3EF7A

Zp-n domain of mammalian sperm receptor zp3 (crystal form iii)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
480
structure length
467
Chain Sequence
MKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDRVEVPIECRYPRLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein, LINKER, Zona pellucida
publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Cell adhesion
total genus 136
structure length 467
sequence length 480
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ef7A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ef7A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ef7A01
1ZU0A 5AA1A 5CBSA 4HS7A 1II5A 1ANFA 4G68B 4M4GA 2FA7A 3KOSA 3JYRA 1P1OA 1LGBC 3D4GA 3QXMA 4LVQA 3RQTA 1DTZA 3KBRA 1N7XA 3OO8A 2Z8FA 1UTHA 4HTGA 2DVCA 3N6UA 2D21A 2I49A 4I9DA 4LZ7A 3E3KA 1Y1MA 1S9TA 4NF4A 4F1UA 1B6HA 1LB8A 1URSA 4OWDA 3GLBA 1PB8A 3G3IA 2B3BA 1EZOA 5CMMA 1PB9A 3RTFB 1NL5A 3PPNA 2H5YA 1TXFA 5BWJA 1A7LA 5DT6A 3Q25A 3IX1A 5IAIA 3FJGA 3MJNA 1BIYA 2F78A 3FXUA 2H98A 4BDMA 5KCJB 4IO2A 1OQGA 1D9YA 3RTWB 3MQ9A 3IJOB 1GGGA 1OVTA 3TTNA 1B0LA 3PUWE 3PGFA 3IAZA 4ZEKA 3FV2A 1M5EA 2IEEA 2HFBA 4NWCA 4EF1A 3TUSA 5AA3A 4R74A 2DXYA 1J1NA 1P1QA 3GBAA 2XXQA 3O28A 2AIXA 1RKMA 3OSRA 3L6GA 3OELA 1LAHE 2I4CA 3C31A 1IXCA 3S4UA 4YZZA 3SEUA 4KCDA 3HHFA 1L5TA 2DXRA 1B3GA 2I58A 1UTHB 4R2BA 5AA2A 1B3HA 5IKBA 4ZEFA 4DXBA 4NF4B 3C34A 3DELB 4GWOA 5KZTA 2PX1A 2REGA 4JSOA 3FVKA 1LLSA 4R9GA 3WAEA 4F22A 2QJEA 3DP4A 2NWJA 3VV5A 1P1UA 3OO9A 1B4HA 4Q8RA 1R6ZA 3HCQA 1Y3NA 4POXA 2Q2CA 4WEDA 3E4RA 2UVHA 1MM6A 4NMYA 1JEVA 4Q0CA 3CFXA 3O29A 1YPNA 2F7BA 2DOJA 1B3FA 3DP6A 3TEPA 3S9EA 1JQFA 3M3KA 3C33A 4GLIA 3N26A 4QFKA 4GXSB 2OWTA 1US4A 3IB2A 2Q9TA 4LQ2A 1I6BA 5DEXA 2PT1A 3O2AA 4RPNA 1ELJA 3RY3A 1IEJA 3CRBA 2FYIA 1H45A 4IB2A 1MH4A 5ITOA 3UGWA 3V5AA 4FECA 4ZZAA 4AB6A 1P1WA 3THIA 1MXXA 2H25A 4ZE8A 4ELPA 3CVGA 1MY0A 1QKBA 3PPOA 1RYXA 3LUYA 3OD7A 4P0GA 2OLBA 3KJTA 4GXAA 4OEVA 4NF8A 3IL1B 5AA2B 2DQVA 2HXWA 4IO4A 3K01A 5I84A 1Y4TA 3L6HA 2NUVA 2ZYNA 1JW1A 5ICTA 4MLQA 4ZEDA 1F9BA 1B0HA 4PE5B 2AL4A 3VE1B 1ZBMA 1XOCA 4NEDA 3IO4A 4EXLA 2PVUA 4I8CA 4QFPA 4Q5TA 2D3IA 2G29A 3TYHA 5AA2D 4DXCA 3TCHA 3GXAA 4Q30B 4G4PA 1B2HA 4QRZA 3HSTA 3Q28A 1M5BA 2HEUA 4GFRA 1ZJLA 4QFNA 3CG1A 2W7YA 3PUYE 4DXUA 1SW5A 3KOTA 1FQDA 2QMXA 3SESA 2E1SA 4TQUQ 2D5WA 3U1OA 5DEXB 5TPAA 2RCBA 4PP0A 1B05A 3FVOA 1PBQA 2XHDA 5I59A 4LP2B 4MH5A 1LSTA 1EZ9A 4XKNA 1TT1A 1FTMA 4N07A 3KEIA 3C35A 3LR1A 3W9VA 1O7TA 3H3GA 1JW4A 3S9MC 3IOWA 1GV8A 1ZKBA 3E9XA 2GHAA 1VR5A 4C1TA 3G3GA 4F29A 3S9NC 1FCKA 4FAJA 3ILUB 4BDLA 4GVOA 2VHAA 3PV0E 4DZ1A 3EQ1A 3TPAA 3HPIA 4NF8B 5JK4A 1FTLA 2UVJA 3MBPA 4ECFA 1H44A 1VSOA 1B46A 1DPEA 3OXNA 4R9FA 1IXGA 1JETA 1NH7A 1JW5A 2ZMBA 5FHNA 2ZYMA 1Y3QA 5H8SA 4JXIA 2NVUB 5EHMA 2WKYA 4H0WA 4PETA 2HQ0A 1I6AA 4H6DA 1DMBA 4QF9A 1SW1A 2Y7RA 2X7QA 4F3PA 4LATA 1B40A 4DCYA 2CMOA 1IUDA 4OVJA 4R72A 4M1VA 4NF6A 4NE4A 4ZS9A 4LZ5A 2UXAA 1B7ZA 4ESWA 5L8DA 5JEIA 2DYXA 3N94A 1WDNA 2HZKA 2RKMA 5H8HB 4F2QA 3V83A 3I5OA 4OHNA 3O66A 3MP8A 1AOVA 1IXHA 1FTJA 4RK9A 2ESNA 3K2DA 3IB0A 2A5SA 3O6HA 3H06B 4G68C 4H5FA 3P7IA 1MXUA 4WXJA 3FIRA 1VFDA 5I58A 5I59B 4N6PA 4F3GA 4U4XA 5K2XA 1JNFA 1XT8A 4RJZA 4RYAA 4O3BA 1H43A 3FGSA 3MVYA 4YICA 1FTKA 3ECRA 4P0IA 4U4SA 4F31B 3GBBA 1S50A 3C32A 4P11A 4EQBA 3PPQA 5CM6A 5L9MA 3M3FA 2I3VA 1AH5A 1QJMA 1B1HA 4THIA 3EF7A 4IO3A 3LSFB 1M5FA 3EHSA 3CIJA 4NF5A 4OETA 2VD3A 3LSXA 2R6GE 1FQCA 1Y1ZA 2CZLA 3I3VA 3PUVE 5AA4B 4UACA 3IOVA 1A8FA 3T9XB 1N3XA 1I69A 4YU0A 4PFWA 1SW2A 5AE4A 2LAOA 4RPOA 4ZEIA 4FJPA 5TU0A 2DS9A 2XX7A 2Z23A 3OOAA 3KJ7A 1EH3A 3O6IA 1OMPA 4NF6B 1H3DA 4OFOA 4QFOA 1FQBA 4R6KA 5H8FA 3TTKA 1UTBB 1N3WA 3VXBA 5FTIA 3G3JA 4QHQA 2XXTA 1DPPA 3CI8A 4U22A 3SEVA 2THIA 4MF3A 1LFIA 3G3FA 1LAFE 3EHUA 5DVJA 3A09A 2VP1A 3TODA 3BFTA 2GRVA 1MXYA 1MG1A 1QUJA 2AYSA 2RINA 1O64A 5I58B 4G2ZA 4U23A 1MY4A 4OYVA 1M5DA 1R9LA 5FTHA 1QULA 1IXIA 3QIMA 3B6TA 3TDJA 2V84A 5L9OA 1R9QA 3MZ9A 1MPDA 1OIBA 3UA8A 3U93A 3TFLA 4GF8A 1LBCA 4OFLA 1HSJA 3LSWA 1NNTA 4XKRA 4HCWA 4Z7EA 1B1XA 4X9TA 4OXVA 3M3LA 1I6QA 2OBGA 1CE2A 3FJ7A 3JZJA 2ANJA 1NNKA 3KSJA 3N6TA 1US5A 2XXPA 3U94A 3NK3A 3OO7A 1IQ7A 1MQJA 3TCFA 3T22A 3FD3A 3MVXA 1LFGA 5I56A 2Z8DA 4IGRA 4YKJA 1SYIA 2O84X 4XTCQ 4QSCA 4F19A 5J1DA 4GQOA 4TLLB 4POWA 4PQJA 3TELA 4XKQA 3K6VA 4KD5A 3UN6A 2DSFA 1A54A 4H5GA 2UVGA 3OENA 2Y7KA 1HSEA 3BFUA 5A5XA 1B4ZA 2O69A 5H8FB 1ZMGA 2NOOA 4AB5A 5FHOA 1OLCA 5FHMA 3PD9A 2ONSA 2ZNTA 1XVXA 3C9HA 3HHGA 3ODBA 1QKAA 3RGYA 3LBSA 3MAMA 3B7DA 3MVWA 4C1UA 3CG3A 2O1LA 3CSGA 2HZLA 1URGA 4F2OA 4BDOA 5LOMA 3I6VA 4IY5A 3RN8A 1NH8A 4G8HA 1UIUA 1XS5A 1D3KA 5DTBA 3V8XB 1VFEA 3VVDA 1SQYA 3SEXA 2DWIA 5K2YA 3F11A 4DE8A 2XXHA 4FIMA 2VD2A 2B65A 4GRKA 4L17A 4XXUA 4IY6A 1B5HA 1MY3A 3S2VA 3TCGA 4IO7A 1MPBA 1N84A 2GHBA 2ONRA 1ZIUA 1GTKA 1DOTA 3BKIB 3RUMA 3W9WA 1ATGA 1NFTA 1MQHA 4F1VA 1D9VA 2G93A 1AIVA 3EPEA 1DSNA 2XXWA 4GL8A 3BBRA 1PBPA 4LUBA 4JWYA 3U92A 1EZPA 1AMFA 2F6GA 4U2RA 1P99A 3TTRA 4KYSA 3O6GA 4NTLA 1FQAA 2OCUA 5I2NA 3B6QA 4TLMB 4ESXA 5HPQA 3FVNA 2O7IA 2ZYKA 