3EF7A

Zp-n domain of mammalian sperm receptor zp3 (crystal form iii)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
480
structure length
467
Chain Sequence
MKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDRVEVPIECRYPRLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Cell adhesion
molecule keywords Maltose-binding periplasmic protein, LINKER, Zona pellucida
total genus 136
structure length 467
sequence length 480
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ef7A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ef7A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ef7A01
3KEIA 5FHNA 4DLDA 2DWAA 3CFXA 3OO6A 4U2RA 3ZKKA 3S9LC 3NK3A 2OK2A 2WKYA 3TQWA 3TPAA 1DTGA 3FV1A 3PPRA 2RF1A 3IOWA 4I62A 3FVNA 2QSXA 1PBPA 2YLNA 5EHSA 1P1NA 4F1UA 4LP2B 3R6UA 4PETA 4GXAA 4IO3A 5CM6A 1HSLA 4YB5A 1S7YA 2H98A 3TMGA 3PPPA 2AL4A 2F36A 1N0TA 3QUFA 4ZEIA 3UP9A 4LA9A 4IGTA 4IO2A 1QKAA 2OZZA 1L5TA 4GL0A 2OJTA 1BKAA 4P11A 3RT6B 1M5DA 4OVJA 1EU8A 3C35A 5K2YA 3TCHA 3UA8A 2YJPA 4GWOA 1JQFA 5HBCA 1UQWA 4ELOA 3UN6A 4F3BA 4WEPA 4QFKA 2ZMBA 4RA1A 5I56B 1MQHA 2A5SA 2DS9A 3S2VA 5AA2D 1TT1A 3FJGA 2IA4A 3BFUA 2UYFA 3HV1A 3T9VA 3D4CA 1B52A 1O63A 1SI0A 3FXUA 1SW2A 3FATA 2HQ0A 3MAMA 1GVCA 2XXHA 2F7CA 3ECRA 4YAHX 1SYHA 3GBBA 3IK6B 4WKMA 3T93B 1H45A 4BDOA 2GFEA 1FTOA 2X7PA 3FUZA 4OENA 1Y3NA 3PPQA 4F3PA 5EYFA 1B3GA 1GR2A 5ICQA 3F11A 5CMMA 1NL5A 2X7QA 1P1UA 1IUDA 2CZLA 3OXNA 5A5XA 2HEUA 3SKPA 2YPNA 4EDPA 2HAVA 2Z8FA 4HTGA 2LAOA 4YKIA 3N26A 3U8QA 4ESXA 2O6AA 4F2QA 5JEIA 3R26A 2P1SA 4M1VA 1MDQA 4G68C 4ONYA 3UK4A 2FA7A 4NF5A 4H8IA 3FVGA 1UTHA 4JWYA 3PUZE 3TTMA 4DXBA 4MLQA 4F31B 2OWTA 2ZNTA 1IIWA 1FQCA 1MQJA 3KSXA 1IZ1A 3O29A 4IY6A 1T0KA 2P0SA 3C9HA 1XS5A 4GF8A 1Q1KA 1XC1A 1IQ7A 3E3KA 3QK6A 4ISUA 3M8UA 5TP9A 2ZYNA 3TTRA 4DZ1A 2I48A 2R6GE 4Z7EA 5I2NB 5ISUA 3OMBA 1Q35A 2DOJA 3LSFB 2OWSA 2DWIA 1B58A 2XXRA 1CB6A 1PB7A 4OETA 3QSLA 3V5AA 4BDRA 3FV2A 1USYH 5AA1A 1B1HA 3WAEA 5AA2A 5KCJA 2GHBA 2O51A 3MVWA 5EHMA 5H8SA 4BDNA 3T9HB 1Y1ZA 4F22A 3TQLA 3VLVA 3TUSA 4MFIA 3VV5A 1P99A 3IOVA 4O3AA 1H3DA 3CI8A 2DWJA 2A5TB 3ODBA 1IXGA 3T9UA 4QFLA 3TODA 3BBRA 1US5A 1A8FA 4LATA 4NF6A 3H6WA 1PDAA 1OLAA 5CC2A 1WVJA 2I4BA 4ZZAA 2D21A 1FW0A 2H9BA 3CRBA 3PU5A 4OFLA 5H8QA 4EQ7A 4OYVA 1USYE 3FIRA 3SDFA 2RCBA 3HPIA 3L6HA 2HCAA 2B65A 2DWHA 3JYRA 4FEDA 2DQVA 2B3BA 3BKIB 3ILTB 3N5LA 5CMCA 3MP8A 1N84A 2VP1A 4G8HA 1XVYA 4HW8A 2NWJA 5JK4A 3IOTA 1XVXA 3QIMA 3OOAA 4JDFA 1IXCA 2I6EA 4U21A 4EXKA 5M2VA 1H76A 2RKMA 3TTLA 1VE4A 3B6QA 3MPLA 4NF4B 1AL3A 2Q8JA 4F1VA 3TCGA 2D3IA 2XXVA 1TXFA 2AIXA 1LFHA 4QFOA 3C31A 1MPBA 1P1WA 2HXWA 1GGGA 3EHSA 3W9WA 4DXUA 5DEXA 3H6UA 1A8EA 4QSDA 3KZGA 3D4GA 3K1MA 3Q26A 4BLAA 3Q28A 3CSBA 3MPKA 3SESA 2Z8EA 4IO6A 4XKQA 2PVUA 5CBRA 4U4XA 3MZBA 1I69A 4BDLA 2F97A 1URGA 2HAUA 2XD2A 4P0IA 3VE1B 1RYOA 2VGQA 2V3QA 3N94A 1XHYA 4G4PA 4PE5B 2I3VA 3V8XB 1PC3A 2F7AA 4LZ8A 2UYEA 3H03A 4OEUA 4ZEBA 5CMKA 1FTMA 3O6GA 4XTCQ 1B46A 5I57B 4LQ2A 2ZYOA 3IJXB 5DEXB 4KYEA 3VLUA 3CSGA 3G3FA 2O69A 2G29A 2NUVA 2REJA 3SERA 1Y1MA 4KR5A 1MXYA 3H3GA 3M3LA 3IR1A 4UA8A 5DYHA 4FEBA 5F1QA 4N6PA 2B3FA 1POTA 2XX9A 1TFAA 3MVXA 1P1OA 1HSEA 4HS7A 4KPTA 1B5IA 5I56A 2XXQA 3CFLA 4XXUA 3KJ7A 3UORA 2XXPA 3E4RA 2R9JA 2XXYA 4G68B 3OD7A 1B3EA 5L9OA 4PP0A 3C4MA 1SBPA 2V25A 1S50A 4NF8A 2FYIA 3H4ZA 4ZS9A 1GV8A 4AB5A 1JEUA 1TWYA 1MH4A 1PEBA 1FCKA 2Q2AA 1MQGA 2XX8A 3C36A 2IEEA 2UVGA 1M5BA 3EN3A 4GVOA 4NMYA 1N3XA 2ONKE 1NNFA 1O64A 3FXRA 1B9JA 1JW4A 3G7WA 3G3JA 3KG2A 5KDTA 4M4GA 3TKDA 2OLBA 4FORA 3VVEA 1QW0A 3MVYA 3PV0E 1LB9A 1R9LA 1ZMGA 3FJ7A 1R6ZA 3C33A 3IB0A 1B3FA 5CMBA 5L8DA 1B0HA 2I4CA 3K00A 3MBPA 2GRVA 3LSXA 4KCCA 4PQJA 5DTBA 3KN7A 1MPDA 4PFYA 3ONMA 4YB6A 1LFGA 1A99A 1BLFA 1M5EA 1D4NA 1SDXA 2ZYKA 4NE4A 4OWDA 3SEVA 1POY1 4I8CA 4R9FA 1ZU0A 3OEMA 4ZE8A 5ICTA 1LAXA 3KGCA 5I59B 1LSTA 2KLFA 3OO9A 4NWCA 2O84X 2H5YA 4Q8RA 3MP1A 5DVIA 1SW5A 3K6UA 1B7ZA 1LB8A 1EH3A 1GTKA 1JEVA 1B2HA 3HHFA 1AMFA 1SYIA 4KYSA 4YMBA 4RK2A 3B7DA 4G8NA 3FXQA 2Q9TA 1B32A 1S9TA 2P2AA 2UVIA 3QYTA 4QSCA 2DE4A 1SQYA 2PMSA 5I2KB 3K2DA 5FHMA 5H8FA 2UXAA 4LQ5A 5AA2B 4GD5A 4E0XA 1OVTA 3MZ9A 1VSOA 1DPEA 3CIJA 2I3WA 3G3KA 3K1PA 1YCJA 1JVYA 3KOTA 3PGFA 1VFDA 4ELRA 5I58B 5I59A 5HPQA 3FASA 3RT8A 4F3GA 4QRZA 4ZEKA 5ITPA 4H8JA 1YTVA 2XHDA 4KQPA 2Z23A 2DXRA 4YKPA 2F35A 3TTNA 4OERA 2D5WA 5H8NB 2FNCA 2Y7IA 1Y3PA 4U4SA 3S4UA 1FQFA 1B6HA 2VD3A 3TCFA 1URDA 1MH3A 3E13X 3FJMA 3O6IA 1LFIA 4IO4A 1MY0A 3K6WA 3PMXA 4G2ZA 3RNNA 4R75A 1EZOA 3LSWA 3HHGA 2THIA 1ZKBA 4JB7A 2GH9A 1MXWA 1ZTYA 4YICA 3QUJA 4JBZA 2O1LA 4DIGA 5DVFA 2HFBA 1SI1A 3TDJA 1P1QA 2F8DA 3MP6A 2DP8A 3RUMA 3KN3A 4FIMA 4DCYA 4R9GA 1NNKA 2ESNA 1FQDA 2DVCA 3IL1B 1SD3A 3G3IA 2QRYA 1I6AA 4EQ9A 4ESWA 3W15C 4R2FA 4GIZA 3QXMA 1OLCA 5H8HA 4ZEFA 2OCUA 2O1MA 3I5OA 1I6QA 1H44A 4KCDA 4R2BA 3U94A 1KWHA 3PPOA 3C32A 5AA3A 3G3GA 3KFMA 4U23A 3IJOB 3O9PA 1SW1A 4F18A 3N6TA 3CR9A 2XD3A 4OZ9A 2PT2A 2O7UA 1JETA 4NF5B 2Y7RA 5L9SA 4PFUA 4ECFA 1QUJA 4RJZA 1UTHB 2RCAA 1ATGA 3DLNA 4YZZA 3SEWA 3KOSA 4I9DA 4F1YA 2BJJX 1US4A 3CFZA 5I57A 2XXIA 