3EF5A

Structure of the rna pyrophosphohydrolase bdrpph in complex with dgtp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
132
structure length
132
Chain Sequence
HWIPVVAGFLRKDGKILVGQRPENNSLAGQWEFPGGKIENGETPEEALARELNEELGIEAEVGELKLACTHSYGDVGILILFYEILYWKGEPRAKHHMMLEWIHPEELKHRNIPEANRKILHKIYKALGLEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable pyrophosphohydrolase
publication title Structure and Biological Function of the RNA Pyrophosphohydrolase BdRppH from Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus
molecule tags Hydrolase
total genus 33
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 3.6.1.-:
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14815 NUDIX_4 NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3ef5A00
1MR2A 3WHWA 3SMDA 5FSMA 1F3YA 2VNQA 5DDGA 3MDIA 3BM4A 3H95A 5LPGA 1PUSA 1MUTA 5ANTA 3Q4IA 3P5TA 5DEQA 3F6AA 5ANSA 4JZTA 2J8QA 3CNGA 3O8SA 1R67A 4N1TA 2DSDA 3X0RA 2KDWA 3EF5A 3X0LA 4S2VA 4C9XA 3GZ5A 5GHPA 2B0VA 2QJOA 3Q91A 1PUQA 2B2KA 5GHIA 1VHGA 4JZVA 3FK9A 5FSIA 5ISYA 2FKBA 1XSAA 1X84A 2PNYA 4K6EA 1VRLA 5FSOA 1V8NA 2GT4A 2YYHA 3A6SA 3EEUA 1V8VA 3OGAA 3U53A 1K2EA 1VIQA 1VIUA 2FVVA 2I6KA 3BHOA 3O69A 3X0PA 2O5FA 3ACAA 2VNPA 3I7VA 5C8LA 2A8QA 2JVBA 1V8MA 1OW2A 3SONA 3X0MA 4HVYA 2A8TA 5ANVA 5BONA 3SHDA 1XSBA 2AZWA 4S2XA 3O61A 3F13A 4YPRA 4C9WA 4NFWA 3MGMA 1PPXA 2I8TA 2XSQA 2DUKA 4NFXA 4KG3A 1HX3A 1RYAA 3FCMA 2RRKA 5IW5A 3HHJA 1PUNA 1Q33A 5DPKA 1IRYA 3GG6A 1G9QA 1X83A 1JKNA 1V8TA 3X0JA 1NFZA 3EXQA 4ICKA 1SJYA 5I8UA 1PVFA 2A8PA 5FSNA 5C7QA 1KTGA 5C7TA 2A8SA 3O52A 2GB5A 3Q1PA 4S2WA 5CFJA 3X0IA 1V8IA 2GT2A 1G0SA 3DUPA 2O1CA 3E57A 5GHOA 1RRSA 2DSCA 5GHQA 1MQWA 3I9XA 3A6UA 1KT9A 1NQYA 1VHZA 3FJYA 4JZSA 2W4EA 1MQEA 2A8RA 1V8UA 3ZR0A 1V8YA 1MP2A 5GHNA 3HYQA 3G0QA 3O6ZA 5ANWA 4DYWA 1PPVA 1PPWA 2DSBA 2O5WA 5FSKA 2YVNA 4KYXA 5GHMA 1GA7A 2DHOA 5DD4A 3X0KA 1SZ3A 4MPOA 4S2YA 2Q9PA 3ID9A 3Q2SA 3QSJA 5HZXA 5BS6A 3AC9A 3N77A 3GRNA 2QKMB 3A6TA 4ILQA 3P6YA 5IW4A 2YVMA 2B06A 