3FASA 2V3UA 5H8NA 2XXUA 4LONB 4ZEBA 2Y7WA 1SVXB 5DVFA 2O68A 4WEPA 2UYEA 3MP6A 3MPKA 5CI5A 2R71A 2PYYA 5A5XB 2F7CA 1Y4CA 2F36A 3T93B 2OK2A 2ABHA 3SETA 2RC8A 2RC9A 1OVBA 1T0KA 2H9BA 1N76A 4JB7A 5EHSA 3SDFA 4ELRA 2I0CA 1SDXA 2X7PA 5ICQA 1VE4A 3KZGA 5M2VA 3H6VA 5CBRA 1KWHA 2PBWA 4PFUA 1MY2A 4QSDA 1B52A 4ND9A 4KYDA 4YAHX 5CMKA 3CR9A 1N0TA 4GOTA 4R2FA 2V3QA 2H99A 3MZ1A 4YB6A 3N5LA 3PMVA 1GR2A 4ZZEA 2XX9A 1BLFA 1NNPA 4R73A 4FORA 4OQOA 2GH9A 2Y7PA 1Q35A 3K02A 3ONMA 1P1NA 2DE4A 3OO6A 4ONYA 3MW0A 3U72A 4EQ9A 3VXCA 1YCJA 1XVYA 1POTA 1FW0A 3H6WA 4JWOA 2Y7IA 4G77A 3FV1A 2R9JA 2DWJA 1USYH 2A5TA 4BDQA 1NKXA 4KFQA 1WVJA 5CC2A 1SW4A 2F8DA 2ZYOA 1Y9UA 1XC1A 2I3WA 4O3AA 1IITA 2Q2AA 3V89B 3PPPA 1MQDA 2HCAA 3K1MA 3MVZA 2RF1A 2XXIA 4ISUA 4WKMA 3SERA 1LB9A 4RK2A 3C4MA 1D4NA 2O1MA 4HCYA 4O3CA 2YPNA 3HV1A 3EHTA 3NK4A 3IOTA 1BKAA 3JV9A 5TPAB 4F1YA 3HN0A 3OSQA 2QRYA 3KGCA 3C36A 2B3FA 3FUZA 5F7VA 4NWDA 4DLDA 2VOZA 4OERA 2DE2A 2QS3A 4DIGA 3Q26A 1LAXA 1NMUA 4YKIA 2RCAA 2XXRA 3B6WA 4C0RA 2Q8JA 1TFDA 5EYFA 1A99A 1Q1KA 3IO6A 2REJA 4MBPA 5CMCA 3KN3A 4BDNA 1FQFA 3AXFA 4LZ8A 3PPRA 1MDQA 3TQWA 1LCFA 2V3TA 1A55A 2UVIA 3KFMA 3H6UA 3QAXA 3TQLA 3TKDA 3OEKA 1LFHA 4YKPA 2XD3A 3E13X 4OENA 4KR5A 4FEBA 2ZNSA 2ALUA 4KCCA 1B58A 1Z7NE 3PUZE 4ELOA 2YJPA 1B7UA 3USDA 1IZ1A 3DP8A 2F35A 2ZXTA 1FTOA 2A5TB 4FATA 5H8QA 1O63A 5CRYA 2F5XA 3QYTA 3IJXB 1XHYA 3K00A 5ITPA 4LQ5A 5B70A 1FQEA 4KI0E 1USYE 4U1ZA 4FEDA 3M8UA 3KN7A 3KSXA 3PMXA 3VLWA 2DVZA 1B3LA 4PFTA 4LA9A 1IIWA 3UORA 3FJMA 3FATA 1GVCA 3VFJA 3D4CA 4U1OA 3TTMA 1MM7A 1TWYA 2PMSA 1MH3A 1ZTYA 2Z22A 2O6AA 3UIFA 2XXVA 4G8MA 3SEWA 1UIVA 4H8JA 4EDPA 3T96B 4X1BA 2DWHA 1Y3PA 4JDFA 2RC7A 4GIZA 3FZVA 3K6UA 4QFLA 2UYFA 3Q27A 3T9UA 4DDDA 3IK6B 4R6HA 4H1XA 4X48A 2ONKE 1HSLA 4OFJA 4NF5B 4PFYA 2P1SA 3KG2A 3O97A 4KQPA 2YLNA 3UK4A 2DWAA 3HO7A 2OJTA 3RPWA 4EUOA 5JTYA 3SEYA 4YB5A 3IOUA 3MC2A 5BUUA 2XXXA 4YKKA 5H8QB 1B9JA 3O9PA 3RT6B 3LC8A 4F3BA 3KN8A 2V25A 3MP1A 3VLVA 4R75A 2HAUA 4OESA 1LCTA 3FXRA 3K1NA 3G3HA 2BJJX 4ELQA 2DE3A 3PU5A 3MPLA 1SD3A 2F97A 3TTLA 3K4UA 4GL0A 1B51A 5ELVA 2GFEA 3QUFA 3DLNA 4ZE9A 4RA1A 3R26A 1PB7A 4RY1A 3QK6A 5I57A 2E0SA 4RNSA 4I1DA 5TP9A 1MQGA 3SKPA 4GD5A 1NNFA 4EF2A 1LBBA 2H4IA 3FVGA 2OWSA 4F3SA 3S9LC 1MPCA 1MXWA 4YMBA 1UQWA 4JWXA 1SYHA 4XKPA 4G8NA 3OEMA 2ZNUA 1ZLQA 3CFLA 1S7YA 1M5CA 3K6XA 1WODA 4H8IA 1B3EA 3R6UA 2Y84A 5I2KA 3ZKLA 1QW0A 2QS4A 3ZKKA 3CFZA 4F39A 1MRPA 3A3UA 1SI0A 4XIGQ 3MWBA 2Q89A 4OMBA 3PMWA 5I56B 4TOZA 5JTYB 4QSEA 2P0SA 4I62A 1SBPA 2I48A 2XXYA 1N04A 4JBZA 1N7WA 3R7XA 4E0XA 3H03A 3IB1A 2QMWA 3K1PA 2I0BA 3G3KA 1OLAA 5KDTA 3RNNA 4MLVA 1QUKA 3DM0A 5HM4B 4R6YA 2F6PA 2AL5A 2F7AA 4IO6A 4JSDA 2OZZA 4BDRA 3H7MA 3UP9A 5B7DA 1JVXA 1OQHA 3VLUA 3RLFE 2FNCA 5DVIA 4RXLA 4MFIA 1JEUA 3K6WA 1TFAA 3W15C 2F34A 3QSLA 2QSXA 1CB6A 4YB7A 5H8HA 5I57B 4OTEA 5TP9B 2VGQA 3U8QA 3T66A 4HW8A 1MY1A 3CSBA 1B7HA 5CMBA 3VVEA 1MXVA 2M8CA 3T9HB 4Z0IA 3PD8A 3H6TA 4OEUA 4KHZE 1H76A 3EN3A 1MXZA 1A8EA 4ZECA 1Z7ME 1A40A 3ILTB 1MDP1 4DCXA 4ZDMA 5I2KB 1YAEA 3IR1A 1MQIA 2X26A 4IGTA 4G68A 3MUQA 3PUXE 3Q29A 1YTVA 2Z8EA 1SI1A 1B32A 2XD2A 3ZSFA 4N13A 2PT2A 3TAJA 1R1NA 5I2NB 4AQ4A 1QUIA 1AL3A 3MZBA 2O51A 5AA4A 1JVYA 2DP8A 3T9VA 1Y20A 1QVSA 3ZS6A 1B5JA 1RYOA 5KDTB 1PDAA 3OMBA 3G7WA 5H8NB 1B5IA 5F1QA 3A3CA 4IO5A 1MS7A 2QPQA 4UA8A 5HBCA 2Q88A 2XX8A 1PC3A 4KYEA 2QS1A 3RT8A 5DYHA 3K0VA 2V93A 5KCJA 1LAGE 4F18A 4BLAA 4U21A 1DTGA 5L9SA 3VVFA 4H65A 2HAVA 2P2AA 2QS2A 3TMGA 1UTBA 4KPTA 2IA4A 4H67A 4EXKA 2I4BA 1URDA 3GZGA 2I6EA 2NXOA 1BP5A 3TZAA 3LSLA 1BTJA 3H4ZA 3FXQA 2O7UA 4OZ9A 4FE8A 2KLFA 3WAFA 3IORA 4EQ7A 2QL3A 5ISUA 4K3FA 4X1DA 3QUJA 1EU8A 4E0WA 1PEBA 3VDFA 4YMAA 1POY1
chains in the Genus database with same CATH superfamily
1H5BB 2ZOKA 3GIVA 3GMRA 5TJWK 5CLYA 3Q2VA 5AA1A 3VXQB 4ZOEA 1I9IH 1UVQA 4A7GA 2A3TA 1YY8B 4PUBH 3D50A 2FA7A 1J0KA 3WDIA 4GKZA 3CE1A 3JYRA 4JFOA 5A7EA 1LGBC 5GZOA 1TFPA 3QH3B 4S1SH 4OLZH 2IXQB 4F8QA 2CGYA 4QTHB 5GIRB 1P7QB 1EHLH 5FYJL 4LOVA 3NCWA 3IMWA 3KBRA 1BQSA 1R33A 3RNQB 1FYTD 2B1HH 2VT5A 3OO8A 3KYNB 1OGTB 1UTHA 2AXFB 5DD3H 4GW5A 1TQSA 4WV1B 4CRPA 5JXAL 3QQ9C 4HTGA 2EDKA 1B4JH 1P53A 3ZT6A 4PBQA 1FL5A 3JV6B 4FFYH 4P46A 4B96A 3V4PA 3EIFA 1CFQB 3OTTA 5LG6A 1B6HA 3L3OC 4EVNB 3FTGA 3HC4H 2CUIA 5I1LB 2FECI 4MVBC 4WJ5A 5FM4A 1FZOB 3FUIA 1LB8A 2VMCA 5I1CH 1N64L 1ZTMA 4P2RD 1FHGA 4XB3A 5EOTA 1PB8A 3N85H 3G3IA 3VCLA 2B3BA 3ZKND 2V2TB 2Y23A 1HHJB 2R0ZH 4N2KA 2O4EA 4FHBD 4F58L 5BJTA 3EH1A 4NBYB 4PRIB 4X2UA 5K5YA 4M7LH 5BCAA 1PLGL 2ZPKL 2NSMA 2VRKA 3D3VE 1EJOL 4WUUB 4N24A 4ZS6D 5DCCA 2HPOA 2DYSB 5EF3A 1A7LA 4OZHE 1AR1B 3Q25A 3IX1A 5IAIA 1DSFL 4W9IC 4I48B 3KZ8A 4H1LH 5E8PA 2CALA 4JANA 4R8WL 1PY9A 3K6NA 2GIMA 3UCQA 4EN3C 3UEQA 1KYFA 5DQDL 4U1KA 5C3TA 1DBBL 2GJJA 4XC3H 5I1KL 3CSPA 3QE5A 3QG7H 1H3PL 4JGUA 3UAJA 4HHGA 4NBXB 3CAFA 5F89A 1ORQA 4X7TA 1MXDA 5I76A 3RWHA 3Q0HA 4K55A 2ENJA 1FI8C 4GXUN 4ZO6A 1CDIA 1DN2A 2XQ0A 3MKKA 4G42A 3FCTB 3TF4A 1GGGA 1OVTA 3HC3L 4PJHB 4C54A 1A6TB 5FPIA 4Q74A 5JMOC 2ATAA 4NJAL 2DQJL 2R23B 4WWOA 5AW7B 3PUWE 3FBPA 1EZUA 2UVEA 4FHKA 