4QFNA 5H8HB 1D9VA 3T22A 5IAIA 3K02A 3OO8A 4ZEDA 1BP5A 3GXAA 2O7IA 4OQOA 4FE8A 2F6PA 3O97A 1EZ9A 1PB9A 2DXYA 2NVUB 3MWBA 1ZBMA 1OVBA 2H25A 1B3LA 2GHAA 4GFRA 3S9NC 1MY4A 1B7HA 4X1BA 1QULA 1CE2A 4C1TA 1UTBB 1I6BA 1LAHE 3KBRA 4KI0E 4PFWA 2I49A 3PMVA 2QMWA 1YPNA 2ZNUA 4GXSB 4N07A 3H06B 3N6UA 2CMOA 1LLSA 3EPEA 3QAXA 5K2XA 1DOTA 1NNTA 3Q29A 3RQTA 1VFEA 1NFTA 3ZS6A 2E1SA 3TAJA 3S9EA 4JSDA 4THIA 3TFLA 1B5JA 3LSLA 1F9BA 1FTJA 2QMXA 4MLVA 1MM6A 1MY2A 2Y7WA 4Z0IA 3IB1A 3O28A 1B0LA 4N13A 5L9MA 3IX1A 1LBCA 1OQHA 4LZ7A 3HN0A 1JVXA 1MPCA 3TELA 2NXOA 3AXFA 2I0BA 1MDP1 1H43A 2DVZA 4U1ZA 2Z8DA 5ITOA 3RTWB 1A40A 2F6GA 3T9XB 4JWOA 2RC9A 2XXWA 3RLFE 3MZ1A 4QHQA 3OSQA 2X26A 4TQUQ 4WEDA 2F5XA 3OEKA 4NWDA 3U93A 1J1NA 4Q5TA 4F2OA 5I84A 4DE8A 2PT1A 2ZYMA 1EZPA 4TLLB 2RC7A 4IY5A 5KZTA 4HCWA 4FECA 1MY3A 1M5CA 3OELA 4EUOA 1NMUA 3LC8A 5J1DA 3FZVA 1ANFA 3TZAA 4O3BA 3O66A 4U22A 4F29A 4H1XA 1XOCA 5CI5A 4ZZEA 4I1DA 4OFOA 1FQAA 3SEUA 1B5HA 1DMBA 4HCYA 3SEXA 4YU0A 2I58A 4H6DA 4EF1A 3USDA 4NEDA 4R6KA 4IB2A 4POWA 1MQDA 3S9MC 2DE2A 1O7TA 3P7IA 1AH5A 3K4UA 4Q0CA 4RXLA 3W9VA 4BDQA 2H99A 5AA4B 2ONRA 4H65A 2ABHA 1LCTA 4JWXA 4EF2A 3PD8A 4GL8A 4ZECA 2AL5A 5KDTB 1OQGA 3H7MA 3RY3A 5CRYA 1SVXB 1MXVA 2Y7KA 3EHTA 3MQ9A 2UVHA 1MQIA 2ALUA 4RK9A 3TEPA 1JW5A 1RKMA 2I0CA 4RPNA 3MUQA 1IXHA 4QFPA 3M3KA 2Q88A 3PMWA 4EXLA 4NTLA 3EF7A 2G93A 3EQ1A 3U92A 3VVDA 3FD3A 1N04A 3HO7A 3RN8A 4H5GA 3K6VA 4ZDMA 2R71A 4AB6A 4YKJA 5AA4A 1SW4A 3PUWE 4IO7A 1ZJLA 4JXIA 1M5FA 3LUYA 4R74A 1B51A 4ZE9A 1N7WA 3A3CA 4OXVA 4OTEA 4XKPA 2RINA 3K1NA 4YKKA 1Y4CA 2ONSA 1AOVA 2VOZA 1MM7A 4U1OA 3K0VA 4E0WA 2F78A 4GRKA 2A5TA 3Q27A 3SEYA 1NH7A 4YB7A 3VVFA 3V89B 2DSFA 3KSJA 4X48A 5DVJA 4ND9A 3G3HA 2O68A 3R7XA 2H4IA 5IKBA 4GQOA 3KJTA 3MVZA 1B40A 1Y4TA 2XXTA 4AQ4A 4DCXA 4C0RA 1QJMA 3L6GA 5BUUA 4KYDA 2DYXA 3IOUA 4OHNA 4RPOA 3RPWA 3UIFA 5I58A 4G8MA 4ELQA 3HSTA 4GOTA 5CBSA 5FTHA 5I2NA 4OESA 1XT8A 2F7BA 1QUIA 4H5FA 5LOMA 3I6VA 1Z7NE 1TFDA 4OMBA 1NNPA 1D3KA 5H8NA 4EQBA 3MJNA 2QS3A 3K6XA 1R9QA 1Y9UA 3RTFB 3FGSA 4OEVA 2Z22A 3M3FA 4R73A 2HZKA 4H0WA 2VD2A 3VFJA 3T66A 3U1OA 3UGWA 4BDMA 1UIUA 1LAFE 2W7YA 1WDNA 4XKNA 1FTKA 5TPAB 1IITA 1R1NA 1VR5A 2V84A 4FJPA 4MH5A 4RNSA 5A5XB 3ZKLA 1D9YA 1LGBC 1OMPA 3H6VA 4MF3A 4JSOA 3LR1A 4R6HA 4XIGQ 2HZLA 1ZLQA 2XXUA 2XX7A 4KD5A 3HCQA 1N7XA 5B70A 1BIYA 2VHAA 1ELJA 2QS4A 3OENA 1ZIUA 3FVKA 3SETA 3PD9A 4XKRA 2E0SA 1UTBA 1DPPA 2V93A 4NF6B 1N76A 1N3WA 2V3UA 3CG3A 4LZ5A 5H8FB 4GLIA 4LUBA 3DM0A 4QSEA 3RGYA 5H8QB 3TYHA 5BWJA 3LBSA 3I3VA 3MW0A 4PFTA 2Q89A 1B05A 5TPAA 4MBPA 4F3SA 4Q30B 1Y20A 2Y84A 3A09A 5TP9B 3JZJA 2QL3A 3PUYE 3PPNA 3JV9A 3B6TA 3IAZA 4QF9A 4DDDA 3GLBA 2ANJA 3VXBA 3B6WA 1PBQA 3KN8A 1LBBA 1MRPA 1NH8A 2ZNSA 3IO4A 3GBAA 1JNFA 1MS7A 3DP6A 3NK4A 3OSRA 4L17A 3TTKA 3H6TA 1B1XA 1B4ZA 4KFQA 4F19A 2XXXA 2PYYA 5KCJB 3V83A 2QS2A 5JTYB 1B7UA 1MG1A 1OIBA 3IB2A 3O2AA 2QS1A 4RY1A 4TOZA 1LAGE 3CG1A 1MXZA 3GZGA 3ILUB 4LVQA 2V3TA 1IEJA 4NF8B 3O6HA 2M8CA 4R6YA 3DELB 3ZSFA 4O3CA 1DSNA 2Y7PA 1WODA 1A54A 4H67A 4FATA 1QVSA 1PB8A 4G77A 3VXCA 2AYSA 3PUXE 1UIVA 5FHOA 2QJEA 4IO5A 3CVGA 4RYAA 4YMAA 3DP4A 1AIVA 1B3HA 3PUVE 1BTJA 1NKXA 3IO6A 1QKBA 5TU0A 5F7VA 4C1UA 4TLMB 4ELPA 2QPQA 5AE4A 5JTYA 1JW1A 2ZXTA 4X9TA 5ELVA 4WXJA 3WAFA 4DXCA 1YAEA 3K01A 1Y3QA 1MXXA 3BFTA 3E9XA 1HSJA 2DE3A 3EHUA 1B4HA 1MY1A 1MXUA 3T96B 3A3UA 1A55A 2NOOA 5DT6A 3VLWA 5B7DA 4P0GA 1RYXA 4FAJA 4LONB 3DP8A 5HM4B 4NF4A 1URSA 2OBGA 1DTZA 4K3FA 1FQBA 3VDFA 4F39A 3MC2A 4X1DA 3FVOA 3IORA 1A7LA 1FQEA 3OO7A 4R72A 2F34A 3U72A 4IGRA 3C34A 1FTLA 4G68A 2PX1A 2Q2CA 3Q25A 4KHZE 1Z7ME 2PBWA 1II5A 1QUKA 2RC8A 4POXA 5FTIA 3THIA 2UVJA 1LCFA 4UACA 1IXIA 4OFJA 5I2KA 2REGA
chains in the Genus database with same CATH superfamily
3RHWF 4CMHC 3UAFA 2WQ8A 5GZOA 3TPAA 3C6SA 3T5WA 5ITFB 1AFVH 1O75A 2X6AA 2AK1H 3GI8H 4XP5H 4LP2B 1IFRA 1XD1A 1H15B 2PABA 3NEXA 3C60B 4PJFB 4N0FA 1EUTA 2OR9H 3B6SA 4LCYA 4XMLL 3CFNA 1E7UA 4YUEL 2OZZA 3QZBA 4M1DL 4H1LH 4AW7A 1MCPL 5E24E 1KJ2A 1XSJA 3C35A 1AO7A 1T7YA 1QP1A 2HMIC 2HN7B 3IM1A 5DWPA 3X13B 4DPBX 1YNTF 1BEXA 3S2VA 2G3XA 5AA2D 4N8VG 3BWSA 3O9WC 3DV6B 3QULB 5TE6L 5AL0A 4DUVA 2CPUA 1DVZA 2EJ1A 5FDWB 4WHYG 4Y5XA 2C9XA 3U7WL 3MBEC 2EDEA 4JHWH 5LB1A 3E9UA 5D71H 2ZCKH 3RHWK 4OENA 2YD5A 2XWJA 5KJRH 2BIMA 1MI5E 2FSDA 2J55A 3UACA 5IOPB 2Y0SA 4NC0B 4U3XA 5JIKA 4QAWA 5I9QC 1NL5A 1O9WA 2IQ9L 3OXNA 3BGFB 4PDDA 5CBEA 5MERA 5EZIL 3SD2A 3EFDL 1UFUA 1UXWA 2EIZB 1UYWL 2VZSA 1DN0B 3DJSA 2LABA 5D5MB 4GJTB 1IBGH 1D5XA 4HU2A 1OF2B 2F54D 2NOYA 4LHUG 2Z8WC 3ZTDC 1NFDE 4KJYB 4YNYA 4OAWB 1SYSA 4PRAA 4AVJA 1QEWA 3ECVA 4PJIF 2EYSA 4AITA 4I87A 2P8LA 3ZYIA 3OLIA 3HZ3A 4FNLL 4LCWE 4X0NA 4ZW6A 3NJLA 3QZWB 4L4TD 3NJFA 5KYWA 1QUNA 5JIHA 1G6RB 5ELIA 5F6HJ 1MHCB 3P9MB 2IAMC 5EOCH 1JOIA 3NEOA 2Y7SA 3SE9H 4B9CA 4KK8D 1SN0A 3L1FA 1LO3H 1BQHA 2NR6C 2ZCKL 3DRQA 2A6DA 1U8MB 5SWSD 3MRNB 1SMOA 5CLZA 3LH2L 5DUBA 5TE6H 2VZUA 3ILEA 3Q6FB 3QHZH 4CSSA 4K94C 1JWSB 5BS0E 2V9TA 4HUKB 5I66B 1T21B 3ARFB 4F9PA 3CRBA 4UOW0 3FIRA 4Z7NB 3FFOA 5I0VA 1VHPA 3SDFA 3GSNL 3CIAA 3G04A 4Q6YA 4P23C 5D7SH 1WF5A 