 3HG1E 2J8OA 3NPZB 3QUML 2ICEC 5DMKA 3ES6A 4BUHA 1AO7B 2ZWYA 3G5YB 2WPGA 3O3DB 1TKWA 3WLWC 5F96H 2H26B 3PLYA 1Q94A 3CFDB 3D2TA 4JG5A 3ECBA 1LK3L 2P43B 4O9HH 3E3QC 5DUBA 2X70A 4KX8A 1HKFA 3MZTA 1RUPH 2R2BB 4F7TB 4Z7IA 2G60L 1E4XH 3HRPA 2ZCZA 4OKVA 4OLYL 4WEBH 4WI7A 2FVNA 4LHQB 1X7QA 1E5AA 3B2PA 4OUUB 2NX5B 3C8KA 4XHQA 5JR1L 3S7GA 3MNVA 3T77B 1A47A 5DTFA 2VUOA 3DIDA 3QJFA 3RKDC 5F7DA 5ESVA 2X2IA 2X87A 2OMUB 3E2HB 3HI6L 5DSCA 1VAHA 3VD4A 3W0WD 2XWBB 3QULA 1KBVA 4ZMWA 1DEDA 1OAXL 4PJIE 1YO4A 3FPXA 3NCYP 3SE8L 4L29A 4YDIH 4Z8FL 3N44B 1UASA 1B2YA 3WN5A 3B6SA 3ULUF 3PE9A 1XHHA 1MWAH 3AJ7A 2RHEA 3M1BA 1KSRA 3FT4B 4HFWB 2AEPL 2PUQT 2V7NB 4J5VA 1JV2B 4JCWA 5IBUB 1NPJA 1Q9OA 5KBNC 2VXVL 2BHYA 3C09C 3I9PA 1YEHL 3TWYA 1RHHB 2EDQA 4MAYB 1BM7A 5D7IE 5SX5H 2XWCA 4YX2L 1DBBH 1DQMH 1TTBA 2EH7H 4NP9A 4NUMA 2OZ4L 2NMSA 3KWVA 5CD5C 1P4IH 4G3YL 4Q56A 5DD5L 2OQJB 4XCEB 1BFVL 4YJZL 4JKPL 3STZB 3ULAB 5CGTA 2XETA 5BZWB 3MRCB 4ADGA 1SUHA 4MA7L 4LU5L 1IVTA 1QSFA 1C5CH 3SBWA 1NC4A 4AGMA 3SO3B 5F3HA 3V0AC 3UH8A 4ZMVA 5E94A 2PXYA 1BEYL 3EJUA 1HL4A 2HKFH 4P2RA 4OGAC 3H54A 4I3RL 4Y4FD 3L95A 2NSXA 4CSTA 4Q9QH 1U95A 1AHWA 3ESPA 4QXUL 4ZS7H 1ZLSL 3UAFA 1F97A 1ZT1A 4G83A 4YHYB 3IGKA 3QCVH 3TPUA 4NZJA 3AW5A 3QVAA 4PGZA 1REIA 1MFDL 1ZA6B 3K6IA 4ZS6C 1YC8A 3FU3A 3L3JA 4NHUA 3DOIA 5HY9A 3VQMA 2XVGA 3V0EA 3X17A 1M05A 2WUCL 3TH3T 1QLRA 2Y3NA 2GTWB 2R7EB 5JTWA 1U33A 3C5JA 1B2WH 4FFWD 4R4BB 3QWOB 1T4KB 3MV7A 3B9KC 1N67A 4LARH 1GSMA 2Y7MA 3RWJA 3FQUB 1L7TL 1FNGA 4UDUB 4JFDB 3G6JF 2CUAA 5HJGA 4GSQA 2XQYK 3AS3A 3LV3A 4X5PA 1MLCB 4KWUA 1EHLH 4XWOD 2DQGL 5IGXL 2FECL 1J5OL 5LGJB 3Q13A 3PL6A 4GUQA 5EZOL 2IDSA 5TQ2L 3G9VA 3P4MB 2H6PB 1FH2A 1SEQL 4ES9A 3P30H 4RFEA 1FA4A 1J0JA 1L7IH 2W1NA 3MROA 3I3BA 2DWYA 2CIIB 3ZQ9A 4WUKH 2ED6A 4MWFB 1MXDA 3R1GH 5LAPA 1LEIB 4Y5XC 2VC2L 1J1OH 4ZO8A 2XZZA 3PWVA 5IB2A 3DUHA 3OQRA 2XC8A 1Z2KA 5DUML 1Z3RA 2BMKB 5DA0B 4MGXA 4PVNA 4N8CL 3C60C 5AYTA 4PJ5A 1LP9F 