3EFSA

Biotin protein ligase from aquifex aeolicus in complex with biotin and atp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
232
structure length
232
Chain Sequence
b'FKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKGRGRLGRKWLSQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 61
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3efsA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3efsA01
4YRTA 3LC0A 4L87A 4H2SA 2CJAA 2ZZEA 2E41A 4C92B 3NENA 4EMHA 2DJZA 4E51A 4YRNA 2FYKA 3HFVA 3BW1A 1N9RA 3A5YA 1NYRA 3RERA 3A32A 5LJ5f 2Q5IA 2ZNJA 3JCMW 4YRMA 3JCMQ 4EX5A 2DTIA 3JB9J 4N0AA 3SWNC 4M78A 3HSBA 3JB9G 4K87A 1J5WA 4OLFA 2RB6A 3TEGA 2K57A 1HC7A 3JCMg 3LSSA 4YP0A 4P71A 2VXEA 4NL3A 4YRFA 4M7AD 2ZIMA 4M7AC 4WI1A 2JN0A 4TQFA 4QVCA 4P74C 3EFRA 3FJPA 3REUA 3RKWA 4YROA 5GAMg 4CS2A 1EIYA 3HY1A 4M7AE 3V7CA 1MGQA 4JUVA 1ASZA 3JCMb 5GMKj 4WJ4A 1B70A 3LSQA 1Z7NA 4XTWA 2DQ0A 3I7FA 1X01A 3V8KA 3HRKA 3IKMB 3M4GA 3UGQA 5LJ3g 4CH5A 5C53B 4M75D 4M75C 5LJ5j 2DEQA 3A74A 2ZT8A 5GMKh 1M8VA 4HWOA 4M78F 4M7DC 4YRRA 3V8LA 2RHQB 4XTXA 3RL6A 1YFTA 4HA8A 4UP7A 1Y96A 4M77G 4M75E 3QUIA 3DSQA 1YCYA 2VC8A 1HK9A 1BBUA 1U1TA 4M7DE 3HXVA 1WPYA 4EMKB 3VQXA 3M4PA 3QTCA 4XTZA 2YLCA 4YRPA 3P8VA 4F7UE 1X55A 4C92G 3JB9F 2ZR3A 4XEMA 4MMKA 4H2YA 3VQWA 4C8QB 2DKGA 2XGTA 5LJ5d 1WQWA 3EFSA 2ZT7A 2ZZFA 1KQ2A 1GGMA 1JRIA 4H2XB 4H2VA 1E1OA 2DXTA 2AKWB 2AMCA 2ZNIA 2EAYA 4X5OA 4P71C 4RQFA 3RESA 1BIAA 3JCMf 5GMKe 3HFZA 5GAN2 3ICAA 3OD1A 1Z7MA 1N9WA 2RHSB 1WLEA 1H4TA 2ZGWA 1QF6A 4M75A 4YDQA 4M77B 4C92A 3HRIA 4M7DA 3MF1A 1BBWA 2DXUA 2ZZGA 3JB9D 4HT8A 1D3BB 3FIFA 5GANg 1LOJA 5LJ5e 1NJ2A 2YLBA 1W66A 1YFRA 2EJFA 4F7UA 4M7AF 3W3SA 2EJGA 1NJ5A 3PZCA 1N9SA 2E10A 4YRIA 1U1SA 1I8FA 4J15A 1USYA 2E1HA 3A31A 5LJ3f 4YRQA 4EMGA 2G4CA 4EMKC 1HXDA 2CJBA 3FB9A 1EVKA 3E9IA 4G85A 5GANh 3VBBA 4NL2A 2DDZA 4Y91A 4YRGA 4HT9A 1SESA 4KR3A 1B76A 3WQZA 1X56A 2ZCEA 1B7YB 1TH7A 2EJ9A 4PJOB 3RIRA 4V2SA 1G51A 4DQ2A 3HXXA 4NCXA 4M75F 1B34B 4C92F 1LYLA 1QE0A 4A54A 5DY9A 2ARUA 3V8JA 4M7DF 3QO8A 3M4QA 5CAIA 1E1TA 1KMNA 3V7RA 3INZA 4TVWA 5HGQA 3TEHB 5GAOr 3NELA 5GAMj 1JJCB 4F7UF 1LJOA 5E3IA 4P75A 4JRKA 1H641 4M77C 3A7AA 2RM4A 3QO5A 5GAN4 3JCMh 4UPAA 2QTXA 2RHQA 2CGHA 3NETA 4DPGA 2ZIOA 4WF2A 5ELNA 4BWAA 3HTZA 4C8QG 