1J1PH 3H2PA 2VLKB 3KPTA 4HUWA 5EWIH 4NUGL 3NYKA 3U4EB 3OOAA 1KYOJ 3QCUH 4XGZB 4JM4L 3TEYA 2CHDA 1PDKA 4X5LA 2FX7H 3MNWA 2AJXL 5I1CL 4NI6A 4XBEH 4L1SA 4HCFA 4JFZH 3CCHA 4XO8A 3KLKA 5DUMH 2PVUA 4ODXA 3MBEA 2AJUL 3VXSE 3GXFA 4MYPA 4EBQH 5EOTA 1GTNA 4HCIA 1N0XL 1EXGA 3H1ZA 3D2UB 3LPWA 1L9OA 3RZCB 4BK8A 3ETBJ 3QPXL 3BKCH 1T0NA 3HE6C 4EI5B 4R5VA 4ALAL 2QHRH 1KIQA 4PGDA 3SYQA 3ES6A 2GITA 4UM9D 5FA3B 5LXGL 3BPCB 5D8JL 2JTDA 4QJ4B 2YRLA 4XCFH 1S7TA 2B3FA 4OVVA 4NYLA 5KS9A 1JVKA 3DX8B 4DERA 4OVUA 3BFWA 1R0AL 4F8PA 2WXLA 5C0IA 2QV4A 2XXPA 4G68B 5E2VL 5FKPA 2XWDA 1I7RB 4TVPE 4UCFA 3L9RA 2EIBA 3A4DA 3QUMA 1CK0L 1S50A 3S2AA 1ZIAA 4UU9A 2FH8A 1DQTA 4Z76B 5B8CA 1L0XA 3BQUC 2VJXA 4LKCA 4A63A 4RFEB 1R33A 3QDJA 3LMJL 5E95B 4ZS7H 3TBSA 1IC0A 4P5RA 3VVEA 1N4XL 3L5JA 1H15A 1LB9A 4TUOA 4UT9H 1KELH 1R5VB 5DSCB 3BUBA 3HOGA 2NTSP 1M5EA 4KHXL 4OCWH 3THMH 1EHXA 4Y2OB 2GJZB 1VSCA 4R3SA 4C8XA 4OZGB 4Q9CA 1FSAA 1ZU0A 3OEMA 1LAXA 3KGCA 2YD4A 2BX5A 3SKNB 3IJEB 4NNPH 2DKUA 2ZONA 3P30L 1MOEA 1Q9LB 2W65A 1B7ZA 1PKQE 1JEVA 4JY4A 4QXTB 3ZKMC 4ATWA 1SJMA 3ARZA 1FPEA 3UTZA 1OGAD 4M6OH 4X83A 2EVJA 2VDPH 4QSCA 2O6PA 1SQYA 4LQ5A 1F13A 3GKWL 4NZUH 4O5LL 3UIYA 4AL8C 1ZHNB 1MIMH 5KBNC 2GHWB 4JM2A 3WKML 4M5ZL 4X7TB 2J6EL 2A9MH 4YDIH 2KHAA 5CBEB 5J13C 2YWZA 4ZEKA 4YSCA 5C0CB 1WGVA 1ZY9A 4QYOA 4TPRH 3T2OA 1DL7H 1VAHA 1FZKB 3DHJA 3RPIB 4Y4KA 3HZKB 1NM4A 3EOAA 4GUOA 2DLHA 2Y7IA 4FLRA 3A4FA 1M6OA 2BMKA 5FKAA 3MOQA 2DBLH 5CFAA 4Z7AA 3PNWB 5KYXA 5TK4A 4TOYH 4Y88A 3ZKSD 3OB0K 4JRYE 2BJIA 4HUUA 1CR9H 1FIGH 2BOBB 1U95A 2JWYA 5D72H 4QHKJ 3LNFA 4M3HA 2Z31B 1BXVA 1AZUA 5AYUL 3ZW3A 4NQDB 1BVOA 4GXVH 3AMLA 3D8MA 2F8DA 3RIKA 3HA0A 1UD6A 2DP8A 3VSVA 3MLYL 15C8L 2P8PB 3BLBA 3GTVA 4JZOA 3O6ML 1H6EA 4NO0B 3DGGA 2BDNH 5FS5A 3ZRSA 3JZYA 4PS3A 5J6GA 1P0SE 5EU6D 5I1GL 1ACXA 3ZHNA 4GWWA 3F85A 4U2ZA 3TXAA 1NMAL 3PGDB 3CE1A 5BXFB 3B1UA 3FNKA 3K7UA 3MRPB 1DVYA 1Z9PA 4UINH 1ZHKB 3CH1B 5ITBL 3WUZA 4PCSA 4G6JL 1ESOA 2Z8SA 3GRBA 3MVSA 5JW4M 1PLGL 3V5DA 1D9VA 1L0YA 3QORD 3JUYA 3IRCA 2GTWA 5CJ8A 1OM9A 1AZRA 3O45A 4PRHA 1F3JB 2NYKA 1X9UA 4XPGH 1RPQA 3ECWA 3M1OA 3F7VA 3FRPA 1A02N 1I6BA 4G80B 1U8HB 4KTGA 1UD2A 4Z3FA 3LKOB 2NZ9D 3D1MC 1B3JA 3RDJA 3ZQWA 3EPEA 2A38A 4NDMA 5FYJH 3V79C 1C08A 5BVPL 3KS0H 4S0HA 3D0AA 3QMFA 1E6JL 1CFNB 3FB7A 5AD0A 4KK9D 1M7IA 2QMXA 4MLVA 1GYAA 4XTRD 4MVBD 3IB1A 3UPCA 4L9LA 3CVDA 1MDTA 3ARBA 1LBCA 3NJNA 4RISH 3INUL 4A37A 4WDIB 1N18A 3HFFA 3D06A 4E9WA 3IFAA 3ARDB 1RUQL 2GK2A 4U3SA 1FNAA 4XNXH 3EHBC 3GZOA 3KBZA 5I84A 3VU1A 2VLJB 4JCWA 4P59H 5KJ7E 2R9HD 3I50L 2ATAA 1CDBA 1MFBL 1WPCA 1SVBA 4NRZB 2VH5H 3RP1A 2NY0D 4ZQKA 3K6NA 1XZ0B 1ZE3C 2ESVE 4P05A 4RGNC 3REWA 3NRFA 5I2IA 4F29A 2UXTA 5CI5A 3O0LA 5LDZA 1HINL 3D3VE 2EE6A 4NEDA 1IEAB 3NCBB 3QDJD 4OGQC 3GSRB 3HBGA 1P9MC 2LW3A 3BN9C 2YEZB 3W9VA 4AZ8B 4OVTA 4MNQD 4R4FL 4HHAA 4KBPA 4NKMB 4WW1A 5HJGA 1TJXA 2F54A 3LN5A 3ZE2F 1IQDB 1IAOB 5SV4A 2AL5A 2A6JB 2IPUK 3EHTA 3H53A 4LLWB 1UCBL 1K72A 1IFGA 1CF8H 2I0CA 1U4FA 2FO4A 4PBXA 1NOFA 1KLFA 3FQUB 3HR5B 3E2HC 3PPEA 2OJEB 1EMTL 2XVLA 4JS7A 5C2BL 5LQBL 1SY6H 4RWYH 5EU7C 1SXZA 1NLDH 1IM3A 3AREC 2X44D 4DGVH 7PCYA 4MXWH 5HI5D 4ZE9A 1SJHB 1OW0A 1ZLSL 4JQXA 1NCOA 2KLSA 4WI7A 4X98A 2HPTA 1NV5A 1Y4CA 4MNHB 2VLMD 1T7WA 3V0GA 4JPIB 4ZOCA 4E9XA 4YB7A 4PJAF 4P8QA 2VN6A 2YFNA 4ND9A 2NUPB 4H8UA 4P2QA 4PVMA 1MZZA 1I3UA 4X4XA 4YE4H 4BH8A 3AM8C 5EZLA 3QT2A 1IB5A 4WEEA 4WTZA 3MLTA 3NIFF 4PREA 4X99B 4FA8A 5IB5B 2XXTA 5FR3A 2FQFA 3UIFA 3LZOA 4G9FD 3L4WA 3FO9B 1UB5B 3ILPA 1UEMA 4H2CA 1NCWH 4M29A 1KY6A 4F2EA 1UC6A 3SZKC 3TIEA 1TZIA 3A6BL 3K71A 4GBXA 4HHWA 1IBHA 4NGUA 4U1NB 3V0WH 4EOWL 2VXTL 4IGBB 4B9JA 4AE1A 1RIHH 4OEVA 2ICWA 1JGEA 4LLVA 5FA4B 4LBAA 4DP5X 1KN2L 4U0QB 1EEZB 1G84A 3C5JA 2JB6B 2LU4A 1ZS2A 3FAXA 3DSFL 2VISB 4KTEH 4YIQB 5JPMA 2ZJSL 4I4WB 3ZKLA 1OZUA 2HZLA 4JZJA 4PWJA 1E4XI 4GOSA 1EXUA 2ESVA 1HC1A 1CU4H 1UM6H 2WOYA 4FNPA 5I1HH 2Y7QA 2WP3O 1ZIUA 1F90L 1CD1B 4AE0A 4GI6A 1DPPA 1MHHB 1SEQL 3U65A 1ZS8A 4LLDB 3OKLB 3T3ME 1CUOA 3MRKA 3S9DB 2AK4D 2P42B 4YSAA 5TPAA 3IMVA 2BVYA 2QFRA 4FKEA 1N3NA 1KGIA 3CDCA 1UT2A 3B6TA 4XPAL 3IBEA 2NQ3A 2ANJA 2GSIA 4A67A 4ZFGH 3MRPA 4JR9L 2CIKA 5T1JA 1BBJB 3Q1SL 5E9DB 3LY6A 5F3FA 5JLZB 1GH7A 5HGHB 4OVQA 4XC1L 5B7FA 4KFQA 1EGJL 4IOSA 5JTYB 3HS0A 3ZU8A 4M1CD 3Q2LA 5HHOB 2FGWL 3RE0A 1A22B 1KIUB 3C2AH 4R6YA 3AAZA 5IQOA 1HILA 1XR8B 4X4ZA 3UIZA 1BYPA 1F6LL 3VXCA 1OSEA 1PS3A 3DK0A 4PJ6A 2Y23A 1EERB 4FTVD 3QQDA 1IKNA 4PRHE 4OLUH 2B7DT 3S34H 3U0WL 3K8MA 1I7ZA 2E0PA 2VDQB 5C0CD 2AQPA 4WXJA 3VWJC 3DMMD 2XWEA 2DEYX 4IDJH 4YX2H 3EKCA 3L95B 1CFNA 1YQVH 1TQCB 3FB7B 1MXXA 2XN9A 3VFNB 1WD8A 5L9DL 4EZMA 4OI7A 1QKZL 3LKRB 4HXAH 1XF2B 2BVTA 2RACA 4HS3A 3VDFA 5I18L 4PB9H 3TA3A 4E9TA 2ZXQA 3HAEA 4UBDD 3IU4H 5TQ2L 4YHIA 1RK1B 4PJ7B 2GCYA 1G7HB 3CZEA 4JANA 1XF1A 5I1EL 1WV7T 5KYYB 4ZBJA 2APSA 4PF8A 1KCKA 1LNUA 1A4KB 4XXWA 5FFGA 1F42A 3ZZSA 4HSAC 4DO4A 4IW4C 3KWXA 3IDIB 4N5ED 5K39A 5B1AB 1WH0A 5AWNL 2P80D 4MA3B 3LHPH 1KNOB 1N0TA 1LK2B 4YSOA 4L3AA 3WFEL 5FW8A 1IEAA 1JZEA 4S1DC 5GHWL 4YWGL 2BY3A 1NV7A 4WI8A 4OZFH 2EVHA 