3QXTA 5KW9L 4B41A 2QR0A 3BH8A 5DEJA 3ZJAA 1NCWL 5BCAA 1RHFA 2AXWA 2IAMC 1PFCA 4ELMA 4LEXH 1Z32X 2YSTA 4TTDC 4IQHA 1L7TH 4CSZA 1AR1D 1CFBA 2NY2C 2BCKA 4LVOC 3QUYC 4L4TD 3UG4A 3WUWG 3WXVL 4CN6A 1CBJA 3QFJA 4IKLA 2KUTA 4R2GB 4P3CL 5E9DB 4PRIB 4JN2B 3T8MA 4LCYB 3VYPA 4F91B 1ONQB 1HAWA 3QI9A 1ASQA 1FP5A 4CC0A 2RJMA 4XP6H 5I23A 1NC4D 4JK0D 4BWWA 4FKEA 1PY4A 2VH5H 2A77L 4G8GA 2A6IB 2W0KA 3S35X 3T6ZA 5CINL 3PV6A 3FSVA 4O2CA 5KUKA 3BWUF 4QRRD 2EDFA 2FHFA 3DYMA 2YSSA 5CCKH 5L0QB 4KAQL 1H0DA 5FWRA 1UJ3B 3M1BB 1SOQA 2DIEA 2X4UA 3GRBA 4RX4D 3VJ6B 3I6KA 3MPCA 1BD2E 1X5YA 1KPRA 1BVNT 1K4CB 3DIFB 1WUZA 4S1DD 4QJ4B 1BDYA 4F9PA 1FZMA 4G7SB 3T2NH 3SGEH 2PYED 1CGSL 5DD6B 4NQED 3IJ8A 4H0HB 5DXWA 3OMNB 4JPKL 2QELA 2QFPA 3BUPA 1X44A 2HT3C 3ULUL 2K6YA 4B9CA 1FC2D 4MD5B 4GQQA 5B38B 2X4TB 5B8CB 1FNLA 3PV7A 5FR3A 2ODHA 3L6FB 4K3EL 4U1IB 3RVVD 2VUKA 3JV4A 5IQNA 5E08H 3QXAB 4AUYA 2WTRA 3JTBA 4UOJA 1BJ8A 4P2CG 2EZ0C 1JGUL 1LEGA 4YK4C 5GZOC 2OTWB 1YAZA 4PJBA 2WVTA 5BS0D 5JW5B 4Q74A 3Q05A 1A7PH 2F53A 3OJDB 2VQ1B 4UMGA 3OAYH 3WSQL 2HKHH 3UAJA 1MSPA 1E8ZA 3J07A 1XGQB 3BVDB 4GUPA 3TOPA 3K6FA 1CGXA 1KCWA 2HFFB 1AD9A 4FOMA 1QW8A 4DN3L 3TEWA 2AV7A 3WHXA 1TZGH 2C7FA 5DJ2B 1N5YL 1GZQA 4RRPM 5E8NB 2NY2B 3VH8B 2DQIH 3WMQA 4JQXC 2R51A 3SOBH 2Z93A 3GXFA 5HHQB 1BJ1H 3FB6B 2MTPA 4OF7A 1RJCA 4OCXH 5GS0H 1G7JA 4MMXA 4ZFGH 3O0RL 1SXZA 4U3HA 1DO6A 4IBVA 3RB7A 4ABWA 5MI0B 1PYWB 1JGUH 4KTDH 2CLRB 4PJCA 1S7QA 3MV8D 1CL7H 1OAKH 1ZHKB 4IGBD 3DROA 4Y5XB 5GGSA 2VDNH 1M1SA 1DQLH 3HB3D 1F11A 5E6YA 4GLRI 1KYOJ 5C0ND 3FF7A 2CK2A 3E6HA 1A7OH 1WRFA 3T3MB 1OSZA 5HI5C 4P23B 1LE9A 4NO0B 4X9HA 1QKZL 5JW4M 1I9RL 4S1SH 1RZFL 1IKFH 1HXMA 4RSYA 4L0YA 5CEZH 3NIGE 1UZ8B 1EVTC 3W11D 2BSCA 5E70A 1FNEA 2DLFL 4JJ5A 4I3SH 2BIIA 1NCAH 4NGHH 4QPEA 5KVDH 3PQYB 1AQKL 1UQSB 1PEZA 2IBGA 2ZP8A 4X83A 1U30A 2J73A 2LR4A 4N2CA 5EU4B 1EAJA 4Y4HC 2P80D 1NUFA 3RIAF 4YLCA 2IDQA 1X4ZA 2KPWA 3IDMB 1S78C 1XWVA 1ZANL 3LIUA 4O2FA 