3EF7A

Zp-n domain of mammalian sperm receptor zp3 (crystal form iii)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
480
structure length
467
Chain Sequence
MKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDRVEVPIECRYPRLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Cell adhesion
molecule keywords Maltose-binding periplasmic protein, LINKER, Zona pellucida
total genus 136
structure length 467
sequence length 480
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ef7A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ef7A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ef7A01
2FA7A 3IR1A 2VGQA 3QSLA 5A5XB 2FNCA 3CG1A 1ZU0A 3K01A 4F3PA 2H98A 1RYOA 1Y1ZA 2VP1A 3WAEA 1USYE 1Y3PA 3CVGA 1LGBC 1LAFE 3IB0A 3RN8A 3PMVA 4QF9A 4F1YA 3OO6A 5JK4A 4KD5A 2VHAA 5L8DA 4R6KA 3RTWB 1WDNA 2F8DA 3LUYA 3Q25A 5A5XA 1M5FA 1M5CA 1SYIA 2UXAA 4THIA 1DPPA 2O6AA 3HCQA 4XIGQ 3C9HA 3MC2A 1B46A 1CB6A 3TCHA 4NEDA 3JYRA 3THIA 4KYSA 4YZZA 1NNKA 1D9YA 1DPEA 1FQAA 1Z7ME 1UTBB 2IEEA 2NUVA 1AH5A 3K6XA 4H8IA 5TP9A 2O51A 1JEVA 2ONRA 3BBRA 3L6GA 3H6VA 1SI1A 3MZ9A 4R74A 4YB6A 4ZZEA 3SKPA 5TU0A 3TMGA 1FTOA 1UTBA 3IAZA 3TCGA 2O7IA 2VOZA 3PV0E 3QK6A 4NWDA 5I56A 3H4ZA 5JTYB 1R6ZA 2DWHA 1PBQA 3TUSA 1B0LA 4RYAA 3W15C 2DVZA 4DZ1A 4DXUA 4G68C 5B7DA 5I57A 1B7UA 3TTLA 4X1BA 4EXLA 1SBPA 4MLVA 2CZLA 3TTNA 4P0IA 3TAJA 1OMPA 4KQPA 1FTKA 2F7AA 4OVJA 2PT2A 3KG2A 3TQLA 5CMCA 1BKAA 3EHUA 3OO8A 4FEDA 4GIZA 1JQFA 2HZLA 3U72A 1H44A 1N0TA 3GBBA 4I62A 4OYVA 3MJNA 1USYH 1XVYA 2DXYA 3K4UA 5F1QA 1T0KA 1EU8A 2XXQA 3MPLA 4WKMA 1B4HA 2ZNSA 3R7XA 3H03A 2H25A 4RK2A 1H3DA 1POY1 4H65A 1TFAA 1MPBA 2ALUA 3BKIB 3DM0A 3EQ1A 2QS2A 3TPAA 3U92A 1A7LA 1WVJA 1P1QA 3KZGA 4AB6A 1SVXB 3VE1B 3VVFA 2ZYOA 2H5YA 4GWOA 2XD3A 2F35A 3TTRA 4TOZA 3ZS6A 3IOUA 1Y3QA 3QIMA 3E13X 4FAJA 2DVCA 3TODA 5ICTA 4LONB 1BTJA 3O9PA 5H8NA 4PFYA 1II5A 2XXUA 3O6HA 4PFTA 2QS4A 2UVGA 4KYDA 4N07A 3VLUA 1LCFA 2M8CA 1XVXA 2I4BA 2QJEA 4OFLA 1MS7A 4OFJA 4PFWA 4ECFA 3MAMA 1Y3NA 3E4RA 4MLQA 1SYHA 4G77A 1SW5A 2OK2A 3HHGA 4C1TA 1NFTA 4Q30B 4IY6A 4FATA 3SEWA 4MBPA 4ZEBA 2OJTA 2UYEA 2Q88A 1N04A 1OQHA 3IJOB 3M3KA 4R9GA 5EHMA 4F1UA 2B65A 4HS7A 2QS3A 2XX7A 3MVXA 4IGRA 1O63A 4UACA 5M2VA 1B51A 1L5TA 3RNNA 1MG1A 3T96B 4LZ7A 3VVDA 4ELPA 1JETA 2Y7PA 1D4NA 4KPTA 4I8CA 3OEMA 3HV1A 4TLLB 2WKYA 1R1NA 3CI8A 4GLIA 3U94A 4DXBA 3OEKA 1B5HA 4F3SA 4JSDA 4H6DA 2VD3A 2RC7A 3PUXE 1RKMA 4ELRA 1MRPA 2PX1A 2THIA 3SEVA 2ZXTA 3C35A 2QMXA 2YJPA 4NF5A 4F22A 1Y4TA 3TDJA 1Y9UA 1UQWA 3MP6A 2O69A 3B6WA 3CSGA 1IEJA 3KSXA 2REJA 1MDP1 1JW5A 1PEBA 1EZPA 3PUYE 2F6PA 4NF6A 5AA2D 5ITPA 1DTZA 3SEXA 1Q35A 1TT1A 1DMBA 1NNFA 3FXRA 5H8SA 5KZTA 3IO4A 4YAHX 5I59A 1URGA 1UTHB 2OWSA 1MY3A 1NKXA 2Y7WA 3O6IA 4MF3A 1N7WA 5KCJB 3FUZA 3K6UA 3ECRA 2R6GE 2OCUA 4FE8A 4GFRA 4NF4A 1SDXA 3R6UA 2A5TA 4G8MA 5DVJA 3FVGA 3KJ7A 5ITOA 2X7PA 4C1UA 2ABHA 4ESWA 2XXPA 4F2QA 1B7HA 2I0CA 4YKIA 4FIMA 3T9UA 4XXUA 3LBSA 2Z22A 1YAEA 2G29A 2QSXA 3HSTA 1OVBA 3RTFB 2ZYNA 4R2FA 1URDA 2AL4A 3N6TA 5DT6A 4AQ4A 4K3FA 4FECA 4JBZA 3T93B 1VFEA 3M3FA 3O29A 3E3KA 5K2YA 1A40A 1ZKBA 2I6EA 3CRBA 4H8JA 2XHDA 3BFUA 3VVEA 3W9VA 3MWBA 1ZIUA 3DP6A 3OMBA 5ISUA 3PPNA 1EZ9A 3LR1A 3N26A 2UVHA 3B6TA 4FEBA 3UORA 1N3XA 2O84X 3IO6A 2Z8EA 3PD9A 5TPAB 3K0VA 3O2AA 3FXQA 1Y1MA 2I3VA 1LBCA 1ZTYA 3KJTA 3OOAA 5DVFA 3TCFA 4POWA 2RCBA 2H9BA 1NL5A 5CMBA 5TPAA 5L9OA 2I58A 1FTMA 3RPWA 4U4SA 1MXZA 3K1NA 1IXCA 2REGA 4Q5TA 1D3KA 4BDMA 2F6GA 1MXVA 2XXHA 3G3KA 3KBRA 3O6GA 2O68A 4IO7A 4GD5A 4ZDMA 3FVKA 4GRKA 5K2XA 3TTKA 4I1DA 4U22A 2AL5A 1Z7NE 2PBWA 4G4PA 1B1XA 4QFPA 1GGGA 4R2BA 3U93A 4QSEA 2XXIA 1JW4A 3FATA 3G3IA 2DE4A 4C0RA 3K00A 3KSJA 3V89B 4XKRA 4H0WA 4DCYA 3NK4A 2F78A 1IIWA 2ZNTA 3SESA 4ZE9A 2YLNA 1MDQA 1MY1A 4GL0A 4WXJA 4YKJA 4JWXA 3H6UA 3OO7A 4HW8A 2AYSA 4YKPA 3K1MA 5CI5A 1B4ZA 3FIRA 3MUQA 5CRYA 5KDTB 3KOTA 3OD7A 3SEYA 2HEUA 3FVNA 3RLFE 5I57B 2XXYA 2UYFA 2F97A 1YTVA 1A99A 3FJGA 1OQGA 3OENA 4R73A 2DS9A 3GZGA 5I56B 1URSA 2D5WA 1MPCA 4U21A 4KI0E 4QRZA 4ZEDA 4U1OA 4QFLA 5DYHA 4ND9A 4XKPA 4KYEA 4ZEKA 5FHNA 2Y7KA 1P99A 2B3FA 2A5SA 3OSRA 2RC8A 3N5LA 4RJZA 1BIYA 3UA8A 2AIXA 2RCAA 3HO7A 1MQDA 3I5OA 3MQ9A 2DWAA 1TWYA 1M5DA 3ILUB 3PMXA 4GOTA 4RXLA 4X1DA 3C31A 3SDFA 3CSBA 5IAIA 4DE8A 3C34A 1POTA 2BJJX 5LOMA 4OHNA 3SEUA 3T9HB 3FVOA 3MP1A 3UGWA 4OETA 2OBGA 5FHMA 1FW0A 4G2ZA 1Y4CA 4OXVA 1MPDA 5AA2B 4XKQA 2NVUB 1UIVA 4YICA 4BDQA 3A3UA 1GVCA 1B40A 5I58B 2NWJA 4LA9A 2XXVA 3RQTA 3FASA 4BLAA 1ELJA 3TELA 4Z7EA 1LAHE 1SD3A 2F36A 3S9EA 1IITA 3G3JA 1FCKA 4XKNA 2Q8JA 1DSNA 2Z8DA 1I69A 3LSWA 4IO2A 3M8UA 1MXUA 4PP0A 2ZMBA 1B2HA 4LATA 4OEVA 4RPNA 3Q26A 4ELOA 3Q29A 4LUBA 1IXGA 3H6WA 1B3FA 3VV5A 1AL3A 5JEIA 5H8NB 3ONMA 3RUMA 1XC1A 3SETA 3KEIA 2DYXA 4NF8A 3D4GA 3G3HA 3S9MC 1N84A 4YKKA 3FJ7A 3QXMA 3ZKKA 1O64A 2QS1A 3HPIA 4X48A 5AA2A 5CBRA 4F3GA 5CC2A 2ONKE 1DTGA 5IKBA 1SQYA 3MVYA 1WODA 2O7UA 1XT8A 2F5XA 3C4MA 1LFGA 2O1LA 1PC3A 2P1SA 4G68B 5H8HB 3TYHA 1MM6A 4GF8A 4NF4B 2GHBA 4OTEA 3T22A 3VLVA 4BDNA 4H1XA 5CMMA 4F19A 3IOWA 4TLMB 1S50A 4IY5A 3HN0A 2DP8A 3MZBA 2RKMA 4EQ9A 3PPRA 