3EF7A

Zp-n domain of mammalian sperm receptor zp3 (crystal form iii)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
480
structure length
467
Chain Sequence
MKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDRVEVPIECRYPRLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein, LINKER, Zona pellucida
publication title Crystal structure of the ZP-N domain of ZP3 reveals the core fold of animal egg coats
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Cell adhesion
total genus 136
structure length 467
sequence length 480
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3210 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ef7A03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ef7A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ef7A01
1MRPA 4N13A 4HCWA 5K2XA 4K3FA 4F3BA 3QYTA 4RA1A 4IO7A 2I0CA 5DEXB 2ABHA 4EQ9A 4I62A 2ZNSA 5CMKA 4HTGA 2B3BA 5EYFA 3FVOA 3UORA 1QJMA 3H6VA 4X48A 5L9SA 4BLAA 4H5GA 1XVXA 2VD3A 1ZIUA 4FEBA 4LP2B 4ZZAA 3S9EA 4KYEA 3NK4A 1UIUA 3Q28A 4ND9A 5ICQA 4JBZA 3C31A 2HEUA 2XXHA 3LUYA 1WODA 1ZBMA 1ZTYA 1L5TA 3U72A 4R74A 2O68A 3AXFA 1ANFA 3PD8A 4ZECA 1SW2A 2XXYA 2ZYOA 3EQ1A 4GQOA 4GXSB 3LC8A 1NNKA 1AOVA 3I6VA 1H45A 2G93A 3R6UA 3M3LA 1JVYA 1LAHE 4QFOA 4OXVA 3JYRA 3K02A 1O7TA 3SERA 2OLBA 3DP6A 3H03A 4NF4A 1LFIA 2RC8A 5J1DA 4OZ9A 3ILTB 1LFHA 1B5JA 4YKKA 3FVNA 5IAIA 1OLAA 1YTVA 3G3IA 1B1XA 4AQ4A 3QUJA 1B46A 3DELB 3OENA 4QSCA 3QXMA 4JXIA 4UACA 3MZBA 2XHDA 1A99A 4R6YA 3MP6A 2F6PA 1FW0A 4G8NA 1AIVA 2I3WA 1N7WA 4LQ2A 2H98A 3MWBA 1I6BA 4OMBA 4R9GA 5H8HA 4NEDA 2AL5A 4X1BA 4DLDA 4G8HA 3RN8A 1H44A 2DE3A 5KDTA 2IEEA 4OFLA 4NF6A 3V83A 2PVUA 5LOMA 3G3FA 4OENA 4OETA 4AB5A 3O28A 5EHSA 2XX8A 4F1VA 4ELOA 4QFKA 1H43A 3E9XA 1D9VA 4UA8A 1ZKBA 4F3GA 3IR1A 1IXIA 1RYXA 1SVXB 2XXVA 4RPOA 4ZEKA 4OQOA 4YKJA 1ATGA 4F2QA 3H6TA 3TCHA 3LSLA 4KFQA 1B7UA 1LB8A 1LAGE 4R6HA 4RY1A 2DVCA 3VVDA 3IL1B 4X1DA 2HAUA 3FVKA 3A09A 1IITA 4F18A 2Q88A 3ONMA 2ALUA 1N84A 2QS4A 3RTFB 3KBRA 3BFUA 4PETA 3RGYA 4PFYA 2RINA 3H06B 2V3QA 5CMMA 3T66A 2O84X 1VR5A 5DVJA 2XXIA 4OEUA 5HBCA 4KCDA 4F1YA 2AL4A 3GZGA 4ELRA 3HHGA 5KCJB 2XX9A 1A7LA 4IO6A 1B3EA 4RJZA 3O6HA 5F7VA 5FTHA 4WEPA 1LAXA 3Q27A 2A5SA 4H8IA 4HCYA 1Y9UA 4OYVA 1A8EA 5FHOA 1Y3QA 2NUVA 3M3KA 3THIA 2P1SA 4IY6A 3LSFB 4XKQA 3IJXB 3IB0A 5ELVA 2VGQA 2V3TA 1N0TA 3V5AA 2BJJX 4L17A 3OD7A 2F78A 2QL3A 1BKAA 2F8DA 1XT8A 4LONB 1B4ZA 4C0RA 1LGBC 5BWJA 3PPOA 1TT1A 3V8XB 3C35A 3I3VA 3K2DA 2B3FA 5CBSA 3K4UA 4R75A 4OTEA 4KYDA 4FEDA 1HSJA 4YAHX 1CB6A 4MLVA 1B40A 5ITOA 4ONYA 2Q89A 3TPAA 1GTKA 3TZAA 2VD2A 4NF8B 1FTJA 2Y84A 3W9VA 3TAJA 1M5EA 3VLVA 1JVXA 4F2OA 5ISUA 1XHYA 1MY1A 2XXPA 4LVQA 1NNFA 4R2FA 1UQWA 2V25A 3C36A 3TQLA 4EXKA 3SDFA 1RYOA 3OMBA 5JK4A 4ZS9A 4KCCA 3A3UA 2V84A 1P1WA 1M5BA 1NKXA 4G2ZA 2V3UA 4YU0A 4XKNA 2QSXA 4EDPA 4Z0IA 1H3DA 1MQHA 3VXBA 1MM6A 1DTGA 1P99A 3GBBA 4DE8A 1GR2A 4ZEFA 3CFZA 3DP8A 3HO7A 3UN6A 5CMBA 3K1MA 3PPQA 2HZKA 2B65A 1SQYA 4NE4A 4BDOA 1MXVA 3ODBA 1I69A 5CMCA 1B05A 1B5HA 3C34A 1GV8A 3TCGA 1VSOA 1MY4A 3K6WA 3PGFA 1QVSA 4NF4B 3UP9A 2DYXA 3IOUA 3PUYE 2I49A 4RPNA 2DE2A 3DM0A 1HSEA 1VFDA 1MQJA 4NF5B 2G29A 3I5OA 1LBBA 4EUOA 3PU5A 4YB5A 1F9BA 1FQAA 2UVHA 4YICA 3RUMA 4QFNA 3T22A 3L6HA 4MF3A 4TQUQ 3S4UA 5KCJA 3MC2A 4NF6B 1IUDA 1NNPA 1M5DA 4FIMA 5CI5A 4XXUA 3WAEA 2HFBA 1TFAA 3S9MC 4H6DA 2X7PA 4IB2A 2IA4A 5CRYA 3RPWA 1MPCA 4YB6A 2REJA 1B4HA 1MPDA 1NH8A 1DPEA 3FJMA 2QMWA 4F22A 1JNFA 3KN3A 3FXRA 1US4A 2I3VA 3FXUA 4JWOA 1II5A 2O69A 4Q5TA 5M2VA 4EXLA 4JDFA 2O51A 4IO2A 2F7CA 3M8UA 3PPNA 1B6HA 3VLUA 2F6GA 4KQPA 3CG1A 3MZ9A 4BDRA 2XXRA 2PT2A 1EZ9A 3DLNA 4OFJA 4H8JA 2NWJA 4JSOA 3T9HB 2HXWA 4U4XA 4TOZA 2OJTA 1USYH 1LAFE 3TYHA 3K6UA 2XXXA 4NF8A 4F19A 4G68C 3JZJA 1GGGA 3VFJA 3SETA 2Q2CA 3MP8A 4WKMA 3RT8A 1MXYA 3E4RA 1R9LA 3V89B 2AIXA 1B3GA 3IOTA 1SW1A 4JWYA 2ESNA 4PFTA 2ONSA 1PBQA 2I58A 2OK2A 2Q2AA 1OLCA 2F35A 2F34A 2RF1A 2ONRA 1DMBA 3RLFE 1A55A 1B3LA 3TUSA 3VVEA 1JW5A 1P1UA 1EH3A 3KOSA 4G68B 4DCXA 3VV5A 3F11A 2H5YA 3OELA 3LBSA 4YB7A 5I2NA 3RNNA 1Y1MA 2FYIA 1ELJA 1AL3A 3C32A 1JEVA 4KYSA 4EF2A 4EQBA 4GFRA 2F36A 3W15C 2HAVA 4ZZEA 3FVGA 1URSA 3PUXE 3B6WA 1XVYA 2X26A 3GBAA 2DWIA 4NF5A 2OCUA 2XXWA 5HPQA 4FE8A 1PC3A 2O1LA 1N7XA 3HV1A 2ZMBA 2Y7IA 5TU0A 1MXUA 1YAEA 1PB7A 4C1UA 2DWJA 4Q8RA 3GLBA 1M5FA 3G3KA 1B2HA 2P2AA 4LZ5A 1R6ZA 3PMWA 1US5A 1PBPA 1T0KA 2PMSA 3UK4A 5I59B 1OMPA 3IB1A 3FZVA 1FTLA 3U93A 2RC9A 4YZZA 2I4BA 3KG2A 1O64A 2Z22A 1Y4CA 2QMXA 4I8CA 1POY1 1MY2A 1MXWA 3H7MA 5H8QB 3T9UA 3PMVA 3MAMA 1H76A 3L6GA 3UGWA 2ANJA 1XS5A 4GD5A 1TWYA 3MVYA 4U1ZA 4M1VA 4BDMA 1UTBB 4ZEDA 3H6WA 3FXQA 1P1QA 2ZYKA 1B52A 4O3BA 4RXLA 2NOOA 5CM6A 5I57B 3EF7A 1URDA 2Y7KA 3KOTA 2DXYA 3KN7A 4P11A 3GXAA 1MQIA 1KWHA 3MVWA 1S7YA 4ESXA 3FV1A 4LQ5A 4YKIA 3Q26A 3CFLA 1EU8A 3QK6A 3VVFA 1A8FA 1MH4A 5DYHA 4THIA 3SKPA 2ZNTA 1FQBA 2E1SA 2XX7A 4F3SA 3TELA 4HS7A 4U21A 3E13X 1NMUA 2DS9A 3PV0E 5FHNA 5DVIA 1B7HA 4R9FA 2O6AA 3G3JA 3N26A 4AB6A 1JEUA 2I4CA 1YPNA 3IK6B 1AMFA 4QSEA 4R72A 3O2AA 4G68A 4GXAA 3BFTA 1Y3NA 5TPAA 3WAFA 3LSWA 2F7AA 3HCQA 4GL8A 3S9NC 4R6KA 