3EF8A

Crystal structure of putative scytalone dehydratase (yp_496742.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
149
structure length
149
Chain Sequence
MTDTNLVEMRAIERMMFDYSYHLDMNHPEELAALFVEDCEVSYAPNFGATGRDAYKKTLEGIGTFFRGTSHHNSNICIDFVSETEANVRSVVLAIHRYTKERPDGILYGQYFDTVVKVDGQWKFKRRELRTTMTTDYHVRAANPIGRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative Scyalone Dehydratase (YP_496742.1) from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.50 A resolution
rcsb
molecule keywords Putative Scyalone Dehydratase
source organism Novosphingobium aromaticivorans dsm 12444
molecule tags Lyase
total genus 37
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ef8A00
1HKXA 5IG5A 4IIAA 3NM2A 2W2CA 3HX8A 5DRVA 3F40A 3B7CA 2K54A 3F7XA 4L7KA 3JUPA 1W01A 1CQSA 4FCMA 1W02A 2HMMB 2YFLB 4HZ9B 1K41A 1EG9B 3HK4A 1QJGA 4HVNA 3F8XA 5AI1A 2CKFB 1ISKA 1O7HB 3I0YA 1STDA 3JUOA 4XDWA 3BLZA 1ULIB 3CU3A 1ZO2A 3B4OA 3FH1A 3UNLA 3G16A 1ZX2A 3F7SA 3MG2A 1UUWB 2CHCA 3GZXB 4Q53A 3LYGA 4R1KA 2QGUA 1OUNA 4XM4A 3LZAA 5TGNA 4MJDA 3MSOA 5AIHA 2B1XB 2XSOB 3F14A 5BXQA 5CF1A 3EBTA 1SJWA 3EBYA 4HM6B 3EN8A 3DZLA 3VSYA 3KKGA 2HMOB 3S5CA 1IDPA 2Z77A 3JUNA 3FGYA 1W00A 3WMDA 4HM0B 4XBXA 3RGAA 5KP1A 4H3UA 2QIYA 4L8PA 4HJLB 3CNMA 4RZMA 5IEOA 3B8LA 4HM5B 3IPTA 2UX0A 1OCVA 4XBTA 4LGQA 4HM8B 3UJMA 3CNXA 3NHXA 1E3RA 2I9WA 3NV0A 5JPPA 1JN5B 3D9RA 3HZPA 5D83A 3FF0A 5DREA 5BVBA 2GEYA 4LMIA 1JKGB 1DMQA 1Q40B 3FSDA 1O7PB 1GY5A 2BNGA 2F99A 4WWUC 4FCJA 4KVHA 1JB5A 3JUMA 3RGRA 3FLJA 3E99A 2XSHB 5IG3A 3KZTA 1AR0A 2JQ5A 1JN5A 4K1UA 3JUQA 3EN1B 3GZBA 3T8UA 1BUQA 3SOYA 3DM8A 1WQLB 5FW5A 4WP5A 1GY6A 1ASKA 2R4IA 2BMRB 3STDA 1C7HA 2B24B 2GBXB 3VGNA 2A15A 3NBRA 4XB5A 4OUQA 3OWUA 5KP3A 3GWRA 2Z76A 2HMLB 1E3VA 1O7GB 3B4PA 1EA2A 4LEHA 5AIIA 3H51A 1NDOB 8CHOA 4PEJA 2HMJB 1TP6A 5IENA 3EHCA 1QMAA 3SOAA 5CK6A 1NU3A 5CXOA 1A2KA 1OGZA 4STDA 3G8ZA 3EJVA 3F9SA 3KE7A 1O7MB 2HMKB 5CLKA 1DMNA 1TUHA 2HMNB 3NUVA 1ULJB 2STDA 2F98A 3MG1A 4U13A 4K1VA 2YFJB 1Q42A 3MKIA 3OX9A 2RGQA 3A76A 3KSPA 3GZRA 4X2HA 5AEUB 3K7CA 4L8OA 3DMCA 4OVMA 5JPUA 4HM3B 1GYBA 4X2OA 3BB9A 4CDLA 5KP4A 5AIGA 5IF6A 3F8HA 5IG4A 1W6YA 3OWYA 3FKAA 3MYTA 3OXAA 4HKVB 4HZBB 1JKGA 1Q40A 2PZVA 3EX9A 7STDA 3OV4A 1OHPA 3MHEA 2Z7AA 2RCDA 1E97A 3T8NA 1OF5B 3SEDA 1OPYA 4WYKB 4HM7B 5EVHA 5STDA 1JB4A 2RFRA 4HM1B 5IEPA 4HM2B 5IERA 3ER7A 1GY7A 1Z1SA 2XR8B 2IMJA 1U5OA 3H3HA 1JB2A 1OF5A 4ORLA 3DUKA 4WYKA 5HGRA 1S5AA 4N3VA 3DXOA 3FZWA 4XBYA 3ROBA 4GB5A 4HM4B 3MG3A 1UUVB 5D81A 2F86B 5D82A 4I4KA 3M8CA 5G2GA 3EC9A 3EQQB 1OHOA 1O7NB 3Q90A 2XRXB 4XDVA 3NXJA 1OH0A 5CF2A 2INXA 2BMQB 1DMMA 6STDA 2GBWB 2GXFA 3FF2A 4J9AA 1VZZA 5AEWB 3GRDA 3NV0B 4J8TA 3EF8A 3GZYB 1NWWA 2OWPA 3OWSA 4R9KA 1O7WB 3ECFA 3G0KA 1OGXA 2GEXA 1OHSA 3CPOA 3K0ZA 5AIFA 4R9LA 2BMOB 5IG0A 1GS3A 2YFIB
chains in the Genus database with same CATH superfamily
1LNHA 1YNVX 1CH0A 2JDIH 2BT3A 1HKXA 2W6JH 5IG5A 3DGLA 4IIAA 3CCR3 1M904 3NM2A 4N6MA 2LYXA 2W2CA 3HX8A 4MMZB 1RGFA 5DRVA 2CG1A 1BNSA 3CCQ3 1D6ZA 2CWVA 3B7CA 3F40A 3WODG 1ROVA 2K54A 4EW5A 3D5GA 2Y74A 3UL6A 3F7XA 2QEX3 1I0XA 1BSEA 3LTDA 3WA3A 4L7KA 3JUPA 4BTYA 1W01A 3LXUX 1CQSA 4FCMA 5EEOA 3S29A 1LVNA 1W02A 2HMMB 2YFLB 4HZ9B 1K41A 1EG9B 1RHLA 3HK4A 1JV2B 1QJGA 4HVNA 1X1XA 1QALA 1IV9A 1Q9EA 1MWSA 1HYFA 2CH9A 3F8XA 5AI1A 2CKFB 1YJW3 2RBIA 1ISKA 1O7HB 1VQP3 1BRJA 3I0YA 1STDA 3JUOA 4XDWA 3BLZA 3X40A 1T2IA 1ULIB 4BU4A 2XFTA 3CU3A 1FGMA 1ZO2A 3B4OA 1N5PA 4HOHA 3BNEA 1VQO3 1MNLA 2KXGA 3G4S3 1VQ43 1I8VA 1KSIA 4KFDA 1RTUA 1M1K4 3FH1A 1LOWA 1MWUA 1RN7A 3UNLA 1TFOA 3G16A 1IK3A 3I563 1ZX2A 3CCJ3 2CW9A 3F7SA 3V99A 4AKYA 3MG2A 2V1LA 2W04A 1PY3A 3CCL3 2O9UX 4NPBA 1MGWA 1UUWB 1LQMB 1DYUA 2H0IA 1UI8A 1EUIC 3PCSA 5ELUA 1YJ93 4BTWA 3ZG5A 2CHCA 3GZXB 2XH9A 3LYGA 4Q53A 4R1KA 1M1XB 4WHAA 3X42A 1RKYA 4RBNA 1YI23 1R4YA 5AYSC 3HIIA 2QGUA 1UCLA 1CYVA 1OUNA 2L4VA 3LZAA 4XM4A 5TGNA 4IPBA 4MJDA 3MSOA 3FG1A 5AIHA 2ZL8A 2ML6A 1NJI4 2B1XB 1RGAA 2XSOB 3F14A 5BXQA 2W9PA 5CF1A 2C11A 1YGWA 3EBTA 1SJWA 3EBYA 1JBTA 4HBRA 3ZFZA 4HM6B 3RNTA 1HU9A 2CK3H 1JNQA 1VQN3 3EN8A 3DZLA 2OOVA 3V92A 3NQYA 3VSYA 2IA7A 1RGCA 3KKGA 2WGOA 1RSNA 2HMOB 2XEPA 3S5CA 1W2B2 4AEQA 1NB3I 1IDPA 1BAOA 2Z77A 3JUNA 1DVCA 1LOVA 3FGYA 1W00A 2M7OA 1TU5A 3N54B 4KT3B 3AGNA 1SQWA 1GMQA 5LC7A 1UUGB 3WMDA 1JBSA 1IVUA 