2DE2A 1R9LA 2HAVA 2I49A 4RK9A 1HSJA 2R71A 2F7CA 1FQDA 1YCJA 2V84A 3K02A 4EF1A 5CMKA 5I59B 1B1HA 5B70A 3RT6B 2B3BA 3O66A 4EXKA 5CBSA 1LFHA 1MH4A 1R9QA 4OESA 4WEPA 4E0XA 3TEPA 3KFMA 4JB7A 1VE4A 3MW0A 1B3HA 1BP5A 1MXXA 3MZ1A 4G8NA 3RT8A 5FTHA 4ELQA 3PGFA 3H3GA 1OLCA 3H7MA 3PPOA 4F3BA 4U23A 1XHYA 3TFLA 5ICQA 3MVZA 2QRYA 1F9BA 4R75A 1SW2A 3CIJA 3PUVE 4PFUA 2UVIA 2OLBA 4QFKA 1MY4A 3B6QA 4X9TA 1B3LA 4OWDA 4PE5B 5KDTA 3Q28A 2Z8FA 3PUZE 2NOOA 1AMFA 3N94A 2XXTA 1M5EA 1LSTA 4HTGA 2XX8A 4H5FA 1B7ZA 5FHOA 1FQEA 4BDOA 2ZNUA 4EF2A 3PD8A 3C36A 3LSXA 1B6HA 4JWOA 4NF6B 1M5BA 2GRVA 2PMSA 2P0SA 3O28A 4GXAA 3T66A 3WAFA 4MFIA 4QSCA 1Y20A 3AXFA 3IOVA 1MH3A 5L9SA 3UP9A 2H4IA 1A55A 4OQOA 4F31B 1PDAA 1AIVA 5HM4B 5HBCA 4JDFA 4LQ5A 2KLFA 3CFXA 2ESNA 5H8QB 3NK3A 2V93A 3DELB 4OZ9A 1MXYA 3G3GA 3KOSA 3ZSFA 2H99A 5I2NB 2X26A 3FD3A 4Z0IA 1MQHA 1S9TA 4IGTA 2G93A 4H5GA 2I48A 2HCAA 2V3QA 4GXSB 3K6WA 4R72A 5AA1A 3I3VA 5I84A 4QSDA 4RA1A 1LB9A 1LCTA 5DVIA 1IZ1A 3N6UA 1N3WA 1NNTA 3K2DA 3DP4A 4JWYA 4N13A 5EHSA 1OIBA 1QKAA 3O97A 4MH5A 5J1DA 2W7YA 2Z23A 4IO3A 5I2NA 1QVSA 2NXOA 2QMWA 4BDLA 1MQIA 1RYXA 2VD2A 3CFLA 1QUJA 1SI0A 4RPOA 2QL3A 2R9JA 5I2KB 4ZS9A 3UK4A 5JTYA 3S9NC 3C33A 1H76A 2Y7IA 5DTBA 5AA4B 5BUUA 3HHFA 1QKBA 3LSLA 3LSFB 3V5AA 5H8HA 2XXRA 2HFBA 1MQJA 4ONYA 4EQ7A 1DOTA 1B9JA 1BLFA 2PT1A 1MQGA 4DXCA 4F29A 5H8FA 4GVOA 3PPPA 3T9XB 1JVYA 4H67A 4KCCA 4PQJA 2YPNA 3VXBA 3KN3A 1VR5A 3I6VA 3MPKA 2HXWA 2Q89A 1QJMA 3UN6A 3A09A 2I0BA 4LP2B 4DDDA 3KGCA 4IO4A 1EZOA 1I6BA 5DEXB 4RY1A 2ONSA 2A5TB 2XX9A 3FV2A 2O1MA 4DIGA 3EF7A 3IJXB 2E0SA 4LVQA 4OMBA 4F1VA 1US5A 4KCDA 4YMAA 3PMWA 5AE4A 1KWHA 1ZLQA 2GH9A 2RF1A 4M1VA 4OERA 4XTCQ 3F11A 4U2RA 3FZVA 4ZZAA 1LAGE 3RY3A 2DE3A 1HSLA 3JZJA 4R6YA 1A8FA 2X7QA 3FXUA 4P0GA 2V3TA 3QAXA 4NF5B 3W9WA 3Q27A 4LZ8A 2Q2AA 4KFQA 3DLNA 4JXIA 1IXIA 1P1WA 1Q1KA 4IO5A 1B32A 1JVXA 1PBPA 3MBPA 5L9MA 3VFJA 1N7XA 2RC9A 1NMUA 2DXRA 2Q2CA 3GLBA 4R6HA 3RGYA 1QUIA 4O3BA 1B3EA 4GQOA 4IO6A 5AA3A 4HCYA 5DEXA 1PB8A 4UA8A 2HAUA 2Y84A 3OO9A 2LAOA 2ZYKA 1LBBA 4OENA 2DOJA 3S4UA 3EPEA 3S9LC 3H06B 4IB2A 5KCJA 5FTIA 1GR2A 1P1UA 1B3GA 1VSOA 3IK6B 5F7VA 5BWJA 1ANFA 1HSEA 5CM6A 1MY0A 4KR5A 1US4A 3P7IA 5H8FB 2ANJA 3ILTB 4KHZE 1FQCA 3QUJA 3U1OA 4F2OA 3FV1A 2GHAA 3TQWA 1MXWA 1B0HA 2RINA 3A3CA 2DWIA 2Y7RA 4EUOA 1EH3A 1NH8A 2Q9TA 1NNPA 1O7TA 2V3UA 3V8XB 1OVTA 4HCWA 3IL1B 2DSFA 2I4CA 2D3IA 1B5JA 1IUDA 3SERA 1UTHA 3TTMA 3USDA 1I6QA 4G8HA 1NH7A 3TKDA 1JNFA 3KN8A 2OWTA 4JSOA 4E0WA 3TZAA 4ISUA 1LB8A 3G3FA 2HZKA 3BFTA 2UVJA 3JV9A 3C32A 3CFZA 3ODBA 4QFOA 3OXNA 1GV8A 5AA4A 5HPQA 1FTJA 2PVUA 2HQ0A 4L17A 5EYFA 3UIFA 5I2KA 3IX1A 4FORA 3R26A 1P1NA 3E9XA 4POXA 4OFOA 1JEUA 3H6TA 4TQUQ 4DCXA 4O3AA 1B58A 3K1PA 1FTLA 4OEUA 4FJPA 3KN7A 4BDRA 4U1ZA 1ZBMA 4N6PA 4QFNA 3CR9A 1CE2A 4PETA 3VXCA 4ESXA 4NTLA 1AOVA 3V83A 4DLDA 2F7BA 3EHTA 1IXHA 3QUFA 1FQBA 1A54A 1B05A 1ZMGA 2I3WA 2PYYA 1ATGA 1JW1A 2GFEA 1S7YA 2XXXA 3PPQA 4NF8B 3B7DA 4F18A 4R9FA 3IOTA 3S2VA 1A8EA 3ZKLA 1GTKA 3MP8A 3U8QA 3EN3A 3K6VA 2XD2A 3L6HA 2P2AA 2D21A 3PUWE 4GL8A 4NE4A 4NMYA 4ZEIA 4YMBA 1XS5A 4I9DA 1I6AA 3D4CA 3MVWA 3PU5A 1LFIA 1N76A 1QUKA 2F34A 4ZE8A 2OZZA 1LAXA 3DP8A 4G68A 4M4GA 4WEDA 2DWJA 1H45A 4F39A 4ZECA 4AB5A 5I58A 1IQ7A 2FYIA 1B52A 1H43A 4YB7A 4EQBA 1QW0A 3IORA 4Q8RA 2QPQA 4ZEFA 1ZJLA 1OLAA 3G7WA 4O3CA 1PB7A 3GBAA 1PB9A 1TXFA 2E1SA 3LC8A 3FJMA 3M3LA 1YPNA 4LZ5A 1J1NA 1D9VA 4U4XA 1XOCA 2DQVA 3QYTA 1LLSA 1MM7A 3EHSA 3CG3A 1QULA 4LQ2A 1TFDA 4NWCA 3GXAA 4RNSA 1B5IA 4Q0CA 2XXWA 2ZYMA 3IB2A 3OELA 4P11A 3IB1A 4YB5A 2IA4A 1VFDA 3FGSA 1UIUA 4YU0A 5ELVA 1P1OA 2CMOA 4QHQA 3T9VA 2V25A 1FQFA 3OSQA 5TP9B 5H8QA 3VLWA 1SW1A 3VDFA 4EDPA 1MY2A 1SW4A
chains in the Genus database with same CATH superfamily
1BD2E 4XCCH 5CEXA 2ADJB 3VWKA 4V1DE 4E9VA 2G3ZA 5C2BL 4MA8L 4ZAKC 4G9DB 3CG1A 1ED3B 1WYJA 2P5EE 8FABB 4JQXC 1RZFH 1NEZA 2I25N 2OMTA 3R7QA 4FFZA 1LGBC 2VXSH 2XPGB 5GZNA 1WP6A 3QORA 2COVD 4LHUD 5I0ZA 4PP1D 2G0LA 5HPMA 3LHPH 5CXPA 1ZANL 4K7PX 4FLHA 4WI3A 5J6HB 4WO4C 1KEMH 3K71A 5DHXB 4PRPA 3J8F7 4M3JA 4OFPA 5F96L 3RU8H 4ANVA 3EYFA 4OTXL 5GGTH 1UXMA 2ONRA 1UB6A 2VDLH 4G6MH 4HJ0D 1RZIA 1FL6B 3C5JB 3DX4A 2VOZA 1KT2A 3TJEH 5JTYB 2BCMA 5IWLC 1H6FA 1V7ML 4OF7A 1FVCA 3TUSA 3B3IA 2Q3AA 2WIMA 3AY4C 1LDPL 3GSXB 1EJ6A 3PHOA 1NEPA 3L54A 2P5EB 3KG2A 2NR6A 4AEEA 5JIPA 2WOBA 3EXJA 4GIZA 1F56A 2OA9A 4PTUB 3KBPA 1Z9SA 2H3XC 2IMNA 2X9YA 3JZ7A 4MJ5A 5SWSD 1NAMH 1G7QB 1USYH 5T3XE 3F83A 4HC1L 2XXQA 3BGAA 3O2DH 1L0PA 1U8HA 1KYOJ 2R39A 4KZCA 1IGIL 5CILH 3KYKH 1TFAA 43CAA 1DQLH 1M56B 5T8IA 2FJFA 3WTUA 1KTKE 3RZCA 2MKWA 3KZ8A 2WHVA 4U1KB 2G3MA 3OZKA 3E13X 3L5HA 4W4NA 4I9XA 2CAKA 2DM3A 1GCYA 2K8MA 2YIHA 3MV7E 4ODXA 5I6KA 2UVGA 3BSGA 5AW3B 3KPLA 4QD2E 5CCKL 4NC0B 2EKSB 2PTTB 2W1NA 2PMZA 2Z92B 3HC3L 3WAJA 5J1SC 3DMMD 2HJKB 3L3JB 3VU1A 5IY5B 2N7BA 2XYCA 5D8JH 4B27A 3LXAA 4FATA 5E00A 2R0ZL 4YHOL 3CFDB 4DGIH 1MSPA 3VFVA 2FJHA 4MLSA 4POZD 4HS7A 1I9JL 1P5VB 3ATBA 4G6JL 4X4ZA 5ABDE 4JN1L 3RB7A 3H85A 1FO0H 3B2XA 3QFDB 5JLZB 5H4ZA 1HZHL 3NEEA 1IEAA 2P8MB 3ORJA 4HIIA 2YRBA 4KXDA 3FFCB 3TEXA 