4ZG0A 2QJTA 3L85A 1V8WA 3X0NA 1Q27A 3A6VA 4YOQA 1SOIA 2A6TA 3GZ6A 1VC9A 3R03A 3MDGA 4JZUA 3X0SA 1V8SA 3I7UA 4V14A 1MK1A 1SU2A 3EESA 4KTBA 4KG4A 2ICJA 1V8LA 4YPHA 2R5WA 1XSCA 3GZ8A 1VCDA 2I8UA 1I9AA 1VK6A 2PQVA 5GHJA 1TUMA 1K26A 3ZR1A 5CFIA 2KDVA 3KVHA 3X0QA 3X0OA 3BAPA 1NQZA 2G74A 5FSLA 2YVOA 3GWYA 3FFUA 3RH7A 3J7Ye 3DKUA 1X51A 1JRKA 3FSPA 1HZTA 3Q2TA 3MCFA 1QVJA 2FMLA 2ICKA 1NFSA 3N9UA 1U20A 2G73A 4IJXA 2CL3A 1KHZA 2YVPA 3COUA 3Q93A 5ANUA 4HFQA 1Q54A 1VC8A 1RRQA 1V8RA 4N1UA
chains in the Genus database with same CATH superfamily
1MR2A 3WHWA 3SMDA 5FSMA 1F3YA 2VNQA 5DDGA 3MDIA 3BM4A 3H95A 5LPGA 1PUSA 1MUTA 5ANTA 3Q4IA 3P5TA 5DEQA 3F6AA 5ANSA 4JZTA 2J8QA 3CNGA 3O8SA 1R67A 4N1TA 2DSDA 3X0RA 2KDWA 3EF5A 3X0LA 4S2VA 4C9XA 3GZ5A 5GHPA 2B0VA 2QJOA 3Q91A 1PUQA 2B2KA 5GHIA 1VHGA 4JZVA 3FK9A 5FSIA 5ISYA 2FKBA 1XSAA 1X84A 2PNYA 4K6EA 1VRLA 5FSOA 1V8NA 2GT4A 4J7GA 2YYHA 3A6SA 3EEUA 1V8VA 3OGAA 3U53A 1K2EA 1VIQA 1VIUA 2FVVA 2I6KA 3BHOA 3O69A 3X0PA 2O5FA 3ACAA 2VNPA 3I7VA 5C8LA 2A8QA 2JVBA 1V8MA 1OW2A 3SONA 3X0MA 4HVYA 2A8TA 5ANVA 5BONA 3SHDA 1XSBA 2AZWA 4S2XA 3O61A 3F13A 4YPRA 4C9WA 4NFWA 3MGMA 1PPXA 2I8TA 2XSQA 2DUKA 4NFXA 4KG3A 1HX3A 1RYAA 3FCMA 2RRKA 5IW5A 3HHJA 1PUNA 1Q33A 5DPKA 1IRYA 3GG6A 1G9QA 1X83A 1JKNA 1V8TA 3X0JA 1NFZA 3EXQA 4ICKA 1SJYA 5I8UA 1PVFA 2A8PA 5FSNA 4J7HA 5C7QA 1KTGA 5C7TA 2A8SA 3O52A 2CZRA 2GB5A 3Q1PA 4S2WA 5CFJA 3X0IA 1V8IA 2GT2A 1G0SA 3DUPA 2O1CA 3E57A 5GHOA 1RRSA 2DSCA 5GHQA 1MQWA 3I9XA 3A6UA 1KT9A 1NQYA 1VHZA 3FJYA 4JZSA 2W4EA 1MQEA 2A8RA 1V8UA 3ZR0A 1V8YA 1MP2A 5GHNA 3HYQA 3G0QA 3O6ZA 5ANWA 4DYWA 1PPVA 1PPWA 2DSBA 2O5WA 5FSKA 2YVNA 4KYXA 5GHMA 1GA7A 2DHOA 5DD4A 3X0KA 1SZ3A 4MPOA 4S2YA 2Q9PA 3ID9A 3Q2SA 3QSJA 5HZXA 5BS6A 3AC9A 3N77A 3GRNA 2QKMB 3A6TA 4ILQA 3P6YA 5IW4A 2YVMA 2B06A 4ZG0A 2QJTA 3L85A 1V8WA 3X0NA 1Q27A 3A6VA 4YOQA 1SOIA 2A6TA 3GZ6A 1VC9A 3R03A 3MDGA 4JZUA 3X0SA 1V8SA 3I7UA 4V14A 1MK1A 1SU2A 3EESA 4KTBA 4KG4A 2ICJA 1V8LA 4YPHA 2R5WA 1XSCA 3GZ8A 1VCDA 2I8UA 1I9AA 1VK6A 2PQVA 5GHJA 1TUMA 1K26A 3ZR1A 5CFIA 2KDVA 3KVHA 3X0QA 3X0OA 3BAPA 1NQZA 2G74A 5FSLA 2YVOA 3GWYA 3FFUA 3RH7A 3J7Ye 3DKUA 1X51A 1JRKA 3FSPA 1HZTA 3Q2TA 3MCFA 1QVJA 2FMLA 2ICKA 1NFSA 3N9UA 1U20A 2G73A 4IJXA 2CL3A 1KHZA 2YVPA 3COUA 3Q93A 5ANUA 4HFQA 1Q54A 1VC8A 1RRQA 1V8RA 4N1UA