9RNTA 4HM0B 1K734 1N8R4 4XBXA 2KAAA 1MGRA 1FUSA 3RGAA 4H61A 5KP1A 1SIHA 4H3UA 1BUJA 2QIYA 1AY7A 4N6UA 3LTCA 2CX0A 4G1MB 1BIRA 4L8PA 1GD4A 2KF5A 4GL6A 1RN1A 4HJLB 1B2XA 3BNDA 1G02A 3CNMA 3DY5A 4RZMA 1BOXA 5IEOA 3B8LA 4HM5B 3IPTA 4KFEA 1LRAA 1Q864 1QVG2 2D42A 2UX0A 5M18A 1MWRA 5M19A 1CYUA 1OCVA 4XBTA 4LGQA 4HM8B 3UJMA 5IW9A 1BNFA 3CNXA 4LYLB 1UCKA 3NHXA 3NM7A 3IJEB 1DVDA 2OCTA 2BO9B 1I2GA 3DH2A 1E3RA 4HAAA 1RGKA 2I9WA 3NV0A 5FGOA 1JN5B 5JPPA 2Q07A 3D9RA 3HZPA 4BIRA 5D83A 3FF0A 2E2UA 5DREA 1B3SA 4CPKA 5BVBA 1FGTA 1QAKA 2L1SA 3AMOB 1X1UA 2GEYA 4LMIA 1JKGB 1DMQA 3LT8A 4R4KA 1Q40B 2CWTA 1TRQA 1O7PB 3FSDA 1WMOA 1GY5A 3TDGA 3NBBA 1UGIA 2BNGA 2F99A 1YJN3 4WWUC 3GSPA 4FCJA 4KVHA 4EXRA 2R41A 1JB5A 1TFKA 1W6CA 5G1LA 2F56A 3G713 1V58A 3U97A 1VQ63 3VF1A 3AHSA 3HIGA 1VQQA 4EC6A 2KF3A 3JUMA 3CCV3 3RGRA 4MMXB 1UCJA 2WOFA 1BNJA 3FLJA 3WHOA 1NB5I 3E99A 2XSHB 3BNCA 4O2HA 5IG3A 1K8A4 1GOUA 3KZTA 3N8BA 2QA43 1AR0A 2JQ5A 1JN5A 3OW22 4RNYA 3QRDA 2F4YA 4K1UA 2RSXA 3A5EA 3EN1B 3GZBA 3JUQA 1EEJA 1IQXA 2CWUA 3Q1CA 4HYZA 3SLUA 3I553 3CME3 1JZOA 2K3DA 8RNTA 1ZS7A 2ZA4A 1A2PA 2CFGA 1TTOA 2F5WA 1YHQ3 1BSAA 3T8UA 1JJ22 1I0VA 3N9HA 1TRPA 1BUQA 4FR9A 3SOYA 4N6OB 2CFWA 1W7CA 1SPUA 3DM8A 3LT9A 1LOYA 1B2UA 1WQLB 5FW5A 4TX4A 3NQZA 1BANA 4WP5A 3L0RA 1G0TA 1GY6A 4KFFA 3X3YA 1ASKA 2FXTA 2R4IA 4ILFA 1T2HA 2BMRB 3STDA 3SXXA 3CC43 1C7HA 2B24B 1YIJ3 2GBXB 1OACA 3VGNA 3CCU3 2IUJA 2A15A 1VQM3 1IQ8A 4FMCA 3DGYA 1FGOA 3NBRA 4XB5A 5I97A 1GSPA 1RGHA 2PNCA 2W9QA 4OUQA 4QWTA 1L5GB 1PU4A 1RNTA 3FCSB 4K90B 1W6GA 1IYYA 1I2FA 1SARA 2W0QA 1IVWA 1I70A 2WO0A 3OWUA 4NHFA 3V98A 1RNBA 1FW7A 5KP3A 3GWRA 1QAFA 1K9M4 2Z76A 4O02B 2HMLB 1B20A 1STFI 3EB8A 3T0UA 1E3VA 3FG4A 2P0XA 1VQ93 1O7GB 3B4PA 1EA2A 2XF3A 3CCE3 4LEHA 5AIIA 4CCVA 1BVIA 3IMAB 3LTAA 4FMBA 1PYLA 2AAEA 3H51A 1QVF2 2XFSA 1NDOB 1B27A 3D79A 3WOFB 2SARA 1BSDA 8CHOA 2BHMA 2HMJB 4PEJA 4R80A 2CX1A 2WGQA 1RGGA 1TP6A 1RRLA 1ROAA 5IENA 3EHCA 1WTHA 3X3ZA 1JRQA 1QMAA 3SOAA 2IUKA 5CK6A 1NU3A 3D5IA 3WA2X 5CXOA 1I3IA 3HI7A 1A2KA 1OGZA 4STDA 2KF4A 1Y4KA 3S67A 1BNEA 3KFQC 3G8ZA 2H0GA 3EJVA 1GMPA 1RGEA 3BIRA 2H0HA 1NO3A 2F5MA 3F9SA 2W56B 3BNBA 4LSOA 3KE7A 1O7MB 1IQYA 1SIIA 1KC84 1Q824 3DGOA 2HMKB 5CLKA 1DMNA 1A67A 1TUHA 2K0MA 3BU4A 1BNIA 1V74A 1V57A 2HMNB 3DGMA 3NUVA 1ULJB 4J5GA 2STDA 2ZDJA 1N9EA 2F98A 1UI7A 2LQVA 3EE1A 3NBJA 3MG1A 3WDGB 1K28A 4U13A 2KCDA 1W5ZA 2FNQA 4K1VA 4EV2A 2IYJA 1LXEA 1J2BA 4ZM8A 1B21A 1BRKA 1RJOA 2YFJB 1Q42A 3MKIA 2SBLA 3OX9A 2RGQA 2OOVC 3A76A 3KSPA 5LC6A 3LMLA 1GOYA 2BIRA 1FA3A 1A2VA 3GZRA 4X2HA 5AEUB 2D1WA 2RNTA 5A0OB 3K7CA 3KCHA 1T5YA 4J5KA 4BL3A 4WFOA 3CXC2 3KN4A 1B2SA 3PXMA 1UCIA 6RNTA 4L8OA 5GSPA 1RCKA 2XGNA 3DMCA 4OVMA 3CD63 2CIUA 1GOVA 5JPUA 4HM3B 1GYBA 4NREA 3SYUA 4X2OA 3BB9A 4CDLA 5KP4A 3S27A 1HZ1A 2OTJ3 3QK9A 5AIGA 1VQ83 1UW1A 1EQKA 1I3FA 4JRFA 1G96A 1US1A 4RNZA 5IF6A 1TJDA 1Q7HA 2W03A 4AKZA 3F8HA 5IG4A 1W6YA 3OWYA 1W2ZA 1YVSA 3FKAA 3CCM3 1AVKA 3CC73 4N6TA 3MYTA 4FMAA 2O3OA 4FCZA 3OXAA 4HKVB 4HZBB 1NNVA 1R4CA 4OK0A 3J7Yd 1IT7A 3Q2PA 3GAXA 3AMOA 5M1AA 1YGEA 3X3XA 1JKGA 4DKIA 1Q40A 1BRIA 2PZVA 1LNIA 3EX9A 7STDA 4N6NB 3OV4A 1OHPA 1PFPA 1LQGC 3MHEA 1BRSA 2OQEC 2Z7AA 2KF6A 2RCDA 3G6E3 1E97A 3T8NA 1WMNA 4MMYB 1DETA 3DGNA 1OF5B 3HOHA 3CMA3 1RCLA 1Q7Y4 3SEDA 1OPYA 1RGLA 4WYKB 4HM7B 2Y73A 4JF8A 5BU4A 5EVHA 5STDA 3CC23 1JB4A 2J8XB 1WNHA 3CPW2 3D3LA 2RFRA 1U8CB 3S28A 1YIT3 2OTL3 1VQ53 3LOYA 3AHWA 4HM1B 3AGOA 3O8YA 4O8SA 1N9JA 1F8NA 5IEPA 2UUGC 1A90A 2GU1A 4K61A 1RRHA 2MF7A 3PCRA 4HM2B 5IERA 1FGRA 2XGLA 3MWZA 3ER7A 1RDSA 3D4AA 1GY7A 1D6YA 1KWIA 1Z1SA 1AV4A 2C4BA 1U5OA 2IMJA 2P05A 2XR8B 3PGBA 3H3HA 5AYRB 1IVVA 1JB2A 1D6UA 1OF5A 1UGHI 2GU3A 4EBGA 1RLSA 1BRGA 4ORLA 1DE3A 1FZUA 1MOLA 3DUKA 2Z6BA 1BRNL 4WYKA 1IVXA 7RNTA 1S723 1N5HA 3RDEA 5HGRA 3K9MC 1S5AA 2CFLA 1FGQA 4N3VA 2IY2A 1MWTA 3DXOA 3FZWA 4XBYA 3JVCA 3ROBA 4BTXA 1M9GA 4GB5A 1Q814 1JZDA 1IT8A 4HM4B 3X41A 1TIJA 2ML5A 3MG3A 3CCS3 1UUVB 1EKMA 3UB1A 3Q3FA 5D81A 1X1WA 2F86B 4CJNA 5D82A 4I4KA 1VQ73 1B2MA 2CFKA 5RNTA 1C54A 2P09A 3MPHA 3M8CA 5G2GA 1I2EA 1UDII 3EC9A 3EQQB 2MC8A 3URPA 4IT7A 5G1KA 1OHOA 7GSPA 1X1YA 1O7NB 2YX9A 1VQL3 1BGSA 3Q90A 3UL5A 2CC3A 1IU7A 1RN4A 2XRXB 2E2TA 3PZWA 4XDVA 2CG0A 1WMPA 1KD14 3K5TA 3NXJA 3WOEB 2CFDA 3LH4A 1BNRA 4EYCA 1OH0A 1GMRA 1YVBI 5ELJA 3SX1A 4EV5A 3KIIA 3SVAA 1AQZA 1KQS2 1FYSA 2FGTA 5CF2A 2BU4A 2INXA 2GSPA 1FUWA 2BMQB 2UGIA 1DMMA 3ZG0A 6STDA 2GBWB 2GXFA 3FF2A 1BRHA 2KRTA 4J9AA 1CEWI 1IV7A 1BU4A 4RNTA 1VZZA 5AEWB 3GRDA 1B2ZA 4I5QA 3NV0B 2P0MA 4J8TA 1LOXA 3EF8A 4MEIA 3GZYB 1NWWA 2OWPA 1ZGXA 1JBRA 4LZIA 1GD3A 3WR2A 1BNGA 3LTBA 3OWSA 4GSPA 4R9KA 1N8QA 5JBSA 4BL2A 1BSCA 1O7WB 3ECFA 3G0KA 2W56A 4KZ1A 1OGXA 4N6V0 5EQLA 4N6LA 6GSPA 1RMSA 2GEXA 3FG3A 1T3BA 4GHOA 1OHSA 3PYJA 3PS8A 3U1WA 4FMDA 3CPOA 1BSBA 1AVLA 3ALAA 3KSED 1W4NA 3K0ZA 5AIFA 2E2VA 2ZHXB 4R9LA 2BMOB 5IG0A 1VQK3 1FUTA 1GS3A 2OQEA 2HOHA 3NX0A 4O3VA 5HOHA 2WOHA 5BIRA 2C10A 2P38A 3K63A 2YFIB 2AADA