1TUPA 4H6DA 4QAMB 3PUXE 3VRJA 5J3HC 4XXDB 2JI1A 3BRDA 3TDJA 4W9FC 3EDJA 4K3EL 4B3VA 1T21B 3B2VH 2C34A 4LSRH 2JKRM 3PWVB 3AU0A 4H8WC 5E6IB 1LD9A 2FEDD 4PJCA 2XNAA 3IFAA 3SGEH 4DVRH 4NZ8A 3D8MA 4U7MA 1AFVL 4TULL 4WWKC 1TT1A 5KBMA 1P4UA 2FBRA 3IO4A 4F33B 5A2IH 4NF4A 4BE6A 3IWUA 3VXUD 3ZE2B 2KDGA 1UFUA 3UADA 3WFBH 1A6AA 4V11A 4AC4A 2EDQA 4G11A 2MNWA 3CVIL 4MSWA 3BWUF 4XN2A 3QZWB 4FHBD 4ONHA 1QQDA 3P30H 2D3JA 2AXHA 5GIRA 4Z3FA 3QYNA 3E79A 4N5EC 4FECA 5AOMA 1IBGL 5GGVH 3T1FA 2VDKL 3B1TA 2CHWA 1UZ6F 3BFUA 1PSKL 2J8UA 4NUGL 4R7DB 1FBEA 1SPDA 1RZJL 3Q2NA 1PG7H 4FF9A 3RTLA 1Z5LA 3RVUC 5IJDC 4BHUA 1J1OL 3QDJE 5G2NA 2GVYA 4M56A 4XXWA 3IT8D 5E8OA 5BZDA 5I1EH 5JZ7C 3KJTA 3CFUA 4JY6B 1BVZA 4OIFA 1OGAE 2EIDA 1ICTA 1INEL 5G4OA 4B41A 5C86A 5JYLA 1NEZB 1F86A 4XRCB 1L4IA 1CB4A 1NLBL 1MVUA 5DMGC 1QBMH 5EOCJ 5BZWB 1U3YA 1VFOA 5SWZB 1AMYA 1Y6KR 4X4XB 2YARA 3IDYB 3AZUA 4Q6IB 4OGQC 1BYPA 4L4JA 3CBRA 4UAHA 35C8L 2IDTA 3FTSA 4RRPG 5KYWA 3QBTB 4GL0A 1FP5A 1MCPH 3EOBB 3ETBJ 5K9QI 4F27A 2QMKA 2DV6A 4YKPA 2MHAA 3W3BA 5E6ZA 4WY7L 1EHLH 1J8RA 5FLUA 2HH0L 3LZFH 2V5TA 3X3GH 3EJSA 4J1UA 3IMWA 2FGZA 4AGNA 3FT1A 5DC2A 3BFWA 3UPAA 1MPCA 4LOUD 2YO3A 4CVXB 1O6SA 2G2RA 3BDXA 1MUJB 1EGJH 1XZ0A 4KRNA 3BQVA 3WHXA 4OM1H 4HBCL 1NCGA 3UBXA 3RVXC 4YHIA 4Z0XB 3JT0A 3TBYB 1IFRA 2AF2A 2N01B 2WXHA 2M26A 2MWCA 2NSMA 3RVUD 4OBRA 4LVHB 5SV4A 1BQSA 4LPVA 1XWVA 4HT1H 1DN0A 1XCXA 2PCXA 4GAFB 2PO6A 3V6OA 4OHNA 1NPNA 3APFA 1E67A 3MRFA 3S37H 1RXLA 2NXYD 2ZPKH 3PWPA 4JQVA 1KGYE 3UTQB 3UX9B 4U33A 3NIDF 1JV5B 5KDTB 5L8LB 1MFEL 1ZPUA 1G9NC 3G3JA 3MV9A 4XNQB 1W16A 2EKSA 2PTTA 4UIMB 3KVPA 4PP0A 4R7NB 4L9LB 3ZL2A 1OZTG 1ZT7B 3PUCA 2Y6SD 4OV6F 3OPZH 1E42A 1XGPA 3QWRA 4IDJH 3TIDB 3H6WA 5JEIA 4NIYE 3KYAA 4DKFL 2VLKA 3GMLB 2VABA 5GZNC 1OVZA 1AGBA 2WB7A 1XT5A 2AK4E 3U2JA 4AGOA 1N84A 3IF1A 2CUMA 5JUEL 1O64A 3T3PE 3GXIA 3GC3A 1PVHA 5AA2A 3KLDA 4PJ8D 4UT6L 1SEBA 2ZOTA 1WA1X 4KVPA 4BK5C 3CN3A 4I9WE 4U2ZA 8FABA 1WODA 1MIEL 2H7WA 2IANB 2BVTA 5AW0B 3REWA 3ZRSA 2I07B 4BDVB 4NHCH 4FNQA 3OKEB 2M8XA 2YD2A 4JPKL 2NW2B 4P2OC 1LEGB 4HETA 3CZGA 3HN0A 2RKMA 4L8BA 3SE3C 3RILA 3W39B 2DE2A 1WD8A 3CHRA 1NUZA 1U8JB 1W72L 3DC0A 5T5NF 3L9YA 4I3RH 2A6DB 1R9QA 1JVKA 3S36X 3L2LA 3KAAA 1I8AA 3KPRB 3H3GA 2O1AA 1M3IA 5AOZA 5AUMB 1A9BB 3L95A 5IV2B 3MUGB 4K8RC 5HYQA 3VFUB 3MO1A 2OLBA 3WU1A 1T1YA 4ZQKB 2QHRL 4BCXA 5J13B 4OWDA 2Z8FA 3QQ3B 4P2OD 1TEGA 3PUZE 2X3AA 1NPJA 1FPIA 1L7TH 2I7OA 2NY1D 1DFBL 4U3SB 1FQEA 4TLKA 5F2FA 3LSXA 1D5BB 1QLRB 1E4KC 4BSJA 4MBRA 3ZDXB 3M8OH 3NCYS 1E27B 1URLA 5EORL 2GHWB 1JPGB 3LB6C 4XWOD 5CO1A 1OIOA 3LKRA 1IJNA 1A55A 3WL9A 4JRFA 1BQRA 5HBCA 4NERA 2Q7AA 3RWDB 3P3SA 1JZ8A 3KOSA 4ZW5A 1U42A 3HE6A 5KSBE 2O93L 4IGTA 4N8YA 3O3EB 1GIGL 4XTRD 3PG2A 2YXWA 5BQ7A 4F8PA 1Z0NA 3BLKA 4AS4A 1LB9A 5EU6D 1YJDL 5FYJU 3O2DA 1NNTA 2F7IA 4WW2F 4PMEA 3C5ZD 3T4AB 2PTUA 4TQEH 5AW5B 2UY6B 2NYZA 4FQQB 5FB8A 2LV4A 5CD5D 4UM9D 1UB5B 3HR6A 4HJGA 3PGCA 5ISZA 3LB6D 1D7DA 2CZHA 2BZCA 2WN2A 4QUOA 4HCRL 1FAKT 5B1AB 4X7TB 3WNLA 2G4EA 1VFUA 4KGLA 1HOEA 3E6FB 2Z1PA 4ODVL 4X7SL 1MQJA 4ONYA 2OI9B 3G6AB 4JLRA 4L3CB 4TUKL 3F5WA 1LO2H 4GO8A 1WAAF 3VW3L 4PQJA 4KOBA 2XOTA 4HIJB 2AVFA 3I6VA 1NLBH 2J6WA 2V6HA 4FHKA 4ABUA 4EO5A 2ZWKA 2ZWYA 4EVNB 1SFDA 2HT2C 3ECQA 3LYRA 4AYMC 3JV4B 2ONSA 2LR4A 1EEQA 3O3BB 5I18H 3FUFA 2WXLA 3TL5A 4BFNA 1T6WA 4UANA 5I23A 3OG6B 4ZZAA 1DBML 4RMTA 1D7CA 2B2XH 2AEOA 4UTAH 4OB5H 1TVBA 1OY3B 4JHAH 5EUOF 3CC5A 1WISA 3EFDL 5CGTA 3VFRA 1NV2A 2NY4C 5MP6H 3MYJB 4PJGB 3LEXA 4HV8B 5L9MA 2CO4A 3I6GB 4HJTA 3PHSA 1GTNA 3IMBA 5KS9A 4Q56A 1RZGA 4ZTOL 3EO9H 4JO1L 3LEXB 4HV8A 3X1GA 3UBXB 4ADJA 4AIZB 5TE7L 3RY4A 1GZQB 4LNRA 3Q2CA 2FB4H 4CSSA 4DGYL 1CTOA 3ZIMA 1XVSA 2Z7UA 4AW7A 1EXUB 5LO7A 2DH2A 3EJTA 5BV7L 3QUJA 1NFAA 1P84K 3Q01A 4PGEA 1B0HA 2E4TA 2VXTH 2VZUA 5CJQL 4M1GH 1EH3A 4A67A 3DI3B 2GT9A 4ZPVA 3GB7B 4LQ1A 1UTHA 5G5DA 3BKCL 4K71C 1DVSA 4DKDC 3ZL4H 1HHJA 3LNFA 1U3HA 2CDFA 4J8RA 4WK0B 5SX5K 4L29B 5F3BA 5EIIG 4FZ8L 3ES6A 2XDHA 4ZS6D 5IWLA 2FQGA 5DLML 4JCMA 2JJVA 1QHQA 4FXGC 2KLRA 5F3BB 3MJ9L 5LDUA 2EADA 2IBGA 1IAII 4ZFOA 4POXA 3PQYD 1GOFA 2DQGL 3C5SA 1OB1B 4JN1H 2TRYA 1T5XB 4N2BA 1C1EH 3FQNA 4PUBH 1U8CA 3VGBA 3MFGB 3NSXA 3ARUA 5J1AB 3TIEA 4GH7B 1WBZB 4BFJA 1AG6A 1ZHBA 2Z93A 4Y2DD 4R97C 5EO9B 2FDBP 4DP9X 3MP8A 3EUUA 4IK7A 1CFQB 2NY4B 3BUDA 1T03H 4DP8X 4ZEIA 1CFSB 3BVNA 3GI8L 3H9HB 5I8EA 2YQGA 5JPMC 4BH7B 5AENA 1D5XA 3NIFE 1H43A 4EI0A 4PAZA 2YFOA 4EN3D 3ECVA 5AAMC 2PYFB 4QNPF 4WW1B 3N50A 4Z3HA 1T1YB 5IT2H 3S7GA 1J1NA 1XOCA 3QYTA 4LQ2A 1S78C 1QULA 3SDAD 4Y2DC 3ROOB 1DQQB 1CF1A 3HFFA 4YB5A 2OMWB 2XYBA 5JPMB 4IHOA 3SDCA 3PWJA 2AFNA 3S88H 4ZFZA 2X09A 1MCKA 2DLGA 4Z7VF 3IR1A 4HCGA 1M53A 1TZOA 4JFHE 2H2SC 5A2CA 3GI8H 4AQEB 4ZUTB 5H37G 3QIUA 1RJYB 4JEGB 1X5HA 4P9HH 1GC1H 3QEHB 3NOHA 4PAFA 1RMFH 1U3JA 5MEPA 1NIAA 1UD6A 3QO0B 3OVUB 4FE9A 5IB1A 4DEPC 2VITA 1YN6A 1OTUC 3BAIA 3HCQA 1NAML 3EYSL 4AQ8C 1FL6A 2P7TA 1G0YR 3FT4B 3P4OB 4H8IA 1IC0A 1TZIA 1QRKA 2NY7H 1AMXA 1YY8A 2PYEE 4RMQA 1JPTH 2X5PA 2BRQA 3JT2A 6PCYA 3RL1A 3IAZA 3TT3L 2O7IA 3BYYA 3N42B 5ISZB 