3U92A 1N76A 3PD9A 1MH3A 4JWXA 3SESA 4QFPA 3S9LC 1B0HA 1B3HA 4U2RA 1ZU0A 2X7QA 5AA2D 5B70A 2O7UA 3MUQA 3PPRA 4H1XA 1NL5A 3K01A 5I2KA 2DQVA 3G7WA 4Q30B 5HM4B 4G4PA 4N07A 5I56A 3IOWA 1QW0A 2FA7A 4DXUA 5H8NB 4OEVA 4DIGA 4PQJA 4GWOA 4G77A 1LCFA 1XOCA 3CVGA 3EHTA 3QSLA 4EQ7A 1MY0A 1HSLA 3FJGA 4OVJA 4MLQA 1WDNA 1SYHA 1IQ7A 3OEKA 4XKPA 2M8CA 5BUUA 1LCTA 4H65A 5I59A 1EZOA 3TMGA 4NWCA 2YJPA 5JTYB 3O66A 3OO9A 3CSGA 1AH5A 2DXRA 3HPIA 3H4ZA 5I2NB 1USYE 5KZTA 4DZ1A 3D4GA 5H8QA 3CI8A 3SEYA 3K0VA 4QFLA 5ICTA 3MZ1A 4IO5A 4KR5A 3MW0A 5A5XA 3K6XA 1UTBA 1IXCA 4ELPA 1RKMA 3IORA 4WEDA 3UA8A 3K1NA 2D3IA 4GRKA 1ZJLA 3TKDA 2DOJA 5I57A 1FQCA 3Q25A 4GL0A 2XXTA 4U22A 1LSTA 3HSTA 4GIZA 3C33A 1SW4A 3ILUB 1Y20A 5CC2A 4LUBA 4TLMB 4ZEIA 4OWDA 3OO8A 3K6VA 3T9VA 1B9JA 4EF1A 1IZ1A 1B3FA 4ZEBA 3IJOB 3IOVA 3TTMA 4X9TA 1BLFA 4H5FA 3W9WA 3FD3A 3H6UA 1OQGA 5AA4A 5JEIA 3SEXA 2D21A 3MQ9A 1MG1A 3PMXA 1MS7A 3JV9A 4YKPA 1MDQA 2OBGA 1B0LA 3FIRA 4IO4A 1B32A 4MFIA 4O3AA 2REGA 1MXXA 2QPQA 1TXFA 2HCAA 4FECA 1P1OA 2CMOA 2OWTA 1UTHA 4POXA 3LR1A 1UIVA 2FNCA 4R73A 3LSXA 3PUZE 4DXBA 2D5WA 1MQDA 2VP1A 1URGA 4KD5A 2F97A 3USDA 2R71A 4KHZE 4ZE9A 4P0IA 3IO6A 2Y7PA 1SDXA 3HHFA 3VXCA 1S50A 4JSDA 3N5LA 5L9MA 1QKBA 1QUKA 4BDLA 2UYEA 3KSJA 4F39A 4RYAA 5H8NA 2QS3A 1P1NA 2NVUB 3K1PA 2P0SA 1PB9A 2DP8A 4HW8A 4WXJA 4KPTA 3ZSFA 1GVCA 4GVOA 5H8FA 4QHQA 3PUVE 1SBPA 4IO3A 3T9XB 3T96B 3N6UA 5L8DA 2I0BA 4Q0CA 1QULA 2RC7A 2AYSA 3N6TA 3EN3A 4ESWA 2UYFA 2I48A 1OIBA 5B7DA 1SW5A 1ZLQA 1A40A 1Y4TA 2WKYA 5TPAB 5JTYA 2GH9A 3R7XA 1JW4A 2Z8FA 5AA2A 1I6QA 1PEBA 3DP4A 4I1DA 4U23A 1FQEA 4F1UA 1SI0A 1WVJA 1POTA 1MY3A 3SEUA 4DXCA 2YPNA 4NMYA 3TQWA 5I2KB 3TTKA 3ZS6A 5I56B 4F31B 1B58A 4MBPA 2PBWA 4NWDA 2R9JA 2XXQA 2Y7WA 2O7IA 3O29A 5DVFA 1B7ZA 4QSDA 3T93B 1DPPA 4MH5A 4PFUA 4OERA 1IXHA 1Z7NE 4R2BA 3TTLA 3QIMA 4U4SA 1SYIA 3IB2A 1Y3PA 1CE2A 3U94A 3KSXA 2XD2A 3KEIA 1B1HA 1JQFA 1D9YA 1BTJA 3CG3A 4GF8A 3CSBA 4FAJA 3C9HA 2UXAA 3CFXA 3CRBA 3BBRA 2A5TA 3QUFA 5I58B 2O1MA 4O3CA 1FQDA 5L9OA 4RNSA 5AA1A 4E0WA 5I84A 3U1OA 2H4IA 5A5XB 5DTBA 1VFEA 4FJPA 4OHNA 2ZYMA 2DVZA 4FATA 3OO7A 2DSFA 3EPEA 3ZKKA 4M4GA 4I9DA 3MP1A 5AE4A 1EZPA 2LAOA 4QF9A 4LZ8A 3O97A 1R9QA 1Q1KA 3OSRA 1R1NA 3IO4A 1MXZA 4GOTA 3TEPA 3FJ7A 3RT6B 4XIGQ 4P0GA 3FGSA 4OESA 4BDQA 1OVBA 3IX1A 4LA9A 3MJNA 1DSNA 5DEXA 2Z23A 3EHSA 3N94A 5TP9B 3G3HA 3OO6A 3H3GA 3D4CA 2Y7RA 2ZXTA 1FQFA 3KN8A 3TCFA 5AA4B 1IIWA 3SEWA 2HZLA 1B51A 3B6QA 2UVGA 3OSQA 2DWAA 4RK9A 1BIYA 1LBCA 4ECFA 4N6PA 3R26A 2I6EA 3BKIB 2R6GE 3TTRA 2NXOA 2PX1A 1FTMA 3EHUA 1UTHB 3KJ7A 3MVXA 5IKBA 3M3FA 3PPPA 5EHMA 3CIJA 2Z8DA 4TLLB 3UIFA 2DWHA 3NK3A 1MPBA 2DE4A 2QJEA 1MM7A 1N3XA 1QUIA 3B7DA 3TODA 4DDDA 4POWA 2QS2A 2V93A 2Q9TA 3U8QA 1B5IA 1S9TA 3FV2A 3G3GA 3K00A 4PE5B 4KI0E 3B6TA 3MBPA 3Q29A 4G8MA 3VE1B 3KJTA 4LATA 2GRVA 4H0WA 3QAXA 3KZGA 1DTZA 2Q8JA 4GLIA 2PT1A 3FASA 4YMBA 3C4MA 3VLWA 4LZ7A 5H8FB 1M5CA 2Z8EA 2KLFA 5FTIA 4Z7EA 1Z7ME 1IEJA 2F5XA 1I6AA 1OVTA 5FHMA 2CZLA 4ZE8A 4IY5A 3FATA 1N3WA 5H8SA 1LB9A 3ECRA 1IXGA 1JW1A 1PDAA 2HQ0A 2YLNA 2THIA 5I58A 4NTLA 1XC1A 5AA2B 4XKRA 2QRYA 3IAZA 1NNTA 4PP0A 1BP5A 4ELQA 5F1QA 1FTKA 3MPLA 4FORA 1QKAA 2VHAA 1YCJA 1ZMGA 3KGCA 1D3KA 4YMAA 2GHAA 1N04A 3RY3A 2W7YA 1DOTA 1SD3A 4JB7A 3PUWE 3HN0A 3OXNA 3P7IA 1D4NA 2H99A 2OWSA 2H9BA 5AA3A 3OEMA 3VDFA 5K2YA 1OQHA 2VOZA 5CBRA 3SEVA 4XTCQ 4RK2A 4F3PA 1SI1A 3ZKLA 3A3CA 1PB8A 1FCKA 3O9PA 2ZYNA 3OOAA 2UVIA 2PYYA 4ISUA 4DCYA 1MDP1 2E0SA 4BDNA 4QRZA 2UVJA 3CR9A 5TP9A 2RCBA 3E3KA 1MQGA 3KFMA 3RQTA 2H25A 1LLSA 1QUJA 5H8HB 4E0XA 3TTNA 4F29A 2RKMA 3TDJA 3FUZA 3TFLA 5KDTB 1TFDA 2ONKE 5DT6A 1NFTA 2A5TB 3RTWB 4IGRA 4ZDMA 3O6IA 1VE4A 2RCAA 2QS1A 1Q35A 1O63A 3O6GA 4U1OA 4C1TA 1LFGA 3MVZA 3S2VA 4H67A 1A54A 3MPKA 2GHBA 1FTOA 5ITPA 1Y1ZA 4IGTA 2OZZA 1J1NA 4PFWA 2XD3A 2GFEA 2XXUA 2F7BA 4OFOA 2ZNUA 1NH7A 1JETA
chains in the Genus database with same CATH superfamily
4N13A 3TP4A 2VOTA 3N40F 4HCWA 1VB9A 5K2XA 4CN4A 1WEJH 5CCKL 3UG4A 3IM1A 3ECVA 1TLMA 3ARGC 1A4KB 1A6AA 1OGTB 3PDGA 3LKPB 4PBXA 4RA1A 1G6RA 3PGDB 3KCWA 3LMJH 12E8H 1L3WA 1PQZB 3MRKB 2OM5A 1CDHA 1R3IH 3VA6A 2I0CA 4IO7A 1XH2A 2EIZA 3AQXA 4O2FB 2ABHA 3PQYA 4A67A 3EGDB 4E42B 4EUPH 5IK3B 1N6VA 4PJDB 3BKJH 1J0JA 5L9DL 4GQZA 5KOMC 3TTYA 4I62A 3EYOB 2WQVA 1KV7A 4K7PY 3MBXL 5HDOA 5EO9B 4P2RA 3QE5A 3TURA 1CLOL 1ETZB 4HBCL 2B3BA 1UT1A 4PJGB 3QXAB 4PRNA 1AR1D 3EFFA 3VGHA 3FVOA 3UORA 4IU2B 1QJMA 2B1OA 4X48A 5E2WL 5TDPB 4E9TA 2BO0A 4IEFB 4HDIA 1JZHA 4UYPA 5IBTL 3DETC 2A83B 3DMMB 1OV8A 2DBLL 2X87A 3CV5A 2VD3A 3FTZA 4FL4C 3ARDB 3VFNA 1CBJA 5FCUH 4JFYB 4GW4A 4J6IA 4L37B 5DR5L 3S9EA 2VDPH 1DN0B 1WZ1H 4KNTA 1H6EA 5D1ZD 4E41B 4IBWA 3VRJA 4XPFH 1KTDA 4I77H 4EDXA 5ICQA 2Q74A 3JZ7A 1ZLSL 5C6WH 1ECZA 2DQCH 3C09C 4H8WH 1HXMA 5CIPH 5F3HB 4PJ8D 4YHMH 4YWGL 3OJ2C 3S34L 4WZ9A 3ARGB 2J1KA 3MNVA 4PN6A 5DK2B 3LUYA 1J8RA 4NRYA 3BH8A 3HI1A 2IBBA 5L6YL 1JXFA 2QSTA 5D1XA 5AB0A 1L5TA 1L5GB 2WZAA 1YEJH 4FZEL 2LU3A 4PJDE 1BZ8A 4G83A 4JVWA 1VZGA 2MMXA 5I19H 4XGZB 2VC2L 5DC9B 4X6CF 5GSRB 4L3CB 4YXLH 5K33A 3AXFA 1MIEL 1DUZB 1KIPA 2DW5A 4D2NA 4B96A 2HH0L 4YFEA 1MG3C 1W72H 