chains in the Genus database with same CATH topology
1LNHA 2JDIH 2BT3A 1HKXA 2W6JH 5IG5A 3DGLA 4IIAA 3CCR3 1M904 3NM2A 4N6MA 2LYXA 2W2CA 3HX8A 4MMZB 2CG1A 5DRVA 3CCQ3 1D6ZA 2CWVA 3B7CA 3F40A 3WODG 1ROVA 2K54A 2Y74A 3UL6A 3F7XA 2QEX3 3LTDA 3WA3A 4L7KA 3JUPA 4BTYA 1W01A 3LXUX 1CQSA 4FCMA 5EEOA 3S29A 1LVNA 1W02A 2HMMB 2YFLB 4HZ9B 1K41A 1EG9B 3HK4A 1JV2B 1QJGA 4HVNA 1QALA 1IV9A 2CH9A 1YJW3 3F8XA 5AI1A 2CKFB 1ISKA 1O7HB 1VQP3 3I0YA 1STDA 3JUOA 4XDWA 3BLZA 3X40A 1ULIB 2XFTA 3CU3A 1FGMA 1ZO2A 3B4OA 1N5PA 3BNEA 1VQO3 1MNLA 2KXGA 3G4S3 1VQ43 1KSIA 4KFDA 1M1K4 3FH1A 1RN7A 3UNLA 1TFOA 3G16A 1IK3A 3I563 1ZX2A 3CCJ3 2CW9A 3F7SA 3V99A 4AKYA 3MG2A 2V1LA 2W04A 3CCL3 2O9UX 1UUWB 1DYUA 1UI8A 3PCSA 5ELUA 1YJ93 4BTWA 2CHCA 3GZXB 2XH9A 3LYGA 4Q53A 4R1KA 1M1XB 4WHAA 3X42A 1RKYA 4RBNA 1YI23 5AYSC 3HIIA 2QGUA 1CYVA 1OUNA 2L4VA 3LZAA 4XM4A 5TGNA 4IPBA 4MJDA 3MSOA 3FG1A 5AIHA 2ZL8A 2ML6A 1NJI4 2B1XB 2XSOB 3F14A 5BXQA 2W9PA 5CF1A 2C11A 3EBTA 1SJWA 3EBYA 4HBRA 4HM6B 1HU9A 2CK3H 1JNQA 1VQN3 3EN8A 3DZLA 2OOVA 3V92A 3NQYA 3VSYA 2IA7A 3KKGA 2WGOA 2XEPA 2HMOB 3S5CA 1W2B2 4AEQA 1NB3I 1IDPA 2Z77A 3JUNA 1DVCA 3FGYA 1W00A 2M7OA 1TU5A 3N54B 1SQWA 5LC7A 3WMDA 1IVUA 4HM0B 1K734 1N8R4 4XBXA 3RGAA 4H61A 5KP1A 1SIHA 4H3UA 2QIYA 4N6UA 3LTCA 4G1MB 4L8PA 1GD4A 4GL6A 4HJLB 3BNDA 3CNMA 3DY5A 4RZMA 5IEOA 3B8LA 4HM5B 3IPTA 4KFEA 1Q864 1QVG2 2D42A 2UX0A 1OCVA 4XBTA 4LGQA 4HM8B 3UJMA 5IW9A 3CNXA 3NHXA 3NM7A 3IJEB 1DVDA 2OCTA 2BO9B 1E3RA 2I9WA 3NV0A 5FGOA 5JPPA 1JN5B 2Q07A 3D9RA 3HZPA 5D83A 3FF0A 2E2UA 5DREA 5BVBA 1FGTA 1QAKA 3AMOB 2GEYA 4LMIA 1JKGB 1DMQA 3LT8A 4R4KA 2CWTA 1Q40B 3FSDA 1O7PB 1NB5I 1WMOA 1GY5A 3TDGA 3NBBA 2BNGA 2F99A 1YJN3 4WWUC 4FCJA 4KVHA 4EXRA 1JB5A 1TFKA 1W6CA 3G713 1VQ63 3U97A 3VF1A 3HIGA 4EC6A 3CCV3 3JUMA 3RGRA 4MMXB 2WOFA 3FLJA 3E99A 2XSHB 3BNCA 4O2HA 5IG3A 1K8A4 3KZTA 3N8BA 2QA43 1AR0A 2JQ5A 1JN5A 3OW22 4RNYA 3QRDA 4K1UA 2RSXA 3JUQA 3EN1B 3GZBA 1IQXA 2CWUA 3Q1CA 4HYZA 3SLUA 3I553 3CME3 2CFGA 1YHQ3 3T8UA 1JJ22 3N9HA 1BUQA 4FR9A 3SOYA 4N6OB 2CFWA 1W7CA 1SPUA 3DM8A 3LT9A 1WQLB 5FW5A 4TX4A 3NQZA 4WP5A 3L0RA 4KFFA 1GY6A 3X3YA 1ASKA 2FXTA 2R4IA 2BMRB 3STDA 3SXXA 3CC43 1C7HA 2B24B 1YIJ3 2GBXB 1OACA 3VGNA 3CCU3 2IUJA 2A15A 1VQM3 1IQ8A 4FMCA 1FGOA 3NBRA 4XB5A 5I97A 4QWTA 2PNCA 2W9QA 4OUQA 1PU4A 1CYUA 1L5GB 3FCSB 1W6GA 2W0QA 1IVWA 2WO0A 3OWUA 4NHFA 3V98A 5KP3A 3GWRA 1QAFA 1K9M4 2Z76A 4O02B 2HMLB 1STFI 3EB8A 3T0UA 1E3VA 3FG4A 2P0XA 1VQ93 1O7GB 3B4PA 1EA2A 2XF3A 3CCE3 4LEHA 5AIIA 4CCVA 3IMAB 3LTAA 4FMBA 3H51A 1QVF2 2XFSA 1NDOB 3WOFB 8CHOA 2BHMA 2HMJB 4PEJA 4R80A 2WGQA 1TP6A 5IENA 1RRLA 1ROAA 3EHCA 1WTHA 3X3ZA 1JRQA 1QMAA 3SOAA 2IUKA 5CK6A 1NU3A 3WA2X 5CXOA 3HI7A 1A2KA 1OGZA 4STDA 1Y4KA 3S67A 3KFQC 3G8ZA 3EJVA 1NO3A 3F9SA 2W56B 3BNBA 4LSOA 3KE7A 1O7MB 1IQYA 1SIIA 1KC84 1Q824 3DGOA 2HMKB 5CLKA 1DMNA 1A67A 1TUHA 2K0MA 1V74A 3DGMA 2HMNB 3NUVA 1ULJB 2STDA 2ZDJA 1N9EA 2F98A 1UI7A 2LQVA 3EE1A 3NBJA 3MG1A 3WDGB 1K28A 4U13A 2KCDA 1W5ZA 2FNQA 4K1VA 4EV2A 1LXEA 1J2BA 4ZM8A 1RJOA 2YFJB 1Q42A 3MKIA 2SBLA 3OX9A 2RGQA 2OOVC 3A76A 3KSPA 5LC6A 3LMLA 1FA3A 1A2VA 3GZRA 4X2HA 5AEUB 2D1WA 5A0OB 3K7CA 1T5YA 3CXC2 4WFOA 3KN4A 3PXMA 4L8OA 2XGNA 3DMCA 4OVMA 3CD63 2CIUA 5JPUA 4HM3B 1GYBA 4NREA 4X2OA 3BB9A 4CDLA 5KP4A 3S27A 2OTJ3 3QK9A 5AIGA 1VQ83 1UW1A 1EQKA 4JRFA 1G96A 1US1A 4RNZA 5IF6A 2W03A 4AKZA 3F8HA 5IG4A 1W6YA 3OWYA 1W2ZA 3FKAA 3CCM3 1AVKA 3CC73 4N6TA 3MYTA 4FMAA 2O3OA 4FCZA 3OXAA 4HKVB 4HZBB 4OK0A 1R4CA 3J7Yd 1IT7A 3Q2PA 3GAXA 3AMOA 3X3XA 1YGEA 1JKGA 1Q40A 2PZVA 3EX9A 7STDA 4N6NB 3OV4A 1OHPA 1PFPA 3MHEA 2OQEC 2Z7AA 2RCDA 3G6E3 1E97A 3T8NA 1WMNA 4MMYB 3DGNA 1OF5B 3CMA3 1Q7Y4 3SEDA 1OPYA 