3IFOB 4DPBX 4NNYA 1XGRA 3MV8D 5F3HB 1CXKA 5EDSA 2DVZA 5IJVA 2CCVA 3OC8A 2HPOA 3HI1A 4Q0XL 5C9JA 3BPCB 3KVQA 4HXBL 1NI9A 5LN8A 4KI5C 1DVFB 4JZOA 5C0AB 2ZX6A 3L08A 3WFZA 4QRPA 1M6OB 3FSAA 5HDOA 1QOKA 1MCRA 3SPJA 5CMCA 4P2QA 4BFIB 1BKAA 3DV6B 3D34A 4HS6A 3ZE1E 1QSFA 4APQA 4I62A 3IDNB 3MJNA 4QRPE 1FBDA 1JNNH 2XA8H 1A65A 3SPIA 5IJKC 1J8HD 5EF1A 3BFOA 4LAQL 4OI8A 4JFED 2I5YL 3GPEA 5FDWA 5I71B 2ZWLT 5EU6B 1HCFX 1CUOA 4JJOA 1I8LC 4OAWB 3QI9C 4Z7NB 4O2CA 1M2VA 3NA4A 1FPGA 1NCDL 4P5MB 2QVUA 4YK4B 1LGVA 2HVJB 4WO4D 3QXAA 3H9YA 3H54A 5HHPA 4OQTH 1RPQA 3SY0A 5JHDA 1GS7A 2KMWA 4YSPA 2VC2B 3SE8L 4OJFH 4KZEH 3FU7B 2R8TA 2VDPL 4HJ0C 5KYYB 4KYDA 2ODIA 2PCRA 3H2QA 4BSVA 1S7SB 4PS3A 3P4LA 3UTZB 1HQ4B 3E6FA 3CCHA 4NOBA 4WY7H 1EHLL 2FWUA 4R5TA 4DKAA 4ECFA 4F7EB 4DJMA 4MLQA 4RWHA 3ATFA 1AZNA 1S7XB 1S7SA 1ZLSH 3JWDC 3WIAA 2WEFA 2OL3L 3L48A 5CBAB 2Y2WA 2K3HA 3AGWA 5B38A 4RBPH 2EVHA 4R9GA 1F6FB 4LOVA 5H94B 5MERB 2QS3A 2M1KA 1KN4L 5DFVC 3X14A 1O63A 3GSNH 2F54B 3T0EC 2DYPD 5DJYB 5E6YA 4XTRC 4KPTA 1XX9C 3M17B 5D2LE 5DRNA 4AC2A 2Q7YB 3DK0A 3LZOA 1T2JA 4PMFA 3EO1B 4IOSD 4XAWH 4F3FB 2R0KH 3UMNA 2H26A 2O6EA 1JZGA 1LILA 1TENA 3ECBB 3FOMA 5GRUL 2EE6A 3ZX1A 2EDFA 3WJMA 2DB8A 4ZTEA 2YJLA 3QHFL 3AB0B 4F2EA 1CICC 1NCJA 4QOKD 1PMYA 1SJEB 3HN8A 3NZUA 4QRFA 1T89C 1PD1A 1AQ8A 2D2CC 3ZRCC 3L16A 2W92A 4B5EA 5GJSL 1KIRB 4M1DH 3QUYD 5E9NA 4Z7VA 1CURA 2YGVA 5T5FH 5DEGB 4N5UA 1EYKA 3IE9A 4NO3B 4Y4KC 5CFHA 2Z3FA 5C0AA 2X7PA 4F2QA 4PY7A 1YYCA 2BJMH 4PGCB 4FIMA 4MKMA 3ZE0F 4F57L 5EU7E 4MMYB 4HUVB 2EYRA 3BN9D 5I8EB 3FB7B 5L2KE 5IW3A 3HSTA 2YPLD 3RTFB 1WFJA 4KKCC 4UV4L 3N6TA 2FWLB 5A7BA 1E9QA 1CICD 1HFUA 2A4EA 3EJZC 4D3CH 2ETWA 2FX9H 4JB9L 3V4PA 4MNHA 1NSNH 1IGJA 2I6EA 4H8JA 3FO2B 1VGKA 1UXWB 3GK8L 1RERA 1OV8A 3H6JA 1DVXA 2YBGA 2BP5M 3BD5A 1OPGL 4TTGA 1PX3A 3EYVA 4YUEL 3WSQH 5DUPL 5I1HH 3IJHA 3NIGF 5HDQH 1L7TL 1JDAA 3FCSB 3S4SG 3P69A 2OS7A 3T0ED 3ESMA 1AKJD 3TBSA 5I1AB 4ZFZB 2H9BA 4NBZB 3EH5B 4AQAA 3BSZH 1FZMB 4U4SA 2Z34A 1QWHA 5FYKD 1MXZA 3QIUB 1SRDA 1UWXK 3UJTL 4YXLH 4QCIB 2XZAL 4M93C 4XP5H 3C6LC 5DWPA 3WY3A 4LLDB 3VI3F 5DK0B 1ZHLB 2VDKB 1PIGA 3R8QA 3U93A 4NQED 4KI5F 5DFTA 3O9WD 3GB7A 1IEAB 3HE7C 4HIIB 3O2WH 4C0RA 1PJ9A 4DW2H 1BJ8A 2DLFH 3N6YA 4L5FE 3H9HA 3AQDA 4ODTL 3O8XC 4PJ7E 5ID1B 3VVVA 3MGOA 4CU6A 2JV6A 5F0JB 3MUQA 1XF5A 2C9RA 3C6SA 4FFZL 3FVNA 1AIZA 5I57B 1XGQB 3UZQA 1SXNA 1XDTT 3SO5A 2J8UE 4KH2A 3SDYH 2A74A 3MBXL 4U1IB 2VLLA 3TZVC 4HIHB 3LOWA 4H20H 1AVAA 5TE4H 1RIHH 2ED7A 3RJDA 3MLTB 1BREA 4ZSOB 3IFNH 4X9YA 5C6WH 1VZIA 4OD3H 4DKFH 4GMTL 4AL8L 4LSSH 2ED8A 2AGJL 2ZF8A 1EANA 3MSTA 1X5XA 4N8CH 3ILPA 1ZGLM 1DBBL 5INCA 1POTA 4W9DC 2N0MA 1D6EB 1KTLA 2W9LA 2DI9A 4HFUL 2H0JA 4W6WB 3ZYJA 3EFDH 1O6TA 3IDGB 2F7QA 3CBJB 4JFPA 4OXVA 5JDJA 3Q9QA 1GVCA 2VMFA 4PJBE 5I1DB 1YN6B 3D2UA 1J7VR 1HC1A 1TFPA 2YAMA 3FC8A 4G80A 4YQXL 4LLMA 2WKOF 2UV3A 1FCKA 1TTBA 1SOXA 5T1LD 5MEOA 1VDGA 5KSAD 1AZBA 2Q76A 4AMWA 3B50A 4LUBA 4KXZI 2D3LA 2GYSA 1HHIA 2PCPA 1ZD6A 2WX9A 3AREC 3G5ZB 4LDEB 1EEUA 1NCDH 1AJ7H 4TVPL 1OQOA 1XGYL 4BUHA 3PGCB 1WG3A 3QXMA 5C09B 3TXAA 2ONKE 1P7HL 3GM0A 4PJ5B 3FFCA 5KTEL 3N1PC 4WFFD 5J89A 3JYCA 1RURL 5KVDL 3UJIH 2RALA 1IQDB 2B0SL 5IVZB 4CVZB 5T33H 4EXPX 4P11A 4XN5A 4JG9A 1TVDA 1NOLA 3G6JA 4GT0A 2GI0A 2EDKA 3PHAA 3OKNB 1AGEB 4W4OA 5BUAA 4NC2B 5IBTH 2IWGA 1P0SE 2PP8A 4RX4A 4E9RA 4FQIL 4EQ9A 1F4WH 4JM4H 2XWCA 1PIFA 2HAVA 4PAIA 4JKMA 4P57B 3IETA 5CWSB 5I5RA 1MRDL 1E4XH 2X2JA 3MYJA 5JR1H 1HSJA 1TTAA 5I59B 1NGXB 4FQCH 1DK4A 1ROWA 1A6WH 3L3IA 2BHFA 1MH4A 3ILEA 3L9RA 1H0DA 4YZFF 2WYIA 1WIOA 4ODUA 5CJQH 1OLCA 5DK3A 1J12A 1XF4A 1AXSA 2KERA 3FFCE 4JZJB 3HVNA 4NGHH 4P23C 5ACMA 4X6BB 3H0TB 5L4MA 4R75A 3RP1A 5DRZA 4M9OA 4PV9B 4LBEA 1HNGA 1QFWM 3DV4A 1Y6MR 2W0LA 1JZ4A 3KM2A 4YHYC 4YBQC 1M71B 3N94A 5JTWA 2XN1A 4OH2A 5EQAA 4LEBA 2QQQA 5KBPA 1ACCA 2J4WH 3LS4H 1V10A 4KVNH 2OXGA 1X5JA 1T4KA 3H3KA 1U91B 3BLBA 2X4PA 4QRRB 2PMSA 1VFMA 3CHXA 5BOPA 1PDKA 2R51A 4EI5A 1UM6L 3AG4B 1TYJA 1WBYB 2NY2D 4LHJB 4XP5L 3KPSB 2KLFA 4M7LH 3OB8A 1SYSA 2H99A 1AHWA 3ULUF 3SY0B 4Z0IA 4WHDA 1MQHA 1S9TA 3ZDZE 2NX5E 3HVDA 3IDIA 5DUJA 4GXSB 4O94A 2DD8H 2FT8A 1KWGA 1UA3A 3NQKA 4N13A 3TPUA 3GSXA 1YEFL 1PKOA 2XVLA 1BF5A 3WO4C 5DYOA 4AV5A 2EUXA 5I2NA 1S78D 2Y7OA 4KHTH 4M62H 5E00B 1L6ZA 2EINB 2Q1EA 4QDGA 1RZ8B 3B2UD 4ISVA 1TYRA 1Y1DA 5HYJA 1JZDC 2D03H 2D7TH 4KK6C 1J9TA 5AA4B 3MOAL 2G2NA 3QDJB 4FXKC 1F58H 1RK7A 2IFGA 2NZ1A 4NAMA 4R0LA 3K80A 3MRCB 2ISDA 5ACZB 2CR3A 3KGTA 4JW3A 4DGWC 5BVJB 4HUVA 1B9JA 4XC1H 3FF7A 2GSIA 5F0PB 4ALAL 2IALA 5IG7B 3WNKA 4QYOB 1YMME 4MZ2A 3UZEA 2B9AA 5KSBB 1LO5B 2NXZD 3MX0A 3VUAA 1EZOA 2WVVB 4JBSA 2XETA 3WJMB 2XBZA 4MAYC 5IQ7L 3RL2A 2UZXB 4JO3H 5F21B 3ZTJH 1AZZC 5EUOA 4LCIH 3LAFA 4JK0D 1SJEA 1ZGLB 3HPJA 3JBG7 4P07A 5E4AA 1LAGE 3LNEA 5B3NA 2WVSA 3JZJA 2CO6A 3QDGD 4I85A 5KTEH 2OJZH 2CHNA 2XZZA 4NC1C 2O4EA 2GKIA 1BMGA 4HXAH 4MJ5B 5DD5L 4HKZB 3WUWA 2QPSA 3JV6B 3R1GL 4X83A 1AOZA 2CDEB 3MBPA 4PJBF 3GLBA 3FUKA 3U79A 2F1BA 5BQDA 5EPMA 1JMXA 3MUZ1 3TVMD 2VR4A 3K6SA 4Y9GA 3NJIA 3F7VB 2WBJB 3ARSA 2ZOOA 4Z76A 2ZYKA 2X4PB 