3UGTA 5GAN7 4M78B 3BDUA 4YRSA 4M77E 5GAMh 4YREA 4C92D 4C92C 4P73C 4XTVA 4EMKA 5LJ3j 4M7DD 2P0LA 2EL9A 3UFGA 4YCWA 4RCBA 4YRCA 4PG3A 3REXA 1YB3A 3RUXA 3BJUA 4XU2A 2E64A 4K86A 4AH6A 3PCOB 1B8AA 3IALA 3QSUA 4X9DA 2ALYB 5K1XA 5GANf 4ZTZB 3P8YA 3V7SA 4C8QA 4C92E 3A5ZA 2QHSA 1EVLA 3VU3C 4LNSA 4H2XA 4P3NA 1G5HA 5LJ3h 1USYC 3JCMX 2C8MA 3HXYA 3IKLA 5GAN3 3UH0A 1NJ1A 2YHTA 2C7IA 4XTUA 3JB9I 2I2LA 3JCMe 4J6YA 2I4LA 2RHSA 1E22A 1NNHA 3QO3A 1KQ1A 4M77A 1EFWA 4TVAA 3HFNA 3R07A 3SWNB 4YYEA 5GAN6 3KFUA 1D3BA 4XU1A 1I5LA 2P5IA 4H2WA 4HWTA 4P72C 1WQ7A 3GIBA 2CJ9A 3A7UA 2I4OA 5GAOn 1FYFA 4P73A 11ASA 4CH3A 4M7AB 4PJOG 1ATIA 4J5YA 4KR2A 5GAMf 1YFSA 2PMEA 2ZINA 2HNIA 4MMLA 4H2UA 4RDXA 5GMKm 3L4GB 4HWPA 4ZIBA 3MEYA 2QHTA 4P75C 4YCVA 4C8QF 2Q7EA 4UP8A 2DZ9A 4TVYA 5GANj 1PYSB 2ZTGA 1HTTA 4UP9A 1WU7A 3HY0A 1H4SA 2E3CA 2QHUA 4TTVA 2J3LA 1WNLA 3BY7A 4Q6GA 2DVEA 3HXZA 4XTYA 1B7YA 4PJOA 4Q15A 1B34A 4M77F 4M78G 3A7RA 2VXFA 4M75B 2DTOA 4H02A 1ADYA 3JCMV 2DTHA 4M7DB 2ZR2A 3QO7A 4C8QD 3RACA 4C8QC 3RGLA 3JCMP 3TEHA 1JJCA 2IY5B 2Q7HA 4P72A 4J6XA 5GANd 3AHUA 3TUPA 4XU3A 4F7UB 2DU7A 4RCCA 2I4NA 1C0AA 4J6WA 2ARSA 4P3OA 3VQVA 4K88A 2QHVA 4C8QE 5GAOp 4YCUA 3E9HA 2RA2A 2ZT6A 3NEMA 4HWRA 4P3PA 4CH6A 3L1AA 4M77D 4YRJA 5GMKl 3JB9H 2DZCA 1KMMA 5GAOm 1EOVA 3SB2A 1X2HA 5GAN5 3HXWA 1VQZA 4G84A 5C51B 3PCOA 3RKXA 3BFMA 4PJOF 1WYDA 2ALYA 5GANe 3ERRA 2E5AA 3JCMd 1X54A 4O2DA 5GAOq 4RMFA 2DQ3A 2J3MA 4HWSA 2PMFA 4KQEA 5GAMd 1M5Q1 3JCMJ 4X9CA 4M7AG 4HVCA 5K1PA 1EIYB 4BW9A 5LJ5g 1ASYA 1ADJA 1G5IA 3RF1A 2ODRD 1SERA 2ODRC 1NYQA 1RIQA 2Q5HA 2AKWA 1L0WA 1B70B 4TWAA 2RD1A 5KNNA 4YRKA 4NOYA 2FB7A 1EQRA 3SWNA 3HXUA 1JBMA 1I81A 2Q7GA 4PJOD 4PJOC 1NJ6A 2ZT5A 5GAN8 3L2ZA 5I21A 1SETA 4PNOA 4TQDA 4WJ3M 12ASA 5LJ3d 5F5WA 2ARTA 1X2GA 1BIBA 4XU0A 4M7AA 2CIMA 1H4VB 1LNXA 5LJ5h 5GAMe 4PJOE 4H2TA 4ZTUB 3VQYA 2ZXFA 3L4GA 4P74A 4OP0A 3PGGA 5GAOl 2EWNA 4CS3A 4M75G 1Y96B 4XQ3A 1PYSA 3QNEA 4N0AC 4M7DG 3IG2A 4JLIA 4M78D 2Y90A 4M78C 2XTIA 4XEOA 4RQEA 5ELOA 3QHSA 4YRLA 3JCMc 1YGBA 1E24A 4F7UG 1NJ8A 5LJ3e 3P8TA 4JRIA 1I4K1 2I4MA 1SRYA 4QVDA 4EO4A 4M78E 3HFOA 4CS4A 5C52B 1IL2A 2DU5A 3MF2A 3RKYA 2AMCB 4TVAB 4PHCA 1H4QA 3G1ZA 4A53A 2IY5A 4CH4A 1KOGA 3CMQA 2E65A 4YPFA 3HFZB 5GMKi
chains in the Genus database with same CATH superfamily