4WYKB 4HM7B 2Y73A 4JF8A 5EVHA 5STDA 3CC23 1JB4A 1WNHA 3CPW2 3D3LA 2RFRA 1U8CB 3S28A 1YIT3 2OTL3 1VQ53 3LOYA 4HM1B 3O8YA 4O8SA 1N9JA 1F8NA 5IEPA 1A90A 2GU1A 4K61A 1RRHA 2MF7A 3PCRA 4HM2B 5IERA 1FGRA 2XGLA 3MWZA 3ER7A 1GY7A 1D6YA 1KWIA 1Z1SA 1AV4A 2IMJA 1U5OA 2XR8B 2P05A 5AYRB 3PGBA 3H3HA 1IVVA 1JB2A 1D6UA 1OF5A 4EBGA 2GU3A 4ORLA 1MOLA 3DUKA 2Z6BA 4WYKA 1IVXA 1S723 1N5HA 3RDEA 5HGRA 3K9MC 1S5AA 2CFLA 1FGQA 4N3VA 3DXOA 3FZWA 4XBYA 3JVCA 3ROBA 4BTXA 1M9GA 4GB5A 1Q814 1IT8A 4HM4B 3X41A 1TIJA 2ML5A 3MG3A 3CCS3 1UUVB 1EKMA 3UB1A 5D81A 2F86B 1VQ73 5D82A 4I4KA 2CFKA 2P09A 3MPHA 3M8CA 5G2GA 3EC9A 3EQQB 2MC8A 4IT7A 1OHOA 1O7NB 2YX9A 1VQL3 3Q90A 3UL5A 2CC3A 1IU7A 2XRXB 2E2TA 3PZWA 4XDVA 2CG0A 1WMPA 1KD14 3K5TA 3NXJA 3WOEB 2CFDA 3LH4A 4EYCA 1OH0A 1YVBI 5ELJA 3SX1A 4EV5A 3KIIA 3SVAA 1KQS2 2FGTA 5CF2A 2INXA 1FUWA 2BMQB 1DMMA 6STDA 2GBWB 2GXFA 3FF2A 2KRTA 4J9AA 1CEWI 1IV7A 1VZZA 5AEWB 3GRDA 3NV0B 2P0MA 4J8TA 1LOXA 3EF8A 4MEIA 3GZYB 1NWWA 2OWPA 4LZIA 1GD3A 3LTBA 3OWSA 4R9KA 1N8QA 5JBSA 1O7WB 3ECFA 3G0KA 2W56A 4KZ1A 1OGXA 4N6V0 5EQLA 4N6LA 2GEXA 3FG3A 1OHSA 3PYJA 3PS8A 3U1WA 4FMDA 3CPOA 1AVLA 3ALAA 3KSED 1W4NA 3K0ZA 5AIFA 2E2VA 4R9LA 2BMOB 5IG0A 1VQK3 1GS3A 2OQEA 3NX0A 4O3VA 2WOHA 2C10A 2P38A 3K63A 2YFIB 4K90B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKX A;  5IG5 A;  4IIA A;  3NM2 A;  2W2C A;  3HX8 A;  5DRV A;  3F40 A;  3B7C A;  2K54 A;  3F7X A;  4L7K A;  3JUP A;  1W01 A;  1CQS A;  4FCM A;  1W02 A;  2HMM B;  2YFL B;  4HZ9 B;  1K41 A;  1EG9 B;  3HK4 A;  1QJG A;  4HVN A;  3F8X A;  5AI1 A;  2CKF B;  1ISK A;  1O7H B;  3I0Y A;  1STD A;  3JUO A;  4XDW A;  3BLZ A;  1ULI B;  3CU3 A;  1ZO2 A;  3B4O A;  3FH1 A;  3UNL A;  3G16 A;  1ZX2 A;  3F7S A;  3MG2 A;  1UUW B;  2CHC A;  3GZX B;  4Q53 A;  3LYG A;  4R1K A;  2QGU A;  1OUN A;  4XM4 A;  3LZA A;  5TGN A;  4MJD A;  3MSO A;  5AIH A;  2B1X B;  2XSO B;  3F14 A;  5BXQ A;  5CF1 A;  3EBT A;  1SJW A;  3EBY A;  4HM6 B;  3EN8 A;  3DZL A;  3VSY A;  3KKG A;  2HMO B;  3S5C A;  1IDP A;  2Z77 A;  3JUN A;  3FGY A;  1W00 A;  3WMD A;  4HM0 B;  4XBX A;  3RGA A;  5KP1 A;  4H3U A;  2QIY A;  4L8P A;  4HJL B;  3CNM A;  4RZM A;  5IEO A;  3B8L A;  4HM5 B;  3IPT A;  2UX0 A;  1OCV A;  4XBT A;  4LGQ A;  4HM8 B;  3UJM A;  3CNX A;  3NHX A;  1E3R A;  2I9W A;  3NV0 A;  5JPP A;  1JN5 B;  3D9R A;  3HZP A;  5D83 A;  3FF0 A;  5DRE A;  5BVB A;  2GEY A;  4LMI A;  1JKG B;  1DMQ A;  1Q40 B;  3FSD A;  1O7P B;  1GY5 A;  2BNG A;  2F99 A;  4WWU C;  4FCJ A;  4KVH A;  1JB5 A;  3JUM A;  3RGR A;  3FLJ A;  3E99 A;  2XSH B;  5IG3 A;  3KZT A;  1AR0 A;  2JQ5 A;  1JN5 A;  4K1U A;  3JUQ A;  3EN1 B;  3GZB A;  3T8U A;  1BUQ A;  3SOY A;  3DM8 A;  1WQL B;  5FW5 A;  4WP5 A;  1GY6 A;  1ASK A;  2R4I A;  2BMR B;  3STD A;  1C7H A;  2B24 B;  2GBX B;  3VGN A;  2A15 A;  3NBR A;  4XB5 A;  4OUQ A;  3OWU A;  5KP3 A;  3GWR A;  2Z76 A;  2HML B;  1E3V A;  1O7G B;  3B4P A;  1EA2 A;  4LEH A;  5AII A;  3H51 A;  1NDO B;  8CHO A;  4PEJ A;  2HMJ B;  1TP6 A;  5IEN A;  3EHC A;  1QMA A;  3SOA A;  5CK6 A;  1NU3 A;  5CXO A;  1A2K A;  1OGZ A;  4STD A;  3G8Z A;  3EJV A;  3F9S A;  3KE7 A;  1O7M B;  2HMK B;  5CLK A;  1DMN A;  1TUH A;  2HMN B;  3NUV A;  1ULJ B;  2STD A;  2F98 A;  3MG1 A;  4U13 A;  4K1V A;  2YFJ B;  1Q42 A;  3MKI A;  3OX9 A;  2RGQ A;  3A76 A;  3KSP A;  3GZR A;  4X2H A;  5AEU B;  3K7C A;  4L8O A;  3DMC A;  4OVM A;  5JPU A;  4HM3 B;  1GYB A;  4X2O A;  3BB9 A;  4CDL A;  5KP4 A;  5AIG A;  5IF6 A;  3F8H A;  5IG4 A;  1W6Y A;  3OWY A;  3FKA A;  3MYT A;  3OXA A;  4HKV B;  4HZB B;  1JKG A;  1Q40 A;  2PZV A;  3EX9 A;  7STD A;  3OV4 A;  1OHP A;  3MHE A;  2Z7A A;  2RCD A;  1E97 A;  3T8N A;  1OF5 B;  3SED A;  1OPY A;  4WYK B;  4HM7 B;  5EVH A;  5STD A;  1JB4 A;  2RFR A;  4HM1 B;  5IEP A;  4HM2 B;  5IER A;  3ER7 A;  1GY7 A;  1Z1S A;  2XR8 B;  2IMJ A;  1U5O A;  3H3H A;  1JB2 A;  1OF5 A;  4ORL A;  3DUK A;  4WYK A;  5HGR A;  1S5A A;  4N3V A;  3DXO A;  3FZW A;  4XBY A;  3ROB A;  4GB5 A;  4HM4 B;  3MG3 A;  1UUV B;  5D81 A;  2F86 B;  5D82 A;  4I4K A;  3M8C A;  5G2G A;  3EC9 A;  3EQQ B;  1OHO A;  1O7N B;  3Q90 A;  2XRX B;  4XDV A;  3NXJ A;  1OH0 A;  5CF2 A;  2INX A;  2BMQ B;  1DMM A;  6STD A;  2GBW B;  2GXF A;  3FF2 A;  4J9A A;  1VZZ A;  5AEW B;  3GRD A;  3NV0 B;  4J8T A;  3EF8 A;  3GZY B;  1NWW A;  2OWP A;  3OWS A;  4R9K A;  1O7W B;  3ECF A;  3G0K A;  1OGX A;  2GEX A;  1OHS A;  3CPO A;  3K0Z A;  5AIF A;  4R9L A;  2BMO B;  5IG0 A;  1GS3 A;  2YFI B; 