1OSZB 4AITA 2JKTM 5DFAA 2QKIB 3VI3E 4ZXBD 1TXKA 4KKQA 3P7IA 2YD3A 3W9DA 4KHZE 1FQCA 3QUZA 2APTA 3T6XA 2DLEA 2GSGB 2PR9A 4WFED 4X42A 3CVBA 3UG3A 2J1WA 2HVJA 4DP4X 2RMNA 4HUNB 2V3UA 1K5WA 4JFYA 4APXA 3DPDA 5SX5H 1HZKA 1S9WB 1TQUA 1W15A 2QTVA 2ZYRA 4N0CC 4N0UE 4OD1L 5I73C 5IQMA 3TTMA 5IMKB 4E0WA 2KHAA 3SJVA 3PHQA 5HHQA 3TBBA 4ISUA 5FO8A 1PPIA 5BZWA 2ZUQB 2HZKA 2FNWA 5AA4A 5TJWK 2IGTA 4KO6A 4WNQB 2CGRH 3HLKA 4QRRD 3T0BA 2MH4A 3BAEL 4AMKL 3CQPA 3BMWA 1SJMA 3TX4A 1FTLA 3WN5B 4JM2C 5J1AA 2J25A 1P7KB 1HDMB 5I8OL 4K9JA 3BUPA 4B9FA 4W93A 3HZKA 3QWNA 5KOMC 1DVFA 4JZOB 5LG6A 4XP1H 1NCUA 1QA9A 1XMEB 1ADQA 2VXUH 3DUHA 1U9KA 4QKXB 1OANA 4Y7MA 2OXHA 3TO4C 3TWCH 2MOGA 4JCWA 3WHXB 1GOHA 5D7JD 4L5FH 4M48L 1KYDA 4XVTL 4IJTA 1PG7L 3RUGF 2P2AA 2FWOB 3IAGC 1ZS8B 2OMXB 3V9CA 4HLEA 2XG4A 1FRGH 5H2BA 1LMIA 2C9PA 4WK2B 3VD0A 2YR3A 3Q2VA 1WBXA 5IQOA 2FO8A 4OGZA 4J28A 5LWYH 2AXGB 1SXCA 3UAEA 2HFGH 1PB7A 2H41A 3VGEA 4IW4C 4E5XA 5CJXA 4TV3A 4Z77A 2XQ0A 1T0PB 1YPNA 3DV4B 4D0CB 3CDZB 2H0PA 3ZZSA 4V2CB 2XQYG 3UERA 1ITBB 1TFDA 1E6OH 4ZS7H 4BDQA 3LNHA 4IOFC 5C0IA 1MRFL 4WTWA 4HKJA 4LP5A 4MB5A 2GCYB 3DETD 2DKUA 3U6XA 3ULVC 2TSAA 3QQDA 4J3VA 4Z7UB 1D7FA 4WJ5B 2W95A 1SW4A 5D7LA 2A74C 1YUHA 2FNCA 1TPXC 4O02A 3NZHL 3QNYA 3HIZA 4KQ0A 2NZ9C 1A22B 4Q6IC 4Y5VA 1H3WM 3QNYB 4LLQB 5IB4B 1R4XA 5T1LB 3MRMA 4X7CC 4YO0B 4PJAB 1DPPA 4IOFD 1VADA 4OZGE 4JQIA 1TO5A 3IFNL 1F2QA 4YBLC 5CZKA 1FTOA 2PO6B 1NSNL 1J1PH 3QK6A 3N9GH 4EVNA 3GINA 3TZVB 3ENEA 3PLYA 3A6OA 1AZRA 4FERA 3MCKB 5CBEA 5LHDA 4JPIA 2JF1A 5HYIA 1YQ2A 1WE5A 2PLTA 1A1NA 3FN0L 5EQ9A 4X1BA 1I1AC 5D55A 2OZNA 2QVMA 3LZLA 2I60H 3HE7B 1H3TA 5KSVB 3NQIA 5D4QA 2HT3D 5A1AA 1A5FH 1ULVA 5E1IA 4NNPL 4YIQA 1LHZA 1XVYA 2A0LD 1K4DB 4ODWA 4ZOEA 3RY6C 1IZKA 3EFOA 1EDQA 5FGBA 4MTMA 3G6DH 1BF2A 2WYKA 3ME0B 3FULA 2DF3A 3KZGA 5IVXA 1HILB 3NN8B 4J3XA 5F93C 2YUWA 4M93B 4WW1A 5LUMA 3IOUA 5HGHA 4LCWE 3TASA 1UGNA 4FQJL 1XB3A 1S5HA 3MNZA 4XAWL 3ET9F 3RWDA 3EHBB 4DZBB 5JLZA 4P46C 1ES0A 1IGFH 1F4YL 1PY0A 1JPGA 4HUWB 4RGNB 3QR0A 2QSCL 1NLDH 2O5YH 5AQ0A 3LDBC 3NFNA 3BP5A 4OCNC 4MDJB 5AAMA 2FHCA 3HHGA 2IADA 3MNDA 3Q6GH 5EO0A 4X0KA 3TBCA 4ZEBA 1WCQA 3M3KA 1ODUA 1U93A 4LMQE 5EHMA 2V5YA 1FJ6A 3KBZA 2D73A 4X7FC 5BZDB 2X3CA 3EFFA 3T65A 4I3RL 3TBTA 5IHBA 3RNNA 3VVDA 1PTZA 3QDME 1MG1A 4QRTA 2L7QA 3I6LD 3D87B 4L1HA 1AXTL 5T1MA 1DE4A 2AGJH 2FJUB 3U46A 1CGUA 3IFCA 1KDIA 3QCTL 3O6MH 1JTTA 5AZ2L 2THIA 3MLZL 4MMPA 1Y4TA 1KEGL 1Y9UA 3GT6A 3BI9X 4HIEA 4CRPA 1UOVA 5JPNC 4PREB 3X11B 4MD0A 5F6HI 5AAWA 1PEBA 2F6PA 2BX5A 5FKAB 3WE6A 4HQQL 3HS8A 1T04A 1U8MB 3N85L 4X7EC 5KZTA 5H8SA 4KDWA 4TUOA 3S8FB 1UOKA 4EI5C 2ZCKH 3TJHD 1HU8A 1WWCA 2AP2A 4OZHA 4F58L 2DQTL 1E8ZA 3NA9L 4DFIA 4C1UA 3BXNB 4NQDD 2EDWA 3KJ6L 3AG2B 4CDHA 5F7NC 2QSXA 3PJNA 2YJQA 4UTBA 3IJSB 4X2UA 1E3XA 1Q0YH 4R2FA 5B1JA 2OZ4L 5GGTL 5JPNA 3B5TA 3QXVA 4Y19E 3T0EB 1DP0A 1N59B 2FWOA 2PCYA 1UACL 1EYIA 4UTAA 1JSYA 4LNRB 4NKQB 1XZWA 5GHWH 2J1YA 5HGBB 5K2YA 4DETA 4MNQB 2BOCA 5TH2B 4GW4A 5CEZL 3MV7D 5L88H 3S88L 2FD6H 3JV6A 3QORD 4FBPA 1RZGB 3MJ8B 2KZWA 2XPGA 3B6TA 4QWWD 1NPUA 3UORA 5IHUL 4HALA 4GG6E 2YUZA 5KG9B 1DUYA 3CFQA 4IU3A 4WUUB 2DYPB 5BW7A 4G9DA 1L9PA 2WJ5A 4PJXB 4U0RC 1E4XL 3WGVB 4W70A 4M43L 1HZLA 1NOAA 1C12B 1LO2L 2QEJA 4HS3B 4XH2A 4PJHE 4FTDA 1Q9WA 3UO1L 4W68A 1MHEA 3G3KA 1W8NA 3QZPA 5K2XA 1USZA 3GTTA 4M8RA 4OZIF 2Y1ZA 1B0IA 3MLWL 4JR9L 2LVCA 4BZYA 2V4LA 3CLWA 1GGGA 4FLSA 1ZS2A 1QFHA 3JVGA 1J8HA 2K9UA 5DRNB 8CGTA 2AI0H 2E6PA 4B97A 1NCHA 3VI3A 3KSJA 1BJ1H 2F78A 1MCSA 5EU3B 4N8CL 2Z8WC 1Q90A 3TH3T 4Z7AA 4RVBA 5I8CA 3WEBA 3S34L 2LHAA 2QFPA 4R96A 3HG2A 3HRZB 2O5XL 4Z7QF 3QG6A 1M7DA 2VL4A 1DQKA 2IBBA 2CKBH 3ESNA 3X1BA 5J5EA 1D9QA 1NC4A 2N0KA 1J0HA 1OHQA 4MVBC 1X4ZA 5KYUA 4EIGB 1EHKB 5LBVA 3ASWA 1RK0B 3Q48A 2F54D 4FFYL 4YQXH 2Z4QA 4PJHF 5JOFB 2C9AA 3HG5A 3VGAC 4LF3A 5I56B 2QGCA 2CMRH 4PV9A 2PW2B 4U1OA 2NMSA 2Z64C 2ZP0T 2AXWA 3DOSB 3B9KA 1SYVB 5EA0H 5I1IH 2GBTA 1UXWA 3EDFA 5IQNA 5DJZA 3RPIA 4Z3JA 1R5VB 4XNYL 3DMMA 2KLSA 3MBED 1E9QB 3HMXL 1NWOA 2VABB 2Q6WA 3PNRB 4PJ9B 3L3DA 2ZUXA 2HVKA 4NZFA 5AA2B 1SQMA 4OGYL 1AQHA 4JY6A 1RPKA 1IBDA 1B40A 2IPKA 3U0TA 1NGYA 3L3OB 3FASA 1JGEA 1FTAA 2IAMC 2UXTA 1JV2B 4MRBA 4FMKA 3I6LE 3V6OE 3BUTA 2QHLA 5F71A 3ESPA 4HWNA 4IBYA 1NGYB 2EXYC 3L3OA 1HEZA 4LASL 4QOKA 3QORB 1D9KA 1YXIA 1KYAA 2MCPL 3V10A 1YYML 5INDB 4N2GA 4OT1H 1MCQA 2BOLA 3C2AL 1XFPA 4TOYH 1WZMA 4MJOA 1PZAA 3TNMB 4YKKA 2QKIA 3ZKKA 2VITB 3Q8FA 2AZUA 1JGUH 2N3JA 4NEHB 4XO9A 5IFJA 4JUTA 5B39B 4P2RB 3MVYA 4QPEA 3JV0A 1QSED 3I2CL 2V3EA 4U1GB 3GIVB 3I9AA 3WEAA 3QWRD 4NQXA 5FECB 5F97E 2FH8A 1ZEAH 3QO0A 4I18C 4MA7H 5IB1B 4NF4B 4EBQH 3RWEB 5HDWA 1WICA 4J1UB 5DJ0B 4PRAA 2B15A 4TNWF 2QELA 5TK2A 4YVUA 5KYNA 2DP8A 4FQHA 2AQ1A 3BPOC 4HC1A 4CVXA 4N0YL 3MV8E 1I9JH 3RT6B 3GSRB 3N55A 2YZ8A 3BZFB 3LV0A 3CFCH 2NY6D 1EDHA 4R5XA 4QLWA 4CMHB 2XWIA 2I7SA 1DBKH 1MCWM 2FNBA 1I8KA 4X7DC 5EG6C 3FB8A 1B88A 5C0BA 1F9BA 1M71A 2NR6D 2OJ1A 1BZOA 4YGVB 1WCBB 4H46A 1MY4A 4X9TA 5TQ0L 1ZGLP 4P5MA 3Q28A 4LU5L 4S1SH 1FNGB 5CIPB 4H26B 1CK0L 3UOAB 3LPWA 4AGMA 1KTLB 1MPAH 