2XWDA 5GRWA 3I6LD 3QIWD 5GS1C 3N3EA 4BELD 1SW2A 5D7JA 4HWBH 3D06A 4G8IA 1JJUA 3E1ZA 5IF0A 5D5ME 2HWZL 3R0NA 3P69A 4PY8I 4XVUC 3ESNA 2R59A 4FYSA 3OQRA 3KPPA 4UU9A 4GQOA 2NNRA 2FQGA 4HIXL 2YA0A 4NKMB 3PWVA 3UZEC 1OOAA 4P3CL 4OLUH 3FU8A 1TZ8A 5I5JA 5CWSB 4E41E 1N4XH 1E28B 5GISL 1OTUC 2YKKA 5FLUA 3WLWC 4IGBA 3AT0A 2XJLA 3ZE2E 2E4TA 1BZDA 1JF1A 1YMMB 2OTUA 4HWBA 4ONOA 3U6RA 4U4IA 1A7RH 1CYXA 2FJFB 4M5ZL 4J6RH 5ILTL 4EDWH 1JVYA 3M3LA 4NZTH 2QQNH 4A38A 2YZ8A 1K2DB 1D5ZB 3CZEA 1Z5YD 1UM5H 5DJ2B 4X9YA 2F18A 4BZYA 2MQ3A 1UXMA 1SJHA 5DURB 1KT2B 1R3HA 2OLBA 4H8UA 3DP6A 2BWIA 3T6QC 1ML0A 2BS8A 5TTRA 4ORGB 1FNEA 2ZKHL 3GXFA 4XHJC 4WFGE 4OZ9A 5T3XH 3CDGA 1LFHA 1B5JA 5IZ3B 4ODTH 1VRSA 1H6FA 4YKKA 1TJXA 1Q8MA 4XNXH 3U36A 4UI2A 3OJMB 1OALA 1OD7A 2BWQA 5IB2A 1J0ZA 3KPRA 1GY2A 4FJYA 2BWDA 4AZ8B 5GS1B 4QSCA 4NC0B 5F24A 4JFDA 4N26A 2DAVA 1B4RA 4P5KA 3MZBA 1F45A 1OT4A 1GPOH 2FZ3A 2X9XA 3NEEA 3SKJH 3VQMA 1GCYA 4D7BA 3MP6A 4AYDC 2F6PA 4GWWA 2B1AL 4HS8H 3D39E 3AW5A 1LL1A 1LDPL 4U1SB 2I3WA 1A0QH 3L4CA 1AS8A 3I50H 4NUQA 1MNUL 4D9LH 1R1CA 2GEQA 1F56A 3L2LA 3MWBA 2HX7A 1IGJA 2AJSL 3MTRA 1YMME 4OMBA 3WTTA 4R9GA 3IDXL 1RHHA 2C9VA 4ZFOL 1CUOA 2VXUH 3HE7A 2JF1A 3QHFH 4C8XA 5HJBA 4JB9H 4YHNA 3L3GA 4Y9GA 4QO1B 4MHFA 5DTFB 1U4FA 1PGRB 5GGSY 4HX1B 3FO9B 5CO1A 1O6TA 2LFEA 5KDTA 1CO1A 4DN3L 1ZGLB 3KYOB 5HY9B 4TSBH 3BH9A 2KDGA 4YN3A 3RA7L 4HJGA 5IB5B 1PTZA 3KPLB 3B5GA 4QHLA 2OTPA 2ZOOA 2ZJSH 4W9HC 3F6JA 1MVUA 2OP4H 1K6QL 3HFUA 4LCUB 5HYSA 4LKXA 1P4IH 3IDMA 2RFXA 1B0RA 2YK1L 3LV0A 4ZI8A 2CDGB 3K4DA 3F00A 3O28A 3DROA 2Z7WA 3CWGA 2D9QB 1KLGB 4HXBL 3ZT6A 1DVFB 3MFFA 5D7LB 5GJSL 3SO3C 4DAGL 4ELOA 3OGCB 3QDJD 2WZ5A 1RPUA 1T4WA 4LESA 3VXOB 4HAGA 4OTXH 3O3EB 4QFKA 4NZFA 1V3LA 4N5UA 4B9CA 2E5EA 4AG4H 4GG6A 3NDYE 1EJOH 4UA8A 3I3DA 3IR1A 4F3GA 4IIQC 2HTLD 2J55A 1MELA 3D2UD 5CBEA 2XXVA 4RPOA 4ZEKA 3CHRA 4PLJD 3MRQA 5DGRA 3WUWB 3TEZA 3ZO0A 2J43A 4ZYKA 2QQLL 4OCRL 2FBJL 2DJMA 1NUWA 5DHMC 3VXTA 4RIRA 5ANHA 4JY4B 3T6VA 3HC4H 4H1LH 3ULAB 3E79A 2C9XA 3G5YA 1BX2B 3OC5A 3FTGB 5EO0A 1LAGE 3PWJB 3CK0L 2Z6FA 3GI8L 3OZLA 3HB3D 4JFXA 4ZMYA 5IJVA 4LSSL 5J5EA 1ORSB 1CLYH 3C9NA 3G5VA 1WBYA 1A6ZA 3QJTB 5LGKA 1H3PH 3WXVL 2VABB 4F20A 4NAJA 5C70A 3FVKA 2BVOB 3GGWA 2C9AA 4PJ9D 4QRUB 4GEIA 3RNKB 4KO9A 1JK9B 2HJLA 4FHJA 2WUCH 3FT3B 4NBZB 4F18A 2ZWLT 4OB5L 1GC1L 3HZ3A 3VTAA 3IXAA 3LPGA 4GRMB 1EHXA 4O51B 3VMNA 4H1LA 3ONMA 1QATA 3GSQA 4NO5B 4UOZA 5EMYA 2Q9OA 1O9WA 3OWRA 2YR3A 2JKSA 3RTFB 1NUZA 4P59H 4TNVK 3QNXB 3RGYA 2I25N 3SO3B 2WJ5A 3CFBA 4AJWA 2XY2A 1SYSB 3H06B 2DM4A 3GSWA 4K3EH 4JNXA 1K4DB 1XGRB 2IPKB 4IIQB 4KDTA 4TUUA 4HKZB 1NCHA 2PW1A 3GSUA 2O84X 3UTTB 2IGTA 4UM9D 4JQXC 3L9EA 5DVJA 2DQTL 3TNMA 4BQ9A 2OMTB 5C0NC 2XXIA 5HBCA 3E6HB 4XC1H 3FTWA 5KYYA 1A21A 4UDUA 3UP6A 4ELRA 5BUPA 5DWUH 5AVYB 3CFEB 1VGEL 5J1AB 1JNNH 1KGCD 1C7SA 3LEVH 3ZVVA 4LRIC 3ROOB 5DJAB 3U0WL 1QVOA 4E9WA 4MZ3A 1CBVL 4OF3A 5DJ8B 5AAWC 3Q27A 5IVXA 2PFYA 1AI1H 1CT8A 4JFWA 4XPGH 4YHOL 4HK0B 3FMGH 1A8EA 3EADA 2QPFA 4XODA 4AYGA 1BG9A 3DBSA 2NMSA 3DX6A 2FT7A 1A4BA 3FTYA 4MA7H 3STLB 3LSFB 1B2YA 4L05A 3LZPA 4XKQA 2A6IB 2AITA 2FGZA 2YD9A 3DBXA 3KYKH 3HI5L 3IB0A 4L9LB 5INDA 3IDIA 3M17B 2VGQA 1ZIBA 5I1DB 4LL1A 4ZUUA 2HX8A 5LCVL 2V3TA 1GYWA 4LBEA 4PSRA 4YO0B 4K94C 1J1XH 3RDJA 1HQRA 3UTTE 1MNNA 1HEZB 3VVVA 1S7VA 3CHXA 1MF2L 3ZDZF 4IBZA 5EWIL 3V5AA 4K9EH 4YR6A 4TTDC 4U3SB 4FAAB 4KZDL 3OAYK 1GZPA 3HN3A 3JWOH 2FJHB 3D2TA 3L4WA 2QHRH 3SDCC 2I07A 5LWYL 3QR1A 2BZ7A 5DHYA 3NACH 4JHAL 4WIQA 2QL3A 4R5TA 2CLZB 2CCWA 4BQBA 3SKMA 1AYOA 4X6CB 1XT8A 2F8DA 1B4ZA 1WZMA 4X9IA 1M2VB 2HVKA 4N6QA 43C9A 4FLHA 3RQ3A 1KCUL 1OAQL 1UCBH 3T2NH 5BWJA 1IM3B 4F5CE 5JQ6H 4NKOA 4O02H 3JTBA 4G7QB 3BZFB 3INUH 4RRPA 5FLVA 3K2DA 1L9RA 1ODUA 1K9ZA 3HG1D 5A3IC 5T1MA 4O5LL 2B3FA 5CBSA 1R9FA 2J6EL 1EEUA 2WXJA 1HH6A 1KB9J 4OTEA 4U1MA 2C9QA 3GMLB 4MQXC 1H9VA 3UJTL 3IVKB 1JG9A 4NXSA 3WDIA 5CN1A 3KC1A 3RYDA 5F3BA 4UINL 4YAHX 1Z0MA 4NUGL 2EEDA 4Z7VF 2JB6A 3MV8B 3UAJC 3UZVA 5I6MA 1B40A 5LO7A 3WKMH 1KTLB 5L2KB 1WD8A 4EI6B 4J2XA 1IEBB 3HE6B 4WGVB 3O4LB 4APQC 1FTJA 3MLVL 3W9VA 1SMOA 3H9SD 4RWYL 5HHVL 1YYMH 5ISUA 4Q6IA 3GHPA 5D1ZA 1KWKA 4K7FA 4ZAKC 3D09A 1DSFH 5DCCA 4LVQA 2WLIB 1MRCH 5EQ9A 4X6CE 1BGXL 3N42F 1U93A 4J4PD 4HVBA 1WCQA 1UA6H 4NDMA 1J05B 1OB1A 4IDJL 4DN4H 3MV9B 1Z9OA 3LQAC 5FCSH 5LAPA 1JMXA 2P8LA 1BQKA 4ZS9A 4WW2B 5DFAA 3QJOA 3GSVB 2BHFA 5E99L 5J6SA 3CDFA 5JPNB 4QXGH 4CW1A 4G11A 1EXUA 1S78C 2YMOA 3O9WC 2OXGA 2FVNA 5LQBL 1TJHH 2WV3A 4LN5A 2V3UA 4J3OG 4W9LC 4XKNA 1MHPL 3MV8E 4EDPA 5A16B 1F13A 1TF4A 1UOLA 3H7BB 1BXUA 3ARSA 4X4MA 2ZCKL 2IPUK 1LNUB 1MFEL 4M1CD 3VWJA 2BP5M 3O4LE 4FF9A 4LFHG 1X5GA 3TO4C 3WHXB 4APQB 4HZ1A 3CZJA 1OLLA 2NY5L 5JW4N 3IJYB 4GWSA 4X80H 2N1TE 1M7UA 5EZPA 3GUTA 2IWKA 5IZ1A 4ZEFA 2Q7YA 4ZAKB 5IKCB 2BSRB 3GMNA 1KBGH 4ZDHA 3UN6A 1KN2L 1QUNA 5JHMA 3IDJB 1ZCRA 1IE4A 3PPQA 3WSQH 3ZTJH 2XWBB 4YHIB 3PGFH 1S7RB 2MWCA 1OHZA 1P7QD 3D3VB 4NQSA 4LLYA 4OCMC 1GZHC 1O9ZA 4NE4A 3IE4A 3PWPD 3WFZA 3IETB 5C0BB 1BWMA 1MXVA 1NCDH 3B5HA 1IX2A 3VXUB 5CGMA 3EDEA 4EMZA 4LIQH 5L8LB 3GKZA 1ZRUA 2APTA 3W0WE 2C9UA 