#chains in the Genus database with same CATH topology
 1LNH A;  1YNV X;  1CH0 A;  2JDI H;  2BT3 A;  1HKX A;  2W6J H;  5IG5 A;  3DGL A;  4IIA A;  3CCR 3;  1M90 4;  3NM2 A;  4N6M A;  2LYX A;  2W2C A;  3HX8 A;  4MMZ B;  1RGF A;  5DRV A;  2CG1 A;  1BNS A;  3CCQ 3;  1D6Z A;  2CWV A;  3B7C A;  3F40 A;  3WOD G;  1ROV A;  2K54 A;  4EW5 A;  3D5G A;  2Y74 A;  3UL6 A;  3F7X A;  2QEX 3;  1I0X A;  1BSE A;  3LTD A;  3WA3 A;  4L7K A;  3JUP A;  4BTY A;  1W01 A;  3LXU X;  1CQS A;  4FCM A;  5EEO A;  3S29 A;  1LVN A;  1W02 A;  2HMM B;  2YFL B;  4HZ9 B;  1K41 A;  1EG9 B;  1RHL A;  3HK4 A;  1JV2 B;  1QJG A;  4HVN A;  1X1X A;  1QAL A;  1IV9 A;  1Q9E A;  1MWS A;  1HYF A;  2CH9 A;  3F8X A;  5AI1 A;  2CKF B;  1YJW 3;  2RBI A;  1ISK A;  1O7H B;  1VQP 3;  1BRJ A;  3I0Y A;  1STD A;  3JUO A;  4XDW A;  3BLZ A;  3X40 A;  1T2I A;  1ULI B;  4BU4 A;  2XFT A;  3CU3 A;  1FGM A;  1ZO2 A;  3B4O A;  1N5P A;  4HOH A;  3BNE A;  1VQO 3;  1MNL A;  2KXG A;  3G4S 3;  1VQ4 3;  1I8V A;  1KSI A;  4KFD A;  1RTU A;  1M1K 4;  3FH1 A;  1LOW A;  1MWU A;  1RN7 A;  3UNL A;  1TFO A;  3G16 A;  1IK3 A;  3I56 3;  1ZX2 A;  3CCJ 3;  2CW9 A;  3F7S A;  3V99 A;  4AKY A;  3MG2 A;  2V1L A;  2W04 A;  1PY3 A;  3CCL 3;  2O9U X;  4NPB A;  1MGW A;  1UUW B;  1LQM B;  1DYU A;  2H0I A;  1UI8 A;  1EUI C;  3PCS A;  5ELU A;  1YJ9 3;  4BTW A;  3ZG5 A;  2CHC A;  3GZX B;  2XH9 A;  3LYG A;  4Q53 A;  4R1K A;  1M1X B;  4WHA A;  3X42 A;  1RKY A;  4RBN A;  1YI2 3;  1R4Y A;  5AYS C;  3HII A;  2QGU A;  1UCL A;  1CYV A;  1OUN A;  2L4V A;  3LZA A;  4XM4 A;  5TGN A;  4IPB A;  4MJD A;  3MSO A;  3FG1 A;  5AIH A;  2ZL8 A;  2ML6 A;  1NJI 4;  2B1X B;  1RGA A;  2XSO B;  3F14 A;  5BXQ A;  2W9P A;  5CF1 A;  2C11 A;  1YGW A;  3EBT A;  1SJW A;  3EBY A;  1JBT A;  4HBR A;  3ZFZ A;  4HM6 B;  3RNT A;  1HU9 A;  2CK3 H;  1JNQ A;  1VQN 3;  3EN8 A;  3DZL A;  2OOV A;  3V92 A;  3NQY A;  3VSY A;  2IA7 A;  1RGC A;  3KKG A;  2WGO A;  1RSN A;  2HMO B;  2XEP A;  3S5C A;  1W2B 2;  4AEQ A;  1NB3 I;  1IDP A;  1BAO A;  2Z77 A;  3JUN A;  1DVC A;  1LOV A;  3FGY A;  1W00 A;  2M7O A;  1TU5 A;  3N54 B;  4KT3 B;  3AGN A;  1SQW A;  1GMQ A;  5LC7 A;  1UUG B;  3WMD A;  1JBS A;  1IVU A;  9RNT A;  4HM0 B;  1K73 4;  1N8R 4;  4XBX A;  2KAA A;  1MGR A;  1FUS A;  3RGA A;  4H61 A;  5KP1 A;  1SIH A;  4H3U A;  1BUJ A;  2QIY A;  1AY7 A;  4N6U A;  3LTC A;  2CX0 A;  4G1M B;  1BIR A;  4L8P A;  1GD4 A;  2KF5 A;  4GL6 A;  1RN1 A;  4HJL B;  1B2X A;  3BND A;  1G02 A;  3CNM A;  3DY5 A;  4RZM A;  1BOX A;  5IEO A;  3B8L A;  4HM5 B;  3IPT A;  4KFE A;  1LRA A;  1Q86 4;  1QVG 2;  2D42 A;  2UX0 A;  5M18 A;  1MWR A;  5M19 A;  1CYU A;  1OCV A;  4XBT A;  4LGQ A;  4HM8 B;  3UJM A;  5IW9 A;  1BNF A;  3CNX A;  4LYL B;  1UCK A;  3NHX A;  3NM7 A;  3IJE B;  1DVD A;  2OCT A;  2BO9 B;  1I2G A;  3DH2 A;  1E3R A;  4HAA A;  1RGK A;  2I9W A;  3NV0 A;  5FGO A;  1JN5 B;  5JPP A;  2Q07 A;  3D9R A;  3HZP A;  4BIR A;  5D83 A;  3FF0 A;  2E2U A;  5DRE A;  1B3S A;  4CPK A;  5BVB A;  1FGT A;  1QAK A;  2L1S A;  3AMO B;  1X1U A;  2GEY A;  4LMI A;  1JKG B;  1DMQ A;  3LT8 A;  4R4K A;  1Q40 B;  2CWT A;  1TRQ A;  1O7P B;  3FSD A;  1WMO A;  1GY5 A;  3TDG A;  3NBB A;  1UGI A;  2BNG A;  2F99 A;  1YJN 3;  4WWU C;  3GSP A;  4FCJ A;  4KVH A;  4EXR A;  2R41 A;  1JB5 A;  1TFK A;  1W6C A;  5G1L A;  2F56 A;  3G71 3;  1V58 A;  3U97 A;  1VQ6 3;  3VF1 A;  3AHS A;  3HIG A;  1VQQ A;  4EC6 A;  2KF3 A;  3JUM A;  3CCV 3;  3RGR A;  4MMX B;  1UCJ A;  2WOF A;  1BNJ A;  3FLJ A;  3WHO A;  1NB5 I;  3E99 A;  2XSH B;  3BNC A;  4O2H A;  5IG3 A;  1K8A 4;  1GOU A;  3KZT A;  3N8B A;  2QA4 3;  1AR0 A;  2JQ5 A;  1JN5 A;  3OW2 2;  4RNY A;  3QRD A;  2F4Y A;  4K1U A;  2RSX A;  3A5E A;  3EN1 B;  3GZB A;  3JUQ A;  1EEJ A;  1IQX A;  2CWU A;  3Q1C A;  4HYZ A;  3SLU A;  3I55 3;  3CME 3;  1JZO A;  2K3D A;  8RNT A;  1ZS7 A;  2ZA4 A;  1A2P A;  2CFG A;  1TTO A;  2F5W A;  1YHQ 3;  1BSA A;  3T8U A;  1JJ2 2;  1I0V A;  3N9H A;  1TRP A;  1BUQ A;  4FR9 A;  3SOY A;  4N6O B;  2CFW A;  1W7C A;  1SPU A;  3DM8 A;  3LT9 A;  1LOY A;  1B2U A;  1WQL B;  5FW5 A;  4TX4 A;  3NQZ A;  1BAN A;  4WP5 A;  3L0R