1TSRA 3EF4A 4TKWA 3UC2A 4IIZA 4X8JB 2XWEA 4TPRL 1E9OB 3GBMH 1FRGL 2L7JA 4Y8DC 3V0GA 1F42A 4FI7A 7TAAA 3O28A 3NJHA 1BVNP 3WAFA 1Y20A 2MTPA 4Y4HB 1LXMA 2YSSA 1ASPA 3VMPA 4ODSH 5I6XB 3AXHA 4OQOA 4KUZH 5FOBB 1G4MA 3GMOA 5IVXB 4CJ1A 3IDIB 3E38A 5CCJA 2OMZB 3NK3A 4W81A 5JXEA 2ZYSA 2IOOA 1SLWA 2KUTA 3OWRA 4HX1B 4MMXA 1FNLA 5FHBH 4XP1L 4JPWH 5T1JA 3QDMD 4LL1A 4MGXA 4M3HA 3O3DB 4ZMZA 1QACA 4LSSL 5JHLA 4JWYA 35C8H 1ORQA 3IGAA 3AXLB 4PRNB 1L9RA 1M7IA 3GSQB 2JI3A 4OFIA 1SI0A 4HGWA 3S9NC 1U3NA 1PQZB 2QVFB 1H8LA 4YXKH 5D72H 2OCFD 1URIA 3DGDA 3N44F 4FFYA 1DLHA 3MRIA 1W72A 2R2HA 1DL7L 4NQXB 2DRUA 2YK1L 3LRGA 1MQGA 4UB0L 1RZ7L 4H25A 3S98A 4WHTA 3VXBA 1NCAH 1IBBA 2EE0A 4RMRA 4XN8A 3T8MA 1AXSB 1Y18A 5IBLC 1FVCB 2Y22A 1G7PB 3CX2A 1JPST 2VZVA 4KX8A 4XGZB 5IMOB 4NQCA 3ISYA 3ML9A 1FDLH 3L3IB 1YJDH 3FV2A 2TSBA 4OMBA 2ZKHH 4DN3L 4HJJL 3FHEA 1MEXL 4MMYA 4AYBA 4PHZA 4UT6A 4B9KC 2YGPA 3CNKA 5LGKA 3MLPA 4GQRA 4AW4A 1AD9B 2Q0ZX 1A8FA 3TZVA 4B60A 4DGUA 2GTWA 3EZ8A 1WT5A 2XWJA 5ALCH 2MOVA 3PIQB 2PFYA 3SBWC 3PAVA 4XC1L 4GAJH 1QUIA 4O3BA 1FAIH 2XWBB 2WLHA 4CUCA 3SPCA 3HG0A 3L3DB 1KBGH 1ZA6A 4O02B 1JNNL 4H26A 2F19H 3QUMA 5I6NA 5EBWB 1JAEA 4XMWA 1EK3A 4FQXC 4Y1AD 1DQDL 5BWJA 2H47C 4F5CA 1MHPL 1NUXA 3L8QA 3SGJC 1PJWA 4RNRB 2EEDA 3IU4H 3THML 3CFCL 5DR5L 4NKDA 1T3FB 4JFYB 1I9IL 4BZ1L 1MAMH 1MRCH 3JXAA 3D39A 4R90H 1OP5K 2IPKB 1OCWL 2MNUA 3RGVA 3HC0A 3CN4A 2DSFA 2CK0L 2D3IA 2I4CA 2VC2H 1MF2L 3KG5A 5JXAH 2C9UA 4A6YL 1NH7A 1AZVA 1LP9A 4N0FB 4EBQL 2HT4C 2O5ZL 5HYSG 4GRMB 3F6LA 1S7TB 2UVJA 3S3PA 3QO1B 4QRSB 3LKPB 3DOSA 1A8JH 1RVFH 1YC8A 3R26A 4J8RB 2XU9A 3BX7C 3QJHA 1KGIA 5MEQB 4X6CA 2DIEA 5KVEH 2NY1B 2EZ0C 4C4BA 3QT2A 4XBEH 3GHBL 4HU2A 2IWKA 3WFEH 5I15L 3FBQA 4C8XA 4A55A 3VXCA 1NL0H 1ZS8A 4WJKB 3PY9A 3T2LA 1RL1A 2XUWA 1TQCC 3IJYA 3E3QC 5A16A 1C5CL 5I1JH 3PPQA 2A9AA 2XWKA 1IE4A 1BF8A 4YX2L 1UZGA 2N7AA 4G70B 2ZKMX 1KJMA 1OAZH 4U2YA 1E27A 1TEFA 3MLUL 1N76A 1SLXA 1QUKA 1TTRA 1ACXA 4YDVA 1H45A 3QPQC 1BPVA 2ALWA 5E9AA 4YB7A 2R2EA 1I75A 1ZJBA 2D0GA 1I8KB 4G1EA 4N6QA 1E2VA 3GBAA 3A6CH 1NCAL 4ZO8A 2R69L 1LLSA 3UP1A 2DIBA 3A4FA 1AR2A 2J5WA 4Z7UA 3M46A 4XB3A 3BDYH 3DIVA 5GRUH 2XXWA 5A7EA 1E4WL 2IAND 3FGSA 3RTWB 3WJLA 3CSTA 3D85D 3FTWA 4QHQA 1TT6A 1YECL 2HT4D 2HA1A 3LV3A 4XNBA 3TOPA 2VKWA 4DVBB 2ZXDA 1TETH 3DGGB 5FKPB 1MQ8A 3Q43A 3OJMB 5FUCC 5DJ0A 3EDEA 5FUCE 3QSLA 1IGTB 3GUTB 3K01A 5A6LA 5B3JF 2P8LB 3X17A 4KITB 4E68A 1YA5A 3K6FA 2X1WL 2EQDA 3WOVA 5LKNA 4NF0A 4PYGA 2H1LM 2JK5B 4G8GE 4MD0B 3OKEA 2WBWB 1WDNA 1OAJA 2F8DA 3GLEA 2AERT 5ENWA 1TQTA 1S7TA 5DJ6A 3HW7A 5CLTA 5B22A 4LK4A 5KS9F 3AUWB 3GMPA 3MC2A 2JK5A 5DRXB 3ZKXB 3QXUA 4XXCA 4IBUA 3ZT5A 3PWLA 2NXYB 5C08A 4BM7A 2NX5B 2IFFL 3PWPE 3ALXA 4NRZA 4E5XG 3RPBA 1WUNT 2K7PA 4CKQA 2OX3A 2I9LA 3KPOA 3QSKB 4JKWA 3OKMB 2A6JA 1J0IA 2XV3A 4PR5B 3TTNA 2UZXA 4B50A 4N2KA 2ATKA 4QXGH 2PR4L 4IRZL 3MOAH 5F7BA 4OAWA 3HFUA 4CILA 5TE7H 5FLVA 3K4UA 1KXTA 2X53A 4IKNA 1SFHA 5DVPA 2FJGB 2X4OA 4XMXA 3BKIB 4QRPD 1SJXA 1AGDB 5AOKA 1QFWL 3HHMA 5DUML 3A0OA 1XL6A 4GX4A 2IWFA 2J7LA 2VUYA 2JQZA 3QVAA 4UTBL 1FV1B 1H9DA 3V0HA 3BP5B 4PFYA 2EDTA 3X3FL 4ANWA 5JHMA 2E7MA 5C0CE 1V54B 3ARGA 3L3KB 4UTAL 2OP4L 2CBMA 1L0QA 3IFLH 5BS0A 2I4BA 5A2KH 2KKQA 4PJHA 4HCRA 1ZHKB 3MBEA 3LN5A 2HLAB 3RPLB 5EU3A 2V17H 5AG8A 1HHJB 3SEWA 5EU4A 2IXQB 1X5IA 1ILSA 4WFFE 4NKDB 1NUFA 5CILL 5EYGA 5DMIH 1HAWA 2P8LA 1IMEA 5AW4B 2V37A 4LO9A 4NHUB 4AEHH 5ESAB 4PCDA 2WXGA 4IJ3C 1GXEA 2XWOA 5DRZB 4H8UA 4TLLB 7FABH 1EEYA 1FFTB 1MVYA 1A9EB 4K3HA 2OCJA 2KQNA 2HG5B 4JSDA 1ORQB 1TIUA 3HTLX 1YDPB 1YYLH 1NMBL 2OQJA 4D3CL 4R26L 4FXKB 4XVUD 2WVVA 1B0GB 2PYEA 3KSXA 1FIEA 1H9VA 3DV6A 1N0LB 4JNXA 4PRIB 1BMWA 3K7UA 2UX6A 1OAZL 4OFDA 4EN3A 2R1WB 3I02A 1DMBA 3MNWB 5E6SB 3H55A 4BRJA 4YAHX 3SPGA 2OWSA 2FBJH 2WJ7A 1IC5H 1NGWA 3VI4F 2X2YA 1BJ1J 1KJMB 1N59A 3I6KB 4YDLB 1J18A 1GYUA 2W0KA 2ZCHL 1ZANH 5F24A 1NMCC 2HT2D 4L8DA 3CX5K 3C8KB 2GIMA 1KFGA 4X5XB 3GHBH 2ZYNA 1AYRA 5C1MB 1K8DA 1E65A 2R27A 3NZ8A 3CHSA 2WNXA 4PG9A 1A4JB 3SGDI 3O29A 3I84A 1MIEH 4JMNA 3HA0A 1MWAB 2YD6A 2XKUA 3SBQA 3WG7B 5IESL 2NUPA 4XCCL 5DJDB 1F2XK 5HGHB 5ISUA 1NFIB 1OPOA 2ZD0A 3MQIA 3G5VB 4FEBA 4NQVB 4M61B 1K9TA 4WTXA 3LKNB 3QQ9D 1G43A 4OSUL 4G43B 4QCIA 2FVNA 1PDKB 3ARQA 1S7RA 1KCWA 3DGCR 1F4HA 2JLLA 2HWZH 2FJSA 3APMA 5L9OA 4HHAA 3GTNA 4PPTA 1NWPA 3R19A 1QHOA 4PJGE 1XGUA 5E6IA 1IEBA 2XPYA 3ZJAA 1BPLB 3ILQD 4X6EA 4LLMB 1PLGL 1A7QH 5IW1A 2C9SA 3VFTA 1KPUA 1FL3A 2YSSB 5EU4B 3D39B 3FRPG 3S35X 4NUQA 2VLLB 3MKGA 2VDOL 1XCWA 1XH3B 4LCWA 4OD2A 4QFPA 3TJEL 3SCMA 3OR6A 2E6JA 3B8SA 3MRBA 4A2DA 15C8L 3VXSE 4GINA 3EYQC 4PRID 4X7TA 2FAUA 5AW9B 5D9SA 4BJLA 2LE9A 3BJLA 3MHZA 4NZUL 2IEPA 4BSWB 3QFGA 1Z32X 1RY7B 5ANME 4KROD 3TYGL 2G75A 3ZMRA 4M8QB 1M7IB 5FDYA 3QR2A 2DTMH 4Q89A 3IMTA 4X7SH 3SSGA 1ZLSL 4K23H 1XBDA 3OAYK 3ZE1F 4K7PL 3FJGA 3JUZA 1UASA 5LBSA 4DOHE 1G9MH 3OENA 1NIBA 1MJUL 3HI5L 3MNWA 1E9OA 2Y5TA 2IQ9H 2I9TA 4ETQB 5I6XC 2VDLL 3MJWA 3STBA 3EFOB 1JPTL 4Y4HA 1R9FA 1BIYA 1HZHH 1K4DA 1CDHA 1XSOA 4Q5TA 1LNUB 4O8MA 3MI6A 1J87A 4RSVA 5GRYA 1H6UA 4CN6A 1EGJA 3PHQB 2EDLA 