2F15A 2ORBL 3R1GL 3U1PA 3O9WB 4PVBA 2E0PA 3K6WA 3BI9X 3MRDA 1YC8A 4FQXC 3SE3A 3PGFA 1G7QB 4N3UA 2F8XC 1FBFA 1BFOA 2IWEA 3FSAA 2D03L 1L3NA 2B1HH 1CTMA 3PUYE 3OR7B 4NHCH 4R3SA 4M1GL 5EIQA 3WEOA 1U95A 1MEXH 2A9CA 4KKAC 5MERA 3BRDA 3WTWA 1R24B 2ZX5A 4N8PA 4ZS7L 2V33A 3SE4C 1TENA 2DJ4A 4YQXH 2YAMA 3H6AA 2ADIB 4OIFA 3TO4B 1MQJA 1BBDH 1T7YA 3PHSA 1S5HB 2DIJA 3FXBA 4NKDA 4CJ1A 4P57B 1XGQB 3D33A 1RZGB 1FPIA 1FGVH 3V6OC 4G70B 4QHKI 4PRPE 5JPMC 4V2BA 2XWKA 2ITCA 5IEHA 2P24B 3S4SG 4A2MA 4UQ2B 4HCRH 4RGMC 5FGCB 1ES0A 1WF5A 4TVUA 4CKVX 2H9GB 2WVTA 5C0BE 4PLNC 4N2MA 4R75A 1BDYA 1CFQB 1U8QA 5LNGA 3VXUE 1IM9B 4POUB 3HPLA 2ZZVA 4TQUQ 1A64A 3N9GL 1SJMA 4MNQD 2CNZA 3GYYA 1WA2X 4N4YB 3MJ6A 4JY6B 3VXRB 2O26U 4LNRB 3EO0A 4ETQA 1NGWA 2OXHB 3KS0H 2PXYD 3O81A 2GY7B 3QDJA 3QXWA 4NZUH 4TVSa 4HKBB 5E8PB 3MCLL 1WS8A 4DP8X 3QEHB 4HCRA 1CQYA 4NF6B 1KBVA 2OYLA 3VD2A 1NNPA 1M5DA 2XRAH 1ED3B 2VISB 4QTHB 1MN4A 1IAIM 5I5IA 1K5NA 1FSKC 1RIVL 1IU1A 3D2UA 3BGFC 2MNJB 3ULUD 1JWMA 1QHOA 4PRHA 1TFAA 4N87A 2JCCB 2TRYA 3VXSB 4KTDH 4YSRA 4TUKH 4TLKA 1N18A 2YUVA 2IA4A 3PU7A 5CRYA 3I9GH 1BD2D 1XL6A 2ZX9A 1YLBB 1JGVH 1RZFL 2K45A 3DO7B 2REJA 4P0DA 1AQDA 4RLDA 4EI0A 1AXTL 4CKQA 2C1OA 1WJ3A 3QFJD 3VFPA 5KUKA 1DANU 3QUGA 5ESAA 1X5YA 3AROA 3DX1A 3HI6L 4XO5A 3FJMA 1I9RH 4NO3B 4U05A 5IOKA 2PO6C 1DJIA 1L7TL 1IC7H 3NRFA 5FGCE 1IC1A 1CZ8L 2AK4D 3FT2A 4OCLC 2FWOA 1KBPA 4RGMB 3RNQB 3SOBL 4PJ9A 4LBAA 1MWAB 1BP3B 1QLFA 1PSKL 1I3GH 5TDNB 1II5A 3U4EB 3V9EA 1R47A 1DVYA 4MXQD 3BAJA 1FRGL 5M2VA 3FZUD 1EAPB 1HCFX 4GI9A 4N8VA 3VXRE 3ZDZB 4FQLL 4DI3D 4I85A 4GSQA 5IR1A 3M8UA 4KUCD 1B6HA 1T83A 3L2MA 3BPNC 3GI9L 4J8RB 2JLLA 4XI5C 2ROYA 3LIZL 4MD0B 3L3JB 4QRAA 1RXLA 4F37K 4NQCA 2CIKB 5C0EB 1WT5A 3UGXA 2F6GA 3LRHA 2P45B 4RNRA 1FSKB 1J48A 1OPGL 3BGFB 2JCCE 2P5WD 3VXSE 4FQJL 2XN1A 3BP5B 1S7SA 4WFHE 1ZT4A 4UM9A 3H7LA 5FUCC 5ANMA 2PT2A 5I0DA 5D7IF 2VYRE 2D31B 3MR9B 1WAAF 3IMRA 4ZOAA 3MNMA 3BC9A 4TUJA 5E4AA 5E6IA 4OJEH 1J8HD 3SGKA 4MZ2A 5J56B 3O6LH 4I3GA 3V6OE 4TOZA 1VCAA 1L0PA 3MRFB 1YN7B 2KQNA 1FFOB 1IKNA 5GHWH 1KPVB 2W91A 1PD6A 1Q9KA 3OG4B 2PO6B 4TL5A 3W38A 1Z5LB 5B8CB 4F19A 1PG7H 2ODHA 4JO5A 4Z5RB 1NBZA 5FGSA 3T8VA 2FWLB 3GBDA 1KTKE 2Q2CA 1OAYL 4NHBA 2NX5B 3FQ4A 3MUZ1 5FXCH 4OR1A 1MXYA 3C8DA 2AJYL 3S8GB 4Z0BL 1NTDA 5D72H 3BPNB 5FM8A 3RWEA 4OIAA 1DEEB 2P7TB 4YJZL 4WNSA 4AH2B 4D0BB 4XVSH 2R0ZL 1D9KA 3BWSA 4Y4FD 4JWYA 5F96L 4M5TA 4RGNC 1M1XB 1NGXA 4Y2OA 1E65A 1JUFA 4PJAF 3RWHA 3TBYA 4BFFA 4NLHA 3H1ZA 1MUJB 2ATKB 5CLXA 3VXPB 4MRCA 1OP3K 2DYPB 2AABL 2VDQH 1LE9B 1QX1A 4ERSH 2BXYA 1V54B 2I58A 4OZGE 2EZ0C 5LAXB 4AEFA 2Q2AA 3B2XA 1Z32X 1ZY9A 3K71B 2CG9X 3RLFE 1B3LA 3G5ZB 3PREA 3V0VA 3TUSA 5DHVH 8CGTA 3LV3A 1XEUA 3KJ6L 1PKQA 2WYTA 3A47A 4GBVA 3X12A 4XN7A 3C87A 2OS7A 2VDNL 4FQHB 3GO1L 1S3RA 2ADFH 3K6DA 3VV5A 3F11A 3HG1A 1UENA 4GBXD 5FK9A 3OELA 2NX5E 4YB7A 1RP9A 1KLUA 3NPSC 4AGQA 1Y1MA 4JG9A 3FCUB 5FX3A 5EZLB 3FHQA 5HJ3A 1D7CA 2AW2A 3GSNH 4TQPA 4OAWB 1IAOB 3TN0C 1GC1C 1ZS8A 4JFUA 4TNWF 2E86A 1AWBA 1JEVA 2DM3A 4MAUH 4LLQA 3MTXA 5I24A 2XWOA 4O2CA 3E9TA 3ESUF 2B4CL 4RGNB 1SQMA 3SD2A 1II4E 1G5GA 3L3HB 4KU1A 3VU1A 4R97B 2VR8A 1U8IB 1LM8V 3V0HA 4W9CC 3N85H 1OVZA 1NUNB 1G7PB 2XTJC 3QWOA 4IRJD 5HTSA 4M5YH 4AYFB 3RDTC 4J4PA 5AYUH 1G0HA 1HHHB 3IMTA 5LGYA 3AU1A 3GPSA 4HPOH 4AIZA 3PUXE 4XN4A 2XG5A 2BS71 4WO4D 1XVYA 2O61B 2ZP8A 1ZHBA 1J1OH 1JGEA 2XWEA 1DBKH 2OCUA 3FCSB 2GJZA 1AP2A 3GNML 3MNZA 3VVWA 3HCVB 4FE8A 3L2NA 4PRID 1FO0L 4ES9A 4PD4K 4OZIA 4JO1H 2DLGA 4P5TC 5IQ7L 3IFLH 4XMXA 3S35H 2VLKD 2WBJD 3NPSB 2N56A 5ESQB 1TDQA 2W07A 2X6MA 3FNKA 1KY7A 5IJKA 5F1NB 1BAGA 5IJCC 3HV1A 3WGUB 1I7RA 5BOPA 2C34A 3OC8A 15C8H 2X4OB 3CZUB 1FNGA 1XV8A 3L3OC 5H35B 3TN0B 2GC4C 1YAEA 2P80A 2DWJA 2E27L 4MS8C 1ZVYA 2IV9A 2X9ZA 3ILDA 1BW8A 3EYQD 5JIQA 1TFPA 5C3IA 5LHDA 4JFEB 4TQEL 1WFMA 3DOHA 1HINH 3MCKB 2P2AA 1DQDL 4TN9A 3VTTA 4A7GF 1SY6H 1R6ZA 1RDZA 3V4VB 1TVDA 1A3LL 1CN4A 2JELL 2XZZA 1RUQH 2WQWA 1US5A 1F41A 1PBPA 1C16A 1BLIA 4QY8B 2VWEE 4ATTA 2XV3A 1OMPA 4UILL 4Q8BA 5DUJA 1QFUH 4D8OA 5FO2A 2HT4D 4I0PC 3BGAA 3IU3B 3FZVA 1HL8A 5I76B 2C3VA 5DEZA 2DLFL 2X70B 4DZ8A 1TYJA 5D1QA 4YHKH 1HZKA 5KANI 3SOTA 4KK9D 4FULA 2XIDA 4FNQA 4JQIL 4XXDB 3VFRB 2Y1AA 4FA7B 1JPGA 5E8OB 3QJXA 4NBYB 2EUVA 2D4DA 2XWRA 4TNFA 4Q58C 2I4BA 3KG2A 4OVQA 4YUEH 1A3RH 3EOYG 4P5TB 1PDKA 2QMXA 3KYNB 2PPAA 2UXFA 2FLRT 2H6PB 2ADJB 4J3OD 4KKLC 1RVFL 3I6KB 1POY1 3H7MA 3B9DA 5DRZB 4KMTL 1MXWA 3PMVA 5CGYD 2GSIA 3MAMA 3QO0A 3U7YH 4BFIA 4P8BA 3GTNA 1RZQA 3A22A 4FXTA 3ECUA 4LFHD 4HIPA 5E2VH 1KFGA 2WBBA 1A9BA 3BYTA 2ARJB 2OL3L 5FM5M 2WGXA 4I2XB 4JFSA 1FN4B 2V5TA 2CBTA 2VAJA 4JFEE 1UTBB 3ZN6A 4ZEDA 2EDXA 3T0EC 5IBLD 1AG0A 1MFMA 4KXPA 3OBAA 4BSJA 1A7OL 4I4WA 3QK0A 1E4XL 1QW8A 5FYKU 1JBJA 2PYEA 2BFVL 4L0YA 2NOOA 3DJZA 2FIEA 5I57B 5E6YA 3AXIA 3IYLW 3KH4A 3LOWA 4LRNL 4XCCL 2DXYA 2IH8A 1YHPA 4I0PB 4GNKB 2K8MA 1BQSA 2NUPB 4PJCB 4ZUSA 4XMLH 3COOA 3L3IA 5H37A 3VTMA 2YN3A 1J0YA 3ULUH 3VFUB 1KWHA 3THML 2F8VA 3UDWC 1OCZB 2QMKA 4MNQA 5KYWB 3GEWB 5CILH 1FLRL 4DH2A 1S7YA 1LQBC 3CVHB 3FV1A 3APFA 4ESXA 4HV8A 1YN6A 3F2LA 4YKIA 3REWB 3FQNA 