3WJJA 5LXVA 2BO0A 3T3ME 3ATDA 1FL5A 1ZE3C 4Y88A 2ZOOA 3EFFB 2C3HA 2B08A 3RUGB 2CLZB 2ZSVB 4Y8AA 5B3JE 5C0RH 2HN7B 3O3BA 3HAEH 1OHZA 3GO1L 1RK0B 4IIZA 4OIIL 5CZVH 3GJFH 5AVUB 5JPNC 4FQJH 3RTQA 2CKBH 4JRFA 4QY8A 4RAVB 1MH5B 4BHUI 5T1KD 1TUPA 3KGTA 1Q0YL 2XPYA 1SM3H 2R2HB 4JRXA 2YGPA 2MQCA 4X4YB 1JF5A 1URZA 4JB9H 5DJZA 4OV5B 4ZJ9A 4L1DA 1DL7L 3CC1A 5D1QC 4QTFA 4H25A 2EUZA 1A64A 3VFGL 5FUZH 1GGTA 2WV3A 4Z3JA 2Z35A 3RWEA 3PNRB 4APQD 5JDSB 3HNVL 5F7AA 1E5BA 5GGVL 4O2EA 2FT7A 1DSWA 1S5IL 4F9LC 1BG1A 2NW3B 4M1CD 1G7QA 4AQZA 3AU1B 3GMOB 4IRJD 3QQDA 3QEUB 3K6SB 5FO9A 4G5AA 3U36A 4RZCB 2FQDA 3P73B 2BS71 2IMNA 2JKXA 2WK2A 5LNEA 2EH8H 5E03A 2DOCA 3LTVA 3QIWB 3RDTA 4NZDA 1WAAA 3IAGC 3MTXA 4GSXA 2MHAB 3QE5A 5IHZA 1JP5A 1RULH 1FJ1B 1ZLDA 3DGGA 2OYMA 3AITA 4PGEA 5I75C 2AAAA 4JUSA 3K81A 4Q9CA 5BRZA 5ILTH 4TQEL 3R8QA 4BUGA 1K8IA 1CYWA 4L37B 1WA1X 4PG9B 5FYKD 2B4CC 1CGSH 3DVGB 4FXTA 3A6CL 4MMYB 1LWHA 2VR4A 2YKLH 1Q9KB 1XF1A 1NBYA 2BFVL 4RGNC 4MSWB 3L3KB 4JFXB 5KSAC 1VFBA 3OX8A 4F27A 1TNNA 5BVPH 5A43C 3BI9X 3Q44A 1H5BC 3O8XA 5T3ZD 5EDSA 3QCTL 3OKKA 4P0DA 1NEPA 4PUBH 4PS3A 4XI5D 2W88A 1GHFH 3IT8D 3DJ9A 2ZX8A 3G6DH 1UT9A 3GSXB 4QUOA 1ZGLA 4LOVA 1NLDL 4KZEL 3EJRA 5I74B 1T0MA 4PMFA 4H0GA 1UTDA 1I3RB 4XCNA 5E8OB 4DZBB 1R5VB 2WYTA 3G5ZB 1DJGA 4NPYB 3NFNB 4MDIB 1LO5B 4W9DC 1RSYA 3SDXB 3FU9A 3ZTJH 3E38A 5F3HB 1NEZA 5KS9A 5FCUL 4OGXL 4R0LB 2A83B 1UH2A 5A3IC 5KSVB 4G6FB 4LHUD 4OY9A 1LGVA 2ZUSA 2BVEA 1IM9D 1BQHA 2PCPB 3QIBD 4NZUH 1HZKA 5B3NA 1C8QA 2CLZA 1K6QL 2Q7YA 1AXTL 1O7DE 2IXQA 3FO2B 5I6PA 3MYJB 3D2UB 2OCFD 4NQDD 3D4CA 3WNJA 5IV2B 3KVPA 3WAKA 2ITDA 3TNMA 2DLEA 5DK2B 1A9VA 4IOSA 1TPXC 4X7TA 1TJHL 1R0AL 5J1SC 4BK8A 4JFYB 3HC4H 5HYSG 4AEHL 4HALA 1LL1A 3CDYA 3VG9B 3F7YB 4KMLB 3I6GA 4I5BA 1CPUA 4HA1A 5B8CC 3QRGL 5EU4A 4IRJA 4XR8C 3IS0X 1E3FA 1B0IA 1NIBA 2PO6B 3VDBA 1SVZA 1YJDH 2VB5A 2G30A 5T3ZH 4LZKA 2J6EH 1OB1A 3W39B 4IMLB 4X6DB 3TJHD 4E41A 1YNLH 2O72A 3KEHA 5INDA 1ZSDA