3B9KD 4OVUA 2CBTA 4MX7B 3T2OA 4L4VE 2AFNA 2VXQA 2EIKB 3IRCA 3EADA 3QRLA 4X7CC 4NKOB 1EIBA 1J86A 3KMDA 2YKKA 3V6ZA 1I9IL 1IFHH 3TTSA 3QDAA 1DCLA 3UTTA 1XCXA 2N7BA 4PUBL 4AJ0A 1VZHA 2J2ZB 3MRDA 35C8H 3PF2A 3DK2A 2WC7A 5DGRA 4X42A 3ZMEA 3D4YA 3PQYA 3BWAA 2QVKA 1VLXA 2IEEA 3A4FA 4QGYA 4OLZL 2YEQA 3VXUA 4ZXBB 2IGFH 4DFIA 5IOPA 3M17B 4NEHB 5AKTA 4EF1A 1JVKA 2B1HL 3BGMA 2JI1A 4GYBA 4JDEA 5FUZL 5EPMA 5DD3L 4ODSL 1G0DA 2C3VB 3BUIA 1NUNB 3MV7B 4DK5A 4J8QA 1RY7B 2GC7C 1J1NA 4Y2DC 1C5CH 1A6ZA 3PIQA 4O2EA 3MV9D 5EF2A 1Z5HA 1H3WM 2Q2EB 3Q8BA 1ZHLA 3GBAA 5IW1A 1URLA 4XWGL 1OAKL 2CRZA 4PVBA 1IEHA 5AVVB 2XXQA 2DDQH 3HC4L 4Y16D 5I1CL 3G5VB 1RVFL 3FQTB 3GYRA 3N85L 1SGKA 2A9CA 3L6GA 3S36H 3B2UD 4QYAA 3OELA 3LKQA 1MNNA 1LAHE 4FNQA 3PJSA 2R0ZL 2D3VA 3C31A 3TZVA 4A38A 1IXCA 3CPLB 4WJKB 4M7LL 1Q38A 2ARJA 5J4MA 1CDCA 3VJ6A 4YZZA 4MS8D 3SEUA 3FSWA 1YEWA 3QIWB 4LBEA 5T3ZE 1X9UA 5DT1H 4JBSA 3SO5A 4KHTH 5HHMB 4RESB 4O9HL 1T1YA 5EULV 2DXRA 3CIQA 3T3PE 4N2EA 1B3GA 3HE7C 3PWJB 4Y2OA 1WT5A 3OKDA 1I7ZA 3C6LC 1DZBA 2LTQC 4LCYB 4TQHA 1N8ZB 1OGAE 3FU8A 4HOXA 3VWJB 1ROCA 4ZEFA 3X1NA 1IBZA 3C87A 3PUCA 3JSSA 3C34A 2H45A 4UOW0 3DBXB 4ZW8A 3EXJA 5KZTA 5E94A 2PX1A 2ZXCA 1U8IA 3GRGA 4JSOA 4OF3A 4U1LA 4DP8X 4PJCB 1BV8A 2Z4QB 4QF1A 2NYZA 3JYBA 2HX7A 4XGZB 4TMPA 2PUQT 4ODUB 3ABMB 2PABA 1OAZH 3QUXB 4F22A 5TD4A 3CQQA 4AUJA 4Z76B 5FX3A 4K15A 4P3DA 5DJ8A 1KGCE 1P1UA 1SZNA 2CMRH 4UYQA 5I1AB 4S2SA 3VFMA 1WQVT 1JN6B 3BW9B 3JV4B 1B4HA 3A6BH 2APWA 2HRPH 3QFDB 4UQDA 4R7DA 2LTQB 4HJ0D 1IARB 3SKJL 3OKLB 2CKNA 1IFHL 1SNRA 2JIXB 4YSSA 2WZPD 4YR6A 2Q2CA 4LEXH 35C8L 1X5KA 3RILA 2G2NA 2ZX8A 5DRXA 1D5RA 5E2TH 5IIEA 1MM6A 4GG6F 4E42B 4EF3A 3JBG7 4QRRB 1HX0A 1NCWL 4LCIH 3BGFC 4KKQA 4NMYA 5DMYA 4A6YH 2IGFL 4UQ2B 4HUVB 3QEHB 2WINB 3O29A 1A6AB 2NQDA 2X4RB 3O3BA 4FI7A 4P4RA 4P9HC 4F9LC 2GTWA 1OIOA 4FCAA 4J4PA 1B3FA 3DP6A 3ATAA 4NN6C 2XN9E 1JQFA 4IKIA 3BD4A 1LGVA 2X09A 4CKQA 3V0EA 3C33A 3FZUC 1USQA 4ZW7A 1OSEA 3FU7B 4IRSC 3ZOAA 1PSKH 3IU4H 5HI3C 1BXAA 3KLHC 5KSBA 1C5CL 1YMMD 4FX5A 1NC2B 3PDOA 4PY7B 4X7EC 3F5WA 3WFDL 1UUSA 2PT1A 4N6RB 2DDQL 4BEIA 2BSRB 3O2AA 3GGWB 3ZTDC 5IMLA 1ELJA 3RY3A 3ZHDA 4FI8A 4NZJA 2L0DA 4GIAA 4YHKH 1AI1L 3VGEA 3FFCD 5SWZA 4Y4KC 1NGWA 1ED3B 2XACC 3AROA 4K07A 4P2OA 3QDGE 4JCWA 4ZT1A 3S36L 3WMSA 1MH4A 4X6EA 4HWBL 4CMMA 1ASOA 3OC8A 4FD0A 4UOZA 4FXKB 4I85A 4LOUD 1LBVA 5KZCB 1AC6A 1HOCA 3T2NH 2FZ3B 3NZUA 1EXUB 2YGNA 2Z31C 3U25A 5ITOA 4MNCA 5CZKA 2UY7B 4OV5A 4B9YA 2CLVB 3WEXB 3ULUE 3VRJB 3UGWA 1ILSA 3OKEA 5D1ZD 2G2RB 5I6LA 1PU0A 3GMQB 4GH7B 3LNGA 3FMGL 1P1WA 1VFAB 2XA5A 3IBOA 1V55B 1ETA1 4HGKC 4QLWA 4X6DA 4P4KC 5JR1H 3HG2A 1JV5B 1B4LA 2D31A 4ELPA 3VYPA 4ZE8A 5DD1L 1QKBA 5F7DA 3R0MA 1T89A 3Q05A 4RBPH 3PGDA 1RYXA 1WAAE 1OSYA 2E76C 1U3JA 1OAZL 4N8CL 3IJEB 4P0GA 2BSTB 3QDJE 1P4UA 5ID0A 1MJUH 2Z31B 1UTDA 2C9AA 1TEYA 4UABA 4PU2A 5B1JC 1I8MB 1D7CA 1U3YA 1RIHH 1GC1C 2CMRL 2XY2A 3RUGB 4QO1B 1IBDA 2FX8H 2K0RA 4OEVA 5KYXA 2VDMH 2CNYA 2HRPL 4WAFA 1XB8A 3TEWA 1NCJA 4U1HA 1EHAA 1YSOA 3SE9L 3QFJA 3BAIA 5J5EA 4HCRH 4IJTA 4ZFOL 5E9AA 1ZSDA 1XB3A 3NCFB 4LEXL 3TM6A 3S2AA 2RMNA 2WBJD 5E2TL 4P04A 4N15A 2JQAA 5ICTA 4JHVA 4RFOL 4YNYA 5KUMA 4LCIL 4N8PA 3ISYA 4ZEDA 1F9BA 4LSSH 4B9GA 2W9LA 3WJLC 2BIPA 1IAOA 4L1TA 1HL8A 1K8DA 3T4AC 4OFVA 4AYFB 3PWUB 4PRPB 1PKQB 4BWTA 2KLRA 1QSEB 2NTFA 2WQ8A 5EC1A 1JZEA 3IN2A 3ETSA 4GI6A 3F64A 2AQSA 4BSJA 4B9FA 2YQGA 2J20A 1VGEL 2CPUA 2DIBA 1PSKL 1OTUD 2GC4C 3IU4L 1ZLUK 4G8GE 1LBZA 2AJZB 2C9QA 4JZNA 4PV9B 1BBDH 1KXVC 5ERWB 5I15H 3VX1A 3NGBB 2VUOA 3LXAA 5EU6B 4I8CA 3H0TB 1V3JA 4BFRA 1S7TB 1OAXH 1FVDB 3GD1C 4Q5TA 2BZ7A 2D3IA 3LUZA 2ICWJ 3KH4A 1LQBC 4EI6B 3IMRA 2G29A 3GLZA 5AQ0A 4AYID 2ITCA 4PGBB 5DRZB 4UB0H 3WNNA 5AA2D 4PFEA 1GZPB 4HK3N 4DXCA 5JW4Q 3MJ8A 1AHWC 3GXAA 4M7KL 1LMKA 3GXDA 4GBXC 3DRQB 4YSEA 2AABH 1IB5A 1B2HA 3T2NL 3ZN6A 1IT9H 3D0VB 3KGRA 4HU8A 3LNIA 4GW1A 1ZT1A 3HSTA 4YDMA 3REWA 2AF2A 4QY8B 3OJMB 1CGTA 2Y1YA 2PPFA 1ZJLA 4AMXA 5AW2B 4GNKB 2W7YA 2B8OT 4LPWA 4Q6KA 4YGVA 5AUMA 5L8LB 4DXUA 3HG1E 1AXSA 4X5LA 5D7HA 5FM8A 4OM0L 4PG2C 2BVTA 2VAJA 3H9HA 3WENA 4UDUB 3S36X 4G9FE 2D5WA 2XJLA 2P80A 4TQUQ 2KR0A 3A47A 4N0RA 5IB1B 2I32A 1ORSB 2ITFA 4P59H 1GS8A 1OHZA 4HUCA 4D0CA 2BHFA 2R69A 3ZBMA 5HGBA 3V79C 2RCBA 2WYKA 4XHJC 4GBXB 1XD0A 2BVUA 5D1XE 5D1QA 4Q9RH 3LHAA 4P23C 4P49A 3FVOA 4GWXA 5MERA 3BP5B 4UM8A 4R4FL 2OR8A 5FFLA 4OZGE 3L1EA 5CHNA 4XBEH 5C6WH 1EZ9A 2GY7B 1F8TH 2NXZC 1RIHL 3L95B 2YBRB 4P5MA 3MV8E 5I66A 5GGTL 2FX8L 3C35A 5J9PB 2BVEA 2VDML 1S3KL 4U0RC 5T8IA 3LR1A 3D25B 2NMSA 3VI4F 3H3GA 2W8CA 2XKNA 2H47C 3D18B 2W91A 3GRWH 4JO4H 1S7VA 3S9MC 1KOAA 1BQHA 4HCFA 4YIQA 4FFWD 1UD2A 3LV3A 2B1OA 3AQXA 3WO4B 1OZTG 3ARFC 3ISWA 3VO0A 3V6OA 1KBBA 3GSQA 1NINA 1LDPH 1CFVH 4C1TA 4F29A 4LSSL 3X12A 1AAJA 3E38A 4L23A 1R3LB 2Y7QB 2CZIA 1MELA 2OCJA 8CGTA 4GVOA 5I0XA 4DSYA 3D48R 3VSQA 4R26H 5J57B 3CN3A 5KVFE 1SFDA 1KEMH 5AVRB 2H2SC 2NXZB 4FLHA 2WB1A 5EH1A 3BX7C 3G5ZB 3BO8B 4LARH 2HFEA 2IAMB 5IUSA 1WSST 4LSQH 5GZNA 2BHUA 4U6YA 4FNSA 3T0EA 4MCZA 3UEZA 4MJIE 1W72A 3LYRA 5DUBB 5I15L 4LLVB 4DZ1A 1XGQA 