4AQEA 5B1AB 3TV3H 4OZHA 2ATPA 4TNEA 1OP5K 2DWDA 2PXYA 2I60H 1MRDL 3KEDA 3N2JA 4S1DC 4XNQA 4G8AC 5F0PB 5CJXA 4J3SA 3CFLA 4X7SH 3T6XA 1UZ8B 4TPRL 1TU2A 2PWEA 1FZOB 1INDL 5D7IB 3LY6A 5D55A 2ID5A 3TEXA 4B9IA 1A8FA 3P4OA 1SFDA 2IPUG 2VDOL 3JVFC 4QRTA 3VYNA 1MH4A 4P23C 4YL4A 4MQ7B 2B7DT 3W5NA 3RIFF 3GSOB 2GJ6D 4I2XE 4WWKC 3ERXA 1BD2A 1FZKA 2HUHA 5DUBA 4TYUA 4THIA 3BT2L 2IQ9L 4CMMA 4LLMB 3R18A 1RZKH 5EUOF 2LU5A 4F7EB 1UKSA 3CMGA 4X99A 5HD8C 3T0EB 5B3NA 1FQBA 3SKPA 5AVWB 3LEXA 3DYPA 3D0AA 1ND0B 1AJ7H 3QFJA 5F6HJ 2LAGB 5DQDL 4JFZH 2ZF9A 4K23H 3V2AR 1B9KA 1WIUA 2YPLA 4HXVA 3UYPA 3E13X 1NMUA 1QEWB 2DS9A 1LP9A 2AK4A 4N2EA 1Y1UA 4PJCE 5DVIA 2H0EA 3MLTB 1JYWA 5JOFB 1B7HA 5E1AA 4RFEA 3UACA 4WTWA 5J6HB 3L7EB 5KZCB 4ABQA 3RUGF 3VCLA 3P77A 4XXCC 3IKCB 5F7WC 1FZMA 2F5BL 2UWEA 4P05A 3SPCA 1I1AC 2WD0A 5C0CD 4OCYL 2NCEA 1YPNA 4MAYD 4PP2B 5D7IE 1F0LA 3IK6B 2JJKA 1EO8L 2UVEA 4IMLA 4U6YB 4C55A 3U2SB 5HGHA 3O2AA 3FT4B 4Y1AD 1QBLL 4FFYL 3KR3H 1NDMB 2R2HA 3KG5A 2P5WA 4WHYH 5DRWA 4OCSL 2MNUA 5DFVC 5DMIH 5C08D 5TPWH 3BVNA 3VSVA 2VLLA 5CR1A 1LO2L 2EYSA 2PCFA 5F88B 2JB5L 3GRWL 3UC0L 2XWTA 3QI9B 3LSWA 1L7IL 3D0VB 4H7VA 4WWKB 4XPTH 5I1EL 2BSCA 1SOSA 1T6WA 3K6OA 3V4UH 4GL8A 4DW2L 4GUOA 3ZIYA 2NUVA 3T0EE 2VR7A 4LLDA 2LW3A 3AUVA 1J8HA 2FYVA 4W9IC 1K9YA 3O11A 3PD9A 3QMFA 1PF3A 5FWRA 1AE6H 2OZ4L 3SJVE 1HEJC 4XMUA 3S5LA 3SPHA 4GMSH 4JWXA 2EDDA 2C9RA 1BREA 3SESA 5F7EL 4QFPA 3BSZA 1Q0XH 5KS9A 1B3HA 4GKSB 5FWQA 3WUWG 1GGCL 1OY3B 1EBAA 4KJWD 1FG2B 2BY2A 3K2KA 5FDWB 2R4RH 5HYQA 1VACA 2Z92A 2VLJD 4NS0A 4QF1B 4ZPVA 1N8ZA 4G9FB 3S3BB 1O5DT 2O7UA 4X5WA 1CFNA 4IOFC 4BDVB 1G9NC 3V0GA 1BIIA 5DS8B 3LN4B 4Q30B 5HM4B 1CICC 3MODH 1NL0H 5E7BA 1I1AB 2DBJA 4ZMNA 5I56A 1DQML 3CH1A 4Y16D 4HS3B 4OUUA 5KWYC 2EEBA 1I4FB 2VXVL 1QW0A 3AGVA 1BSIA 1QZ1A 1W2KT 5H8NB 4Y4FA 1LEKB 1IBGL 2A3TA 4L2YA 3OKYA 4A6YL 2VB5A 5FYLD 2CZKA 1KPRA 3CFKB 4P5MA 4GRLC 3Q2VA 4FXKA 3SHSA 1DQQB 4DUWA 1V3JA 2N0MA 1A1NA 1BPVA 3N43B 1JZIA 2RAMA 1TO4A 4KTEL 1EDYA 3BEVB 2VL5B 1R17A 3T1WA 4OFIA 4TQIA 5TF1H 4NP4H 3CSFA 1N64L 2Y3NA 4ODVH 4OVJA 4L4VD 1R5WB 3AQYA 2KPWA 4HFUL 4XPHL 4DK6A 4BH8A 1IQ7A 5E03A 1WGOA 4LKCA 1HEHC 4G9FE 1BF2A 2QQKL 2V5RA 5H94B 3WE6B 4GBXA 1A7QL 5E1GA 5IMOB 1ORQB 2K1MA 3AG2B 1BV8A 2BVPA 4DO6A 1MH5A 3DURB 2EE6A 1E6OH 3W11C 4EZKA 4CVXA 3AWEA 4FCHA 3BH4A 1CICB 4NWTH 4DVRH 5I15H 5DQ9A 2CGRL 3KGUA 5E0QA 5FA4A 4KHTH 1C12B 2OCCB 1MCFA 4N9OB 4BZ1H 1U91A 4K5LA 1NMBL 1OGAD 4DP7X 3CSGA 4F1ZA 3ILPB 1HCZA 3HPIA 3L48A 4IKNA 4ZO8A 5I2NB 4GRLB 2D7OA 4FYRA 1QA9B 4OKVB 4ZXBB 4XVJH 1T0NB 5TE4L 2W8CA 2AJVL 1JNLH 1SXNA 2CHNA 2IJ0C 4R90H 1U8KB 1YYLL 4GI8A 3D4GA 2QGCA 2W9LA 1JPTL 3CSYB 3K1DA 4QFLA 4JGJA 3SSGA 1ACXA 2NY7H 4K7PH 1WBZB 5KG9A 3RWGB 1UVQA 3DGGA 1BYOA 4FHBD 2YBRA 4RCAA 4C59B 1QABA 3N55A 3V7MA 1BXXA 5C09D 4WO4A 4LSPL 2QL1A 5KVGL 3B6SA 4F8TA 4JRYD 5ETUA 5IY5B 1KCVH 3AXHA 4LE8A 2BMKA 3MBWB 1BXAA 1KA0A 1QKZH 4ELPA 1RKMA 3D69A 3FCTA 5IFJA 2J21A 4WEDA 4JM4H 4HMDA 4QRPA 6FABH 3K1NA 4HW6A 2SODB 4UQDA 5C0DB 1N19A 5C07B 4I1PA 4GRKA 1WEJL 3H9ZA 3L7FB 4GQ9H 2EXWC 1T1WB 2YKLH 4PJEB 5ID0A 4JGNA 1NC4A 2OMZA 2VLKA 2WBJA 5KYUB 2Q2LA 3DDFA 4OF0A 12E8L 4FN0A 5F72S 1B4JH 1R3IL 2XZQH 3KLAA 3NZ8A 1R3JB 5AZEH 3QUYA 1G7MA 1I3RA 2YUZA 3W3BA 1NGZB 3ZGIA 2A9DA 3Q44A 3O0LA 1CB4A 4YEEA 2AV1A 3TCXA 3VD5A 4F80A 3C33A 3AACA 3BWAB 1QRKA 4G7YH 4B53A 1QNZH 1XF4B 1JDCA 3QWRD 4M7KH 1WZLA 3BEWA 3FO1A 2H26A 4A7SA 1NV3A 5CC2A 2HTKD 3IFOB 3K46A 5T5FA 2GIMA 1C8QA 3I84A 2GTWA 3DRTB 4JPWL 4UB0H 2K0RA 1V05A 4J3OH 1T5WA 5AW2B 3T9VA 3PXJA 3Q6FA 4HWZA 3UTZA 2FT6A 1MCWW 3SYCA 1B9JA 4PREA 5FCUL 4EAEA 1NCWH 5D9SA 2BP0A 5IHWA 1P7HL 5LGJA 1F58H 1IZ1A 1IVLA 3DIDA 1WZ1L 1SVCP 5FYJL 5H2BA 4ZEBA 4XPFL 4QNPF 3A0OA 4DIXA 3EYSH 3D52A 3EH2A 3IJOB 5DYOA 5C07E 2DQCL 4HUNB 1S7WA 4N1HB 3IOVA 4X9TA 4PJEE 5HGAB 4YHML 1BLFA 1I7TA 4H5FA 1V55B 5K9KB 1JVLA 2WNGA 3CZFA 4I0KA 3H6UA 3VXNB 1OQGA 3GKWH 2CO4A 5I8CB 2WP3O 4L2LA 2D7NA 3UROR 4C58B 4JJHA 2YQ3A 3IPBA 3BWZA 2B16A 4IM8A 4NQEA 3IS1X 2IV8A 1YEJL 2CGZA 1S46A 4EN3A 1CVRA 3NFNA 3JV9A 4YKPA 1MDQA 3IS0X 1ONQB 1QLEL 2OBGA 4YXKH 4P3DA 1MXGA 2J5LC 3BO8B 3KBHE 5LXGL 1F2QA 3TV8A 3D25B 4YH6A 3GF8A 1JFQH 2NQCA 3LNIA 2REGA 3WO4C 1W72L 1OT1A 5D71H 3BWUF 5C0IA 1MJ8L 3G9VA 1LVEA 4JZNA 3CQQA 4PJXF 1J18A 2QVFB 2Z31B 3MU3A 3RTQA 1OSYA 4YZWA 3Q26A 3CBJB 3E2HC 5I5PA 1MHCA 4G1MB 3RFZB 3CXHJ 2XPYA 3RUGB 4QRRB 2EKJA 1JI2A 4PGZA 4QKXB 4NRZA 4U7MA 3E6FB 1UIVA 3SPVB 1DVXA 4WKZB 4UOQA 4R73A 4JRFA 4YLBA 3ABKB 1J0IA 3ARDD 4OLUL 3ROJA 3LSXA 5CMAB 4J2QA 1J9TA 3V4PL 2G30A 3NSDA 4DXBA 3EJZC 4MD4A 4YBQC 4ZOEA 4E41D 4KKRA 3MRGB 2EDFA 3UP9A 3GM8A 1BM3L 2IALB 2LGNA 4J6RL 1SDYA 1XR8A 2QHLA 4NZTL 5DJDA 5F44A 2QQNL 3U0PA 4JM2A 3ARGD 2N1KA 4JLRA 3UBXA 4KHZE 4MDJB 4P0IA 2CHXA 4IIZA 3FB7A 1SDXA 1G84A 2A9BA 5T3XL 5I6NA 3EAKA 3UMTA 3PAUA 4WFGD 4ODTL 3Q8FA 3BHBB 2J5LB 1UB5B 4OVTA 2GJ6A 5F1SA 3WS3B 4F7KA 4JSDA 1F5WA 1G7HA 1PY0A 1BVKA 3L17A 1HSBA 1THAA 2UX6A 3LN5B 1OCRB 1BLNA 3ME0A 2XQ0A 3HHMA 5AW7B 5JUEL 1U8OB 3MJ7B 4QJ5B 4PJFF 5L9MA 2QR0A 1WSST 2FE0A 3E2HB 1GPOL 3SKJL 4DT2A 3RUGE 4POZD 4QRRE 2O5YL 5DVNA 