3OB0K 2ROYA 1ANUA 1DVTA 1CF8L 3MLRL 4LPXA 4GSQA 2XJKA 1CI3M 4DO4A 3MRHA 4GWZA 4MD4A 2R56H 5FA4B 1DR9A 2D3VA 1MHHA 1BFOB 4K7FB 4RZCB 2PPFA 3TNMA 3L9EA 4I0CC 2NY3D 4UUJA 3MODH 4WI5A 5CP3H 4EZKA 4G8GD 3QI9A 4AI7A 1CS6A 3AXLA 2VE6B 3K81A 3LKQB 2W0PA 2YRPA 3D2UD 4N15A 5TDNA 2VLKB 3GMLA 2P5ED 3X12B 1GZPB 4FQQA 3LIZL 1DDHB 5GS1B 4HWBA 1WK0A 3E8UL 3ELAT 5ECGA 3OKDA 4TSAL 4XNMB 4Z7VB 2O7UA 2DQJL 4F9LA 4JM2A 3FRPA 3BH8A 3D4YA 5K9JL 4Q9QL 1GC1C 1T83C 5CJ5A 1G7IA 1MREH 2X7LB 5HY9B 3BYTA 3P73A 4ISVB 2F5AL 1Z2KA 3RVTC 1RFDL 2X7LA 3AG1B 3GSWA 3GRWA 1HXYA 3QZNA 4KXAA 4P59H 2COQA 4BFIA 2F15A 2ZSWA 5HHOB 1TJIH 1HS6A 2PABA 3KHOA 4XE0A 2Z4QB 1IVTA 2P42B 3QORC 4R7NA 4UOJA 2IH1A 3FXIC 5MEQA 2AQ3A 4U23A 1UM5L 1THCA 5TQ2H 3NJGA 4HKBB 4PJ9A 3RFZC 4FX5A 2X6VA 1JGLL 4LSUH 2DQJH 1BD2A 2EIZB 2WUCH 3WFDH 3T0EA 2QJDA 3ROLB 1F5WA 2BWDA 1GJIA 4PE5B 1GA2A 5IV2A 1AMFA 5EN2A 5SWSE 3HR5B 1M5EA 2VAAA 4GQ9L 2XX8A 4FA8A 5CJBA 3C36A 4Y1SA 3RNQA 3FU7A 4GI9A 2E47A 1W72H 2J73A 1IQWH 3FYIB 3T6ZA 4XPBH 4OZ4A 3UTZA 3MNMA 4A7TA 3NCWA 1M2OA 1MI5D 2MIZA 3UAJA 5B38B 1RJZA 5CLZA 4F57H 5H8QB 1LEGA 4F18A 2OL3A 1NQBA 3GXDA 3ZSFA 3L4ZA 1DUZA 1COBA 4OLUH 1TFHA 2VLME 5GRVL 4XCNA 3IN0A 1MHEB 1Q94B 1QR4A 1OTSC 1YC7A 4M7JH 4IM8A 2GW5A 5EZOH 2IDUA 4KZDL 2Z31B 4ENED 1J8HB 3DRTB 2ZX9A 4MVBD 1VERA 3B9KD 1IC4H 4FL4B 3C33A 2AJ3B 3TBTB 5F1OB 4JPSA 2ZOLB 1LO5A 1QO3B 5D1XD 1Z9NA 4N0CD 2AJ3A 3CV5A 1NFDE 2K0RA 4Q7DA 1CFMA 1RZ8A 1Z3GH 3NAAH 4KCCA 3T9XB 4MQ7A 1GH7A 1XB6A 4M8QA 4G6FD 1ZA3A 3LSOB 4RFNC 5F3HA 2D8KA 3GMPB 2YKKA 4L05A 5D7SL 4Z76B 4GBXC 1MCOL 4K5MA 3MRFB 1D9KD 4C47A 3CMOH 1UCBL 5K5YA 4FTVB 1AE6L 3KPPB 1HSLA 4JHWL 2A9DA 1MFAL 4J6RH 4ZI8A 4OZHB 3QUYC 1ITCA 5E23A 1S7VB 1GY2A 1CQKA 2A5UA 3KGUA 3OX8A 4R7DA 4BQCA 4P3LA 1IEBB 2PWDA 3O4LE 5KAQF 3T2NL 3LNIA 4J2XA 4XCYB 3DECA 5K1VA 4EDWH 1IFHL 1THAA 1QZNA 5D70H 3QIBA 4WI2A 4Y19A 4M1CC 4YHKL 5KYXB 2E7LC 2KZ1B 3QJRB 2A2QT 2CU9A 3AXIA 4QHLB 5CJ8A 1US4A 4ENEC 3O0LA 3VX1A 2JLPA 1Y6NR 4RGMC 3O6KL 2QR0B 4P47A 4XMPH 5J56B 2GIXA 2MJWA 1OK0A 4X98B 2MMXA 3GJFA 4OJFL 3Q1EA 4CNIA 1GPOH 1T04B 4XP6H 4LLYA 4GAGH 1IUDA 4CU7A 3F6JA 2CNZA 2PPEA 2UWEF 1JNFA 1BQUA 2OWTA 5AKTA 3T5WA 3CZSA 3BKJH 2ICEB 2N59A 3ZGIA 1IIKA 3MGOB 2KZKA 1G7MA 3T0AA 4LAQH 2WXQA 1UTDA 5TDPA 1E3ZA 4JE0A 3R7RA 1KPUB 2A3TA 4QTIH 2WLZA 5I16B 3CLEL 4AUYA 4FMFA 3ZO9A 3QR1A 5DJ8B 1E4JA 4HIHA 4MXQC 4O7IA 4MDIB 4MNQA 4G6KL 4GEIA 4XAKD 5J4MA 4NGUA 1ZMGA 2PYYA 2Z35B 3WIFA 3CFEB 5EZLA 4G8IA 3B7DA 3GKWL 2VCOA 2PXYC 2FEDC 1O6VA 4MAUH 4QIRA 3FCBA 1G7QA 4L4TD 4WHYH 4NSKA 4Q52A 2IBZX 2AABL 4ODXB 1ZIAA 1LAXA 2AMUA 1ZMYA 4YHOH 4ZECA 4AB5A 4HOXA 3WENA 4U6VH 1CFVH 5E56A 4AEHL 2DL2A 2K78A 3ARGC 4G80B 1EO7A 3BPNB 4LCCA 1PB9A 5DJCB 3LC8A 3QIBB 4W1TA 3ZK0A 4RH4A 4KY2A 2OYKA 1I3GH 3ARGB 3L3KA 3T6WA 1SN5A 2X4UB 5D7KD 2VQUA 5H37H 3QHZH 4YFDB 1NA8A 4J3OD 4M5ZL 4KO7A 4XRCA 1LTXA 4NT6B 2IA4A 1P1OA 5FYJL 3ULSB 3QEGH 4MAUL 4ZNEA 3LPOA 2XXTA 1I7TA 5EOQH 2DWTA 3BKYH 1PLCA 2GJJA 4JO8A 5T1LA 4NQCD 2FJHB 4HLZG 2NUPB 2V5MA 4NZTH 4GXVL 3KLHC 4KVNL 3HNVH 1LAFE 1UKQA 4B9GA 3RN8A 4ZUWA 3QFDA 1RKRA 2UXVA 4EZJA 1NANI 4LLYB 2FLMA 4OCSL 3BQUC 1WO2A 4GRLB 1OT1A 4Y5XA 4J7RA 3VFPB 2ED9A 1NNKA 3C6SB 3VXRE 1X5AA 3QFJD 1HYSD 1CLYH 3KXFE 4ZG1A 2O51A 3KPOB 4MB1A 5DS2A 1IMAA 4L8SC 4PJFF 4X5LA 3DVIA 3UBGA 5ID1A 4XFEA 5JORB 1TJHL 4NHBA 1N18A 3A21A 4JO4L 2EH8L 4XE5B 3JSSA 1GSMA 2HKFH 1UD2A 4UQ3A 1C8PA 1A9BA 4G68C 2Y7NA 4MXVF 1NBZA 2VZ1A 4MLVA 4PU2A 4P2RD 4LE8A 3TAJA 1E43A 1J1XH 4NBYB 2J88L 5KJRH 4MLIA 3QAQA 4HCRH 5HDBF 4LOFA 1HYRC 1WUZA 3U72A 3E6HB 5AYTA 3OPUA 5K9OA 2OL3B 2NY5L 2DXYA 2E56A 4PM1A 1FV1A 5BVPH 1VGEL 2HLFD 3KDPB 4AIOA 1N2RB 4MNHB 4AB6A 5E1AB 1AJ7L 4TVPH 2F35A 4K73A 4TOZA 4N24A 4YHPA 5B1CA 2MOQA 4Y16C 4X9FA 5DC4B 1FPKA 4WW2B 1AE6H 3DJRA 4LXFA 1A14H 2NYKA 1TMQA 4WSKA 4AYGA 2J8OA 2O5XH 4BD4A 4L5FL 4M48H 1QYGL 1NGZA 4P0DA 4XVTH 4Y9EA 4BZ1A 1Y3NA 2DWXA 1SYHA 1GW0A 2EXYD 2EDHA 4HISA 3V9FA 4EDWL 4ELMB 2HLFC 3P0GB 4HFWB 3RLSA 2YGNA 2YEZA 4IBZA 1P7KA 1G0HA 3MVXA 1HL5A 1N4XL 3QUML 3G6JF 4IGRA 1ZHLA 2A9MH 5B4MD 1DSWA 1NGPH 1X9QA 1Z3RA 1RJLB 5DJ6B 3OEMA 4L4VD 3RBGA 1AZUA 2FHBA 2WKYA 3U7YL 4LSTH 3V8OA 2VD3A 2I9LB 3OR7A 4JQXA 2C8NA 2LQRA 3C35A 4M03A 3O41B 3ZDZB 2DKMA 3B2UC 3DIFA 3OX8B 1QYGH 5DT1L 1V7NL 1I9RL 2TAAA 4YHIB 4Z0XA 4OD1H 2DQFB 1I85C 4P8QA 1DDHA 5D1ZC 5AUMA 3PUYE 5AA2D 1DTZA 3FQUB 1WBXB 2B4CC 3DURA 1OO2A 1NNFA 3FXRA 1ZGLA 3RJQB 2RCSH 3G3LA 4NZRH 4XN4A 3GJFK 1ETB1 4HKZA 3VQ2C 3ZTNH 1T0OA 4XXCC 1ESOA 3GSRA 4MS8C 3C2SA 1T2XA 3PWNA 3B5HA 3BEVA 1Q9KA 2W0FA 1JGVL 3K1DA 3BVTA 4NENB 3GSNA 4UINH 4P5RA 1AXTH 3ZMNA 5LGHH 4PGJA 2YAQA 1TLMA 1YAEA 3BEVB 4NENA 4G1EB 4X6FB 3A4DA 1PKQE 5JIQA 1BAFL 4WGWB 1KV7A 4FNSA 1IX2A 3E0GA 4ICWA 3EOAA 3HG1B 4I0PC 3C08L 3CRBA 4FGMA 3GXNA 4O4YL 1GGCL 2BNUA 4ENZA 1DVFC 5IOPA 2OMUA 3LR1A 3QCUH 4JY4A 3DGGA 5FKPA 4PJEB 1JHTB 3SDDA 5T5FA 3MTRA 3CFBB 4PWGA 4TTDC 4U1SA 1ACYH 1YMMD 2G9HA 3MFFB 4OJCA 5AKVA 3CN1A 2ZUUA 5C0BD 2VO5A 4Z0BH 3K1NA 2FBOJ 4WLCA 5DMKA 4WGVB 4WUUA 3TPUB 4GMSH 5ACZA 4OCWH 4U7SA 3DO4A 4X9BA 5K59F 3FVKA 4ABVA 2R69H 4BBWA 