1I3RA 1PIGA 4PJ8C 3TPAA 2DQFB 1CLVA 1HNGA 1OAXL 2NZ1A 2YD3A 4WWKA 5FA3A 4FULA 3T4YA 4JFFD 1FFPA 1CVSC 1GVIA 5DJYA 1UXWA 4ECFA 1H44A 4NKMA 1B46A 1VSOA 3ROLA 1NMAL 3FOMB 5GS0H 5T1KD 3MRQB 3PU7A 2DWTA 3U1SH 3OZKA 1EERB 1HHHB 1JETA 3T3PF 1NH7A 2AABL 2ZYMA 1CFTA 5C0CB 1U3HC 3GM0A 3WV0A 1BPLB 5JW3H 3SE4A 4OJYA 1UD3A 3S3SA 4OFYD 3DO7B 3ZL4H 3S2CA 2OXHB 4JFYB 4H0WA 3DURA 2F6AA 4PETA 1DQIA 1YEGH 1BJ1H 5LO7A 1I6AA 4XP1L 3JV5A 3FBKA 1MNUH 3MREB 5IEKA 1FNSL 3O3DB 3K8KA 1JDCA 4OFKA 4FQLL 4RAUA 2N0KA 4QF9A 4FL4C 4PJ8B 1Z7JA 1MIMH 3DVIA 4DQAA 4MB1A 1OLZA 4KGJA 1YUHB 4FXGC 4LQFH 3N9GH 1B9KA 2IV8A 4HV8B 5DA4A 4DCYA 1DE4B 4LDOB 1NKRA 4N5EC 3RFZC 2IOOA 4M03A 2Q86A 3LEVH 3SOTA 1NUGA 4OVJA 4LK4A 1UM6L 4IBYA 2F2HA 2Z8RA 4PJHE 3RIKA 4NF6A 1KLFB 1SM3H 4G70B 2VLME 4KUZH 4U1SB 4KDTA 2JFCA 5D96C 4PJIB 5I1DA 4Q9RL 4ZS9A 2E9GA 3E1ZA 3BT2L 1U3HB 4ESWA 3QXAA 3BQUC 1E6OH 2EDBA 1ACYH 4XBEL 5DD0L 2BSCA 2DYXA 1X5IA 2XVBA 2HZKA 1IFRA 3WBDA 3BKJH 2FSEA 4Y89A 1ERNA 3EG9B 4N2OA 5C09E 3GS7A 3DIFA 5F6HJ 4Z7OB 5J8OA 1QFOA 4GG6A 1R5WA 3B9DA 4PLKC 5IMKB 5HJ3A 2MTAA 2VQ1A 1AOVA 4LHUB 5I8EA 4FXGB 4LCUA 3GRWL 4JO4L 3P1VA 4KXPA 3RPLB 4R4ND 1FV1B 5I3SA 1G7MB 3RFZB 3DVGB 2W60A 2VQTA 2EEBA 3IB0A 1OTSD 2YD1A 3UYOD 3EYFB 1LDPL 1XZ0B 1CFVL 1TETH 1YEHH 3QZWB 4B0MM 1NFIB 5I1HH 4HK0B 5KBMA 2X4QB 1MXUA 2DLFL 4W9KC 3MRBB 1HT6A 4WXJA 2VR3A 4R26L 2LAGB 3FO9A 3LRKA 3RFRA 1RSFA 1TXKA 1BVLB 3TEYA 1PNCA 1A9BB 1L9QA 5BPPA 1M2VB 4WO4B 3CG8A 3H7BA 4LARL 3DTDA 4U4XA 5H4ZA 4LSQL 3IVKA 4PJ5A 4QHNB 1G0XA 3KJ4B 1ZE3C 4N22A 3RTQD 5TFSH 4XMTA 5C0NC 4XP9L 1MJJA 2A1WL 1XT8A 2YJQA 5E51A 1EFXB 2XVKA 3ESPA 4RYAA 2C1OB 3D87B 3SZPA 3VXRD 3GMNA 5CGMA 3IJSB 4DH2A 1UASA 3OJDA 4I18B 4F8NA 3MVYA 3QI9B 1LWRA 4J3UA 5T3ZH 2WN2A 2EE9A 3IFLH 3M1BA 4CADA 1L5GA 2F1BA 2Z7ZA 1UD6A 3BDBA 3U1SL 3WAKA 4MD0B 3OPZH 5AENA 2MKLC 2NY5C 3ULUF 3GBBA 5JW3L 3SPHA 3ZKSD 1GKOA 1PBYA 5DQJA 4ODWB 2HMID 2Z35A 4R0LB 3ZL4L 5CM6A 3II3A 1G9ML 1GOHA 2AJVH 3M3FA 1I1AA 3DX3A 1YEGL 5KG9B 3V55A 2XXHA 4O94A 4IIQA 1MNUL 3KNBA 1FL3A 2NR6A 3MRNB 4J27A 3FQXB 2GJZB 4XBPB 1MIML 3GF8A 4ZBJA 1J9SA 2VLJD 1QWHA 4MNQB 5I16B 1M5FA 4NF5A 3AG4B 3N9GL 4LQFL 4OETA 1ZGLP 2DYRB 3GSNB 3RHWK 1WAAF 3PGFL 4Y9CA 5JXEC 1UEMA 5HHNA 2VD3A 1IBBA 3HS0C 2R0WH 4PJCE 4X9YA 4ALAC 3SO3C 5F9OH 1SM3L 4M1GH 2CZLA 3RDJA 1WFTA 4KUZL 4FI6A 4ZTEA 4HIEB 5IROC 1A4CA 3RWDA 1A1MA 1E8XA 4JQIH 5LCVH 4AEIH 3FQNA 4WKZA 3CSFA 1ACYL 2EACA 1CFMA 3HTLX 4A1RA 2YC1B 1TFHA 4FEMA 4I13B 3LMJL 5D1ZI 4IJ3C 1PLCA 3GKZA 3BKJL 1Z2KA 3VUAA 3UP1A 1SYSB 2V3EA 1Z9SA 4FKEA 3Q1EA 1SOKA 1QLRB 2G60H 5JPMB 1KBGL 3L4TA 4FJPA 1T0NA 3OGCB 4P99A 4A67A 1M9SA 3IDMB 5JOEA 5TU0A 2PFZA 2DS9A 4LVHB 1HC1A 2EDMA 3OOAA 3HC0B 9CGTA 5BVPL 1TVHB 4UBDC 3SO3B 1G6VK 4JDTH 1E7VA 5ESVA 1LE5A 1HL9A 1TETL 1NC4B 3KPNA 2D2OA 4D7BA 2CA4A 5I1HL 5DC9B 2HPGA 3SDAC 3QUYD 1Y1DA 2BOBA 3RA7H 1IAII 1CDBA 4RBPK 2B08A 4X8GA 1H3DA 2EUVA 3PP4H 2P8PA 3MLPA 3AS1A 1I53A 5MP6H 3APNA 4YHIA 3WN5A 4KXZI 1ZVSA 5GRWA 4WW2B 4QAMB 1PZUB 4R6KA 1WBXA 2VAAA 3ZUCA 2ZF9A 5H8FA 5CF3A 2NT1A 3D3VA 4MJ6B 5AFAA 4KHXH 4ZUTB 1VHPA 5TFSL 3TTKA 4R6UA 2NYYD 1MFCH 3CH1A 5EUOE 4CDHA 1PZ5A 1UTBB 5CSZA 5IB5A 1QRNB 2DH3A 3RWIA 4QHQA 3G5WA 4QGTA 3PDGA 2YUVA 4KTGA 3B2DC 4LCWB 4NM4H 4Y9EA 4P2YA 1AANA 4YFLI 2THIA 5E08H 4DEUA 5B8CC 4R4BA 1DEEB 5DF0A 3FO0H 1LFIA 3ULSB 3MPCA 4MJ5A 1U8MB 1P0SE 3OPZL 2WTOA 3K2KA 1LEGA 5I6PA 3SDAB 2R2BA 3F6JA 3TO4A 4AQ1C 4L9LC 2VKWA 3BPNC 4APQB 3ULUH 1UB6A 5C9JB 2YA1A 3AC0A 5HJBA 3VH8G 3UBGA 3FXIC 5DEGB 1MXYA 3RVXC 2GRVA 1BFOB 1MG1A 1XCWA 1QUJA 1QSFB 3QG6A 4JDZA 4PM1A 1O64A 3WS6C 4OGXL 3QPKA 2GIXA 1PQZB 3C09C 3EYVA 4DGIH 3LKOA 5JZ7D 2N56A 4OF5A 1QHPA 3QORD 3NJJA 3LEXB 1EHKB 5LLIC 1QULA 4U6HB 2CBPA 4ZUWA 3N2JA 1P5UC 4U2ZA 3QIBA 2JQZA 4L4VA 1VGKA 2PO6A 5L9OA 4JY4A 1CDUA 2P43B 4AYGA 4FNRA 2R0WL 1N6UA 3LQZB 1NV5A 4OZGF 4G7QB 4CUCA 2P5EE 3WIIL 5B8CB 1VJSA 3V8CA 5BQ7B 3SPJA 4M00A 4P48A 4XCEB 4L9LB 4OFLA 1XGPB 3FCSA 3LSWA 4JQIL 3VI4A 4AEIL 2PXYC 2WLIA 5LCVL 1NNTA 5IBTH 4JVIA 3S5LG 1KN4L 3MRMB 4E9QA 4X9TA 3TYFA 3VD3A 1OARH 1IBYA 4DP7X 4IK7A 3F01A 1IKNC 3M3LA 4G8IA 2G75A 2Y7SA 4ZMNA 2DEXX 1K4CB 4XP6H 2CO3A 3JZJA 3KM1A 2G60L 3P9LA 4AT6B 2EE0A 1P5UB 1NNKA 1S9WB 1Z3GH 3EH4B 4ATTA 3VVWA 3ASNB 1I3UA 1US5A 4V1DE 3HN8A 3IJHA 4I0PA 1KTKE 2DMHA 3HAEG 4MAUL 2R59A 1EAJA 3NK3A 3ROOA 1HNFA 2VWEC 4JDTL 1IQ7A 1MUJB 3KXFB 5C0IA 1U3ZA 2PETA 3RI5F 4JFPB 2EQDA 5IJDC 4OF0A 2IVFC 5CD3B 1QNIA 4BZ1L 1XIWC 2E7DA 1E9PB 3VX0A 3CVHH 1TKWB 1LFGA 5HHXH 2VUYA 3MGOA 3SDXF 5A2JH 3H3PH 5MP6L 5CLXA 4NENA 4I2XB 4XMXA 1K5NA 3CVDA 5T3XH 2CKBB 1DDTA 3V95A 5EU6E 1SYIA 1QW9A 5I6XC 1E0OB 4PIBA 3V7AE 1TSHA 1MFCL 5GZOD 3NFNB 3BPLC 5AZUA 3AW5A 3QJFB 3RZCB 3CZGA 2OXGB 4F19A 4WU7A 3U65A 4NM4L 5LTCA 3NAAL 5E08L 1OGAA 4TLLB 4P1LA 5JHBA 3CU7A 1AO7D 3TELA 5MENE 1SEBB 1IQWH 3HRZA 2F15A 3LN4B 4KJQD 2XWXA 4G2AA 4N68A 2YK1H 3D2UB 3FQUA 1T1ZA 2F54B 4P46D 4QT5B 4U2YA 5F9JA 5B4MC 5EEWA 1XCTB 2W9EH 2CLZA 1EYKA 1EEYB 4PJDB 4M61A 2LU4A 4JQXC 2Y5QA 1Q0YL 3IMUA 4XO3A 3WXVH 3LRHA 1IGIH 2PR4L 2WQSA 3D33A 1TTAA 2A99A 1MRDH 1IQDB 3GDBA 