chains in the Genus database with same CATH topology
1MR2A 3WHWA 3SMDA 5FSMA 1F3YA 2VNQA 5DDGA 3MDIA 3BM4A 3H95A 5LPGA 1PUSA 1MUTA 5ANTA 3Q4IA 3P5TA 5DEQA 3F6AA 5ANSA 4JZTA 2J8QA 3CNGA 3O8SA 1R67A 4N1TA 2DSDA 3X0RA 2KDWA 3EF5A 3X0LA 4S2VA 4C9XA 3GZ5A 5GHPA 2B0VA 2QJOA 3Q91A 1PUQA 2B2KA 5GHIA 1VHGA 4JZVA 3FK9A 5FSIA 5ISYA 2FKBA 1XSAA 1X84A 2PNYA 4K6EA 1VRLA 5FSOA 1V8NA 2GT4A 4J7GA 2YYHA 3A6SA 3EEUA 1V8VA 3OGAA 3U53A 1K2EA 1VIQA 1VIUA 2FVVA 2I6KA 3BHOA 3O69A 3X0PA 2O5FA 3ACAA 2VNPA 3I7VA 5C8LA 2A8QA 2JVBA 1V8MA 1OW2A 3SONA 3X0MA 4HVYA 2A8TA 5ANVA 5BONA 3SHDA 1XSBA 2AZWA 4S2XA 3O61A 3F13A 4YPRA 4C9WA 4NFWA 3MGMA 1PPXA 2I8TA 2XSQA 2DUKA 4NFXA 4KG3A 1HX3A 1RYAA 3FCMA 2RRKA 5IW5A 3HHJA 1PUNA 1Q33A 5DPKA 1IRYA 3GG6A 1G9QA 1X83A 1JKNA 1V8TA 3X0JA 1NFZA 3EXQA 4ICKA 1SJYA 5I8UA 1PVFA 2A8PA 5FSNA 4J7HA 5C7QA 1KTGA 5C7TA 2A8SA 3O52A 2CZRA 2GB5A 3Q1PA 4S2WA 5CFJA 3X0IA 1V8IA 2GT2A 1G0SA 3DUPA 2O1CA 3E57A 5GHOA 1RRSA 2DSCA 5GHQA 1MQWA 3I9XA 3A6UA 1KT9A 1NQYA 1VHZA 3FJYA 4JZSA 2W4EA 1MQEA 2A8RA 1V8UA 3ZR0A 1V8YA 1MP2A 5GHNA 3HYQA 3G0QA 3O6ZA 5ANWA 4DYWA 1PPVA 1PPWA 2DSBA 2O5WA 5FSKA 2YVNA 4KYXA 5GHMA 1GA7A 2DHOA 5DD4A 3X0KA 1SZ3A 4MPOA 4S2YA 2Q9PA 3ID9A 3Q2SA 3QSJA 5HZXA 5BS6A 3AC9A 3N77A 3GRNA 2QKMB 3A6TA 4ILQA 3P6YA 5IW4A 2YVMA 2B06A 4ZG0A 2QJTA 3L85A 1V8WA 3X0NA 1Q27A 3A6VA 4YOQA 1SOIA 2A6TA 3GZ6A 1VC9A 3R03A 3MDGA 4JZUA 3X0SA 1V8SA 3I7UA 4V14A 1MK1A 1SU2A 3EESA 4KTBA 4KG4A 2ICJA 1V8LA 4YPHA 2R5WA 1XSCA 3GZ8A 1VCDA 2I8UA 1I9AA 1VK6A 2PQVA 5GHJA 1TUMA 1K26A 3ZR1A 5CFIA 2KDVA 3KVHA 3X0QA 3X0OA 3BAPA 1NQZA 2G74A 5FSLA 2YVOA 3GWYA 3FFUA 3RH7A 3J7Ye 3DKUA 1X51A 1JRKA 3FSPA 1HZTA 3Q2TA 3MCFA 1QVJA 2FMLA 2ICKA 1NFSA 3N9UA 1U20A 2G73A 4IJXA 2CL3A 1KHZA 2YVPA 