1G1KA 2R29L 2BSCA 3H54A 4TKWA 4U1GB 4Y5XC 2FVZA 2ZT9C 4XPFL 3V4PH 2A5SA 4WTQA 3MLVH 4E41A 2Z7WA 3L5IA 4ODHL 3WY4A 5HVWA 3FXUA 1SW2A 3AB0C 4X6CA 2VYRE 3U2JA 4W70A 3E1F1 3MRDB 1AJ7L 1K8IA 2F7CA 1SYHA 1PQZA 1PYWB 1CGSH 4BCYA 1S5HB 4XC1H 3IF1A 1IM3B 2MKLC 4L8BA 3TNNB 4J6RH 3NCWA 5A2FA 2OAAA 4GRLA 2BRQA 4MA1B 3VGAC 4FDWA 4BWUA 2IPKA 1XX9C 4BM7A 4XAWL 4N8CH 1B4RA 3ZDWA 1I1YB 4Q14A 2H6PA 1N19A 1ZA6A 1ZVYA 4POYA 1S9VA 4KOBA 4A1RA 2APXA 2IWEA 1HOCA 3UYOD 5LAXA 5JA9A 3FVGA 3M46A 1UTHA 2XWJB 4Z7OF 5FYJD 1WFNA 3PUZE 4MLQA 3I6LE 3T0EC 1MG3C 2A6KA 3DO4A 4OD3H 3C5ZA 3BUQA 3JV4B 1QQDB 4CMHB 4O2CB 1FBHA 1HI6B 3TTRA 3SB3A 4Y5VC 2WX9A 3CDFA 2GVYA 2VRQA 1JFHA 2Q0ZX 1P9MA 2CDGB 3IXAB 4Q6IB 2V2XB 5DJCB 1OOAA 3O8XC 2J57A 4MFHA 3JWDH 4MAYD 2DKSA 4H13C 4UMSA 4ZTPL 1TPXC 1YEDB 2EDDA 1IMEA 1XEDA 4WU7B 5JXEA 1HJCA 3LB6C 5DUPL 1YMME 1CL7I 3RWJA 2BHFA 3O6FD 1KYDA 1NCBH 3QZOA 4HF5L 5IQNA 3QI9C 1QW9A 1HESA 1XB8A 3TQLA 3T6ZA 1UD8A 5EU3B 2ITDB 3SPJA 1F00I 1US5A 3Q44A 2GABA 2H3NB 4BQ8A 3BEWB 4FQIH 3GWJA 2YXVA 4EKXA 2JB5L 1TYRA 4MDJA 4YXKH 3QAQA 4B7IA 1HXYA 2CZNA 2BS71 2R1XA 2B65A 3ILTB 1A6ZA 1ZDQA 3IU3B 4G9FB 4NO2A 3MUJA 1NGQL 1SM3L 2VO5A 5JPNB 5GZNC 1IBZA 3KM1A 3UZVB 2XCMC 1OAXL 2EH7H 3UJJL 3DIVA 3L4VA 2J7LA 3LIUA 1I1FA 5HSFA 1WIPA 3C31A 1MPBA 4PBVC 4IS6B 3WIHL 2NX5B 4IMLA 2CA3A 4DXUA 1ETB1 5KVEE 2RA1A 4H0HB 1QZ1A 4JFXB 4P4KD 1KCUL 2DQFB 1ETJA 2YEQA 1IC4L 3GUFA 4CVWA 3UDWC 1QFUH 2YMXL 3Q2NA 1OCWH 3HPLA 4KTDL 1MRCL 2VERA 4BYHA 4LQFH 3PL6D 1ET7A 1HL4A 3BSGA 1E5ZA 1T2QL 1B46A 4PJFA 4TMPA 4AYFB 4OI9A 1G6RH 5MP6H 4MJ4A 5DEXB 4OZIE 5IESH 3MTXA 3D1RA 3DX3A 4LSVL 3V0VA 5FGBA 3CXHK 3QDAA 3RWDB 4ODXB 4JO1H 2VDLH 4JGJA 4N6PA 5FLVA 3P2TA 4U6XA 3LVTA 1XTLA 1JGDA 2VH5L 3IKCB 4IEFB 5FYKL 4APXA 4J4PA 4TL4A 2B4MA 4J3UA 5BUAA 4HAFA 4WI6A 5BZWB 1U3ZA 1WZ1H 3S2CA 3SSGA 2OI9C 2GEQA 5KZCB 4H26A 1VDGA 2XPGA 3NSJA 3NZHL 4PP0A 1X5LA 2UX7A 3AQXA 3V6FA 4CDHA 3AU1B 1GS7A 5DK2B 5I28A 4ETYA 5LCVL 2J8UE 1WFJA 3U6RA 2X05A 3L81A 2VDOB 4FLOA 3EJPA 4LCVA 4HWEH 3U7AA 1NFIB 1QUPA 4LCWA 4UV4H 2OMWA 2HRPH 4QTIL 2CBQA 5EULV 2XA8H 4ICWA 4HD5A 2ICCA 3CV5A 1QLRA 4G9DA 4MDIA 1CBJA 2XDHA 1MZYA 3WNOA 3VXPA 2CBMA 3EJSA 3DKHA 1R3JA 2Z35B 1LFGA 1ZK9A 3QWRD 3K81A 1W0YT 4KRMB 4R9FA 5ANME 4Z1PA 2BP0A 3GO1H 3MOBL 4QKXB 3RL1A 4YNYB 1FLRL 1ONQB 3LN9A 3FH5A 2O26U 3QDHA 5EC2B 3S88H 1F2XK 3PL6B 4OGYL 3ZSTA 1LB8A 1GTKA 1SOQA 5C0AD 1TEFA 4N24A 2NSMA 1R5VA 5A2JH 3FXQA 1P7QA 3VX0A 5CLWA 5H8FA 3RVWD 3FYEB 1QFWH 1XCQB 3EH2A 4Z23A 4XNZC 5AVVB 3DO7B 2FWUA 2EXYD 3L3HA 2CAKA 4LVHC 4Y2OA 2R2HA 1R75A 1ETZA 1Y1DA 2XG5A 2XV3A 4IBUA 2OYPA 1MF2H 3ARGC 4XVJH 3WKPA 4E5XG 1OSPH 5IB1B 3RT8A 1B4LA 3V10A 2O6EA 4ABUA 3BDBA 2Z23A 1OLLA 5E6UB 1A2YA 3FQNB 1FFPB 5D4QA 2HFGL 2F18A 1AO7E 5I66A 3TCFA 3E13X 3RNNA 1RHHA 2Y5EA 4LAJH 3O8XB 1OM3H 3LCYA 4KKZA 4ZODA 1I9EA 3VE0A 3BPLC 1QLFA 4FERA 4D7PA 1A9EB 5DD1H 2HFBA 1V7MH 4Y4KB 4Y1AB 3IS1X 4R9GA 3PQYB 4UILH 4XH2A 5CU9A 1U2CA 4IK7A 1LMKA 1LTXA 4K3GA 1H3TA 5H35A 2ALWA 4R2FA 1UH2A 3ULSB 5E4IA 4KKAD 4GRWH 3OJDA 4PWKA 2WAHA 3NJMA 3EJQA 4FQ2L 4P2RA 2X2YA 3SQOH 3D48R 3WHXA 3QUXB 4HIPA 3UEQA 4WJKB 2QADB 4Z6AT 3DLNA 3TVMA 1ATGA 1XZWA 3DGGB 3ZL4L 3OR7B 4PE3A 2WXFA 4L18A 2YD9A 2YPLD 1BSIA 3W2DL 3ULUL 3GXAA 1INQA 2Y06H 4B9KC 1QAWA 4EN2A 3GMMA 4X9BA 2GUYA 3OKDA 4BKLA 4DP0X 3QA3A 1B3LA 2WBWB 2H25A 4G61A 2JKSA 4LHUB 1CYGA 2G4GA 1XGPA 2FIKB 4QKTA 4KI0E 2APVA 1YPNA 1RZGB 1GAFL 1LLSA 1EPFA 2CJSA 1MUJB 4JO2L 4MD0B 5EV7A 1KGUA 3WE6B 3KWVA 4AGNA 1XXDC 3Q43A 1MY2A 1T7ZA 1B0LA 1VJSA 2CGRL 3BUTA 1I8LC 4ZYKA 4IRJA 5LG6A 1GMIA 2GSMB 2VN4A 3LKOA 1YY9C 1D5MB 1A0QL 4GIAA 5JW5B 1MDP1 2I0BA 5I1JH 4LRIC 4Y4FD 1LEKB 1SMAA 1TZ8A 4AYEC 3COOA 4TQUQ 1QFWL 1G6VK 3EFFB 4G1EA 3FQTA 5A3IC 2YD0A 2E7DA 4XRCB 3UXFA 2O1AA 4W6WB 3DROB 3HKFA 4CGUB 1CDYA 5F93C 1NMUA 3FTWA 5BO1H 5J1DA 1RLBA 3SGEI 1E9PA 2MIZA 3D34A 5GGVL 1JNHB 4I1DA 3VYOA 2D2OA 4PLOB 3BIGA 1Z3RA 3T2NH 2M2DA 2I58A 3VWJB 3DXAB 2DE2A 3X3FL 1FN4B 4HGKC 4F8TA 1S3KH 3BVVA 2Q7YB 5GXBB 3EYFA 2AJZA 1T1YB 3TYFB 1BWMA 5EPMA 4GL8A 2YAPA 4GAYA 5DMYA 3T0AA 2J1WA 1Q0XH 4HWEL 1MQIA 4QCIA 5SWSE 1KLGA 3QC6X 1WC7A 4OFYD 1XI6A 2VXUL 4QFPA 5CHNB 1JGVL 3O3DB 3GSRA 1JZ6A 3QO1B 3MACH 1K5NB 4M8VA 3HO7A 2HA1A 3C6LA 3TPUB 3NJGA 4OJCA 1IAII 4X6DB 5DA0B 3HG1A 3Q06A 3SDAC 4KXZI 2VZ3A 5TF1L 4GO6B 4D8OA 5FK9A 4IKJA 1B6UA 1NTDA 2VXUH 1PY4A 3TT3H 1LWHA 4L3EA 2DQHH 3H9SB 4RESB 5D1QA 4X48A 4Z0BL 1PZ3A 2C3VB 3KYMB 4ZUWB 3UAJC 1I7UA 3HI1B 3UYPA 5FO7B 1AWBA 3R7XA 1OAYH 1B40A 5H2BA 1C7SA 1U6AH 4OLXH 1EAJA 1MSPA 1L9QA 4MJ6B 4N2GA 5LUMA 5JPMC 4OHNA 1FYHB 3GXTA 4TLUA 1XGUB 3V5HA 1EV2E 4OESA 2R1YB 4U7MA 2D3LA 4Q9QL 3VXNB 5IREA 1Z7NE 1NNPA 2K7PA 1MNUL 4QF1B 4Y2DB 3Q05A 2PFZA 2VIRB 1C16B 3U1OA 1AOHA 3JQOB 1UIUA 1VFBB 4ZTEA 4XKNA 4MB4A 4IGBC 1A3QA 4F57H 1MY7A 4MH5A 4TRPL 3VXUA 2BY2A 4QRSB 4ACTA 3H6VA 2MQGA 4MF3A 3VI3E 1PMYA 1QLFB 4OT1H 3MJ9H 1TZIB 1LD9A 3SKOB 2FEEI 2VAJA 3K71B 4PAFA 5C0AB 1A0QH 3VM5A 1M6UA 1DANU 3PWJB 3T77A 4G80A 5J6HA 4A6YA 1VB9A 1FGVL 1GGCL 2X2JA 3LIZA 5EYHA 4QSEA 1S7SB 3Q2VA 3BHBA 3KYOA 1A7QL 2ITCA 1JNLH 4PQXA 