4JPIA 4DGIL 2NUTA 1W6LA 2GAZA 4M8VA 2WNXA 2NY4D 4YXHH 2ZF8A 2Z9TA 5KJ7E 2Y5LA 3BPLB 4PJHF 2NOOA 1NEUA 3FB7B 4AQZA 3C5ZC 4DKTA 3WTSA 2XWOA 5FHOA 4ZX5A 5JA8B 2ADFH 2UZIH 3HS8A 3VB8A 3KYMB 5AW0B 5IZ1A 5EU3B 1NEZB 3IMVA 3MRKA 4G6JL 2AGJH 5CSGA 1HSAA 3B1TA 5KTEH 3BZEB 1CVRA 1SJHB 2YOCA 3W0WB 2CO7B 3ODBA 5IBTL 4ODXA 1NCDH 1QW8A 2MJWA 3RGYA 1PPIA 1BJ1J 1B0RA 3E9UA 4QTIH 1L9PA 1FAIH 3DJRA 7FABH 1OARL 4HS8H 1N3NA 1T4KA 3NIGB 3P0VL 4C1UA 2OMYA 1CYGA 3R4DA 3TL5A 3L6FB 2K4WA 4BDOA 3T6ZA 1EXHA 2XN9A 1M7UA 2P7TA 5C0BB 2FWOA 4S0TD 4KRPC 1CXFA 1Z3GL 5B3SB 4R90L 2WO2B 1D3KA 1UIUA 5D55A 1XS5A 4QXTB 3GSXB 3V8XB 1HSBB 1WICA 1S9VB 2AXGB 4L5FE 2ZJSH 2EIJB 3EJYC 4KPHL 4WFHD 5E9DB 5JW4R 4WEMB 5K2YA 1ZK5A 2DICA 4DE8A 5L9DH 1QBMH 2CHNA 3UFIA 1YVLA 2VC2B 3FRUA 4EKXA 1HOEA 4U6XA 5HDOA 1A7NH 3CTTA 2GTZB 2YRPA 3CVHL 3OXRB 5HHXL 5HP5A 4NDMA 4QRQA 3H3PL 3MUGB 3N55A 2D3JA 4LLMB 1BWWA 4QHMB 1AGBA 4W70A 5T3XL 3S3JA 2QGCA 1E5BA 1O75A 2IDTA 1NIAA 3S4SA 2NY3C 3K4DA 1ZDQA 3PQYD 4DK6A 3MV01 3VXUD 4OZIB 2ONRA 4LDCA 1DOTA 12E8H 3NTCH 5D7KE 3BKIB 3CJJA 2V8LA 4Y1AB 2EO9A 4GLRH 2YD0A 3HN3A 4YZWA 1U4FA 1YMHA 3RUMA 2E8ZA 4ADJA 4HUWB 4F2EA 2YRBA 1G1CA 3GJFA 1MI5E 1DSYA 5CN1A 1MQHA 1NFTA 4F1VA 1FZKA 2G93A 4K5OA 1Z6JT 1D2PA 3Q13A 4ONHA 2EXWC 4Y4FB 1WFJA 2XYBA 3GC3A 5C0CE 2BNRE 4IBUA 3SKMA 5IQ9B 1IQWL 1DSNA 5FV1L 1PZAA 5I0VA 1OL0A 3EGXA 3OHXA 1QFWH 2W9EL 3BBRA 1NPUA 3LIZL 3JYCA 3HUJE 3ZKMD 3U92A 5AYUH 3UMNA 1VDGA 2ATPA 3WXVL 4NX1A 2EIBA 2A4EA 2DM2A 2HSIA 1XF2A 1L3WA 1WAAA 3C5JB 1MRDL 2QQLH 2X40A 4KYSA 1FJ1B 4NTLA 1JRHI 3QXUA 3MACH 4AXWA 1V7NH 4OGYL 1EVUA 1CC3A 2P9RA 3AVEA 4RGMB 5EORL 3TZVD 4H45A 3PLYA 4E9YA 4D9LL 4M7JL 5DS8A 3ILPB 3RPBA 1R34A 4JFEA 4LF3A 2AK4B 4JFTA 2ADGB 4Z5RA 4PR5B 2UZIL 3DX0A 2XTJD 4I77H 2Z1KA 2I9TB 1U0QA 2AGJL 1HEZB 1FPFA 2VLKB 5KTEL 2XXUA 3FYIB 5C92A 1P7HL 1MHHB 3V9EA 2BFVH 1BAGA 2Z34A 4YBQD 1MHEA 2H0JA 3SDCA 4QTIL 4WHYG 4D0DB 7FABL 4HS8L 5IVOA 4WTQA 4GSXA 2M83A 1NJ9A 4JNXA 1JFQL 2H32B 4ICXA 5MEOB 3MPKA 4ICWA 3VVVA 3NIDB 2PYYA 4JZOA 4K7PY 3IGAB 3PL6C 1X3DA 3WL9A 4G8GA 3K5SA 1WFIA 3GBEA 4YHPA 4KVNL 1X9QA 3WHXA 5FCUH 1TCMA 2ZJSL 2BO0A 1SN2A 1YY9C 2F08A 4UV4H 5L9DL 1OVBA 4DO6A 4J3SA 1KENH 2UXTA 3K6SA 4EQ2A 5D7LB 3MGTB 3HFMH 1NPNA 3EBIA 4NZFA 5EUOF 4EIGB 2ZKYA 2I0CA 2IBZX 4KZ0A 2XLLA 5CN2A 3M1CA 5EOCH 3H4FA 4NKDA 5ICQA 2G4EA 5FUCE 4LSTH 1FUNA 3RDTA 2PR9A 5DK2B 5F24A 5C2BH 1KWHA 2PBWA 2NCMA 2JKXA 5I26A 3E8UH 1MY2A 3BXNB 12E8L 3NTCL 5IHUH 4JM0A 4JG9A 5F0MB 4QSDA 3O11B 1AXIB 2E9JA 4MEVA 3HG1A 3ZU8A 2VYRE 3R06B 4J4PD 4ZDHB 4HUNB 1N0TA 3CN1A 2IGTA 1UOKA 4Q52A 1THCA 4FFTA 4HHWA 2X4PB 5JW5A 4GOTA 1T0PB 3NSCA 4PB9H 4TYUA 2V3QA 4PJ7E 4YSQA 2H99A 3IDYC 4K2UH 4WI6A 4DUWA 2F1EA 4YB6A 2VT0A 1RERA 3G7TA 1QFWL 3N5LA 3DROB 5HHPB 1HI6A 4NO2B 4HEPA 5AL8A 1KCKA 1KT2A 3D69A 4KBPA 5D1XA 1ZHNA 1E7UA 2AVFA 5SWZD 4MNQE 3BJ91 3OAUH 2A83B 3HHSB 4OV6F 4OZGA 4P2OD 1CICB 1HYSC 5IR1B 2P45B 1V7NL 1BLFA 2GG1A 1C12B 1H5BA 3OX8A 4X8JA 4ZYKA 1GR7A 3MV8A 3VDAA 4Q89A 5DJ2A 4ZFQA 5KBKA 3ONMA 2K7PA 2GCYA 2ZOOA 1P1NA 1O0VA 2QGBA 4MNHB 4NQSA 3CZJA 4H26B 4RMUA 1ULVA 3O6KL 4OKVA 3F62A 1OAYH 2QSVA 4JR9H 4I77L 5ESAA 1Y6MR 2AV7B 3Q2CA 3KCPA 3W81A 4DP1X 1KTJA 1A6UH 1U8JB 4HPYH 3U4BH 3OO6A 3I6LD 4RIRB 3MW0A 1KLGB 1IX2A 1ZTXH 5GGSB 2X4TB 3OV6A 5GIRA 3U72A 2WBXA 2K70A 2BFVL 5AB1A 5LXVA 2P4AB 4HJJH 4MMXC 1FO0A 1NGYB 4A7SA 5FO7A 2J5WA 5DS2A 1Z9NA 4O58H 3RNQA 1A3ZA 3V52H 1F86A 2B5IB 3X1EA 2AXFA 4M3KB 4POUB 4I4WB 4X80L 1R3HB 4D0BB 3C60C 2I24N 4FNUA 5TH2B 4E2OA 5J7CC 1R3JB 1POTA 3WFEH 3OVUB 1BX2B 4CJ1A 2A73A 1Y0LB 2DQIL 3JV6A 3IDJA 5IFAH 4JWOA 1JWSA 4G77A 3U4KA 3MI6A 2I5YH 1QLEB 2P8MA 1RV6X 2YXFA 1PY0A 5CP7A 1P1ZA 4MJIA 2AW2A 3B7TA 3RPKA 5L0QC 4BDQA 1OD7A 3SDXA 1NKXA 5HPOA 5DD6B 3VFUA 1WVJA 2VJXA 5DWUH 3MROA 5KBDA 3GLDA 1MLBB 4M6OH 3TA3B 2F8DA 1Y9UA 4AQOA 1KENL 4JMXA 2V2TA 2NW2B 4MSWA 3UIZA 1HHJA 1NCNA 4Z7VF 4G9DB 2I3WA 1P4BH 2I9LB 5DK3A 2FCBA 1GHFH 2H26A 3QFJD 5EOCL 5A6MA 3RP1A 5ET8A 4XZUB 1QRNE 2QPSA 2XU9A 2Y5KA 2B59B 4PHXA 5GS2D 5C2BL 1TZIB 1JIBA 4UANA 32C2A 4PF6A 4JO5A 4LCWE 3AAZA 4UAHA 3WYRA 5IHUL 5I1IH 4ISUA 3G6JE 2P44B 3L3OA 5C0JA 5L0QB 3LSOB 5C0GB 3BT0A 3C4MA 2X88A 3Q3GB 1OTTD 1KFGA 3BFQG 5DZNA 2P5WB 1T2QH 1XVSA 5IVZB 3S35H 2ROYA 2YSTA 1GGIH 3HV1A 3ILDA 1DJZA 4Y5XB 2CCLA 4K2UL 3QEUB 3WJMA 1YZ0A 4AQ8C 2MCMA 1PX3A 4QRUA 5EBMA 1AD9A 3IOTA 3UG3A 3BZDA 3V0HA 1SQ2N 3RB7A 1BKAA 3JV9A 1KLUB 5KVMC 2NNAA 4F2MB 5F44A 4M8QB 4MX7A 2B39A 1KZYA 3LVTA 2W80C 3OAUL 3L54A 3T2QA 1OOWA 3KGCA 4OLEA 4EN3A 2B3FA 1EBAA 4OF6A 3IGUA 2P42B 3MLTA 5F7MC 3X14B 5C09A 4NWDA 2VOZA 4DLDA 4GFTB 4GUQA 5JW4M 1XGUB 1CF1A 3X17A 3G04B 4OBRA 4BFGA 3Q26A 4MA7L 3QQ4B 1NMUA 1KDIA 3NP3A 1YNKL 3EBHA 1OAYL 5CJXC 3TNMB 3WLBA 2WIIB 4L2LA 1H8SA 4OD3H 3COOA 1A6UL 2R51A 2W88A 3FT3B 4HPYL 4YDJA 4CSZA 4C0RA 3LRSA 1ZTXL 1FSKB 1A99A 3RWFA 3OM3B 5FOBB 4HJJL 3KN3A 1FYTB 3V52L 4O58L 1WIUA 4NPJA 4B0MB 2BVOA 5FR3A 4IRZL 2E56A 1QBLH 2OJEB 2J8UB 1GRWA 1PIFA 1T2JA 3DX9B 5GGUB 1K8IA 3VGFA 1Q0XH 3FN3A 3EDKA 2VDRL 3TWCL 4CGTA 3WFEL 2ZAGA 2OKMA 1A55A 2FRGP 3UG5A 5IFAL 2Y7LA 4IQHA 