2PBWA 3QNZB 4A2EA 2VOTA 2GSIB 1RK0A 4R4ND 2QPUA 4JRWA 3FUIA 4HBCH 2F2HA 3POCA 3HI1B 4KRPC 3PWLB 4X8RA 1LP9E 4HSCX 4DCYA 1Q1PA 1AHMA 2Y25A 4PW4A 1SN2A 1NDMA 1ASQA 3MA9L 1JWUB 4OZHF 3DA0A 2K1MA 1XV8A 3D33A 5EO9A 3UAAA 3R1GH 1JJUA 1QR1B 1EYJA 2HKHL 1CFTB 1K4CB 5IQ9A 5DQDH 3VGHA 1K8IA 3KWXA 5F44A 1QZ1A 3BISA 4XPGL 4LRIC 3CN0A 1BX2A 5D8JL 3OHXC 4MZ3A 1A21A 2DQFA 2MQ0A 3KR3H 2BO0A 1T2QH 2R1XB 5DS8B 5DDHA 4M7LL 2DWEA 5E9DA 5KBLA 5MENE 5D2NA 3T2QA 4UM8A 3X1NA 3H0TA 3CSYB 2Y7KA 1OALA 1IE5A 5EQ7A 4NI3A 2IDSA 2D0HA 1XXDC 4HS8L 4EPSA 2AIXA 3HO7A 1CD0A 3ZL1A 1EHAA 2XKSA 4NQVA 1G9MC 1FE8H 3L81A 2G0KA 4DN4H 1FFPB 4JFXB 3MUHL 3QWQB 3S34H 1SHMA 2Y7SA 1ZT4B 3LEYH 1TTFA 2OP4H 4H0LC 4RZKA 3IDXL 4ZUWB 3TA3D 4BFOA 3FVOA 4OGAC 2BIPA 1JF5A 4YWGL 3QZBA 1Z66A 3S96B 2XXVA 1HNYA 5BRPA 4Y5XB 2XRAH 1QRNB 3TELA 3SDDC 2F36A 1G5GA 3S9EA 1MREL 2WC7A 2XN9A 4NZRL 2IV8A 5CD3A 1B2HA 3VNZA 3AMLA 2Y4SA 5IMLB 2XA3A 3VV5A 5CD3B 1T7VA 1A7NL 3KPMA 4PJAA 5D7LD 1AS7A 1NCOA 1E9PB 4GFXA 1G9NH 1IGYB 3HOGA 3VFTB 3OAWA 3A4AA 5EBMA 4K2UH 1LO3H 1R0AL 2XIIA 3NYKA 1PNCA 2WAQA 4HFUH 2KI6A 4JG0H 4PBDA 3STLB 1INQA 4YL9A 2F5XA 1AQMA 2BLFA 3HMXA 4JLRB 1CXLA 2W9DL 3CZUB 4GAGL 1U8CB 2GITA 4AG4L 3IGAB 4PRNA 3HCVA 3QRGL 4S1QH 1KB5L 4ADIA 4EOWH 5HVHC 1XIWC 5DXWA 3VM5A 1FNSH 1HXKA 1U8HB 3ZTNL 1KFAL 1XMWA 4WCYH 3U36A 2I49A 1P6AB 1X5FA 4LSPH 4QRBA 3RWEA 1G1OA 3IXTA 2QL1A 3FF8A 1TCMA 4OZGB 2W59A 4U0QB 3VTTA 3K2MC 4WEPA 4PBWD 3RKPA 3KPPA 4Z7NF 4G8NA 4WHYG 3CC1A 2Q76B 1LO3L 1ETZB 1R0AH 4YGAB 3VRIB 3VWJD 2YQBA 3ARED 3T71A 2FHYA 4P99A 2VDOH 5FCSH 1JZJA 3I85A 2FO4A 3NZ8B 4PJCF 4U3XA 3L6FA 3L3JA 4M6MH 1X7TA 3NRFA 1D5BA 3NJJA 4I77L 4G8IB 3HBGA 2VR5A 5TF0A 3CSFA 3ILQC 1B7ZA 1GC1L 2ZNUA 3OXSA 4WCYL 1HEZB 2X42A 4DZBA 4K8RH 4JWOA 3E9TA 2BMKB 3ARFB 1M5BA 5LGYA 1AGDA 2XWJB 2P0SA 5BRZA 4MMXB 2L3BA 6FABH 4QSCA 1N6QH 4HK3N 4IBSA 4JDEA 5L9SA 4NM8L 2PO6C 3VWJC 4F7TB 3CVIH 3QQDB 4OFYD 1M05A 1WGVA 4GJTB 5DZLA 2Z31A 3JYBA 5KW9H 5KOVC 5DMGD 4H5GA 3GSOA 5E70A 4TL4A 4PB0H 3B7RL 3TV8A 1KTJA 1NAMA 1TJHH 2ATPA 4MX7B 5EN3A 5ESAA 5DZAA 5IMOA 5EHSA 2GJ6E 1YN7B 3UTSD 2WWKT 4IEFA 4KY1H 3OR6B 5E6IC 4LKXB 3SE9L 4AV0A 2QMWA 2IXQA 4MAGA 1XH3A 2ZXBA 4LCWB 3T2PA 5I28A 3QPQD 2F5BL 5DJXA 2R9JA 2LU7A 2VMEA 3G6AA 1JFQH 4GW1A 4KX9A 4A7GF 5I82A 3LSFB 5GZOD 5A6IA 4OLEA 3UTTE 3C09B 1R3JA 1VESA 2OCCB 3KPNB 4RA3A 3P2DA 4KTGA 2HRHA 5AB9A 2YPNA 5F9JA 6PAZA 1CN4A 2O6PA 3BD4A 4JFFE 4FQ1H 4YXLL 1GIGH 4DDDA 4PB0L 4PY7B 4OZIB 5DEXB 1NDMB 3BPNC 2NNRA 1S3KL 3CZNA 1UA6H 1KBBA 2VIRA 1XH2A 1M4KA 1XH0A 3QEGL 5E5MB 2EH7H 5F1NB 3VXUA 2AQRA 5KSBA 4DIGA 1NAKH 3OKYA 2GK0A 4OERA 2EH8H 4A38A 1PZBA 1F8TL 2EZ0D 4AENA 4M7KH 4FADA 3FHQA 5F9WC 4R6YA 3I6GA 1F97A 2LVEA 2RR3A 3W9WA 1CXIA 3V7AG 4JXIA 5EEVA 3LKSA 3VFVB 2R56L 4JMXA 4KKZA 2RC9A 4JFOB 4R6HA 2IH3B 4NZDA 5F1KC 1KXTB 1JPSH 1Q1JH 4G6FB 3ULUC 2ATAA 4GQOA 3K2UH 2QVRA 2Q8AH 1A4KA 3MPCA 4U3SA 1S6NA 4FYRA 5B1BB 3A67L 1NDGB 3W11C 4PV8A 3D2TA 2ZNSA 4MMZC 5KG9A 4N8PA 4LRNL 2IV9A 3INUL 2WBJD 2CMRL 2H2PC 2F7RA 4OJYA 3OB0H 4KR5A 4WUKH 4F2OA 1NCNA 5I74C 2O61B 1KPRA 2H32H 2ZSVB 3G04B 2JKSA 3KPQA 5F70A 2UZYA 1TQBC 2E9WA 4N2CA 1X4XA 1NNPA 2XC8A 1SDDA 3QG7H 4KI5D 2V7NB 4Y1AA 1PKQA 3N43B 4M5TA 4GOSA 2IWEA 3MAWA 1A8ZA 3Q3GB 4NCC1 3BW9A 4D94A 4DO5A 4MEVA 1F13A 4NHUA 3GS0A 5CLWA 4GW1B 2V2XA 1GAFH 3PS6A 1JD7A 2GY7B 2I5YH 4BDVA 4P2OA 2ZXAA 4L17A 1WZKA 3IX1A 2FUQA 1OM3H 3MA7A 1M7DB 1T7YA 4JZJA 4UOZA 2YFNA 1FPDA 4KI1A 1A1MA 4YPGA 3K1PA 1RV6X 4I1RA 4LBAA 2KR0A 3QO1A 4ZO7A 4U1ZA 3NP3A 3U7YH 2QKIC 5KYUB 1ZBMA 4G8EA 3VD9A 4QFNA 3EBHA 4GRWB 4PETA 2HMID 1AOVA 4RGOH 5H37A 3RJOA 3CXDL 3U0PB 2ZONA 2ZWZA 4OM0H 4E42A 4LSUL 1MI5A 5FYLE 2YAOA 1GGIL 3HEIB 3QRLA 2Z0UA 3CVDA 3ZKSD 2CDGB 2EC9T 4Z7VE 3ZKLA 1L0YA 4MCYA 3WO4B 3EN3A 3X1EA 5D1XE 3HE6D 3AMKA 2D21A 2R69A 4YMBA 5CHNA 3QC5X 3BWZA 3F05A 4XNQA 1D5IH 2AK4D 1G1KA 1FBHA 4LHQB 5EU6A 1LBVA 1MH5B 3KLAB 3KBFA 5CHNB 4ZQKA 4OI7A 3GKZA 1B52A 1RUAL 3QXAB 2HVKB 2YSTA 2IH3A 1MJ7L 2CIKB 4BZ2H 2VUKA 1R33A 1OLAA 2IDQA 4N81A 4GI6A 1TVHA 3IDYC 2OFQA 4I2XA 3FJMA 3FQ4A 1QBLL 4JPQA 2A9BA 4HZ1A 5EEYA 4LCYA 2DQVA 2W0FB 5CEXB 1IILE 1HXMA 4LCUA 2DEWX 4OLYH 5ENWB 4GKNB 1A4BA 4KQ3L 1C5DB 2IH8A 1DUZB 3TYFA 4ZUVB 4NO2A 1JWSA 3RVVC 5H8QA 1MY2A 2YXFA 1L0XA 4I89A 2YN5A 3GGWA 3N1MC 1ZTXE 1IBFA 2ZWSA 4LU5H 3D6GA 4S1SL 3AM8C 1WLHA 1CLCA 4WWOA 2XACC 4N1CA 4ZOCA 2WO2B 4JCLA 3LV3B 3I3BA 3S3SA 3MLSH 4F1YA 3BZ4A 2ZICA 3FAWA 3Q25A 1KTDA 2AS5M 2YMXH 5C8JB 3C6LA 1IFHH 2VSCA 2JXMA 4C56A 4P4KB 1PLGH 5IKCA 2WWOA 4OLYL 5JXEC 2RACA 4NOFA 1K3IA 2WMPB 4R74A 4YSRA 4IEFB 3FTXA 3SKPA 3L4YA 3DNKA 5HYSA 1M6UA 2WXPA 4CADA 4HIEB 4YHLL 3QQ4A 1N70A 2E27L 5B7EA 4NP9A 3KLKA 1UCBH 3BIKA 5F88A 4PJFA 5H35B 5JA9A 4X6BA 3VFSA 3QA3A 1HEHC 3WIFB 4NQEA 4ODTH 1TZGL 2WXIA 4X4MA 3ULVD 3W38A 1RK1B 2DMGA 2VXQH 1VHPA 3ILPB 4NUJA 4DKEH 1QASA 4HMCA 4I40A 1PLAA 4S2SA 1CFSA 3U9PH 1N0TA 4LCWD 3MUUA 3I02B 3P9LB 3SYQA 1T0KA 1EU8A 4AXWB 5I9QB 1HTYA 4RK2A 3BVWA 2KBGA 2YS4A 4YSAA 4F8TA 1GZPA 2G2PA 2J12B 3VXMB 3WUWG 3VJ6B 4EEEA 2Z65C 1ZLWK 4ERSL 5HGBA 5J3HD 2CUIA 1OWWA 3NTCL 4BKLB