2VSMB 3WUWB 1B05A 1U41A 3FOLA 3HFMH 4LNRA 5KYNA 1YNLH 1HHIA 1TXKA 3OZ9H 1Y20A 5AAWA 4Q97A 3JZJA 3STBA 5AD0B 1NI9A 2VDNB 5IT2H 3JV9A 2E9JA 3L5WA 4E42B 1GPOH 5D9SB 1F6AA 4JFUA 2PMZA 3RGHA 1AHWB 3ISWA 4QLWA 2Y36L 3B7SA 3H6TA 2PPAA 5T33H 4ZK8A 3AREB 3BDXA 5F1OB 4J4PD 1PLCA 5D71L 3E2HB 3PWVB 3KPLA 4WI2A 1IQWH 2EDFA 4NF8B 2YA2A 4Z95L 4PRDA 4HZLA 1MWAA 2VT5A 1YUKB 4O3CA 2G5UA 4KH2A 2H41A 3ZTCC 1TFHA 1Z7JA 4GY4A 1AACA 4O2FB 4AY0A 2V7HB 5I0XA 1EJ6A 1HQRB 2NCMA 4PMFA 5AKSA 2BSSB 4GKSB 1OZTG 5JTYA 4M1GL 1E28B 2QPFA 3SQOL 5L8JB 3RYDA 4FQ2H 3OJ2C 5FBPA 3BFTA 3F6IA 3T96B 1FO0A 5K69A 5B7DA 4O9HH 5BVJB 3JBG7 4PS8A 4HJ1A 5A7BA 3B4NA 2WZ0A 5E8NA 4FNRA 3GI9H 1HHGB 3OZ9L 3I6SA 4XXWC 1QTYT 3U72A 3HNTL 3GM8A 1EDYA 4WFED 3VXUE 3EHBB 1ED3B 2X9YA 3L7EA 3O41A 5FM8A 5IY5B 4MXQC 5CCKL 3OAZH 1RCYA 3X11A 1AO7B 1P7QD 3CPUA 2XKSA 1M71A 3Q8FA 3FTSA 3QUKA 4HOXA 1DLFL 5T3ZL 1BVKB 3MNVB 3SOBH 1QFOA 3WD5L 2RF1A 5EHSA 4F91B 4H1LA 3UZEC 2D31A 1MCWM 4TRPH 2GSGB 1KTKE 3X1EA 5JA8B 1F1AA 3D52A 4PJ8B 5HI3C 2IMMA 1EGJA 1JXJA 1I8IB 5M94B 3NOHA 2BCMA 2EE0A 3VWJA 1EJOL 5A6IA 1TKWA 1V8HA 4JG1L 4KKNA 1EO8L 4XNQA 3VXOA 3G5XB 4AEHL 4BA8A 5F7UA 5I1DA 4GWOA 4XF5A 1UQWA 4X6EB 1MDAA 4IBYA 1HH9B 1HSBB 1MFUA 3FQWA 3LHPL 4RA1A 2KR0A 5IQ7L 3GSOB 5PCYA 4NQEB 2F61A 1B52A 1BVLA 3HMXH 3OMZA 2NYYD 5ABAA 3P1VA 4LEOB 2BY0A 3HG1E 1N68A 7TAAA 3IK6B 1OQXA 3EYOB 3Q1EA 1DSFL 1QRNE 2FUQA 2YMOA 4CBPA 3W37A 3PPQA 2G3NA 5KVGH 3WKQA 1WK0A 3QEQE 3LD8C 4K7FB 2P24B 3SJVD 4EDPA 3WHE1 2YPNA 3O6FA 2AK4E 1SVCP 1E4WH 1SBBA 4IU2A 3BAWA 4NJ9L 2G0LA 1GGBL 4Q6KA 4RWHA 2J56A 4EN3C 3ZMNA 1NFDB 3WN5C 3QXWA 4X6CF 3P2BA 1YQVL 3G5YB 4ZUUA 2AZUA 4IDJL 1U8PB 4LP4A 4ZG1A 5IZ7A 5TF0A 4IIQB 4PV9B 5LCVH 1BQHB 2YJLA 1T80A 3BMVA 5LGKA 1I1AA 2J20A 2DWEB 3RFZA 4M62H 1II4E 2PW2A 3MU3A 2BJMH 4G11A 1XGRB 1E4HA 4QHLA 2I5YH 3FN0H 1UACL 1IKNC 1JWSA 3BP6A 3MN8A 4LBEA 3T71A 1DQLH 5DJ6A 2AQSA 1XGYH 4J3OG 1N0LA 3DXAE 2FGWH 1X5AA 4HS8L 1WS7A 4E9VA 5JHLH 1SHMA 5GGVH 2H8PB 2CCLA 4ZDHB 5FXCH 2MJWA 1DQVA 1VEOA 1FNSH 1LBBA 1Y1ZA 5IF0A 3AQDA 4F22A 4PJ5B 5MEPB 2UZYA 2DQUL 5GS1C 1T2QH 4AQ1A 3FU7B 1DK4A 1KGCD 2VB5A 3QUZA 2EYTB 4Q0XH 1UTDA 1OLAA 1T1ZA 4KTDH 4PSPA 5KBDA 1FW0A 2XQYG 3D4YA 2BS9A 4PH8A 3T1FA 3GUTB 4U1JA 4PFBA 3PV7A 1R3HA 3P0YL 3VVWA 4L3FA 1FFNA 2JI1A 4WNQA 2PPFA 5F7FA 5JPNC 1XH2A 2EDBA 4LL4A 3MLXL 2QQNL 1F18A 3P4OA 4OLZL 3KPQB 4F37F 4YSUA 5LDSA 2C8NA 3MGAA 4J2QA 4N2MA 1S7UA 4I0KA 5AOMA 3W0WA 4R0LC 4RSYA 1OTUC 3W9WA 3GJEA 3HB3C 3GHBL 4K71B 4P3DA 5EU5A 2WAQA 2FO8A 4HDIB 4NERA 3WS6C 1KT2A 4WHTA 1FORH 3IPFA 2IGFH 1RIHL 4GWZA 3MREA 4U4XA 2BSTB 4JQIL 3F12B 1NLBH 2CH8A 2DYRB 4P0IA 3VE1B 3R06B 1XHYA 2WLZA 4R26L 5FGCE 4ISVB 4ELDA 3BWAA 4LSRL 3BN3B 4UNIA 2UYEA 3V0HA 4XBGB 4KV5F 5IFAH 3UJTL 3ZL2A 2J4WH 1BOYA 32C2B 1FJ6A 5D93B 4IBZA 4RA3A 4Y5VB 1YPZE 1XMWA 2F1EA 3H0TA 4ADIA 5JOFA 1QI4A 3LKQA 4M3KB 3ZZ1A 5F1QA 2YBRB 1M2OA 1CD8A 3T0EB 1ORQA 4I3SL 4WAFA 4MRCA 1M1XB 5CEXB 3QFDB 3STZB 2VE6B 3EH4B 2R9JA 3BGMB 4MAYA 4X0KB 2JVUA 5IROD 1J5HA 3C4MA 2M26A 3RFZC 2DQMA 1J18A 3JV0A 5DVLA 3T6QC 1EHLH 4ZS9A 4AB5A 1E67A 2NLJB 3TC9A 4MA1C 2DLIA 3VGAB 2Z64C 3QIWB 1V7ML 3Q3GB 1M5BA 1OT1A 4OZGA 4RMSA 1KBPA 3BUYB 4HIJA 1TSRA 3FHQA 5AW7B 5FYJE 2NSQA 5DJ8A 1I3RA 3F7LA 2WLLB 3MVYA 2BK8A 3TCTA 4YE0A 1OM3L 4AI7A 3W5MA 1BAGA 4IRSC 3AWGA 1I8IA 3OKNA 1JIBA 5DQ9B 1U92B 3S8GB 2QKIA 2HFGH 1FGNH 4PJDF 4DKFL 4J6RL 1ZXQA 1MH5A 2JMRA 4XCEB 4JK0D 4R8WL 4M7KH 1KGWA 1VRSA 3ISPA 4JFEB 4S1QL 4J3OC 4CJ1A 1Z9SB 3S96A 4KFMA 4OZHF 5C0BE 4NO5A 1AGBB 1DQLL 2AEWA 1C5BL 4ZUTA 2Y5LA 1QA9A 3E79A 4UM8A 2OJZL 5E4EB 2UVIA 3BEVB 2ZCZA 3O81A 4HH8A 4A39A 1U58B 4JMXA 2CALA 1Q90A 2UXAA 1KPUA 1T0MA 3WDHA 5IVOA 3ARFC 3UBXB 2WYZA 1C8QA 4YPJA 5IHHA 3WTXA 2KQMA 4DH2A 4XCYB 3VQ2C 4UUJA 4J39A 2A77H 4EZLA 5DO8A 4F1ZA 3WS6A 4NHCL 1Q0YL 2DXRA 1X5HA 3IPEA 3Q8EA 3GGWB 1HL5A 4ZS6D 5F0PB 1Y3PA 25C8L 2XUWA 1AGCA 3B8YA 3O2DL 4FXLA 4OD1L 1NMCC 1SVZA 3ESVF 3WHE0 4YHZH 4X4YA 5JXED 2BHZA 4JVIA 2CZIA 1HYSD 2QTVA 2CO7B 3HTLX 4MHHG 5GGTH 4YHLH 3BPNC 5E2WL 3JTBA 2COQA 4DIGA 3U83A 1BZQK 1GSKA 1OP3K 5J8OA 3TDJA 2Y9RT 3MOAL 3VXRD 4WKZA 2FUTA 4QHLB 2YWYA 2Q6WA 4YXHL 2TRYA 1B0RB 3IL1B 3G3IA 4GLRI 2UX6A 2X6CA 4JG9A 4LAQL 4ONHB 4N2LA 1SFHA 3FRUB 5H8HA 4J1UB 2AJVL 2GQHA 1G7IA 2ARJB 4FQXA 4RDBA 4K55A 4PRHB 5AVUB 1UHVA 4RMUA 2XQYK 3MHZA 4JG1H 3KPMA 2ZXWB 1V3JA 5IEHB 1BFVL 5EBLB 1I8AA 4ALAC 1LE9B 2RCAA 2R0LH 5C7XL 4HSCX 2XWRA 5HGBB 3ZKXC 1ODUA 2HTKD 1YYML 2J3SA 4GIPD 3QWOB 4LQFL 2G5BA 3VFWA 4WENB 3D7PA 4QGTA 5D2LA 5CCKH 2LLNA 4KPHL 1IC4H 5CEZE 3HE6D 4R5XA 2QSTA 3HVDA 3IDMA 4GAJL 5DMGC 5A2LH 4F37K 3NH7H 2NY0B 2XG4A 4P2OB 2A1WH 2GTZA 5BW7A 5ANHA 1VFEA 1NFTA 4THIA 3VD9A 4PJXF 2QSVA 2WVVA 2C7FA 4IBQA 3C60C 1ZA3A 3T3MB 3KC1A 4X9HA 2PTTA 5A3ID 4QOKA 4HJTA 2X2HA 5J16A 4FE9A 3NT0A 5DEJA 2PXYA 1CU4L 1UM6L 5KW9L 4UZUA 2YRBA 1MFVA 3A4EA 4QHQA 3R0NA 1RZPA 4NWDA 4PTKA 2ZWSA 3ZKMD 3MXWH 2VDPL 2PWDA 2NW3A 3NP4A 1NEZA 3T4YA 2ZOKA 3INOA 3MRBA 1IGYB 3F64A 5L2JA 3KYKL 1O7DC 1DBAL 2H1XA 3RIAK 3UOAB 3H7BB 3BIBX 4EMZA 3FUJA 2JKLA 3RQ3A 1DBAH 1RFDL 3FUZA 4KHXH 4OCWL 