5D1QD 4PE3A 2NCEA 3EBAA 3L48A 2HHMA 3GSUB 4LT7A 3QAXA 5BS0B 3TBVB 1WA0X 1KCRH 3G5YB 1FIGH 1HH9B 2KHAA 2BPBA 3KPLB 1T21B 5I71C 3SBWC 4S0SD 4P2RB 4JCMA 3TIDB 5JMRA 3G5VA 1MFBH 4FFZH 5ID1B 4M6OL 5B7MA 2XD3A 1IEBB 1B2WH 3MO1A 4HSCX 4HCIA 5IWLA 4KR5A 3MCLH 4CVXB 4I2XE 1ZIBA 3LOWA 3CPLA 1P4BL 3RVTC 3S3DB 4KKLC 4MHHI 1ZS8A 4J3BA 2H0FA 4YXLH 4L8CA 1EZSA 1JPTH 2RFXA 2VL4A 4KCCA 4NIYE 2E74C 3EO0B 2VDLB 3MBEC 4FQHA 2QHRH 3SN6N 2C5DC 3TJHD 4MAYC 2V7NA 3IU3A 5BRZB 4Y2DA 4JFZH 4XX5A 2FJGA 4QRSB 2EADA 1HTYA 1LBWA 5F6IC 2EDLA 1OB0A 1JWMB 1U95A 2VWEE 2BHZA 3S96B 4MNGB 4H0LC 2XKUA 3PPEA 3W11C 2FIEA 2A6DB 4V2BA 5I71B 3HUJF 3N1FC 1B4RA 1FTOA 1PDKA 2F54E 5JIDA 2CSPA 1INEH 1T2QL 3BAJA 3EGSA 3S35L 3T6XA 2A5TB 1M1SA 1GGIL 2MHAB 1GAFH 4PJDE 4UF7C 4ZMLA 4G11A 3T0ED 1CXIA 1CBVH 2EH7H 3NP4A 5DHYA 1R3KA 5HD8C 3K00A 5ITPA 4KV5E 3TT3L 1JP4A 4OVTA 2FT8A 1UOWA 4KK9D 4WWKD 5JOPE 2C4XA 4U1MB 1FQEA 1HK6A 4IGBC 3IF1B 3MBEB 1BVZA 3ESOA 2XZAL 4X6CE 3BKMH 4XRCA 5K59E 4K9EH 4QCIA 1JN6A 2X4UB 3FT4B 4MAYB 3HE7A 1PLAA 1EH9A 2O5NA 3K72B 3QNXB 1Z0NA 4PRHE 1J8KA 3C6LA 3KN7A 2DJUA 2FEDD 3L2LA 3CHOA 2AQQA 2QDVA 5I73B 4ES9A 3KSXA 3B3IA 3GO1H 2ZCKL 4K7FB 4HUKB 3HNSH 4E5XG 3T04D 4KX8A 3IB4A 4FMKA 3W0WE 1JZJA 2ZWSA 2YLKA 5IB2B 4GRLA 1QEXA 5ACZA 4GWSA 3FJMA 5IHBA 1RJYB 1X5JA 2A9BA 2YPLB 4EJ1C 5M7QA 3VFJA 4IGBB 4J3VA 4OIAA 5HDBE 4MMYB 4HAGA 4FABH 1CNQA 1NCIA 3D4CA 5C0BE 1QBLL 1D5IH 1LTXA 5I5PA 3BQVA 1Q0XL 1E5AA 1TTGA 1WTGT 2ICCA 3H3BC 3MV9B 3KWWB 2X9YA 1T7XA 1TZOA 2Z7WA 1IM3B 5A2LH 3BMWA 2XXVA 3OAZH 3WTUA 1RZKC 1TJGH 3RBSA 4TS6A 1KCRL 1NANH 2BSRA 4JZJB 2HH0L 4Y16B 4KI5E 5EUOA 5DO2C 2V3FA 3HMXL 1S9YB 1E8WA 3G5XB 1VAHA 1GMIA 1MFBL 2CIIB 3N91A 4FFZL 4FZ8H 1H8LA 1MCOL 1Q90A 3OZLA 4YFEA 2M26A 4HFWB 4KU1A 4N2MA 3MCLL 3I74A 4C59B 2DWHA 4F9LA 5CINH 5BOPA 1UB5A 2GUOA 3ARDD 2EVJA 4WCYH 4YXLL 4JDFA 2BK8A 2BNQE 3DV6A 1TQTA 1JPTL 1WVZA 4GIZA 2R27A 3MNVB 3U9UA 3FZVA 1EXUA 5EO0A 4PFBA 4NQQA 4OZIE 2QADC 4ELKA 4IRSA 1I7UB 2H3NA 2UYFA 2FO4B 4Y1AE 4YWGH 1YYZA 3ZZLA 4JFZL 1ZS2A 4MYWB 3T9UA 3L3GA 2I07B 4PJ7F 5AL0A 3RZWA 4WQOA 1MCQA 1QVOB 4HUXB 5JA9A 3DV4A 2VXSH 3VH8B 1KY6A 2FH6A 1R5VB 3QJHA 3FFDB 1KIUA 4Y4KA 1INEL 1FH2A 4AM0Q 1JV5A 1KTLA 1HSLA 2XWTB 4Z3JA 6CGTA 4PJ5D 3CMOH 1FE8H 3QNZA 4IHOB 2EH7L 1HZHH 2HKAA 2Z91B 5T33H 3WE6B 2P5EA 4XPBL 5EOCJ 2CG9X 5BVJB 1NDGB 1F1AA 3IJEA 2BSTA 2Z31A 2VKXA 2YWYA 2AJXH 1JTTA 3F7LA 3BKML 5LGHH 4OZFA 4DEPB 4K9EL 4H8PA 3LKNB 3DETC 4M02A 4BQ8A 5K9KB 4G80A 2AK4E 4UTAA 3WIAA 3LXCA 4KK5C 4EQ3A 4J6IA 5FXCH 3JWOC 4FJYA 4I3RH 1KEGH 1YYLH 3S5LB 1NFDB 2VLKE 3RY6C 3L4ZA 4AKQA 4JAMA 2E75C 1XAUA 4P4KA 5FYKU 1I1AD 1D5BA 2OTUA 3P3RA 1X5HA 4D9QD 5BUUA 1EO5A 3QJRB 4V1DA 4P57A 2VZUA 1YAIA 3OR6A 2ZXGA 2NR6D 3WEAA 3JTSA 2QVUA 4Q4EA 4TRPH 5J6SA 3AT0A 1N9PA 4I9XA 4A7TA 3GTTA 4DFHA 1RLWA 2P28B 4WFED 3K2MC 1FWXA 3LC8A 4HP5A 4B6ZA 1CFBA 2WYTA 3HNTL 4P2QA 2DIJA 1MREH 1VKXA 3NN8A 2V25A 3BVTA 3MP1A 5B1JA 4FABL 1NCAH 4R75A 3CK0L 4G6AD 5BZDA 4G7VH 3HFUA 1KIQB 1X9LA 3FH7A 1CN4A 4Z7AA 5IB4A 4X8CA 1YMMB 2YMOA 4PV9A 5GSRA 2CIKA 4A55A 4U7MA 4Z7VA 3K1NA 3KVPA 4HX1A 5E5LA 2E59A 2BJJX 4DGWC 1S7QA 1CMOA 1AKJA 2HFGL 3FFCB 1RK7A 2LLGA 4FQXC 2J1ZA 4BE5A 1IMHC 1ZJAA 5I8OL 3PU5A 1SD3A 1CE1H 1B51A 2ZOUA 2GFEA 4ANXA 1P4LB 2J6EH 3QUFA 4TL4A 3WJLA 4PI2A 4RA1A 3V0IA 1F1GA 1RUPH 1VCBC 3T4AA 3RWCB 1RUQH 3RU8H 4OI7A 4WCYL 5F7AA 5ENWA 5IBLD 5MENA 3QK6A 1EJFA 4GWZA 1XFPA 2YQ3A 2VRQA 2YXWA 3G6JF 5IJBC 1GY2A 3SGEI 5TP9A 1MF2H 4F9PC 4YWGL 2XG4B 1KXVA 4MGXA 3TH3T 3DUSB 3INUL 5D1ZB 4MDRA 4GSDH 1QMUA 5DMJB 1I9RH 2G9HB 3QCVH 4J3TA 2J71A 4EF2A 1LBBA 3EOBA 4UDUA 2VXSL 4WO0A 4CC1A 3FVGA 2CDFA 3VGDA 3EBGA 2OWSA 1JGIA 1NPJA 1J9CT 4FQXB 4F3SA 5ETUA 1MPCA 5E5MA 4WUKH 2X89A 3S9LC 1L0QA 1J0JA 2CBOA 3A67H 3PHQB 3D3VD 5E6RB 1AHWA 3CMOL 3ELAT 1FE8L 2ZUQC 4OAWB 3I02B 5F3FA 1HZHL 3MZGB 3ZMRA 5GS0D 5I30L 3KHQA 4KZDL 4JWXA 3EJZD 1FJ6A 3GSNH 4XKPA 1SF3A 3K1KC 3CQFA 5CIPA 2YFOA 4RGOH 3L9RB 4Y5VB 1AGFA 2FJSA 1P7KA 2KZ1B 2AJXL 4KJWD 1KJ2B 2ENPA 5LGHL 2VE6A 1EDYA 3OR7A 3PXLA 5EFIB 4H8IA 4URTB 2NY5H 1V54B 4NWUH 4IKJA 4S1QH 3R6UA 3N1PC 1G7LA 3TO4D 4PG2A 4UQ9A 4G61A 4BGDA 1IMAA 5C7XH 2NOYA 2YD6A 5D2LB 4I3RL 5KSVB 2X1PA 1YYLL 3T09A 2FATL 2WBJB 1E4JA 1O6SA 5F0JB 4AVIA 2AZUA 3ZKKA 4GQZA 4P8QA 4KOBA 4MDIB 5JIMA 3IT8D 1BOYA 2PW1B 4KZEH 2ZUQB 1UZGA 4ETYA 4J1UA 4P23A 3KEHA 4ZMPA 3A0OA 3ZJAA 5DR5H 5ACLA 3R8QA 4HEME 4IBVA 4L4VD 1MFNA 2PO6D 2OX5B 2OK0H 3BUQA 2B3IA 1NCAL 3EDDA 5FGBC 2L04A 3E6HB 4G7VL 4LDLB 4JGJA 4L48A 2ED8A 2NPLX 3NCCB 3O9WC 3UJJH 4XIGQ 2Q89A 1X5MA 4ZOCA 4OSUH 3WY2A 1P4IH 3PMWA 4QRTB 4TOZA 4NQCE 2HT4C 3W2DH 4Z7QE 4MWFB 5EG6C 4IM8A 3SB3A 5B3JE 5L4MA 5CUSH 1SDAB 3EYQD 4HF5H 1H3GA 3NT0A 4YSTA 3ZL2A 5TF1H 4UV7H 1GTNA 1J12A 1P2CB 3VFPA 1JNHB 3ARFA 1SBPA 5IVXB 2O26U 4XR8C 3WMQA 3FOMA 1CE1L 2CM5A 3ME0B 1N04A 1I1FB 1L6PA 1OSZB 3BKYH 2J6EL 3BAWA 4JFDE 1N7WA 4JDVB 1RUPL 1MI5A 4HIXL 4HWBA 2QMWA 3F83A 3L1OH 1SXNA 3P0YL 3IYLW 4I3EA 2ISDA 1RUQL 3RU8L 5C0CA 3FB6A 5E23A 2BNRA 1TSRA 2FWSA 3VU1A 4U4BA 1CI5A 3DPBA 3QEGL 1NUWA 4ZG1A 2EYTB 4HLJA 3DO7A 2BMKB 3QQDA 4HIJA 