3COUA 3Q93A 5ANUA 4HFQA 1Q54A 1VC8A 1RRQA 1V8RA 4N1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MR2 A;  3WHW A;  3SMD A;  5FSM A;  1F3Y A;  2VNQ A;  5DDG A;  3MDI A;  3BM4 A;  3H95 A;  5LPG A;  1PUS A;  1MUT A;  5ANT A;  3Q4I A;  3P5T A;  5DEQ A;  3F6A A;  5ANS A;  4JZT A;  2J8Q A;  3CNG A;  3O8S A;  1R67 A;  4N1T A;  2DSD A;  3X0R A;  2KDW A;  3EF5 A;  3X0L A;  4S2V A;  4C9X A;  3GZ5 A;  5GHP A;  2B0V A;  2QJO A;  3Q91 A;  1PUQ A;  2B2K A;  5GHI A;  1VHG A;  4JZV A;  3FK9 A;  5FSI A;  5ISY A;  2FKB A;  1XSA A;  1X84 A;  2PNY A;  4K6E A;  1VRL A;  5FSO A;  1V8N A;  2GT4 A;  2YYH A;  3A6S A;  3EEU A;  1V8V A;  3OGA A;  3U53 A;  1K2E A;  1VIQ A;  1VIU A;  2FVV A;  2I6K A;  3BHO A;  3O69 A;  3X0P A;  2O5F A;  3ACA A;  2VNP A;  3I7V A;  5C8L A;  2A8Q A;  2JVB A;  1V8M A;  1OW2 A;  3SON A;  3X0M A;  4HVY A;  2A8T A;  5ANV A;  5BON A;  3SHD A;  1XSB A;  2AZW A;  4S2X A;  3O61 A;  3F13 A;  4YPR A;  4C9W A;  4NFW A;  3MGM A;  1PPX A;  2I8T A;  2XSQ A;  2DUK A;  4NFX A;  4KG3 A;  1HX3 A;  1RYA A;  3FCM A;  2RRK A;  5IW5 A;  3HHJ A;  1PUN A;  1Q33 A;  5DPK A;  1IRY A;  3GG6 A;  1G9Q A;  1X83 A;  1JKN A;  1V8T A;  3X0J A;  1NFZ A;  3EXQ A;  4ICK A;  1SJY A;  5I8U A;  1PVF A;  2A8P A;  5FSN A;  5C7Q A;  1KTG A;  5C7T A;  2A8S A;  3O52 A;  2GB5 A;  3Q1P A;  4S2W A;  5CFJ A;  3X0I A;  1V8I A;  2GT2 A;  1G0S A;  3DUP A;  2O1C A;  3E57 A;  5GHO A;  1RRS A;  2DSC A;  5GHQ A;  1MQW A;  3I9X A;  3A6U A;  1KT9 A;  1NQY A;  1VHZ A;  3FJY A;  4JZS A;  2W4E A;  1MQE A;  2A8R A;  1V8U A;  3ZR0 A;  1V8Y A;  1MP2 A;  5GHN A;  3HYQ A;  3G0Q A;  3O6Z A;  5ANW A;  4DYW A;  1PPV A;  1PPW A;  2DSB A;  2O5W A;  5FSK A;  2YVN A;  4KYX A;  5GHM A;  1GA7 A;  2DHO A;  5DD4 A;  3X0K A;  1SZ3 A;  4MPO A;  4S2Y A;  2Q9P A;  3ID9 A;  3Q2S A;  3QSJ A;  5HZX A;  5BS6 A;  3AC9 A;  3N77 A;  3GRN A;  2QKM B;  3A6T A;  4ILQ A;  3P6Y A;  5IW4 A;  2YVM A;  2B06 A;  4ZG0 A;  2QJT A;  3L85 A;  1V8W A;  3X0N A;  1Q27 A;  3A6V A;  4YOQ A;  1SOI