4IB2A 2UUDH 2IXQB 3GHPA 4K71C 3DIDA 3FHEA 1J12A 2FHFA 4ES8A 4H65A 3MRHB 4HPOH 4EF2A 1F97A 1R3IH 1A6TA 4QRQB 3RY3A 4PI2A 3MQ9A 2WZPD 2WLLA 3B2DC 2UVHA 3S98A 1NC4B 1IC5L 3VMNA 3BRGC 5AKTA 5JW4N 3SY0B 1FFPA 1KBWA 1N6QH 2UY7A 2EDQA 2LTQC 2F74A 2N59A 3EOBB 5E94A 3AS2A 3S5YA 4NGHL 4NLAA 3FB5A 5IB5A 4GAYB 4H25B 3RURA 3ILDA 4P46B 3RTLA 1UB5A 5C0DA 3TWYA 1JYWA 4BZ1L 5AVZB 1CF8L 3K2KA 3KPSA 2VKXA 1TVDA 4GW1B 1KCVL 5AOZA 1KPUB 1T0MB 4GQOA 2X88A 1O7VA 1SOKA 2D3NA 1QJMA 5D7JA 4KYDA 2DYXA 1MRFH 4PHZA 3ROLA 3PDGA 1WGOA 2WQUA 4JL2A 3P02A 4KMLB 2KERA 4WKXA 4G8MA 1CN4A 2BVPB 5FW6A 2WWMD 3V0EA 2VDMH 3MKKA 4D3CL 4HJEA 4HLJA 3FGSA 2XKNB 5EEYA 3Q9PA 4C58B 2H1LM 2HZKA 12E8H 4NSKB 1JN6A 1YEHH 2YUXA 4K8RC 2WBBA 5TK2A 2WUCH 2WZ5A 4P59L 1VR5A 1NC2A 4HIIB 2CO7A 4RNSA 3VM7A 4A7VA 3V5HB 4V33A 3CLWA 1B2WH 2ZPKH 4LCIL 2WZAA 4WKZB 1RDXA 3JWNG 1IGCL 3ZK0A 4NF6B 2XJLA 1FNFA 1N3WA 3DVGB 2EKSA 1MAKA 5EC1B 3DM0A 4NZFA 3FONA 3PGFH 1V5JA 4R7DB 2QPDB 1JPFA 2HH0H 3MBXH 4JGUA 4YHZL 4JKMA 1BEYL 1QW8A 3WJLA 4WGKA 3EG9A 2H3KA 1U8CA 1BF8A 5IB2A 3KPMB 3LDBB 4FN0A 4WWOA 1H3PH 1T1WB 3L4UA 5D96C 3ML8A 4IRJB 3SGJC 4XNMB 3Q5YA 3U0TA 3WS3B 3VXSD 2R0KL 4TOZA 2OTPA 1HNGA 1SGKA 2YPVH 4WV1A 1AQMA 1RJLA 2RIKA 3CX5K 3OHXA 4QDGA 1W72A 3RX8A 5IMLB 1SF3A 4TTGA 3VB9A 3ZSFA 4OV5B 1DANT 1Z5LA 3W39B 4X04A 4UDTB 1F6AB 3AROA 4FNLH 1AC0A 1GS8A 3BWUF 1S3RA 5T5FH 4Z78A 3KWTA 3VA2C 2LR4A 2NMSA 4JFQA 1IEBA 4DW2L 2X3AA 4ELMF 4ZFFA 4YLQT 3ETSA 3FTYA 1JW1A 3VXQA 2HX7A 1RP9A 1RK0B 1KY7A 3CU7A 5DJ2A 4N8GA 1MWAB 4FULA 1F3DH 3MRRA 1RYXA 3ZGIA 3FMGL 2WJ7A 5KS9B 2OBGA 2AJZB 1QFPA 2WYKA 3F84A 4F39A 5GRUH 2AW2A 4JRFA 3F7KA 8PAZA 5E8DH 3JUZA 2AS5M 2CR0A 3W56A 1Q38A 4RFOH 1LL1A 1IXIA 1E5YA 3HBQA 3TU6A 5D7EA 5IGXL 2OW7A 5B8CB 4FTVB 1KIPB 5AW2B 5MEND 4L8CB 3S9LC 1RIVL 3LZFH 2BFVH 5SWZA 5L2JB 1TTRA 3L9YA 3FV1A 2RJMA 4F1UA 4NG7A 3MV01 4GXAA 3KLHD 4K3HA 2E3VA 2EDOA 1E7VA 3DYPA 4HKBB 1P2CB 3EW3B 4EUPB 4CU8A 1KYUA 5E03A 5F0JB 5B3JE 1BKAA 5HI3D 3GLDA 4EOWH 3WKMH 3KYMA 4ZUWA 3ARGA 4FNSA 1AXSA 1JWUB 3MGOB 1J0KA 3TVMC 5JIQA 3QI9A 5H2BB 5C92A 3P9LB 3N42B 2EZ0D 3BO8A 3BFUA 2ZWLT 2YJQA 3LS4H 1Z0MA 4ONGH 1PZ2A 3G6JF 4QXTA 4R26H 4DP7X 3MAMA 1G7MB 5A1AA 2XHNA 1NIFA 2HVJB 1NLBL 3D85D 4YDMA 2GFEA 1RJZB 4L1HA 5K9KB 5H94B 2DB8A 4WO4A 4K23L 1R6VA 3F6JA 2WXQA 2R23A 1IE5A 4HK0B 4QRTB 5EEWA 3GSOA 3K2MC 2W9EL 2QT6A 4QNPE 2IFFH 2FIXA 2BNUB 3U8QA 2BCKB 5E8PA 4JHVA 3GK8H 5K1VA 1H8OA 4L1BA 2J8UF 3HBZA 2HLAA 1QFHA 1LDPL 4G68C 2OQJA 4RX4D 2MOVA 4NF5A 2WNXA 5E5LA 4W6XB 1JMZA 1YN6B 3IFOB 4L8DB 2HLFD 3NTCH 1IIWA 1MQJA 3LZLA 3KEDA 2FIRT 3R4DA 4XVJL 3TV8A 2APFA 2P0SA 5BRZA 3J8F7 2VDRB 4JVDA 4I18C 3LSFB 1E50A 2X7LB 1TJIL 2G2RA 4JJOA 1MKFA 3I75A 1IGIL 5LBSA 3T0BA 4NQCD 4FX5A 1SJXA 4YAQA 5AA2A 4ZMAT 1KB9K 5L88L 5KSAA 1P1ZA 2F7PA 4FNTA 1DTUA 3IWUA 1GHFH 1ZJBA 3OQ3B 3MVWA 2NT1A 2R1XB 1I53A 1NMBL 1XGYL 4N8PA 2YD2A 1S7VB 4APQD 1TTAA 2YRPA 1OL0A 4DCQA 1GGUA 2DLEA 1WO2A 1NUWA 3W11D 3T4AB 3TODA 35C8H 5ACMA 1A8ZA 3MZGB 1KDIA 4GT0A 4LATA 5CC2A 4QOKD 4EBQL 2QQKL 3H3KA 4DO5A 4IMKC 1P5VA 5KZCD 2Y2TA 2WPGA 3IJ8A 4AUUA 4Z7UB 1JVLA 3BZ5A 1RSYA 4JFED 3SDCA 4RISL 4S1SH 5DURB 5IF0B 4W9FC 4WFEE 4Y7OC 3VXUD 1FBIH 2VXSH 4U21A 3GIZH 4AQ1B 1CDHA 2MHAB 2XETA 4EXKA 2AJXH 5CD5C 5I73B 1KTLB 4XOAA 3TCGA 1LFHA 4HH9A 3CVHA 1J0ZA 1J1XH 3GUTA 4JDEA 5GGSB 4HWBL 2H32B 3ZHDA 1CXFA 1JV2A 1PG7W 2J43A 4OCMC 2XRAH 5D7SL 3D4GA 2WINA 1HK6A 4M7JL 3GTNA 4PPTA 4XT1C 4DHLA 1M7IB 3SZPA 3SESA 3X11B 1WT5A 3QG6B 4WF7A 5BS0B 4BDLA 1RPKA 5KSAD 4DAGH 4OFVA 3F04A 1RYOA 5F3BB 2HAUA 2VGQA 4LXFA 3GBMH 5DJYA 1FH2A 1F58H 3PDDA 4MAYC 4HP5A 3CH8A 5IQ7H 1WWAX 2QDWA 1H5BB 1OPGL 1J05A 1NCDL 4KYEA 1IC7H 2YMXH 5JOEA 1ZSDB 1D5IH 4PIBA 4FADA 3SYPA 3HMWH 3QJOA 3LNHA 3IR1A 4U1MB 2BHYA 2XJKA 1EJOH 3QIUC 1FO0H 4ORGA 1A6AA 4F7CA 5TFSL 1FVDB 4DJMA 4FXTA 4ZQKB 1IJ9A 4QRUA 3WIHH 4I77H 2M1KA 4PVNA 1MJUH 2A9BA 3OPUA 4G6KL 3K80A 1VLXA 1UZ6F 4WJ5A 2DZEA 2FYIA 4N8YA 4YDLB 2WYHA 3JWDC 1MH4A 4HZAA 3HLAA 4FQLL 3UL4A 2A4ZA 3PQYE 1WFTA 4WU5A 2ONKE 1JW4A 2HT3C 3G3JA 5EC2A 2R59A 1MVUA 4ZOBA 4NC1C 5FUOL 2JXMB 1N59A 3FXBA 2X4UA 1OGSA 4FQIL 5KSBB 1WFMA 1K8DA 4PWGA 5EDSA 2VP1A 4GW4B 3DX2A 4AG4H 2HG0A 1MCQA 1MPDA 1KV3A 5FF6B 3M07A 4G7YL 2ZYKA 3H9SD 2FHYA 4FABL 1POY1 1I7TA 3ZE0E 3D25A 3VSQA 1IU1A 1UXLA 5EU7E 1FL6B 3MP1A 3CJJA 4HIHB 3W0WD 2PW2B 5CLTA 4YMBA 2OZ4H 4PD4K 1VDWA 4EXLA 1CLVA 3BIAX 5H37H 1HXMA 5CJXC 2DEWX 5D2NB 1FBPA 2WC7A 2D03L 2QBWA 2K3HA 1OVTA 1SBSL 1TQTA 4YFLF 1HL9A 1AMYA 4XVOA 3GMRA 4M1DH 1PKQB 3QUYC 4QRZA 4HKJB 1L6ZA 4Y4FB 1S9YA 5ADPH 3MO1B 3U46B 2ZCHH 2ZKWA 3RU8L 3TM6A 2FEJA 4UQCA 2FNCA 1TU2A 5KVEH 1F6FB 2Y6SC 3MODH 4NT6A 4R97C 2ICWB 2IOMA 1NBQA 2DIBA 4UT7H 1FQFA 2VD3A 3APDA 5E4OA 4PAZA 1EZSA 3HS8A 2CKBA 3C5JB 4Y4HC 4KZEL 2KL6A 3VD1A 1M53A 4R75A 2V4LA 4HJGA 5ERWB 3WNNA 1JNLL 4UUJB 4NQCA 4ZXBA 5DVFA 4MXVE 4R84A 1UUNA 3B3IA 5EIVA 5AVQB 1GGTA 4RBPK 1AJ7H 4X6DE 4I1RA 2QSCL 5E6IB 4XMTA 5KS9E 1FPTL 5EZOL 3MJ9L 1H3XA 4LPYA 3X14B 4HX1A 1R4XA 3GLEA 4RAUB 5AW8B 3RGVA 2Z4QB 4XMKL 1IAIH 4XPFH 4PGNA 1KT2B 4WHTB 5ABZA 3A6CH 2B3RA 3CZKA 3FSOA 