4K3DH 2F6PA 3WXWH 3U4AA 1I8IB 1MLCB 1MF2L 2NUPB 4CW1B 3HUJA 3K0WA 2VSKB 5G4OA 4BKSC 3CHRA 3AUVA 3ZDZF 4NPYA 3MBXH 5JHDE 2EZ0D 4NUPA 1NCUA 3EDFA 4MS6A 4PJDF 3MTXA 1SVBA 1I9RL 3H7MA 4K8RD 3QCVL 4XNQA 4L37A 3MA7B 2LR4A 4HV8A 5CEZL 3GXIA 1H0DA 3PJNA 3TN0C 3IK2A 1BPVA 4KV5F 3RLFE 5K9OB 4ZFZB 2VDNH 2FNCA 1G0YR 4HS3A 3A67L 3VXMA 1SXSA 1QNZH 2XZCL 3WUWB 5T3ZD 4X6CF 4U1SA 4MFIA 2CAKA 2VERN 3K6WA 4OD2B 1DSWA 3W15C 1UQSB 3QHFL 1NBYA 3GSNL 4F2ME 2AI0H 2ILLA 2H3KA 1ITCA 5F9DC 5JW4N 1UKTA 3QSLA 3K0YA 1Q9WB 1BOGA 3JV0A 4RGOL 1IC7L 1ZVHA 3QRFM 5I57B 2Y7NA 2B16A 2ZSVB 1AYOA 3IRZA 4J2QA 3D39B 2GT9A 4QTFA 4R5XA 3U30C 3VFRB 1XDTT 1OGAD 4UIKH 3ZE2B 1WP6A 2Z0UA 3G3LA 3DGDA 1TOXA 2IADA 4S1QL 1I1YB 2VGQA 1BVKB 2Y22A 1C5DA 1IVTA 1N10A 3BLBA 4XN2A 3U8QA 2R4SL 4FXGA 4N90E 5C7XL 5JHMA 5HGAB 1N2RA 3O3UN 1PCXA 2HJLB 3GIZH 3L9YA 1X5YA 4ZFOA 4AENA 1G7QB 2OTWA 4QXWA 2BWDA 5HDBF 1OAQL 3BEVB 2YZ1A 4KZEL 4DWHA 1DBJH 4U4IA 4YS4A 4KHZE 1XH1A 3RWGA 4OJCA 1H76A 3MOQA 3CD4A 1KGCD 3BLPX 3I6KB 4RWYH 4FLSA 3MMEA 5DR5L 4URKA 4NT6A 3BQUA 3QPQC 3JWDC 2FX9H 2D7MA 1UADC 3NBNA 1IILE 1NBZA 1BVLA 1FN4B 5EEVA 4CDGC 2OK0L 4JHBA 1N59B 1PYWB 3U30B 1A8EA 3MKGA 2O6FA 5D5ME 3V6FA 4Z1PA 4M7LT 4C56E 1Z7ME 1JMXA 1RP9A 1AP2B 3QFGA 4QHNA 1JGUL 4OSUL 3JTBA 3CC5A 5BS0E 2EIZA 3WAJA 4YH6A 4WJG3 3ILTB 3UERA 4UT6H 1FBHA 3W2DL 1I9JH 1CDGA 4MA8H 3F7RA 5CUSL 4JFFB 1PEZA 2AJUL 2IH1B 2CKBH 4UV7L 4P5RA 5TF1L 4WIQA 2X87A 3IR1A 2ZWZA 2WQVA 1RZGA 5T1KB 4RISL 3PXHA 3PGCA 4MQTB 4JKLA 1TTCA 3BKYL 3ARXA 3MFGB 1NUFA 5BV7C 4OZIF 5DJDB 3SY0B 4DERA 2XN9D 3ZDYF 3V9CA 3PUXE 1E6JH 2OZNA 3F2LA 3HJ0A 3L1OL 5KUKA 1YEKH 1YTVA 4DQOH 4PJ7A 4DKAA 1ZVYA 3U36B 3ESNA 5E6ID 5CWSA 5BRZE 2UX6A 4K3DL 4UDTA 4H20H 5FYLE 3UZQB 3WXWL 4BSWA 4FERA 4I5BA 3ZSFA 3ALXA 3I50L 4UZSA 4N13A 2PT2A 4XVUD 3M45A 4MNGE 3FQXA 4PJ9C 1QD0A 3MBXL 3ZR5A 4BFOA 3TAJA 1H6UA 1JF1A 1VFUA 1ZAGA 4WEEA 3OAZK 3QDGD 1X5ZA 2YAOA 2AQNA 5GXBB 5KYYA 4JPSA 2XV3A 5E2WL 4JM2C 1CXEA 1RFDL 2VDNL 3DGGB 5D71L 5BV7B 1RD6A 5I6MA 1QNZL 1FNGB 2VB5A 2FBJH 5EDXA 1K2DA 2O51A 1RULH 2L7QA 2PWHA 4RCAA 1JVYA 3QDMA 2R29A 3LKSA 1Y20A 4N86A 3K91A 3OQ3B 2FLRT 4KY1H 4CNIB 1HINH 3ZS6A 2CHXA 3U6XS 4DAGH 3ULUD 2YC1A 2BP0B 1G7IA 4K23H 3UG4A 3CNKA 1T04B 2EKJA 5AOIA 2FBOJ 3G7WA 1TYEB 4UIKL 2YEZA 1R47A 3B2PA 5GGTA 43C9B 2R83A 1SDDA 5E00B 3A3CA 3E7JA 3DVFA 4Z78B 3WNMA 1FL6A 2FT6A 5CGYC 2QPQA 2YAQA 1L7IL 2UX7A 5A7BA 3GIZL 2Q88A 5I2IA 5JXEA 3R0NA 2XX8A 2OCCB 3D09A 3HS0A 1VFBA 3SQBB 4GRWE 3HC0A 4HE0A 1PC3A 2UZXB 4J3OH 4ZSOB 5FB8A 4O2CA 3D0AA 3VA2C 3VFOB 2KDYA 3QDJD 5EZLB 2YPLE 4P5KB 3FO2B 2B77A 3K0VA 4RWYL 2R39A 4LU5H 5DZOA 5IROA 1R5IA 4P3CH 3OAWA 4UM9B 4U1IB 4W9CC 2KQZA 1C08B 2D2CC 2EKSB 2FX9L 4ECNA 2YD2A 3ULVH 1BEXA 3APDA 5L9SA 1AGCA 1MZZA 4OT1H 3VVFA 2NY2D 3VSVA 4H65A 1Q9OB 1NUYA 2P2AA 2VC2H 1IFGA 3KDMA 5FECB 1NCGA 1XF4A 2JKSA 3OG4B 4K0OA 1UTBA 4KPTA 1CB4A 3VFWA 4UT6L 1QRNA 1P5VB 3VXRB 1WCQA 3AXHA 1HILB 4MA8L 1BQ5A 5DI8A 4NNPL 1TJHL 2CKBL 3J7HA 1DVFD 2XXGA 1KC5H 3N1GC 1GJWA 4K94H 5KJRH 3G6JA 2NY6C 1TZ8A 2OMBA 3ULSA 4TNGA 3GJEB 3U46B 3MYJB 3FXQA 1BVOA 4ZMAT 1E6JL 1A7PL 4HJGA 4TSCH 2YA0A 1C8PA 4LKXA 4DQOL 1PLBA 1YEFH 2J21A 3JVFC 1HXYA 4G8GD 2GJRA 3B9AA 4Z3HA 4FQQA 3GZQA 5I1GH 4ILDA 5DD5H 3KBEA 4H20L 4Q2ZB 4O00A 2VITA 4HMCA 1UENA 4I7ZC 2QL3A 5A6IA 2O5XL 2ZXDA 4JLRA 2VLJB 3LEXA 4A2MA 4KKBC 3MRGA 4ZJ9A 4LEOA 4PJEE 2EINB 4RVBA 3ARWA 2BVQA 4E0WA 1AS7A 3BC9A 4LCCB 3AS2A 4HS6A 4PTKA 4HXBH 3HE6C 1POY1 4M29A 3V5HB 3RDTD 2KBGA 3HZMB 2FBJL 1RULL 4AQ1A 3AM8C 3BIHA 3DX2A 1RDXA 1IGFH 2ZIDA 4IRJC 4YHZL 4H0IA 1ANFA 4G68B 2J57A 4KY1L 4N25A 1HCVA 2XIDA 4W4OA 2AERT 3GT6A 3HG1D 4K23L 2J3SA 1U91B 2OV0A 5J13B 3BUYB 4XT1C 5ITBL 2FDBP 1DQVA 2FECL 4WHCA 4G9FD 1CTMA 4XO5A 5T1MA 3LDBC 5D93C 1I9EA 3KJ6H 2V9UA 3P73A 3DX8B 2X28A 4GS7B 2HVKA 1NFDE 3IFOB 2WXMA 4O7MA 2F53B 3Q5OA 2FLMA 1F11A 2B3RA 2Z8FA 2EO7A 3BP7B 2WP3O 2QVVA 5FK9B 2WWNA 5B1KA 1A0QH 5D1XD 2H32H 4J8RA 1IBGH 2D21A 3IE4A 1MUJA 4L05A 4I9DA 4LZ7A 3CHXA 5I23A 1S9TA 4HGWA 3QUYB 4LLUB 5CXPA 2X4SA 4NF4A 4WSJA 5DHXB 7CGTA 5J3HD 3PY9A 1CLYH 4L0PB 4P3CL 5LGKA 3MV8D 1VACA 2PXYA 1ZVNA 1QSZA 2WO4A 1QATA 2GFBA 3ULVL 4OWDA 3M86A 2WVUA 3G6AB 5TTRA 3GLBA 4Z7QF 5B3JF 1U9KA 2C9SA 4LHJB 5DRWB 3MRIA 1YEDB 3N42B 4XN8A 4OT1L 1EZOA 5J06A 5CMMA 1IKNA 3RTFB 3UO8B 4N8UA 1AZUA 2VC2L 5KN5A 2QDWA 2ZOLB 4HMEA 1NL5A 1ETB1 4ZPTA 3TIEA 3C5SA 1TZAA 5FO9A 1QX1A 2J88L 3HW7A 1BXXA 3CZFB 3QJFA 5B39G 3ETBJ 4D8OA 1GZQB 1NZRA 1DUZB 1T5XA 3EJRA 4K4KA 4FZEH 4K94L 2YA2A 5KJRL 1E65A 3MJNA 5JHLH 3FXUA 4MDJB 1R17A 3MC0A 2H98A 3ECBA 2YHGA 1IAKA 4JX0A 3TJEL 4BDMA 2XWBB 1XIWA 3W39B 2F54A 4BA0A 2OZ4H 4KKPA 5EBLB 5FBPA 5KCJB 1YEFL 2CO6B 2WO3B 1QQDB 4HHAB 4PJDA 3VACA 4IO2A 1SBBA 3FB5A 3JT0A 1OQGA 5I1GL 4MJID 5DD5L 3V5DB 1AGDB 4YDVA 1FVCA 3ULAB 1ZOXA 4GAAA 5GSVA 1ZV2A 3RX9A 5KVDE 1JZ2A 2KERA 3V6BR 5AG8A 4X04A 2QMKA 2A77H 1WC7B 1DANT 4GAGL 3TTNA 3NCBB 3GM8A 3LZLA 4X6CA 5C3LD 4P5TC 3ZHFA 4QMEA 2FIKA 2Y6SC 1KPRB 4PRHA 4FN0A 2PPDA 1NMBL 1YNLH 1ZA6B 3KWVA 4HXBL 1ZKAA 1YDPB 1WIPA 3CCHA 3QSKB 3PGFA 3QQ9D 1E28A 3QDHA 1BEYL 1BLNB 