4RYAA 5BVJB 4HS8L 3ILQC 3WAJA 4U1JA 4PV8B 1HH9B 3ATBA 3D39D 3GBEA 1A0QL 3O4OC 3DETD 2ICWI 2QKIA 1M2OA 3I50L 2P0SA 2AEPL 5HI4C 1PB9A 3LPOA 3HIZA 4JFOB 2GT9A 5E00B 1CL7I 1U8PA 2C3XA 2NY2B 1U8JB 2DLEA 5EIIB 3O41A 2W65B 1YMMD 1WV7T 3QHFL 4XN1A 5D6CB 4NKIH 3ZSFA 1FFTB 4QHQA 1YEKH 3T0JA 1I53A 5DJ6B 3IFPB 4I18B 5C0CA 4IR8A 3PUVE 2PP8A 4MAYA 3BAKA 1K5WA 2DD8H 2BSED 1QFOA 3MNWA 5DURD 1PFOA 1W0VB 4Y1AA 1KB9K 2HG5B 3CVCA 2I0BA 4WHTB 2ZJSL 3GZQA 5HPOA 2OP4L 1BQHB 3G6AA 2AAVA 4KKCC 1XBRA 2XA3A 2XC8A 1E4KC 5JHDB 5IFAH 1A7NH 3Q5TA 1IMBA 3MRNB 2AYSA 4H44C 5BCAA 1BQUA 4NF0A 4UDTA 1KCRH 4OLZH 4RA0C 4OTXL 3ES6A 4KK5C 5KJ4A 1UQSB 1A9EA 1K4CA 1EJOL 2N0KA 3H3BC 4AG4L 1IGYA 3VE0B 1Y4TA 1ZVNA 3LJ3A 4AS5A 3OPUA 2I9TA 3K6FA 5C0AB 3ECWA 1HYSC 4OD2A 4XMKH 1LE5B 1OE3A 2GH9A 4W6XB 5DC2A 3RVTD 3DVNA 1FNLA 4W81A 4ZUVA 1EO5A 2VLJA 4W93A 5GGUB 3OV6A 4J1UA 3GMQB 3IPFA 5FYLH 1OTUD 4HIJA 3CVDA 4PI2A 1G9MC 1U8HB 2WHVA 1P1VA 1YYCA 3IJHB 4I1DA 3KPQA 5DA4A 4PV9B 3FHEA 5B22A 1SI0A 3SBQA 2ICWA 1E4WH 5BRZB 4Y16A 1H3PL 5JNYB 3AXLA 1MY3A 5BRPA 5JA8B 2V7NB 4ETYA 3PNRB 5EZIH 2A74A 2WUCL 1FPLA 3HLAB 4ZQKA 4HSQA 1TVHA 3IGFA 4XHJD 1LJMA 4LCCC 5EBWB 3ETBJ 4FJ6A 5JHDE 2ZXDA 2FHCA 1LILA 3QPKA 4CADB 1MCOH 2Y2WA 2H32H 4P59L 1DVFD 4GQQA 1U4EA 4G43B 1YEHH 4PHXA 3MJ9H 3QQ9C 3NMEA 5IEKA 1L9NA 3ELQA 3LB6D 2JKWA 4K3EL 4NWDA 4UABA 1X5JA 1CGSH 5C0AE 9PCYA 4M56A 3O29A 5AAPA 2OMXA 3EYVA 1AGBA 1RJZB 3JT0A 1J5OL 1ZPLA 1NV2A 5IB1A 4N5EC 2CWRA 3QP3A 3RIKA 4XC1L 4QRSA 4GWXA 1CXEA 2CO7B 2H32A 5BS0E 4F33B 32C2B 2P48B 3MRMA 3IMBA 4EE2A 4A7UA 4R96A 3LEVL 1YJDH 4HALA 3X3FH 1RK0B 4GX3A 2VXQH 4MKTA 3WI9A 2HKHH 3C5SB 4G80B 2X4TB 4I88A 5AL8A 4KQ3H 3KPMB 3QIMA 1WO2A 3BWUC 5BRZE 2WTRA 4BRJA 4HYTB 4GRWH 1G0YR 2XZCH 1SYIA 4XPGL 3WTVA 4GUPB 5KVMC 5BXFB 1Y3PA 3QH3B 1PNCA 2YEZA 3GJFA 5CGBA 1JCVA 3FMGL 4EBQL 1OGAA 3G6JB 1JGDB 5MP6H 4CILA 4GUQA 1V3MA 3HAEG 4UANA 3P4NB 3KSXA 3CZSA 2PNDA 1G7JB 2BCKA 2XD2A 4LCCB 4UQAA 1T03H 1PAMA 3SDXA 5F0MB 2VMDA 4MA7L 1TVBB 4IU3A 2VXQA 1D9YA 4EKXA 1C5DB 4YSCA 1XFPA 3KYKL 5CEYB 3MUY1 4AL8C 1QHPA 2QFRA 4U6TA 1D2PA 5GZNC 4ELMA 3CSBA 1VADB 5DJZA 2YMXH 4PCDA 3EGSA 4GO6B 4N2HA 2CLRB 1EHKB 3V6FB 1PLGH 4FAJA 1S7XB 1V5JA 1E5AA 1J1XL 2KKQA 2UXAA 4JDZB 2I9LA 3UTTD 1ZHNB 4K9EL 3I02B 4XZ4A 4JRYA 3MBEC 5I58B 2A6JA 4V33A 4JG1L 2QHRL 1ADWA 1S9VA 3CCHA 4B5ZA 4Z8FH 4O3CA 3RI5K 2MHAB 1J12A 3A4DA 3CVIH 4GINA 2J72A 1HWGB 3NACL 2XVLA 2XKUA 2ENJA 1A14L 4RGOH 3UGUA 4CRPA 4E0WA 4RDQG 1AZBA 1KXTB 4HEPG 4TLLB 1PZSA 5I84A 3I85A 1NCOA 1BAWA 4AIOA 3H3PH 3O2WH 2K4WA 1PZ3A 4PAZA 1K8DB 1OK0A 5FC9A 3T2NL 3ZSSA 3CQFA 1GIGH 5ICYB 1Q0YL 2ZYMA 4FATA 2FO8A 1U30A 3S36X 4O02L 3UO1H 3G6JE 4M7LH 4BD4A 2EILB 3INUL 2WNWA 3HVDA 4I3RH 1A6WL 3R4RA 3H42H 4R0LB 5MI0B 1PZCA 1RK1B 1WTLA 4XNZB 4KZEH 2QVVA 3FJTA 1SVZA 2PPDA 3ZKKA 3PJLA 3NGBB 4ZSOA 5CLTA 3CLEH 3QWRA 2FJGB 4I9DA 3AADB 3BQUC 3QZWA 5AE4A 1EZPA 3RIFK 3D0LA 2AEIT 2LAOA 5E94B 1J5DA 3QNYA 1EFXD 3CPLA 1UEMA 3Q2CA 4LZ8A 2EDKA 1R9QA 4QHMA 1PFCA 2X4NA 2F19H 1MXZA 5TDOA 3VD9A 4FG2A 3EOAB 1P1ZA 2WVSA 3QUHA 1DE4B 3KBFA 4H26A 5ALCH 2CKBB 3U2IA 3WS6C 3MBEB 5C0ND 5I1AA 5FKAA 2AP2A 5D7SH 4P0GA 1FL6A 3OAYH 1T4KA 1BVNP 1DSFL 1WZKA 3VGBA 1MRCL 2XZAL 2D3VA 4GKZB 3QC6X 2G0KA 3VQLA 3VGEA 4R4FH 4BDQA 1UA6L 3PIQB 2E7CA 3LKPA 3V5HA 3PGDA 1PYWB 4DN4L 1PQZA 1OVBA 4DKDC 2GSGA 4JZJC 2F68X 3LPFA 1IM3D 1FVDB 2P8MB 4K0OA 4L8SC 4O2FA 4P5SA 2Z23A 3DIFB 4PU2A 3EGDA 3BZDA 5DJ0B 5FW8A 3T0DA 4J3UA 4PWIA 3H3GA 4F8OA 1X5MA 4C4KT 3L3KA 4AX3A 1D7FA 3DLQR 4PIRF 1FQFA 5EO9A 3TCFA 2OYKA 5CCHE 5DVLA 2MNWA 1TJHL 5AW5B 3X14B 5A2FA 4Y19B 5EZOH 2J4WL 2H8PB 1MDAA 1M57B 3OSKA 3MV8D 4OT1L 3Q0HA 4LVOC 5D5MA 3MOBH 2VPOA 3OSQA 4BQ6A 4FCAA 4RK9A 2ZF8A 1F90H 3HE6D 4JN2B 3ZR5A 5BZXA 2ZYIA 3O4LD 1FPEA 5L8JB 3ARDA 1LBCA 2YAQA 2ERJC 1SMDA 2FJSA 3J07A 2HFGH 4JFYA 2JWYA 4N0UE 1BQRA 1N2RB 3RZWA 4X80L 5FR3A 1A6UH 3BVXA 3LD8B 4Q7DA 4E41A 1AZNA 1JMZA 3BW9B 2NXZC 4ZFZA 3DUSB 3UX9B 4Z7UE 1HOEA 4V1DE 5I23A 3EHUA 1A5FH 1KBGL 3RIAF 1XF3A 4AMWA 1RFDH 2B9BA 5JYLA 1UKTA 2MCG1 4X6EB 1YEFH 5E5LA 3PGFL 5DK2A 4O8MA 5FECA 3WBDA 3UIFA 1Z3RA 3P0GB 1T1YB 2CSPA 2G5UA 4LO9A 4K5PA 4F91B 1AH1A 4P56A 4OGQC 4F15B 1NWPA 1DBBH 4LIQL 1MPBA 2XFXB 3EJCA 3BPOB 4Z9KB 1QFWM 3W0WD 2QJEA 5C8JB 4PC9A 5EC1B 2A9NL 3I74A 3N50A 3AREC 4NEHB 4Y19E 1LO3H 5CHNA 3HZMB 1MFVA 2Z8WC 4PBHA 2B1HL 2L04A 1AGCB 2OJZH 3UAJD 3KZ8A 3L1GA 4LVOB 5CP3H 4POWA 4DDDA 3GZKA 3IAGC 1BXVA 1MEXL 3D39A 5FO8B 4NCC1 2Q9TA 3U8QA 4TRPH 1BEXA 3EFDH 4XWGL 4APQD 4YQXL 3IJSA 1BJMA 1BBDL 2ERJB 1KYFA 3LKSA 1MJ7H 1KCWA 2Z0BA 1MCIA 4A2LA 4F92B 2NXZB 3ZPDA 3IXTA 4RMTA 5KBNC 3WIFB 5IJDC 4XNYH 1FGVL 5EN3A 1L6PA 3QNZB 4KI0E 3F7YB 1KMGA 1G6RB 2YC1B 4JO2L 5CP3A 4WDIB 3VE1B 4PRPD 3BMVA 3HJ0A 5CD5D 1K2DA 1D5ZA 2WQ8A 5DD6A 1XF2B 3C6SB 4X7TA 3KJTA 2BSEA 2EIZB 5DC0A 1KT2A 3U6XS 3WKYA 4HOXA 3PQYB 3NEXA 4YSTA 1N70A 5C0BD 1QBAA 4P4RA 4B0MM 3KZGA 5E9NA 3MLYH 4H8WC 1E3ZA 4U6XA 3VXUD 4GLIA 3S2CA 2AK1H 2PT1A 4P2RB 4JKNA 2EDEA 4MYWB 3M1BB 2JKRM 4LZ7A 5IT2L 3C60D 3HBPA 5H8FB 5IVXF 2EXTA 3ARQA 1BFTA 3ZTEA 3Q43A 1M5CA 1MPAL 3AREB 3O9WD 2BHUA 4PRNB 4QTIH 