4H1LG 1MQKL 4PRPE 3WIHA 3DLQR 1KB3A 1MWOA 4P2CG 2XD3A 2CMRH 5GS1A 1FRGL 3CZGA 2O4EA 3QDGE 4JHZA 4I9DA 3NGBC 1J7VR 3F65A 5IAIA 5DHMC 4FE8A 1AR1B 1EAPA 2AKRB 2E9BA 3FL7A 1S9XB 4GKZB 1DSWA 4UQDA 4MJIB 4K3EL 4J3WA 4W68A 4K4KA 3VXSB 3DIFA 5I1EH 2CHNA 3ZDZE 3LZPA 1OB1A 3R8BB 3PMVA 4XPBH 3LQAL 5GGSA 3QAXA 4RGND 4C4BA 4TVPL 4FI7A 3TAJA 2NX5E 3JVGC 2YAMA 1F9BA 1FTJA 5JNYB 3ZDYF 5BS0A 1UVQB 3ARGD 2CLRB 5HGAB 1QWUA 1OD7A 4NOFA 4J3OF 5GRJL 3EXJA 4F7MA 2ZXEB 2GJPA 4JPKH 4KQ0A 2F6GA 4QHUB 3UTTD 4NQ8A 2GCYB 4M6ML 2YPLA 4Z7UE 3OSQA 5L4MA 1WAAA 3L4XA 4EUPH 4DE8A 2FYYA 4MA7H 1MH5B 2Q20A 4Q7DA 4AV5A 2HHMA 3LH2H 2YSTA 1KG0A 3DPBA 1XQ4A 2QV2A 4B27A 4YSTA 4CVXA 1LQSR 3QHFH 4R9HA 1XOCA 1LO3L 1KTCA 3U30C 3SODB 2XWKA 4WSGA 3ATFA 3NIFE 1IJNA 4EF1A 5J1SC 3S9MC 3BEVA 4JG0L 2B20A 3QO1A 4NWTH 4BZ2H 1AH5A 4Q0CA 2AQRA 5ESVA 2ZOKB 5D6CA 1D9KD 3SDXB 4YDVA 3LQAC 4U7SA 3C09B 2AQ2A 3QNYA 4UDUA 3SE3A 1Y18A 4ZOEA 3ME0A 2H3XC 4AIEA 2PETA 3IT8D 3MRIB 4HT1H 3EGSB 3SO3C 3WIFB 3UGXA 4B6ZA 1GGYA 3FSAA 1RZFL 4TNGA 2P5ED 3PWUB 2ADFL 4L8BB 4QY8A 3TNNA 5IWLA 4R74A 2ENSA 2K45A 4MJ6A 4X80H 5CILH 5EZIH 4B96A 2XZCH 1BD2E 3QJRB 2JNZA 3QS2A 2BOCA 2JI2A 1UA7A 4KKBC 4TF4A 4JFOB 5CM1A 1DBML 1YEIH 1ZA6B 2VXTH 2AANA 2KDYA 1UEYA 4NM4H 2CXKA 4S2SB 1ZGLA 2A5TA 3MCKB 2Q87A 3A6BH 4WGWB 4NNXA 2X9ZA 3F05A 1AD0B 3MNDA 3KJTA 4ZO9A 2DS4A 3V4VH 5BUUA 1BYOA 1BA9A 3WO3B 3C5ZB 3E8UL 4DK5A 1RK7A 4MMZA 4U1HA 4BXSV 4YZFF 4X5QA 4NN5B 3MGTB 4OZHB 5LTCA 4JG5A 1G9NC 5B1BB 4I89A 2PTVA 2X1OA 1HJBC 3AFLA 1CQKA 3P0VL 3BD3A 2JKXA 4P3WA 2IPUG 4KO5A 3UGWA 3MV8E 3RAJL 2DICA 4QXUH 5HGBA 3LEVH 4L37A 1MCSA 4JFHD 2ILLA 4ZMWA 3SKNA 2YKKA 1N26A 2PCPB 2WLHA 4MWFA 1OMPA 4NQCB 1UJ3C 2ED6A 1TG8A 1EMTH 3QUZD 5D1ZD 5EU3A 1DUZA 5B70A 2QS4A 4X6BA 1AHWA 3W82A 4ODVH 1Y0LA 2E0SA 2NW2A 1XGTA 2OMTA 1SJVA 5F9WB 1JYXA 3D2UA 1N5YL 2DYPB 3GC3A 2CNYA 4PGEA 2GTZB 3CHRA 3MRCB 3JWOH 5EUKA 2CHZA 3IU3A 4G9FA 3AB0B 2PYEE 2WVVB 5INDA 4FHJA 1GC1C 2R4RH 1P7BA 1U8NA 1O6TA 2NY5C 3N40P 1ZT1B 1X7TA 5J12B 4GXUM 3OSRA 1KGJA 4NUQA 1QSFD 4E0RB 4IU3A 2WVTA 1AD9B 2W0FB 4AJWA 4QBAA 1E28A 3H3PH 2VXVH 5T5NF 4HUUB 5BV7B 4F5CE 8FABB 5FPIA 3MLUL 1LBXA 2XTLA 3V6ZB 3GXPA 1Y6KR 3WYRA 4RFEA 3HG4A 3L3JB 5C0CA 1UIVA 2B4LA 4YMAA 5I0WA 3H9HA 1VADA 4U3HA 2PWGA 3EXLA 2HJLA 1WA0X 4YC2C 4B0MB 3MLSL 3D18B 2KYIA 4QHNA 1E3ZA 1C08B 4OM0L 1SN5A 2MOGA 5IHLB 3OHXB 3K01A 3IMBA 3U4BL 3BKYH 3BZFB 3O3UN 1B4HA 4N2IA 1RZQA 1JNJA 1D5ZB 4OH2A 3G08B 5DJZB 1O5DT 3JTTA 1E6JH 4W9KC 2CLRA 2P5EE 5I30H 4KK5D 4HEPA 2GAZB 2CM5A 1T6BX 3EDEA 4ICXA 3L4TA 4WSJA 2I32A 3SGJA 4HWNA 4FZ8H 1A7LA 3QPQD 2WBDA 3OO7A 4IGRA 2JI3A 3QEUB 3SDAA 1XAKA 4XAKE 5I15H 5T3XE 3ATBA 4P5TD 1NCAH 1AR1D 4M5YH 1F8TH 3T1BA 1NC2D 1KZQA 5LGJA 2FR4B 4H7VA 2UY7B 3V0DA 3VFPA 4XNQB 2Z1KA 1OCRB 2BFGA 4ZAKA 3NK3A 4LZKA 4Z3EA 2XTSA 3LZNA 3PRZA 4NM8L 3CFDB 1K6QL 5K9JH 2FBJL 3LRSB 1G0IA 3M17A 1PY0A 2GJ6E 4N8VA 4O02B 3NFNB 1HSLA 5I3SA 1UM4L 3AXIA 5ITBH 4FL4B 4P1EA 3KDMB 2OJTA 2QL3A 3OF6D 4JE0A 1R3JB 2Z35A 1IARB 1RY7B 3OXRB 5KYXB 5HBCA 1JRHI 3PIQB 3B37A 3MV8D 4HOWA 5BJTB 4WZ9A 2ZOLA 5GS2H 1TEGA 5I1GH 4QFKA 3UN6A 3ROLB 2A6JA 1E5BA 1MFCL 1UZ8B 1FHGA 2IBBA 3PABB 3POCA 3QNYB 4MNGE 3SCMB 1ZGLM 2F19H 5EORL 3VRLF 2V3FA 4XZ4A 4JZNB 4K7PY 2HQ0A 2LVCA 3A21A 3WIFA 5EUOB 2EDYA 2EXWD 2XKNA 3X3GL 2OJEA 3FBPA 1Y3NA 5FGSA 1JWMB 4TQPA 1W8OA 3EJZC 3O2DA 3T9WA 1KCUH 1GYVA 5IMMB 4G82A 1BECA 4IIQA 3RVXD 3L13A 1THAA 2X4SA 4GUPB 4LPUA 4U4IA 3TO4C 2X7QA 3FUIA 5E7BA 1AGDB 5DD0L 2HAVA 1R3KA 4MHFA 3I9PA 1HNFA 3P11L 5AAWC 2HFEA 3GSWA 3RKPA 1FTAA 2NUPA 3TH2T 2Q3XA 3ZDZF 3P77B 1YHPA 1DE4B 4ABWA 4NKMA 4ZPVA 3FUHA 2CKNA 4B50A 2QVVA 2CE6A 2IALB 3RUGF 4ENZA 5MEPA 2ZE0A 2WLKA 1NDMB 4P07A 1OAKL 3TNMA 2P1YA 3KYNB 1RVFH 1CB6A 4ZO8A 4KKPA 2JELL 3AQYA 1PVHA 3FUKA 3IFOA 1NUXA 2ZXDA 2VLKD 4L1LA 4KMTH 3BC9A 4WFFD 1TEYA 1QLEL 2WO2B 5D6DA 5EZPA 4OZFB 4WV1B 5I1KH 2CBTA 2ZZXA 3ARVA 5H8SA 3C5SB 2QELA 4PCKA 1NDTA 4UI2A 1QACA 2OTWB 2OFQA 4PLKD 1MW0A 3P4OB 2DWJA 2BC4B 3VFGL 3BBRA 1O7DE 3QUXA 4KDVA 5F9JB 2AXHA 3GHEL 3WEXA 5K5YA 4TNEA 2Y5QA 4BFKA 1USYE 1T83A 3TJHD 2HCAA 4RGMB 3R7RA 3VFMA 3WFHA 4NRYB 2DQVA 5C0FB 3MYJB 1S78C 4R83A 3OKDB 2IWGA 5CJQH 1XF4A 3A5VA 2B1HL 2WXIA 1ZT1A 3MPLA 3SQBA 3R06A 1OIOA 4FNUA 1XGPB 2YD3A 4KAQH 1WWWX 1RZFH 3RIFK 1AD9A 2W0FA 4XAWH 3AU0A 3QXAB 5IZ1A 3DOIA 2MQCA 4QSDA 2V33A 4HT1L 2UWEE 4PJ7E 3WSQL 2E59A 3Q28A 5CNHA 3S37H 3V6ZA 3LKQB 5CBRA 2MCAA 2NR6D 1ORQB 2BSRB 1BQUA 5DHDA 4AUYA 2ZSVB 1FPGA 4IR8A 4OEUA 2VCOA 4LZ8A 3IGAA 1P4LB 4PJ8D 4XTCQ 2E6QA 3JTSA 4G6FD 4PM1A 2EE2A 5CZKA 4JFPA 5IBUB 4YHKH 3VGBA 5L2KB 4L8SB 4Z3IA 3IDGB 1CC3A 5DT1H 3SERA 4HD9A 2OM5A 1D2PA 3EO9H 3WI9A 1MXYA 2XN9B 3VFNA 3C9NB 4W9EC 3H3GA 4FEBA 4M8UA 2VC2B 2R0WL 3QEQD 5AZEL 2XX9A 5E9DA 5F3BA 1J88A 2F8IA 5CUSH 3QSKB 4OFYA 1AE6H 2XLLA 3Q0HA 4L4VA 2QVTA 4YHIB 1A7BA 1U2HA 4MNHA 5CSZB 2FT8A 5FDWA 5HD8D 2KZ1B 2XXGA 5L7XL 1BX2B 1KLUB 5ISZA 3MA9L 2X3CA 1JI2A 5DEGA 4U1MA 1NPUA 1MQGA 2XX8A 2L7UA 4FATA 3E38A 4X99A 1N3XA 5EPMB 1PBYA 2PO6D 4KKLD 4M4GA 3TKDA 2IH1A 3WTSA 4N8VB 1NIBA 5B38B 3BN9D 3UAAA 4G3YL 4DEPB 5L8DA 1VERA 