2DTMH 5FWRA 2R7EA 4WHTB 4GI9A 4DZ8A 1BM7A 2BIQA 1IGFL 3LH9A 4TPRH 1MG2C 5IFJB 3T1WA 3L3JB 4PRDA 4UU9B 3WDJA 1VRSA 2BSDA 1YJDL 2QZ5A 2WXNA 2XPYA 1DYZA 4JQXA 4LL1A 5IGXL 4MVBD 3FB8A 4B27A 2VMFA 2F19H 1M5EA 6FABH 4JHAH 4MKTA 3S8WA 3L3IA 4QKXB 2HFBA 5ITFA 5INCB 2IPUG 3MLWL 3MLRH 4WWID 5JDSA 4CILA 3ABZA 4XH2B 1ITBB 4E9WA 5LJYH 3SYPA 3C5ZA 5AA3A 2HN7B 1KNOB 3F7VB 3X11A 3QUHA 1RQ5A 3BFOA 1D6EB 1A0QL 4H2AA 1J0ZA 4JVCA 3EJJX 4R74A 1IBGL 3IMBA 4PLOB 5FIEA 1WUNT 5A16A 3GSVB 3QT2A 5CJQL 2Y1ZA 1A47A 2HT2D 3AB0C 5D5MF 1M7IA 2ZOKB 2CCVA 3GMRB 4OA4A 1CLYL 1E40A 1QLEH 4DKDC 1OCCB 5C09D 1AGEA 4ERSH 1GJIA 1UVQB 3NPZB 1RKMA 1XR8B 4QHMA 3HBGA 4YHNA 4GKZB 1ADWA 4ETQA 3FHQA 5AW6B 4I40A 4BELD 1K9TA 1RMFL 4JFOB 4CBPA 3AMLA 2KLTA 3IGKA 2BNQA 4LAQH 3S4UA 5EU4A 3BAXA 1L7TH 1EO8H 4JKNA 4OZIA 3CHGA 4KCDA 2A9NH 4X4XA 1W9XA 4AGMA 5BO1L 4Y1AA 1L5TA 2O1AA 2VDOL 4PW3A 4P1EA 2DQ6A 4OLYH 1UTHB 1WS7A 4GW5B 5JHLL 3KEDA 4R2GC 1KTCA 3LD8C 4R2BA 4ABVA 1DFXA 4NUMA 1HU8A 1IC5L 3AB0B 1FL5B 3R19A 4HXAH 5B7EA 4P46B 1EX0A 3A6CH 5K9QG 4GW4A 4DXBA 4MCYA 4BBWA 2DL9A 1QTPA 1KZQA 2ADJA 1LO0H 1H8NA 4TUJA 3DELB 3AADB 1O5DT 3BKCL 5EQ7A 5GHWH 2REGA 1A6PA 1AZRA 3FVKA 1G4RA 2MCPL 4BK8A 2TSAA 5EOTB 4R9GA 1JGEB 2OWZA 2ZX5A 4N9GA 1SPDA 3APMA 5BJTB 5D2NC 3DP4A 1I8KA 1AKPA 2DBLH 3F12A 15C8H 4JRFA 4BUGA 4N0FB 1RIVH 2AK4A 3NZSA 1GS6X 3VYOA 5TGBB 3TASA 4R2GB 4XMLL 3LD8B 3HCQA 5E8PB 2YPVA 4JANB 1KCBA 4HC1H 4KITB 1JCVA 2DTML 5I75B 1RDZA 2NY0C 4Y2DD 4U1KB 3SE3C 4WEDA 3MDJA 1MHHA 3D39E 4H88H 2EE2A 1NBQA 3CUPA 3OKNA 5F89B 1ORQB 4X7TB 5I76B 4N91A 2F19L 6FABL 1JEVA 5C6TL 3NCEB 4JHAL 3RWHB 1DJSA 4WSKA 4GRWF 4QIRA 3MLRL 2F7BA 2BXZA 4G42B 5IBUB 3TEPA 3SD2A 3SDYH 2KLSA 5JUEH 4LFHG 3O4LA 1HKFA 2XC8A 3M3KA 3CGTA 3PWPB 2FJUB 4UNTA 4H46A 3NESA 3T1FB 4GXSB 3EDJA 2OS7A 5HSFA 2GHZA 4GBVA 3IB2A 1EUUA 1E4XL 1WBZA 3HE7D 1RURH 3C2AH 4X4ME 1QLEL 3MGTA 3EYSL 3C6LD 1INDL 2RR3A 2BNUA 2F58L 1FFQA 3AITA 4U1JA 3V6ZB 3VA6A 2HXRA 3AXIA 4BZ1A 4FLQA 3P9MA 1MY5A 1UWXH 3UTTB 5CFAA 5GRUL 5GPRA 2WX9A 3ZMNA 5IVNA 1OLLA 3BEWA 2JJWA 3W9DA 4IEFA 2JJUA 1KCVH 3PQYB 4LAQL 3BWAB 3SKOA 1L7TL 1IMBA 3VXUB 2AKRA 5IOPB 3PL6A 2A9NL 2TSBA 2OZ4A 1Z9MA 2AMUA 1A1NA 1CDHA 1R24A 5BUPA 2VDLH 3R06A 4FAAB 5IW3A 1EAOA 1H3UA 3P11H 4JDEB 4M43H 4OLYL 5EPMB 2P47B 3C2SA 4S1DC 3ZHNA 4BH7A 2MCAA 1S7SA 1GKEA 4F57L 5IMMB 1B0IA 3IE9A 5ABAA 1G7HA 3WKMH 1E3XA 4FECA 4FXTA 4G6KH 1A6ZB 4HXAL 3PIQB 4AS4A 4O2EB 3KPPA 2B4CL 4H25A 1ZHLB 3GINA 1KBPA 1HN1A 1LO0L 5FF6A 5FO8A 2CEXA 4PJEF 3TV3L 3QYCA 1RZ7H 5GHWL 4E36A 1ANUA 2C34A 2OMXA 2HPTA 1MY0A 2CQVA 3Q9QA 5ET5A 3FKUS 3QHZH 2HWZH 4ODHH 2WVVA 4OCNC 3PJSB 1RUMH 3LUYA 3OLDA 3TZVB 2OLBA 1NDMA 4M7ZC 3KJTA 3RGVA 1R3IH 2ARJB 2DBLL 2X6AA 3TJPA 3VJ6B 5KZCD 4IOFC 1OF2B 3S98A 5J6HA 4LBEB 1RIVL 3BHBA 4NF8A 2XTJB 1T1YB 3FZUD 1BZ7A 3QIUC 3POHA 4XMKH 4IRSD 1IMEA 4BFIA 5HI3D 4HC1L 3KLHD 1YNTF 4Y2OB 2DM7A 1I7ZB 3OKDB 4FBPA 4N0YH 5DJAA 4AUYA 3HZ3A 5I84A 4TULH 4GKSA 5C71A 1NFDF 3S9DB 2H2PC 1ZHKA 3TOPA 1U30A 4LCVA 4MJ2A 4PRNA 3VD7A 4WLCA 4FG0A 4AV4A 4X98B 1UT9A 4M6ML 4HEMA 5DFTA 4Y4KD 3WJJC 2X53A 1U8IB 4QOKA 4D0BA 3GXPA 4U1LB 3MLZL 4N3TA 2AJSH 3P2TA 3GLEA 4QF1B 4KGLA 3VE1B 2P5ED 3SDYL 3NSFA 2W9DH 5JUEL 3S6CA 2AQ3A 1RI8A 2YXMA 3UTPE 1R0AL 4HDIA 3OAYH 2V2WA 2Z31D 3QRGH 4RMQA 4P3DB 4S10A 5DJ8B 4NQCA 2I26N 5DMIH 4S1RH 4OQTH 2QHLA 1XHHA 4S2SB 4BZ2L 3ARGC 1DQDH 2X9XA 3PS6A 1NEPA 5DQ9A 1RURL 4MKMA 1BFVH 4J3WA 4R7DB 3GXFA 3TNNA 4FA6A 5MI0C 1TO5A 4Q8BA 1Z1WA 4LPVA 3AMKA 4MMXA 4YR6B 1JZ7A 4JFDA 3QA3B 1GMEA 1HDMA 4NM8H 1UZ8A 2A6KA 4RZKA 5DRXB 4P4KD 3QAZB 5IIEB 3C60A 1KCVL 2BS71 2ESVE 4V1DD 4G4PA 3KPMB 4BSVA 1A4KA 2LABA 4IOIA 4IS6A 1BQUA 1H3VA 2M2DA 1A21A 2LU5A 4JS7A 3O3BB 4P4RB 1ZLWH 2HXAA 5DC4B 3S8GB 3T0WA 2GTWB 4QRZA 1HCYA 3KLDA 2HEUA 4GFRA 2N1KA 1EO7A 3LSOA 4U1GB 5ADPH 5JHDA 1G94A 3P11L 4HZAA 4MD4A 4M43L 3W37A 3CG1A 2ZG3A 1F6LL 5IVZA 3MJ9L 5EO1A 3KOTA 4OGQC 2RGSA 5KSBB 1FQDA 4KK6C 3SESA 1JNLH 1UKQA 4FTVE 1JDAA 3BMVA 5F7LB 3PDOB 4GQQA 1FNEA 1RZIA 4GRMB 4N2FA 3WIHA 4AC4A 3F5WB 2Y5EA 5BNXD 1OQXA 5DLLA 5EC2B 1FZMA 5IMLB 5FUOH 1KLUA 1RZ7L 3LIZA 4PJAE 1AKJD 5SWZB 3FN9A 1CGWA 1NGWB 1Y7VA 3LXBA 4P2OB 4P07A 5GGRY 4X6EB 4CMMB 2XHDA 5I59A 3UXFA 1NIBA 4WI2A 4LO9A 4NQTA 4DTGH 4LP2B 1CYWA 1R3IL 3VAEA 1HOCB 3T8XA 3SSGA 5I0DA 1F5WA 5MEND 2W95A 1GS7A 43CAA 3KEIA 3RYDA 1A7OL 5LDUA 2DLTA 2EAEA 4WGKA 4OV5B 1C16A 1GYUA 4UYPA 2OMWA 3FT3A 1G4MA 5C1MB 4PBWD 1G9EA 3FBQA 1TQBC 1HHKB 4AQ8A 3OKEB 4N0YL 3U0TA 2RACA 3IOWA 1TEFA 3ILQC 3T2PA 4PN6A 4TULL 4A2EA 1UYWH 4X0KB 1UWEH 4CU6A 3ATFA 3UO1H 1CI3M 2Z64C 3IMTA 2V3DA 4X6DB 2XDHA 2X89D 2F53E 3TTYA 5GGUA 3EFFA 4YE4H 1BJ8A 2D31B 2PKDA 2AJSL 3A22A 5F7DB 4GBXD 3OMAB 5C07B 3ZK0A 3J07A 3PGDB 5D5MA 4C56A 3CFCH 4FQIL 2QVMA 4X5PA 5ID0B 2BP5M 3PV0E 1HH9A 3NJNA 5DMIL 3KPLA 5CJXA 4S1RL 2XN2A 2Z7YA 3O6FC 4OQTL 2R2EA 3CWGA 1DQDL 2WVSA 2QKSA 5KYXB 3HPIA 5JK4A 1FTLA 1LVEA 1HZKA 3M8OH 1BFVL 1OQOA 3OLEA 2PYEA 3NH7L 4YDLC 2G3XA 5C6PB 3DSFH 2F74A 3QFJB 1DPEA 1ID2A 4NQVA 4R9FA 1ZSDB 5FW8A 1XWVA 1VADA 2FR4A 3GHEL 4XMZA 1KSRA 3D9AH 4YNYB 3KPRE 2XXFA 4XHJD 1IAOB