3EFFB 2BOBB 3M7FB 3QCTH 5KJ7E 1OZTG 1H3WM 1L6XA 4LGSB 2XRAL 3K5SA 1JPFB 4KKBC 1RP8A 3MREB 4HDIB 1ZS2A 4X6BA 4KKZA 2BX5A 1UZGA 2WO3B 1NEZB 4Q9BA 1F4YH 4KTDL 1NCTA 3HVNA 1Y18A 3OXRA 3VFNB 4U1SA 4R8WL 2JKTM 3I9GL 3FC8A 5D4QA 1OVTA 3TO4D 2Z65C 3M7OA 4IGBC 1JGVL 2WZPA 3DPBA 1KTDB 3FU5A 4EDXB 3EZ8A 5HDBF 1MKFA 4ZE8A 3I2CH 4ODHH 1HXMB 5FO7B 4PF6A 3QR0A 2WWNA 2NUTA 2VRAA 4QO1A 3FATA 5LBVA 1H6UA 3MNVB 1I9RL 5DTFA 3RJQB 4BQ8A 4HX1A 3FO9A 3ENEA 3ECRA 4NRYB 1IC7L 3BH8B 2NYYC 3HI1B 3JXAA 3KYOA 1U8LB 1ZGLA 1E8YA 5F9JA 2THIA 4X5PA 1OGSA 1KJVA 5IB5A 2VDPB 3P2TA 4UOW0 4G7VH 4P3LA 1I3GL 1XC1A 4QHNA 3VFOA 1IM9D 4AUYA 4BRVA 3FB8A 4K3DL 4XKRA 3IAZA 4Y4HA 2B59A 5EOQH 2DQEH 4PP0A 3W82A 3VXRD 1SBBA 3VH8A 1BP5A 4DSYA 1YPZB 1NMCC 4JX0A 2I26N 5B4MC 1DVFA 5T3ZL 2ETWA 2VE6B 2MFNA 2PYFA 2ROXA 4G8IB 3MPLA 5IF0B 5FV1L 3VXOA 5KOVC 2BW5A 1R5IB 4OLYH 5F7FA 4R6YA 1HOCB 2G3ZA 1JL8A 3Q1EA 1EAJA 1TEFA 3OLEA 5DUMH 3KPPB 1Q9LA 4KKQA 1FAIH 4LVEA 1HIMH 3Q5YA 4P2AA 3VXSD 2W92A 2J88L 1DLFH 4WFHD 1VDWA 2YQ2A 4GG8A 3QEGH 3KVQA 4EZJA 4JB7A 3L5WB 4IGBB 2OTUB 3HE7C 3DOSB 3ZUNC 1O75A 3U6RB 1DFBH 3WDHA 2YRLA 4AYSA 1I31A 1BX2A 3O6LL 2H9BA 3OEMA 1E4JA 3H55A 1E9QB 2N4IA 2XQBH 3NJMA 4LSTL 4MCNA 1ORSA 1R3HB 5M7QA 5CBRA 4LEEA 3MO1A 2Q86B 1NLDH 2VABA 3VI4F 3WELA 1UUNA 1LWJA 2LT9A 1PG7L 1PW3A 2OA9A 4QRUA 1FNEB 3RNKA 4XTCQ 3SEVA 1NAKH 3B3BA 3OJVC 3FT3A 3CZKA 2F53B 4RK2A 5ICXA 3U36B 5JXAL 4IRZH 4F57H 1SI1A 2GBUA 1OCWH 2UY7A 5JR1H 1YPZE 5B7EA 4DKAA 2XPGB 3KPRB 4WHDA 4P9KA 4NZJA 1PB8A 1K9TA 4WEMB 2ZYNA 1NMCB 3FQWB 3QDGA 5F7UA 3OOAA 3QNXA 2YD4A 4JFDB 2PYYA 5D72L 1PIGA 3DX7A 4P5KB 1MDP1 4O4YL 1SYSA 2FZ3B 1HZHH 2E0SA 1I1YB 4XVSL 1NCBH 4BDNA 3GIZH 5I0ZA 1IJ9A 2IPKA 5JW4R 5HGBA 3PP4H 1LWHA 4XPAH 2RCBA 3UTTA 4APXA 4IRZA 1MQGA 3NIFE 3DO3A 1ECYA 2DLHA 3BP7A 2H25A 2VSDA 2ZX7A 1IGJB 1T2XA 2VDQL 1CLZH 3FU6A 4JDTL 1AQ8A 4WQOA 1RHHB 3HFFA 4ERSL 5BO0D 8PAZA 1AZCA 1QHQA 3HE7B 2ZSWB 1M71A 1Z9LA 4HJ0D 3L3GB 5J1AA 3TDJA 3FUZA 3EJPA 5KDTB 4P2YA 1LK3H 3BH9B 1DLHB 5E5MB 4M1DL 3FONB 3MUJA 2PO6D 5IQLA 4DFIA 4QHLB 2XVBA 2A5TB 4KJPC 4PAKA 5DO8A 3L6FA 2ADFL 4F5CA 2OX5B 3SODB 2E7LA 2B39A 2FX9L 3IDMB 2F53E 2RFXB 3A4EA 3QPXH 4FLSA 4I1RA 4HXAL 3GLAA 1I9EA 1SOKA 1RQ5A 1VE4A 3DROB 3MKKA 2NX5D 3CFIC 5K1JA 2Q7NA 1UD6A 2VXSL 1HC1A 5K93A 3KPRE 5F6IC 3STLA 3LYRA 4NIYE 3FUEA 1XCQB 3VD0A 2QS1A 5MENE 4L9LA 3ZKND 4GG6B 4GLRI 3UPAA 3GSNL 3C5XA 3M17A 4KDTC 3TH4T 4XI5D 3K81A 1EFXA 2WINA 4HIIA 1ACCA 4EIGB 5I1DA 5FHAL 2OZNA 1CGUA 3MN8A 4MAUL 3MRQB 4YO0A 2M1KA 5T1JA 3KDMB 3EYFB 4K4KA 3KD4A 1HEZA 3TJHD 4YHLH 4ZYKB 3NJXA 3FXIC 4H67A 1EZUA 4JQXA 3MPKA 3VXTB 4RIRB 3ZTDC 2FJHA 1GGBH 2ALWA 1TYEB 2DYPD 4KK6D 4KPHH 4WTZA 2UZXB 2DQIH 1X6NA 3LKNB 3MSPA 4YDLC 3N85L 4GIOA 2D0GA 1OP3H 2K7PA 4CAGA 4IGTA 4TS6A 1LD9A 2XV6B 2QGDA 3IDGA 5IGAA 5EQ7A 1EUTA 5AYUL 1IBYA 4K2UH 5AVVB 3VFMB 4WK4B 3G5VB 1A6ZB 4HPOL 1ILUA 3MYJB 2ED6A 2IBZX 2XD3A 1PIFA 1CFSA 3NH7H 4NUJA 2PW2A 2F7BA 2HJLB 3RG1C 1NCCH 1IM3A 3EXJA 1J1OL 4DPRA 5AYTA 1DBKL 4H1LB 3K74B 4HA1A 3O0RL 4CUCA 5C71A 3WFDL 4H4NA 4GX6A 3GSQB 4YOKA 4CU6A 4JO1L 1IAMA 1NPNA 3S35L 4G8EA 5I7IA 5GXBB 2WLZA 5F6IB 3IVKA 3CFBB 2Q1EA 3BGMA 4GG6E 1G9EA 4JFVA 2W38A 4XMVA 3FO0H 3GSWB 3T6ZA 2R2EA 2OTWB 5DEXB 1V8HA 2EDOA 15C8L 3H85A 3MV8A 5CFHA 4C4BA 2JKNA 4EQ9A 4G42A 2PW1B 2EE9A 1A8JH 1KTLA 4XNBA 3HE6A 3K5RA 4U1HB 3TNMB 4RGND 3VRLE 3O4LA 2APVA 4OCWL 5HYJA 1FPBA 2WCSA 5KYYB 4HTGA 4HUCA 1HINL 2TSAA 2VXTH 1UWXK 1LEGB 4LEXH 3BN9C 1SY6L 1T20B 5I3SA 2F7IA 1XH1A 3BUTA 5EYFA 2EZ0D 1FE8H 1RUQL 2WLIA 4PVMA 5E8DH 4H2CA 4PE3A 4Q74A 5CFAA 2EIKB 2XLLA 5L4MA 3O6MH 4LP2B 1XI6A 2WPGA 1J05A 3JWOC 4ZD3H 4ZZAA 1S9XB 1C08B 3EYUL 4LVNB 4WJ5A 3NK4A 4WW2A 3GSVA 2QMJA 1OXYA 2J57A 4MVBD 4HJSA 1HAWA 4M43L 3DX6B 1XZ0A 5JPNA 2WUBH 3K0WA 2L7JA 3W0WA 1A3RL 5EEZA 4L5FL 1KYOJ 43CAA 4L1HA 1JXDA 4H13C 4WWID 2YGOA 3SPIA 4ECNA 2AJZA 3IDIB 2XXHA 5FA3B 3NSJA 3B2PA 4JHVA 2NNCA 2AQSA 3IWUA 3UTPE 3US0A 5FIEA 2MTAA 1OT2A 4JPKL 4AEHH 1ZBMA 2P3NA 4LBEB 4K73A 1HQRB 2P5EE 1EHLH 4BFRA 1S7VB 1X5AA 4R74A 5E2VL 1OO2A 1OLZA 1D3CA 4Z1PA 1OHQA 4IW4C 2R56H 4GOSA 3ABGA 1GZPB 4APQA 3UOAB 4Q6IC 5D1ZC 3V0JA 3IJYA 4JFED 3S88H 3ATFA 3QIUA 2KLRA 3SKMB 3ALPA 4JPIB 2Y6SC 1IE5A 4X6DA 2QVKA 3MLZH 3EQ1A 1I8IB 3GLEA 4PRPA 2PFZA 1VZIA 43C9B 1J9QA 3MROB 3P0YH 1S7RA 4AV0A 4CU8A 3I6VA 4ILDA 2CXGA 4XMLL 3IETA 5C0BA 3WU1A 3G6DH 4G6KH 3ULUL 2J71A 5EF1A 2FQDA 5T1MB 4KY1L 2G93A 3R6UA 4GI6A 5CILL 4P2CG 4YBHA 5FGBA 3QJFB 1HH6B 3C60A 4H0GA 4U1MB 4JZOA 2YUXA 5A2CA 4P5TD 5AWNH 3O9WA 5FOJA 4PY7B 1O7TA 3SERA 4X7SL 2WN3A 3FH5A 3H03A 1F2XK 3UJIL 1DN2A 1G7QA 2WXGA 3UZVB 1B2WH 1LFIA 3WCYA 3VWJC 1JHLL 4I3SH 2FSDA 4LLWB 2ARJQ 3QDHA 1QPXA 3KVDD 3OR7A 1AHMA 5E51A 3ULSB 5IAIA 4N68A 5ERWA 1OLAA 1R24A 1YTVA 4MS8D 4NOBA 2ADIA 1FORL 1LHZA 2ITEA 4Q6IB 4PS8A 5D1ZB 1RZKL 4AQ4A 1HCYA 2ZOKA 4K7FB 1B46A 1S5HA 2ZZUT 4XMWA 3UYRH 5ACZA 2WYPA 1AJ7L 3C5JA 6CGTA 2XHDA 1CE1L 5DF0A 5GGRB 4YDVB 3UBFA 1RZGA 2WGNB 4NDMB 4K23L 4DUXA 3MA9H 4G8NA 4XCFH 2IG2H 1ZANH 2ZCLH 2YS4A 2P24A 1QQDB 4UQ2A 1OM3H 4LQ2A 2P8LB 5J89A 4FFVD 2H9GA 4I0PD 2ZUXA 4E36A 2E6QA 3DDGA 1QSFB 