A;  2A6T A;  3GZ6 A;  1VC9 A;  3R03 A;  3MDG A;  4JZU A;  3X0S A;  1V8S A;  3I7U A;  4V14 A;  1MK1 A;  1SU2 A;  3EES A;  4KTB A;  4KG4 A;  2ICJ A;  1V8L A;  4YPH A;  2R5W A;  1XSC A;  3GZ8 A;  1VCD A;  2I8U A;  1I9A A;  1VK6 A;  2PQV A;  5GHJ A;  1TUM A;  1K26 A;  3ZR1 A;  5CFI A;  2KDV A;  3KVH A;  3X0Q A;  3X0O A;  3BAP A;  1NQZ A;  2G74 A;  5FSL A;  2YVO A;  3GWY A;  3FFU A;  3RH7 A;  3J7Y e;  3DKU A;  1X51 A;  1JRK A;  3FSP A;  1HZT A;  3Q2T A;  3MCF A;  1QVJ A;  2FML A;  2ICK A;  1NFS A;  3N9U A;  1U20 A;  2G73 A;  4IJX A;  2CL3 A;  1KHZ A;  2YVP A;  3COU A;  3Q93 A;  5ANU A;  4HFQ A;  1Q54 A;  1VC8 A;  1RRQ A;  1V8R A;  4N1U A; 
#chains in the Genus database with same CATH topology
 1MR2 A;  3WHW A;  3SMD A;  5FSM A;  1F3Y A;  2VNQ A;  5DDG A;  3MDI A;  3BM4 A;  3H95 A;  5LPG A;  1PUS A;  1MUT A;  5ANT A;  3Q4I A;  3P5T A;  5DEQ A;  3F6A A;  5ANS A;  4JZT A;  2J8Q A;  3CNG A;  3O8S A;  1R67 A;  4N1T A;  2DSD A;  3X0R A;  2KDW A;  3EF5 A;  3X0L A;  4S2V A;  4C9X A;  3GZ5 A;  5GHP A;  2B0V A;  2QJO A;  3Q91 A;  1PUQ A;  2B2K A;  5GHI A;  1VHG A;  4JZV A;  3FK9 A;  5FSI A;  5ISY A;  2FKB A;  1XSA A;  1X84 A;  2PNY A;  4K6E A;  1VRL A;  5FSO A;  1V8N A;  2GT4 A;  4J7G A;  2YYH A;  3A6S A;  3EEU A;  1V8V A;  3OGA A;  3U53 A;  1K2E A;  1VIQ A;  1VIU A;  2FVV A;  2I6K A;  3BHO A;  3O69 A;  3X0P A;  2O5F A;  3ACA A;  2VNP A;  3I7V A;  5C8L A;  2A8Q A;  2JVB A;  1V8M A;  1OW2 A;  3SON A;  3X0M A;  4HVY A;  2A8T A;  5ANV A;  5BON A;  3SHD A;  1XSB A;  2AZW A;  4S2X A;  3O61 A;  3F13 A;  4YPR A;  4C9W A;  4NFW A;  3MGM A;  1PPX A;  2I8T A;  2XSQ A;  2DUK A;  4NFX A;  4KG3 A;  1HX3 A;  1RYA A;  3FCM A;  2RRK A;  5IW5 A;  3HHJ A;  1PUN A;  1Q33 A;  5DPK A;  1IRY A;  3GG6 A;  1G9Q A;  1X83 A;  1JKN A;  1V8T A;  3X0J A;  1NFZ A;  3EXQ A;  4ICK A;  1SJY A;  5I8U A;  1PVF A;  2A8P A;  5FSN A;  4J7H A;  5C7Q A;  1KTG A;  5C7T A;  2A8S A;  3O52 A;  2CZR A;  2GB5 A;  3Q1P A;  4S2W A;  5CFJ A;  3X0I A;  1V8I A;  2GT2 