A;  1G0T A;  1GY6 A;  4KFF A;  3X3Y A;  1ASK A;  2FXT A;  2R4I A;  4ILF A;  1T2H A;  2BMR B;  3STD A;  3SXX A;  3CC4 3;  1C7H A;  2B24 B;  1YIJ 3;  2GBX B;  1OAC A;  3VGN A;  3CCU 3;  2IUJ A;  2A15 A;  1VQM 3;  1IQ8 A;  4FMC A;  3DGY A;  1FGO A;  3NBR A;  4XB5 A;  5I97 A;  1GSP A;  1RGH A;  2PNC A;  2W9Q A;  4OUQ A;  4QWT A;  1L5G B;  1PU4 A;  1RNT A;  3FCS B;  4K90 B;  1W6G A;  1IYY A;  1I2F A;  1SAR A;  2W0Q A;  1IVW A;  1I70 A;  2WO0 A;  3OWU A;  4NHF A;  3V98 A;  1RNB A;  1FW7 A;  5KP3 A;  3GWR A;  1QAF A;  1K9M 4;  2Z76 A;  4O02 B;  2HML B;  1B20 A;  1STF I;  3EB8 A;  3T0U A;  1E3V A;  3FG4 A;  2P0X A;  1VQ9 3;  1O7G B;  3B4P A;  1EA2 A;  2XF3 A;  3CCE 3;  4LEH A;  5AII A;  4CCV A;  1BVI A;  3IMA B;  3LTA A;  4FMB A;  1PYL A;  2AAE A;  3H51 A;  1QVF 2;  2XFS A;  1NDO B;  1B27 A;  3D79 A;  3WOF B;  2SAR A;  1BSD A;  8CHO A;  2BHM A;  2HMJ B;  4PEJ A;  4R80 A;  2CX1 A;  2WGQ A;  1RGG A;  1TP6 A;  1RRL A;  1ROA A;  5IEN A;  3EHC A;  1WTH A;  3X3Z A;  1JRQ A;  1QMA A;  3SOA A;  2IUK A;  5CK6 A;  1NU3 A;  3D5I A;  3WA2 X;  5CXO A;  1I3I A;  3HI7 A;  1A2K A;  1OGZ A;  4STD A;  2KF4 A;  1Y4K A;  3S67 A;  1BNE A;  3KFQ C;  3G8Z A;  2H0G A;  3EJV A;  1GMP A;  1RGE A;  3BIR A;  2H0H A;  1NO3 A;  2F5M A;  3F9S A;  2W56 B;  3BNB A;  4LSO A;  3KE7 A;  1O7M B;  1IQY A;  1SII A;  1KC8 4;  1Q82 4;  3DGO A;  2HMK B;  5CLK A;  1DMN A;  1A67 A;  1TUH A;  2K0M A;  3BU4 A;  1BNI A;  1V74 A;  1V57 A;  2HMN B;  3DGM A;  3NUV A;  1ULJ B;  4J5G A;  2STD A;  2ZDJ A;  1N9E A;  2F98 A;  1UI7 A;  2LQV A;  3EE1 A;  3NBJ A;  3MG1 A;  3WDG B;  1K28 A;  4U13 A;  2KCD A;  1W5Z A;  2FNQ A;  4K1V A;  4EV2 A;  2IYJ A;  1LXE A;  1J2B A;  4ZM8 A;  1B21 A;  1BRK A;  1RJO A;  2YFJ B;  1Q42 A;  3MKI A;  2SBL A;  3OX9 A;  2RGQ A;  2OOV C;  3A76 A;  3KSP A;  5LC6 A;  3LML A;  1GOY A;  2BIR A;  1FA3 A;  1A2V A;  3GZR A;  4X2H A;  5AEU B;  2D1W A;  2RNT A;  5A0O B;  3K7C A;  3KCH A;  1T5Y A;  4J5K A;  4BL3 A;  4WFO A;  3CXC 2;  3KN4 A;  1B2S A;  3PXM A;  1UCI A;  6RNT A;  4L8O A;  5GSP A;  1RCK A;  2XGN A;  3DMC A;  4OVM A;  3CD6 3;  2CIU A;  1GOV A;  5JPU A;  4HM3 B;  1GYB A;  4NRE A;  3SYU A;  4X2O A;  3BB9 A;  4CDL A;  5KP4 A;  3S27 A;  1HZ1 A;  2OTJ 3;  3QK9 A;  5AIG A;  1VQ8 3;  1UW1 A;  1EQK A;  1I3F A;  4JRF A;  1G96 A;  1US1 A;  4RNZ A;  5IF6 A;  1TJD A;  1Q7H A;  2W03 A;  4AKZ A;  3F8H A;  5IG4 A;  1W6Y A;  3OWY A;  1W2Z A;  1YVS A;  3FKA A;  3CCM 3;  1AVK A;  3CC7 3;  4N6T A;  3MYT A;  4FMA A;  2O3O A;  4FCZ A;  3OXA A;  4HKV B;  4HZB B;  1NNV A;  1R4C A;  4OK0 A;  3J7Y d;  1IT7 A;  3Q2P A;  3GAX A;  3AMO A;  5M1A A;  1YGE A;  3X3X A;  1JKG A;  4DKI A;  1Q40 A;  1BRI A;  2PZV A;  1LNI A;  3EX9 A;  7STD A;  4N6N B;  3OV4 A;  1OHP A;  1PFP A;  1LQG C;  3MHE A;  1BRS A;  2OQE C;  2Z7A A;  2KF6 A;  2RCD A;  3G6E 3;  1E97 A;  3T8N A;  1WMN A;  4MMY B;  1DET A;  3DGN A;  1OF5 B;  3HOH A;  3CMA 3;  1RCL A;  1Q7Y 4;  3SED A;  1OPY A;  1RGL A;  4WYK B;  4HM7 B;  2Y73 A;  4JF8 A;  5BU4 A;  5EVH A;  5STD A;  3CC2 3;  1JB4 A;  2J8X B;  1WNH A;  3CPW 2;  3D3L A;  2RFR A;  1U8C B;  3S28 A;  1YIT 3;  2OTL 3;  1VQ5 3;  3LOY A;  3AHW A;  4HM1 B;  3AGO A;  3O8Y A;  4O8S A;  1N9J A;  1F8N A;  5IEP A;  2UUG C;  1A90 A;  2GU1 A;  4K61 A;  1RRH A;  2MF7 A;  3PCR A;  4HM2 B;  5IER A;  1FGR A;  2XGL A;  3MWZ A;  3ER7 A;  1RDS A;  3D4A A;  1GY7 A;  1D6Y A;  1KWI A;  1Z1S A;  1AV4 A;  2C4B A;  1U5O A;  2IMJ A;  2P05 A;  2XR8 B;  3PGB A;  3H3H A;  5AYR B;  1IVV A;  1JB2 A;  1D6U A;  1OF5 A;  1UGH I;  2GU3 A;  4EBG A;  1RLS A;  1BRG A;  4ORL A;  1DE3 A;  1FZU A;  1MOL A;  3DUK A;  2Z6B A;  1BRN L;  4WYK A;  1IVX A;  7RNT A;  1S72 3;  1N5H A;  3RDE A;  5HGR A;  3K9M C;  1S5A A;  2CFL A;  1FGQ A;  4N3V A;  2IY2 A;  1MWT A;  3DXO A;  3FZW A;  4XBY A;  3JVC A;  3ROB A;  4BTX A;  1M9G A;  4GB5 A;  1Q81 4;  1JZD A;  1IT8 A;  4HM4 B;  3X41 A;  1TIJ A;  2ML5 A;  3MG3 A;  3CCS 3;  1UUV B;  1EKM A;  3UB1 A;  3Q3F A;  5D81 A;  1X1W A;  2F86 B;  4CJN A;  5D82 A;  4I4K A;  1VQ7 3;  1B2M A;  2CFK A;  5RNT A;  1C54 A;  2P09 A;  3MPH A;  3M8C A;  5G2G A;  1I2E A;  1UDI I;  3EC9 A;  3EQQ B;  2MC8 A;  3URP A;  4IT7 A;  5G1K A;  1OHO A;  7GSP A;  1X1Y A;  1O7N B;  2YX9 A;  1VQL 3;  1BGS A;  3Q90 A;  3UL5 