3MBED 4R4BA 1QKZH 4XO3A 5D1XA 3LZRA 3O3DA 4TVPH 3VGGA 1OCOB 2HRGA 2FWOA 4PG2A 3RDTB 1CI3M 1JGLL 5DEZA 4C4UA 3PGCA 2HMID 3DTXA 1T83C 2ZNXA 2B39A 4OLUL 5CJ5A 3KPNB 2VN3A 3FSZA 2P4AB 5DQDH 5AL8A 3HE7B 3WJMB 4DEUA 3VDCA 4AOFA 1H0DA 4ILDA 4ZD3L 4PI0A 5AA2B 1QNZL 4ESKA 5C0RL 3Q6GH 2A2QT 2W9LA 4M7LH 1T1XA 1FRGH 1IGJB 4OJDH 1DPEA 3G3KA 5T8IA 3GSUB 1VFDA 1N3NB 4PJHE 1YAIA 3CC5B 2NTFA 3OBAA 1U93A 4YHOH 1V7NL 2J1KA 4DCQB 2Z31C 4KK9C 2PFYA 4OM1H 4PS7A 1CDIA 3L1GA 2VDKB 4OF7A 5F24A 2O30A 3KE0A 3US1A 5AYTA 5B1JA 4XPAH 4I3GA 1URDA 2A73B 4HQQL 1SN2A 1YDPA 4U0RC 1RZKL 3QQ4A 3V6OA 1HKLH 1TQUA 4U6VH 4Y19B 4BZ1A 1ZKBA 4MNPA 1MRDH 4FQXB 1ZTYA 1JI1A 1DQQA 3QUYB 5EU4B 3WSQH 5AVWB 4UMGA 3ZDZB 3MP6A 2I9LA 3VFOB 4FIMA 2IH8A 1M2VA 4U4BA 1NNKA 4ZNEA 2NY1C 5CMAA 3R0MA 4NJAH 3FCTA 5DZNA 3L9EA 5GGQH 1HAWA 1WBXB 3TT1H 3VG0L 2YKLH 3L48A 5F89B 3RUGB 5KVEL 1WSST 4KOCA 1U42A 3C5SA 4DSYA 4EXPX 1HCZA 1L0PA 1CT8A 2BSEA 4KKCD 2HJKB 3QXTA 5EB9A 4XWGL 1Q9KA 3KFMA 4K5PA 3J2PA 1A7NH 3R1GH 2WK2A 2FX9H 5KWYC 4YBQD 4ZT1A 3WIIL 2MSPA 5FYLH 1UTHB 3DURB 1FYTA 3N1GC 1U8IB 2BVOA 4NQVA 2COVD 2XG4B 5M7QA 1PZCA 2HTLD 3EOTH 3WFHB 4XBPB 4WFHD 1LAFE 4KMQA 4HZLB 3ZHKA 1X5MA 1OVBA 1SDAB 1A4KA 2CO1A 3SQRA 1XF4B 2GPZA 1YAZA 3I74A 4KI1A 2CDGA 3APMA 3Q7JA 4Q74A 3U2IA 1G1OA 1R9LA 2HX8A 1LAHE 4WI4A 4MJID 3KPRE 5CIPH 3KJ4B 4FABH 3QUML 4KITB 4N07A 1QX1A 2VLJE 5C0IB 4Q2ZB 4AL8L 2EDWA 2XTJD 3QBTB 4PR5A 3L9RB 4AZUA 3GMPA 2GFBB 1B5JA 1NLDL 4QNPF 1S9XA 1OTTD 1IX2A 1A1MB 4QRBA 2Q74A 4PP2B 1SXCA 1IGYA 5E8NB 5AW6B 4BQCA 5IFHH 1MPCA 5DVPA 2K0RA 3RTWB 3VXME 1H43A 1P4LA 4DGYL 2CEXA 1WA2X 4MD5A 4OIBA 2XXWA 3LPGA 4G83A 1E9OB 4M9OA 1UGKA 5TDOB 1K8IB 3ABMB 4PJFF 5F7EH 4N1CA 3O41B 2MKZA 1MPAH 5I71C 3V0VB 2R2EB 1EZPA 2BH0A 4LSQH 2OXGA 1FF5A 1W6WA 3GB7A 2OXHA 3QJZA 4NCDA 5E9NA 3SO3B 4ZPTB 4K8RL 1EANA 3UYRH 3IJEA 5BZWA 1KPVB 1ORSA 4AJ0A 1JXFA 3BFQG 4Z7NF 1EIBA 1DMBA 3TH4T 3CFBB 3ZTNH 5C0JA 5JDSA 4R6KA 1N6VA 5MEQB 2V9RA 2DQFA 4RXLA 4C57C 2Y07H 1WUNT 4NQQA 3MLPA 4XVTL 3RVVD 2CBOA 1OQOA 2ZUQB 5F7NC 4R2GB 2K6WA 3EYSL 1WEJL 1QQDA 3HZVA 1S7QA 2IH1B 5FDYA 5LO7A 4PV8B 1OGTA 3RL2B 3U25A 1CDGA 4A7UA 4Y4FA 4XXCA 5C1MB 3O4LD 5C2UB 5T3JA 1QSEE 2FL5B 4XPTL 3PMWA 2QKSA 2I24N 3L4YA 3B8SA 1S7RB 4DUXA 1XGQA 2Z7YA 3C5XA 2ZAGA 2GBVA 5DO2C 3RWDA 1BIHA 4AB6A 1A6WL 5ESVB 4HK3N 1UASA 3CU1A 1M5FA 3RDTA 3TA4D 1TZOA 2VSKB 5D7JB 4OXVA 3CHOA 1L9NA 3KPOB 4NP4H 5IJKC 5GQBA 1MM7A 3DVIA 4GRKA 1WDAA 2W88A 4JRYB 5AEAA 4KKRA 3TEWA 2IBGA 1ZLWK 5LBSL 4A7SA 5JMOC 4GI8A 2Z7ZA 1O0VA 3EZJB 4XVSL 3RGVB 3UPRA 2JKIS 2J1YA 3RVXC 3IOUA 1QSEA 2VTFA 1U3HB 1PLGH 4JHBA 2OL3L 2J21A 4LPWA 2EH8H 2X4OB 1MCCA 3LPPA 4ELKA 4NKOB 2OP4H 4LSTH 3V0JA 1ZD6A 4AGQA 3FFCE 3UTTA 4AXWB 2D73A 5HXMA 2NY7H 3PJSB 1OP5H 3D05A 2G5RA 2WO4A 5CZVH 3IAQA 3A29A 2I60L 4FCHA 5EO0B 5FW7A 1DQIA 2WGXA 2BP0B 5T1MA 1IGIH 2ARJQ 4GRMA 3V0AC 3N9GL 2V2TB 4FJPA 3NRPA 2C4FT 1NANI 5FUZH 3SBWA 4JFXA 2ITEA 2GUOB 5F7EL 2FEDC 4N90E 3LR1A 2CRIA 3QRGH 4U6HA 1X7QB 3VXMB 2I9LB 2OMXB 3BGFC 3ASWA 1P84K 5I9QB 2VDOL 3DIFB 1N76A 5K59E 2E6JA 3I3VA 1MW3A 1AZCA 5D72L 4WNQB 1ACZA 3RWHA 1FPLA 2ZX9A 3D51A 2JKTM 1BIIB 1UWFA 4NWUH 3OAZK 1H3GA 4N22A 1UXSB 4TS6A 4QWWD 5AW9B 5IMKA 3UJIL 4G7VH 3GLBA 2DBLL 2IV8A 4JJ5B 1NGPL 3CHXA 3QJSB 1NH8A 1ZSHA 3EYQD 4TSBH 4KK8C 5I1LA 3QPQC 4PJIB 1FBCA 2WIIA 1FYTB 4FFTA 5JOPD 5DK0B 3GJEB 4KK5C 2FT6A 3AITA 4ODVL 5AOLA 1DZBA 4Z7IA 5IHWA 5TE7L 1FL3A 3DC0A 3GMMB 1VEPA 2XZZA 4KGLA 4HJJH 3SDXF 1MJ7H 1PB8A 2OA9A 4X5WB 3QCTH 5F88B 5KSUB 1ECYA 3MJ8A 3QJVB 1FRPA 2PYFB 5E99L 5C7ZA 3DP4A 1G4RA 4JO5A 4NQED 3PWLB 4IU3B 3BWAB 5TE7H 3UC0L 5I2IB 1R3LB 1JTPA 1Y6MR 1BTJA 1G5AA 5JHDA 1ZGLP 2R8SL 4J27A 2RFXA 3DPDA 1ZEAH 1RZJH 2GFBA 2OTUB 5DC9B 3FAWA 2VXQH 2YPVA 4UQ2A 3A3UA 3P4LA 3VLWA 4D0CB 2DLGA 2WLYA 4BSVA 1J8HE 4M48H 3EUDA 4YDVB 4ZYKB 3BP5A 5GISH 3TO4D 3EJYC 5IJDC 4PG9A 1FQEA 4PJBE 1N4XH 1CLCA 3O3EB 3FN9A 3ARWA 4YSQA 4J2XA 1XF3B 3RPLA 3FQTB 4OFJA 5FHNA 3K5RA 2IWKA 3UP1A 3VFRA 4U2RA 1G4MA 4ZMYA 4AJVA 2NX5D 3PPRA 3MCYA 4Z7WB 1T4KB 2FTAA 1P1NA 1YEGL 5F7KC 5CD3B 4IO3A 1JZIA 4U1SB 1TOXA 3FU6A 1PJ9A 4JFOA 3QUFA 4N2AA 3UP9A 2AXFB 1INDH 2Q1EA 3SE8L 4D9LH 3MYUA 4KVCL 3OMIB 3V6OE 2G75A 5F3HB 4M6AA 1EZVY 2DQIL 3QZPA 4AVKA 4ZMPA 5EZLB 3QQXA 5C0RH 4MZ2A 1KA0A 4ALAH 4D0DB 4UTBL 4XR8C 2ZMBA 1HHHA 1XR9A 1MQHA 2DS9A 2OMNA 4DQOL 4FMFA 5I6PA 5AAMA 4G8GB 1QSFA 2O93L 3T9VA 3O2WL 4GAGL 1KENL 5IOKA 2QGDA 1ITBB 1T6WA 1NOLA 2ADJB 1DN0A 2B16A 4DI4B 4NAPA 2IEPA 1YEWA 1F4XL 1MAJA 1L5GA 5IBLD 5B39A 2QPSA 3LRMA 4IK6A 4JRWA 5H8DA 4Z77B 5BJTA 2YO3A 4ZAKC 5FGRA 1ES0B 1P1UA 2R2BB 4ZXBD 3U1PA 4LPCA 4WI5A 4PJXE 5FK9B 3WU1A 2VMDA 1IMHC 4P2RB 3QIBA 4GEJA 5DHYB 5F70A 5GSVA 1OCCB 4QR7A 1YMHB 4G70B 3FU0A 5IVXE 1XT5A 3X1FA 4H8IA 2E9GA 3LX9A 4PTUB 4N6DA 1FN4A 3GMOA 1JWMA 4G5ZL 4JWYA 3TTMA 3OKLA 4YGVA 3GJFH 1FQCA 1P1ZB 1RDZA 3VFSA 4H8WC 4KY2A 5DJ0A 3GSNH 1S7WB 1TZHB 2TAAA 2WYIA 3FT3B 4PY7A 3UABA 1XC1A 1RZIA 2BNRB 4PBDA 4XN8A 1KLGB 2I48A 2DI9A 2R6GE 4P3CH 2NY5L 3II3A 3VXNA 3BOVA 1JD9A 3QHZL 4YBLC 2AEQL 3N41B 4M9PA 1PEWA 3SGKC 3LRGA 1YEHL 2IANE 4GBWA 1C5DA