A;  1G0S A;  3DUP A;  2O1C A;  3E57 A;  5GHO A;  1RRS A;  2DSC A;  5GHQ A;  1MQW A;  3I9X A;  3A6U A;  1KT9 A;  1NQY A;  1VHZ A;  3FJY A;  4JZS A;  2W4E A;  1MQE A;  2A8R A;  1V8U A;  3ZR0 A;  1V8Y A;  1MP2 A;  5GHN A;  3HYQ A;  3G0Q A;  3O6Z A;  5ANW A;  4DYW A;  1PPV A;  1PPW A;  2DSB A;  2O5W A;  5FSK A;  2YVN A;  4KYX A;  5GHM A;  1GA7 A;  2DHO A;  5DD4 A;  3X0K A;  1SZ3 A;  4MPO A;  4S2Y A;  2Q9P A;  3ID9 A;  3Q2S A;  3QSJ A;  5HZX A;  5BS6 A;  3AC9 A;  3N77 A;  3GRN A;  2QKM B;  3A6T A;  4ILQ A;  3P6Y A;  5IW4 A;  2YVM A;  2B06 A;  4ZG0 A;  2QJT A;  3L85 A;  1V8W A;  3X0N A;  1Q27 A;  3A6V A;  4YOQ A;  1SOI A;  2A6T A;  3GZ6 A;  1VC9 A;  3R03 A;  3MDG A;  4JZU A;  3X0S A;  1V8S A;  3I7U A;  4V14 A;  1MK1 A;  1SU2 A;  3EES A;  4KTB A;  4KG4 A;  2ICJ A;  1V8L A;  4YPH A;  2R5W A;  1XSC A;  3GZ8 A;  1VCD A;  2I8U A;  1I9A A;  1VK6 A;  2PQV A;  5GHJ A;  1TUM A;  1K26 A;  3ZR1 A;  5CFI A;  2KDV A;  3KVH A;  3X0Q A;  3X0O A;  3BAP A;  1NQZ A;  2G74 A;  5FSL A;  2YVO A;  3GWY A;  3FFU A;  3RH7 A;  3J7Y e;  3DKU A;  1X51 A;  1JRK A;  3FSP A;  1HZT A;  3Q2T A;  3MCF A;  1QVJ A;  2FML A;  2ICK A;  1NFS A;  3N9U A;  1U20 A;  2G73 A;  4IJX A;  2CL3 A;  1KHZ A;  2YVP A;  3COU A;  3Q93 A;  5ANU A;  4HFQ A;  1Q54 A;  1VC8 A;  1RRQ A;  1V8R A;  4N1U A; 
#chains in the Genus database with same CATH homology
 1MR2 A;  3WHW A;  3SMD A;  5FSM A;  1F3Y A;  2VNQ A;  5DDG A;  3MDI A;  3BM4 A;  3H95 A;  5LPG A;  1PUS A;  1MUT A;  5ANT A;  3Q4I A;  3P5T A;  5DEQ A;  3F6A A;  5ANS A;  4JZT A;  2J8Q A;  3CNG A;  3O8S A;  1R67 A;  4N1T A;  2DSD A;  3X0R A;  2KDW A;  3EF5 A;  3X0L A;  4S2V A;  4C9X A;  3GZ5 A;  5GHP A;  2B0V A;  2QJO A;  3Q91 A;  1PUQ A;  2B2K A;  5GHI A;  1VHG A;  4JZV A;  3FK9 A;  5FSI A;  5ISY A;  2FKB A;  1XSA A;  1X84 A;  2PNY A;  4K6E A;  1VRL A;  5FSO A;  1V8N A;  2GT4 A;  4J7G A;  2YYH A;  3A6S A;  3EEU A;  1V8V A;  3OGA A;  3U53 A;  1K2E A;  1VIQ A;  1VIU A;  2FVV A;  2I6K A;  3BHO A;  3O69 A;  3X0P