A;  2CC3 A;  1IU7 A;  1RN4 A;  2XRX B;  2E2T A;  3PZW A;  4XDV A;  2CG0 A;  1WMP A;  1KD1 4;  3K5T A;  3NXJ A;  3WOE B;  2CFD A;  3LH4 A;  1BNR A;  4EYC A;  1OH0 A;  1GMR A;  1YVB I;  5ELJ A;  3SX1 A;  4EV5 A;  3KII A;  3SVA A;  1AQZ A;  1KQS 2;  1FYS A;  2FGT A;  5CF2 A;  2BU4 A;  2INX A;  2GSP A;  1FUW A;  2BMQ B;  2UGI A;  1DMM A;  3ZG0 A;  6STD A;  2GBW B;  2GXF A;  3FF2 A;  1BRH A;  2KRT A;  4J9A A;  1CEW I;  1IV7 A;  1BU4 A;  4RNT A;  1VZZ A;  5AEW B;  3GRD A;  1B2Z A;  4I5Q A;  3NV0 B;  2P0M A;  4J8T A;  1LOX A;  3EF8 A;  4MEI A;  3GZY B;  1NWW A;  2OWP A;  1ZGX A;  1JBR A;  4LZI A;  1GD3 A;  3WR2 A;  1BNG A;  3LTB A;  3OWS A;  4GSP A;  4R9K A;  1N8Q A;  5JBS A;  4BL2 A;  1BSC A;  1O7W B;  3ECF A;  3G0K A;  2W56 A;  4KZ1 A;  1OGX A;  4N6V 0;  5EQL A;  4N6L A;  6GSP A;  1RMS A;  2GEX A;  3FG3 A;  1T3B A;  4GHO A;  1OHS A;  3PYJ A;  3PS8 A;  3U1W A;  4FMD A;  3CPO A;  1BSB A;  1AVL A;  3ALA A;  3KSE D;  1W4N A;  3K0Z A;  5AIF A;  2E2V A;  2ZHX B;  4R9L A;  2BMO B;  5IG0 A;  1VQK 3;  1FUT A;  1GS3 A;  2OQE A;  2HOH A;  3NX0 A;  4O3V A;  5HOH A;  2WOH A;  5BIR A;  2C10 A;  2P38 A;  3K63 A;  2YFI B;  2AAD A; 
#chains in the Genus database with same CATH homology
 1LNH A;  2JDI H;  2BT3 A;  1HKX A;  2W6J H;  5IG5 A;  3DGL A;  4IIA A;  3CCR 3;  1M90 4;  3NM2 A;  4N6M A;  2LYX A;  2W2C A;  3HX8 A;  4MMZ B;  2CG1 A;  5DRV A;  3CCQ 3;  1D6Z A;  2CWV A;  3B7C A;  3F40 A;  3WOD G;  1ROV A;  2K54 A;  2Y74 A;  3UL6 A;  3F7X A;  2QEX 3;  3LTD A;  3WA3 A;  4L7K A;  3JUP A;  4BTY A;  1W01 A;  3LXU X;  1CQS A;  4FCM A;  5EEO A;  3S29 A;  1LVN A;  1W02 A;  2HMM B;  2YFL B;  4HZ9 B;  1K41 A;  1EG9 B;  3HK4 A;  1JV2 B;  1QJG A;  4HVN A;  1QAL A;  1IV9 A;  2CH9 A;  1YJW 3;  3F8X A;  5AI1 A;  2CKF B;  1ISK A;  1O7H B;  1VQP 3;  3I0Y A;  1STD A;  3JUO A;  4XDW A;  3BLZ A;  3X40 A;  1ULI B;  2XFT A;  3CU3 A;  1FGM A;  1ZO2 A;  3B4O A;  1N5P A;  3BNE A;  1VQO 3;  1MNL A;  2KXG A;  3G4S 3;  1VQ4 3;  1KSI A;  4KFD A;  1M1K 4;  3FH1 A;  1RN7 A;  3UNL A;  1TFO A;  3G16 A;  1IK3 A;  3I56 3;  1ZX2 A;  3CCJ 3;  2CW9 A;  3F7S A;  3V99 A;  4AKY A;  3MG2 A;  2V1L A;  2W04 A;  3CCL 3;  2O9U X;  1UUW B;  1DYU A;  1UI8 A;  3PCS A;  5ELU A;  1YJ9 3;  4BTW A;  2CHC A;  3GZX B;  2XH9 A;  3LYG A;  4Q53 A;  4R1K A;  1M1X B;  4WHA A;  3X42 A;  1RKY A;  4RBN A;  1YI2 3;  5AYS C;  3HII A;  2QGU A;  1CYV A;  1OUN A;  2L4V A;  3LZA A;  4XM4 A;  5TGN A;  4IPB A;  4MJD A;  3MSO A;  3FG1 A;  5AIH A;  2ZL8 A;  2ML6 A;  1NJI 4;  2B1X B;  2XSO B;  3F14 A;  5BXQ A;  2W9P A;  5CF1 A;  2C11 A;  3EBT A;  1SJW A;  3EBY A;  4HBR A;  4HM6 B;  1HU9 A;  2CK3 H;  1JNQ A;  1VQN 3;  3EN8 A;  3DZL A;  2OOV A;  3V92 A;  3NQY A;  3VSY A;  2IA7 A;  3KKG A;  2WGO A;  2XEP A;  2HMO B;  3S5C A;  1W2B 2;  4AEQ A;  1NB3 I;  1IDP A;  2Z77 A;  3JUN A;  1DVC A;  3FGY A;  1W00 A;  2M7O A;  1TU5 A;  3N54 B;  1SQW A;  5LC7 A;  3WMD A;  1IVU A;  4HM0 B;  1K73 4;  1N8R 4;  4XBX A;  3RGA A;  4H61 A;  5KP1 A;  1SIH A;  4H3U A;  2QIY A;  4N6U A;  3LTC A;  4G1M B;  4L8P A;  1GD4 A;  4GL6 A;  4HJL B;  3BND A;  3CNM A;  3DY5 A;  4RZM A;  5IEO A;  3B8L A;  4HM5 B;  3IPT A;  4KFE A;  1Q86 4;  1QVG 2;  2D42 A;  2UX0 A;  1OCV A;  4XBT A;  4LGQ A;  4HM8 B;  3UJM A;  5IW9 A;  3CNX A;  3NHX A;  3NM7 A;  3IJE B;  1DVD A;  2OCT A;  2BO9 B;  1E3R A;  2I9W A;  3NV0 A;  5FGO A;  5JPP A;  1JN5 B;  2Q07 A;  3D9R A;  3HZP A;  5D83 A;  3FF0 A;  2E2U A;  5DRE A;  5BVB A;  1FGT A;  1QAK A;  3AMO B;  2GEY A;  4LMI A;  1JKG B;  1DMQ A;  3LT8 A;  4R4K A;  2CWT A;  1Q40 B;  3FSD A;  1O7P B;  1NB5 I;  1WMO A;  1GY5 A;  3TDG A;  3NBB A;  2BNG A;  2F99 A;  1YJN 3;  4WWU C;  4FCJ A;  4KVH A;  4EXR A;  1JB5 A;  1TFK A;  1W6C A;  3G71 3;  1VQ6 3;  3U97 A;  3VF1 A;  3HIG A;  4EC6 A;  3CCV 3;  3JUM A;  3RGR A;  4MMX B;  2WOF A;  3FLJ A;  3E99 A;  2XSH B;  3BNC A;  4O2H A;  5IG3 A;  1K8A 4;  3KZT A;  3N8B A;  2QA4 3;  1AR0 A;  2JQ5 A;  1JN5 A;  3OW2 2;  4RNY A;  3QRD A;  4K1U A;  2RSX A;  3JUQ A;  3EN1 B;  3GZB A;  1IQX A;  2CWU A;  3Q1C A;  4HYZ A;  3SLU A;  3I55 3;  3CME 3;  2CFG A;  1YHQ 3;  3T8U A;  1JJ2 2;  3N9H A;  1BUQ A;  4FR9 A;  3SOY A;  4N6O B;  2CFW A;  1W7C A;  1SPU A;  3DM8 A;  3LT9 A;  1WQL B;  5FW5 A;  4TX4 A;  3NQZ A;  4WP5 