3BUYA 3PJSA 5A7EA 4ENZA 2JJSA 4NEDA 3INOA 4G8GA 2OAAA 3LRMA 3MXVH 1EXUB 5EIIG 2OSWA 4ABWA 1FBHA 4X1BA 5GRYA 4PUBL 2OXGB 4JY6A 5GGTH 3VYPA 5AAMA 5GIRA 5G4NA 4LNRA 1RUMH 1SXZA 2F0CA 3MJ8B 4LPCA 1BZ7A 3RWFB 4HPHA 4HKBA 3QEHA 4YEFA 1OP5H 4NF6A 3ISWA 4MNGA 4XHQA 3TC9A 1M7DB 1XDTT 2PVUA 4QTHA 1ED3A 1IFRA 5LOMA 3C2AL 3G3FA 4OENA 2XT1B 5CLYA 4S1RH 3VWJB 2Y36L 5E8EA 5DMIL 1U3HD 5K5YA 5TPWL 2JCCA 3VXSA 3CDCA 1BQHG 2NRDA 2WB1A 4XPTL 2XX8A 1EDQA 1FPKA 1MWAH 1DP0A 3V4UL 1QMUA 4WK2B 4PFRA 1MFAL 4FI6A 1MCDA 6PCYA 3DO7A 5G55A 3F01A 3SZKC 5DK0B 3P40A 3LNFA 5E6UB 3T0ED 4B3VA 3NJJA 5A2JH 3GMNB 4DP5X 1AE6L 4XN8A 3ZUCA 2EC9T 5HHXL 1QUNB 1SVXB 2BNQA 3SJVD 4EOWH 3TEWA 3X3GH 4XP4H 5JHAA 3V6OA 3BIKA 4OQOA 4YKJA 1ATGA 3TBCA 2G60H 4X0NA 1Q0XL 2NQ3A 1J7VR 2F8IA 1W8EA 4KVNH 4NQSB 1PZ2A 3RNQA 3H6TA 1E2WA 2UXVA 1QSFE 2R4RL 1BVZA 4L1DA 4JKPH 4BINA 3QZPA 1LWRA 5SV3A 4OCXH 1B7UA 2EDNA 3IGAB 5KZCD 3QQNA 3D87B 3ZE1F 3IL1B 4U2YA 2GEEA 3HZYB 5I6OA 4OZ4B 4ONFL 3FN3A 3MRDB 1FNFA 3MFGB 2YD6A 4FYTA 4ENED 4S1DD 1BFOB 4AJ0A 4PV1C 4MD0A 3VI3E 4I48B 2CIKA 3RHWF 3QDMB 4R3SB 1U95B 4OJYA 3GQFA 3NCBB 4TNGA 5MERB 2QEJA 4OZIF 2Q88A 3BP5A 5HHPA 2Q2EB 4TXVB 1IT9H 4YZFE 3QI9D 4NNPH 4WWKD 5E08H 1I7UB 4DEPC 3WFEH 3BFUA 4PETA 4NKDB 2D31A 3GEFA 2RINA 4M7LT 4TQ8A 4GH7B 3HUJF 4OZGA 4F9LA 3HB3C 3UXFA 4PR5A 4ZBJA 4ODVL 2ITCB 1Y0LB 5IEHB 5MEOB 3T66A 3MRFA 2B08A 1YN7A 2LQRA 1IMCA 1FFOA 1KYAA 1ES0B 4L18A 1VR5A 2AHIA 4QRFA 1KPVA 3BQVA 2PO6A 1Z5LA 2H6OA 4OEUA 2VTFA 4LPTA 5B8CA 4WFFE 4Z5RA 3GZGA 3HPLB 3HHGA 4G9FD 1A7LA 4POYA 4X4XA 4I1NB 2CRMA 5CJOH 2NX5A 4RJZA 3EO0B 3O6HA 1E6OL 4R2GC 1RKRA 3WXWH 4W9EC 2IFGA 1T83C 3QDJB 5AW4B 5CKAA 5F7VA 4NWTL 5I15L 1BECA 2A4ZA 1I1AD 3VMOA 1WT5C 3CU7A 2IAMB 3J7HA 4KHTL 3AUWB 3A6CH 4BZ1L 3QDME 3D2UB 1DEEA 2MOVA 5IB3A 1SFHA 3ZKXB 4YFLF 4AH2A 4D0BA 4OYVA 1OP4A 2DKUA 4PRHB 2VDLL 5J7CC 1Y3QA 2XY1A 2F58H 2P1SA 4IY6A 1M1XA 1EZVX 2ED9A 5DFVD 2EH7H 1OAUH 3QRFM 4G72B 4MA8H 4XVJL 1N7MH 1AQDB 5LJYH 1BVLB 2V2WA 1JNLL 4R90L 4UMSA 5E6IC 3SGKC 3RX7A 4X5QA 4M9OA 4P47A 3VFPB 1XCTA 3BXNB 5ESAB 4F7CA 4LEBA 3PAVA 3K71A 2NY7L 4K7PL 1IKNC 4MA3A 3RWCA 1NLBL 3ARFB 2CK0L 3FT2B 1U92B 2X1OA 2FWOB 3PABB 5IBUG 3WTUA 1QLFB 2V5YA 1PY9A 3OD7A 3E80A 2D7TL 4PS4H 5E2UH 4Q4EA 5C97A 2WYHA 2R39A 4N8VB 3HG0A 3IEAA 4JM4L 2DYRB 4UOW1 3V9FA 4ZMVA 3D1MC 4GQ9L 2WLLB 5GRVL 4LONB 4R2GB 5AKVA 4JEGB 4M3HA 4B0MB 2DWEA 3Q06A 1CICD 1AOZA 4NQCB 1XMEB 2YARA 5DLLA 1E5UI 2XZQL 5SWQA 1NUYA 1NPJA 4N2AA 1D9KC 5AZEL 1NGQH 1IAOA 4OAWA 4XPBL 3PPOA 4RNRB 5EORH 2ZUSA 3CXDH 3D34A 3V8XB 3QPQD 5KSBA 1ZT4B 4ONHB 2XYCA 4M8VA 3PAZA 5C7ZA 4OZHF 4N8UA 5I73C 5ANMB 4G7YL 3K4UA 1E40A 4IHBA 1QNZL 4GRLD 3DXAB 3L3HA 1AYRA 4XAWL 4ZXBD 4KRNA 1OCOB 4LASH 3SQBA 4GIAA 1MCEA 4TUJB 4QUOA 5E6IB 4FEDA 1U8IA 4K55A 3EHBC 4WO0A 4XB8A 1DCLA 4WUKL 3HS0C 3ULUF 5ITOA 2OI9C 1ETA1 4ONYA 4R6UA 4UB0L 2AJ3A 4WF7A 1S9KC 4N86A 4YMPA 4YBLC 3TZAA 2R29A 3N0AA 4PVNA 1NBZB 3VLVA 1NCWL 2R7EB 1XHYA 1F58L 2JSFA 5E5UB 2XXPA 4Z7NF 2COQA 1F6AA 3WEAA 1VF5C 1SF5A 4JRWA 4M4RA 3HCVA 4OJFH 4UT6L 5C07D 2ZXBA 3QA3A 2O6EA 1ACYL 1WFJA 4DAGH 3W11D 5DFWH 4CGTA 5ESQA 2V25A 3GKWL 1KTCA 5ET6A 4NQCE 4U49A 1HE8A 3HR5B 5F1NA 2ZWNA 1A1MA 5BMFH 7CGTA 3SDFA 1RYOA 3OMBA 4D7PA 5DGQA 1D9KB 4KCCA 1PCXA 2X4OA 4UIMA 2OKMA 1NGXB 4Y2OB 3TBYB 3ZYJA 2SEBA 3DSNB 3RWHB 4YXKL 3CMOH 4P2OA 4U1IA 3B1TA 5HYIA 2UWEF 5L4JA 2X1QA 4KUCF 5PAZA 5I73B 1M5BA 1R3KB 3DXAE 1IVTA 1TR7A 1FDLH 5D71L 1XBDA 4JHWH 5BZWA 2HN7B 4JFEA 3W5MA 4KNSA 3EHBB 25C8H 3DWTA 4J4PC 3QJRB 2XXFA 4CVWA 1SMAA 3HS0B 3LV3B 2IOOA 1PKQB 2CO3A 3WMSA 1X5FA 3TCLA 3ZZQA 5DDHB 4QY8A 4G2AA 3X12B 3VM7A 3UPRA 3HNTH 4YBLB 1MM6A 2GI7A 3RY6A 1DO5A 4R7LA 3CD4A 2ZTBA 1HN1A 1X7SA 3IU3A 4HJUA 3DX0A 2DI7A 1VGKA 2X70A 5HHOE 3HG1B 4U6HA 1UD4A 2XACC 1GR2A 2CHZA 1J0HA 3FT9A 1BG1A 1KLUB 4FQIL 4L4TB 4Z3GA 5IJKC 1Y1DA 5KS9F 1RSFA 1VZHA 4JCLA 5CMBA 1MCLA 4FX5A 4MHHG 5HJ3B 4I87A 3V8CA 1QAWA 3ZIMA 3BKMH 4X7FC 4BDOA 5DRZA 4WCYH 1LBXA 2EE3A 3KGSA 4XP6H 4U0RC 2JQMA 4J39A 4ZPTB 2AZUA 1OAKH 3ODBA 4RAUA 4H88L 2J1YA 4HJJH 1I69A 4KWUA 4A7VA 5I9QC 2RD0A 3N04A 1A25A 2VR4A 2YQGA 4Z78A 4OU3A 2O72A 1B5HA 3C34A 4E2OA 2LLGA 3TEYA 4I2XA 3VW3H 2BPBA 3CGTA 1FN4A 1MRFH 1U42A 4PJ6A 4NT6A 2MPVA 3P30H 5LBGA 1MY4A 5CUSH 1XH3A 3QWOB 4GW5A 1QVSA 1AS7A 4GT7A 4Z18A 2WYZA 2Z31D 2C3HA 5EU3A 3QEUA 4JFHE 1PKQE 3CVHH 3OZKA 2BVUA 3AU1B 1SXSA 4QRRD 2HB0A 2XG5B 2XN2A 5E6ZA 4WI0A 3ZE1B 3DM0A 5ICZB 2ED7A 4MCZA 1QUPA 3QORB 2RBLA 5D1QC 2ZOUA 1ZHBB 4EKJA 2HFTA 1XAUA 4PJCA 2NZ1A 2GJZB 1AP2B 1L9OA 1DSYA 4RMQA 1GGYA 3ZDWA 5L7XL 1RPQA 1NJ9B 3LX9A 4L4TE 4NKIL 2CBMA 3TBVA 3QG6A 3PU5A 2KLTA 1PX4A 3ARPA 5ENWA 1YEKL 4YPGA 1DBJH 2V0AA 2C4FU 2UVHA 2APSA 2XIBA 1A6PA 1IC5L 4JFQB 4DZBA 3TNNB 4EN2A 1U3NA 4PS7A 5M94B 4AUJA 1FZOA 1RUPL 4KNUA 1W0WA 3T22A 4NPJA 3US9A 4IBQA 4LVHC 3L6HA 4BH7A 1U3HA 5KCJA 5FO9B 2ZX6A 5I9QB 3VFWB 2EAEA 4MJ6A 4RFNC 2A1WL 4KDVA 1A7NL 5IFAL 4QOKB 3FQTA 3MC2A 5L2JA 2IO5A 1OARH 4LLMA 1KCRL 4OLZL 5CN2A 3T0EA 1USZA 3SZPA 1KBKA 1C16B 3ZQWA 2IDSA 1EX0A 4B97A 5CI5A 4XXUA 3SJVA 5ET5A 3WAEA 2HFBA 1JZ7A 3T2LA 1D6EA 2IEPA 2P3VA 2YEVB 4IB2A