A;  2O5F A;  3ACA A;  2VNP A;  3I7V A;  5C8L A;  2A8Q A;  2JVB A;  1V8M A;  1OW2 A;  3SON A;  3X0M A;  4HVY A;  2A8T A;  5ANV A;  5BON A;  3SHD A;  1XSB A;  2AZW A;  4S2X A;  3O61 A;  3F13 A;  4YPR A;  4C9W A;  4NFW A;  3MGM A;  1PPX A;  2I8T A;  2XSQ A;  2DUK A;  4NFX A;  4KG3 A;  1HX3 A;  1RYA A;  3FCM A;  2RRK A;  5IW5 A;  3HHJ A;  1PUN A;  1Q33 A;  5DPK A;  1IRY A;  3GG6 A;  1G9Q A;  1X83 A;  1JKN A;  1V8T A;  3X0J A;  1NFZ A;  3EXQ A;  4ICK A;  1SJY A;  5I8U A;  1PVF A;  2A8P A;  5FSN A;  4J7H A;  5C7Q A;  1KTG A;  5C7T A;  2A8S A;  3O52 A;  2CZR A;  2GB5 A;  3Q1P A;  4S2W A;  5CFJ A;  3X0I A;  1V8I A;  2GT2 A;  1G0S A;  3DUP A;  2O1C A;  3E57 A;  5GHO A;  1RRS A;  2DSC A;  5GHQ A;  1MQW A;  3I9X A;  3A6U A;  1KT9 A;  1NQY A;  1VHZ A;  3FJY A;  4JZS A;  2W4E A;  1MQE A;  2A8R A;  1V8U A;  3ZR0 A;  1V8Y A;  1MP2 A;  5GHN A;  3HYQ A;  3G0Q A;  3O6Z A;  5ANW A;  4DYW A;  1PPV A;  1PPW A;  2DSB A;  2O5W A;  5FSK A;  2YVN A;  4KYX A;  5GHM A;  1GA7 A;  2DHO A;  5DD4 A;  3X0K A;  1SZ3 A;  4MPO A;  4S2Y A;  2Q9P A;  3ID9 A;  3Q2S A;  3QSJ A;  5HZX A;  5BS6 A;  3AC9 A;  3N77 A;  3GRN A;  2QKM B;  3A6T A;  4ILQ A;  3P6Y A;  5IW4 A;  2YVM A;  2B06 A;  4ZG0 A;  2QJT A;  3L85 A;  1V8W A;  3X0N A;  1Q27 A;  3A6V A;  4YOQ A;  1SOI A;  2A6T A;  3GZ6 A;  1VC9 A;  3R03 A;  3MDG A;  4JZU A;  3X0S A;  1V8S A;  3I7U A;  4V14 A;  1MK1 A;  1SU2 A;  3EES A;  4KTB A;  4KG4 A;  2ICJ A;  1V8L A;  4YPH A;  2R5W A;  1XSC A;  3GZ8 A;  1VCD A;  2I8U A;  1I9A A;  1VK6 A;  2PQV A;  5GHJ A;  1TUM A;  1K26 A;  3ZR1 A;  5CFI A;  2KDV A;  3KVH A;  3X0Q A;  3X0O A;  3BAP A;  1NQZ A;  2G74 A;  5FSL A;  2YVO A;  3GWY A;  3FFU A;  3RH7 A;  3J7Y e;  3DKU A;  1X51 A;  1JRK A;  3FSP A;  1HZT A;  3Q2T A;  3MCF A;  1QVJ A;  2FML A;  2ICK A;  1NFS A;  3N9U A;  1U20 A;  2G73 A;  4IJX A;  2CL3 A;  1KHZ A;  2YVP A;  3COU A;  3Q93 A;  5ANU A;  4HFQ A;  1Q54 A;  1VC8 A;  1RRQ A;  1V8R A;  4N1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...