A;  3L0R A;  4KFF A;  1GY6 A;  3X3Y A;  1ASK A;  2FXT A;  2R4I A;  2BMR B;  3STD A;  3SXX A;  3CC4 3;  1C7H A;  2B24 B;  1YIJ 3;  2GBX B;  1OAC A;  3VGN A;  3CCU 3;  2IUJ A;  2A15 A;  1VQM 3;  1IQ8 A;  4FMC A;  1FGO A;  3NBR A;  4XB5 A;  5I97 A;  4QWT A;  2PNC A;  2W9Q A;  4OUQ A;  1PU4 A;  1CYU A;  1L5G B;  3FCS B;  1W6G A;  2W0Q A;  1IVW A;  2WO0 A;  3OWU A;  4NHF A;  3V98 A;  5KP3 A;  3GWR A;  1QAF A;  1K9M 4;  2Z76 A;  4O02 B;  2HML B;  1STF I;  3EB8 A;  3T0U A;  1E3V A;  3FG4 A;  2P0X A;  1VQ9 3;  1O7G B;  3B4P A;  1EA2 A;  2XF3 A;  3CCE 3;  4LEH A;  5AII A;  4CCV A;  3IMA B;  3LTA A;  4FMB A;  3H51 A;  1QVF 2;  2XFS A;  1NDO B;  3WOF B;  8CHO A;  2BHM A;  2HMJ B;  4PEJ A;  4R80 A;  2WGQ A;  1TP6 A;  5IEN A;  1RRL A;  1ROA A;  3EHC A;  1WTH A;  3X3Z A;  1JRQ A;  1QMA A;  3SOA A;  2IUK A;  5CK6 A;  1NU3 A;  3WA2 X;  5CXO A;  3HI7 A;  1A2K A;  1OGZ A;  4STD A;  1Y4K A;  3S67 A;  3KFQ C;  3G8Z A;  3EJV A;  1NO3 A;  3F9S A;  2W56 B;  3BNB A;  4LSO A;  3KE7 A;  1O7M B;  1IQY A;  1SII A;  1KC8 4;  1Q82 4;  3DGO A;  2HMK B;  5CLK A;  1DMN A;  1A67 A;  1TUH A;  2K0M A;  1V74 A;  3DGM A;  2HMN B;  3NUV A;  1ULJ B;  2STD A;  2ZDJ A;  1N9E A;  2F98 A;  1UI7 A;  2LQV A;  3EE1 A;  3NBJ A;  3MG1 A;  3WDG B;  1K28 A;  4U13 A;  2KCD A;  1W5Z A;  2FNQ A;  4K1V A;  4EV2 A;  1LXE A;  1J2B A;  4ZM8 A;  1RJO A;  2YFJ B;  1Q42 A;  3MKI A;  2SBL A;  3OX9 A;  2RGQ A;  2OOV C;  3A76 A;  3KSP A;  5LC6 A;  3LML A;  1FA3 A;  1A2V A;  3GZR A;  4X2H A;  5AEU B;  2D1W A;  5A0O B;  3K7C A;  1T5Y A;  3CXC 2;  4WFO A;  3KN4 A;  3PXM A;  4L8O A;  2XGN A;  3DMC A;  4OVM A;  3CD6 3;  2CIU A;  5JPU A;  4HM3 B;  1GYB A;  4NRE A;  4X2O A;  3BB9 A;  4CDL A;  5KP4 A;  3S27 A;  2OTJ 3;  3QK9 A;  5AIG A;  1VQ8 3;  1UW1 A;  1EQK A;  4JRF A;  1G96 A;  1US1 A;  4RNZ A;  5IF6 A;  2W03 A;  4AKZ A;  3F8H A;  5IG4 A;  1W6Y A;  3OWY A;  1W2Z A;  3FKA A;  3CCM 3;  1AVK A;  3CC7 3;  4N6T A;  3MYT A;  4FMA A;  2O3O A;  4FCZ A;  3OXA A;  4HKV B;  4HZB B;  4OK0 A;  1R4C A;  3J7Y d;  1IT7 A;  3Q2P A;  3GAX A;  3AMO A;  3X3X A;  1YGE A;  1JKG A;  1Q40 A;  2PZV A;  3EX9 A;  7STD A;  4N6N B;  3OV4 A;  1OHP A;  1PFP A;  3MHE A;  2OQE C;  2Z7A A;  2RCD A;  3G6E 3;  1E97 A;  3T8N A;  1WMN A;  4MMY B;  3DGN A;  1OF5 B;  3CMA 3;  1Q7Y 4;  3SED A;  1OPY A;  4WYK B;  4HM7 B;  2Y73 A;  4JF8 A;  5EVH A;  5STD A;  3CC2 3;  1JB4 A;  1WNH A;  3CPW 2;  3D3L A;  2RFR A;  1U8C B;  3S28 A;  1YIT 3;  2OTL 3;  1VQ5 3;  3LOY A;  4HM1 B;  3O8Y A;  4O8S A;  1N9J A;  1F8N A;  5IEP A;  1A90 A;  2GU1 A;  4K61 A;  1RRH A;  2MF7 A;  3PCR A;  4HM2 B;  5IER A;  1FGR A;  2XGL A;  3MWZ A;  3ER7 A;  1GY7 A;  1D6Y A;  1KWI A;  1Z1S A;  1AV4 A;  2IMJ A;  1U5O A;  2XR8 B;  2P05 A;  5AYR B;  3PGB A;  3H3H A;  1IVV A;  1JB2 A;  1D6U A;  1OF5 A;  4EBG A;  2GU3 A;  4ORL A;  1MOL A;  3DUK A;  2Z6B A;  4WYK A;  1IVX A;  1S72 3;  1N5H A;  3RDE A;  5HGR A;  3K9M C;  1S5A A;  2CFL A;  1FGQ A;  4N3V A;  3DXO A;  3FZW A;  4XBY A;  3JVC A;  3ROB A;  4BTX A;  1M9G A;  4GB5 A;  1Q81 4;  1IT8 A;  4HM4 B;  3X41 A;  1TIJ A;  2ML5 A;  3MG3 A;  3CCS 3;  1UUV B;  1EKM A;  3UB1 A;  5D81 A;  2F86 B;  1VQ7 3;  5D82 A;  4I4K A;  2CFK A;  2P09 A;  3MPH A;  3M8C A;  5G2G A;  3EC9 A;  3EQQ B;  2MC8 A;  4IT7 A;  1OHO A;  1O7N B;  2YX9 A;  1VQL 3;  3Q90 A;  3UL5 A;  2CC3 A;  1IU7 A;  2XRX B;  2E2T A;  3PZW A;  4XDV A;  2CG0 A;  1WMP A;  1KD1 4;  3K5T A;  3NXJ A;  3WOE B;  2CFD A;  3LH4 A;  4EYC A;  1OH0 A;  1YVB I;  5ELJ A;  3SX1 A;  4EV5 A;  3KII A;  3SVA A;  1KQS 2;  2FGT A;  5CF2 A;  2INX A;  1FUW A;  2BMQ B;  1DMM A;  6STD A;  2GBW B;  2GXF A;  3FF2 A;  2KRT A;  4J9A A;  1CEW I;  1IV7 A;  1VZZ A;  5AEW B;  3GRD A;  3NV0 B;  2P0M A;  4J8T A;  1LOX A;  3EF8 A;  4MEI A;  3GZY B;  1NWW A;  2OWP A;  4LZI A;  1GD3 A;  3LTB A;  3OWS A;  4R9K A;  1N8Q A;  5JBS A;  1O7W B;  3ECF A;  3G0K A;  2W56 A;  4KZ1 A;  1OGX A;  4N6V 0;  5EQL A;  4N6L A;  2GEX A;  3FG3 A;  1OHS A;  3PYJ A;  3PS8 A;  3U1W A;  4FMD A;  3CPO A;  1AVL A;  3ALA A;  3KSE D;  1W4N A;  3K0Z A;  5AIF A;  2E2V A;  4R9L A;  2BMO B;  5IG0 A;  1VQK 3;  1GS3 A;  2OQE A;  3NX0 A;  4O3V A;  2WOH A;  2C10 A;  2P38 A;  3K63 A;  2YFI B;  4K90 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...