4YRTA 1VIFA 2CJAA 2ZZEA 2E41A 3NENA 5IT9E 4EMHA 4BDYA 1VQ9T 2PZ1A 2FYKA 3HFVA 1N9RA 1ZUYA 5IHKA 3VRZA 3A32A 2QEXA 1TWBA 5LJ5f 2Q5IA 1SHGA 3JCMW 3SHWA 2DTIA 5CKEA 4N0AA 3BE3A 2PVDB 3CCLT 1QVFA 4M78A 5A0LA 1X75C 1ZLMA 3VUBA 2K57A 4GLKA 3G6ET 4OB1B 1KC8U 1I1JA 4M7AD 1VQ5Q 1RAAB 4D6WA 1G2BA 1PG5B 4TQFA 2FRWA 3CC4A 4QKUA 4E7LA 3FJPA 2DAQA 2H3JA 3RKWA 4KUDK 3OMCA 1U06A 1K8AU 4CS2A 2A08A 2NUPB 1JXMA 3META 1MGQA 1ASZA 3JCMb 3P8DA 2CT4A 1Y57A 1AHJB 1K9AA 4WJ4A 1Z7NA 5FU6C 1YCSB 2DQ0A 2WSCE 3A8HB 5GJVB 4JLGA 1WXUA 3IKMB 2LTOA 3M4GA 3G4ST 2PUOB 3UGQA 5LJ3g 4CH5A 3EHQA 5LJ5j 1Z9ZA 3VUZA 4RTZA 1M8VA 4M78F 4YRRA 2GQVA 1KD1C 3PIOA 3PVLA 1W70A 3QJYA 2HL3A 3CCUQ 4J9EA 3CMAA 2LCSA 4UP7A 2PTKA 4M75E 1YCYA 2DETA 4M7DE 4A4GA 4EMKB 1D0ZA 3VQXA 2RHXA 1JJ2P 3R6NA 2CZ1B 2K5IA 3CCMQ 3JB9F 4J83A 5AT1B 5EC7A 1MHNA 3E2UA 1M9SA 3QZ9B 4L5GA 2LP5A 2RQTA 3UF4A 4FU6A 1E1OA 2ZNIA 2KY9A 3VYHB 2EAYA 2M16A 3RESA 1BIAA 3JCMf 3H0IA 5GAN2 3ICAA 2RHSB 1UDLA 1QF6A 4M75A 4YDQA 3EFOA 3SFMA 2RHIA 2AKKA 4M7DA 2CSIA 2KI7A 2OJ2A 3CXCP 1ZX6A 4ESRA 3FIFA 4DEXA 5GANg 5LJ5e 2CZ6B 2EJFA 3W3SA 2BZ8A 2MIOA 4IUPA 3PZCA 1N9SA 2Y4YA 2E10A 3J7AF 1WJQA 3WVEB 2RHUA 4GLMA 4FL6A 3A31A 4RG2A 2JMCA 2P0PA 1MUZA 4II1A 4EMGA 2G4CA 2P84A 3E9IA 3CCSQ 5GANh 2DDZA 2EGCA 4HT9A 2KXDA 4OMPA 3OY9A 2XHCA 3A8LB 4Q5WA 2NUPA 4M75F 3TSZA 1B34B 3IQLA 2YT6A 4A54A 2KQWA 1M3BA 4M7DF 1LVKA 3QO8A 1KMNA 1E1TA 1VQ8T 5J3BA 2LRQA 2EIFA 2HBPA 1BYMA 3TEHB 3VJPA 1JEGA 5GAMj 1JJCB 1LJOA 1IHVA 2RO0A 4P75A 1X2QA 4Y92A 1H641 4JPBW 4M77C 1NPRA 3VKIA 3A7AA 3QO5A 4PLLA 4Z88A 3PFSA 2CP7A 1AVZC 5ELNA 4C8QG 1PKSA 3EGDB 1K9MR 1UGSB 2OI3A 3BDUA 1B7TA 1NYFA 2O31A 3TQ7P 2M0YA 2KRSA 2X3XD 4EMKA 2DLPA 2E5KA 3M0PA 3UFGA 1RAIB 2HQXA 3REXA 1YB3A 3BJUA 2C06A 4AH6A 4X9DA 2MCNA 5K1XA 3P8YA 2MF2A 3LW5E 4C92E 1WA7A 2YUOA 3VU3C 4LNSA 1ZSGA 1USYC 4RTVA 3IKLA 5GAN3 3UH0A 2QYZA 1NJ1A 4XTUA 2SRCA 5HK3A 1KHIA 1SPKA 2WSEE 3JCMe 1QCNA 2RHSA 1UE9A 1E22A 4OMMA 2MWPA 1VA7A 1D1CA 3CEYA 1ZUUA 2A37A 3OYHA 2JNGA 4MZMA 1I5LA 4C0GA 4QQGA 3TEEA 4RTUA 4B9WA 3A7UA 1CKBA 1M3AA 3PVQA 3VYGA 3OYBA 11ASA 4CH3A 2HAXA 1BBZA 2XKOC 4IUVA 3WVDB 4E7ZA 2PMEA 5IAYA 1K4US 4H2UA 1TU0B 4KT0E 3M0RA 3L4GB 4ZIBA 4UP8A 1BKBA 2DZ9A 2DX1A 3CC7A 2K79A 2ZTGA 1HTTA 1PSFA 4A63B 3C0CA 1VQOQ 1HSQA 5FU6B 4A4FA 4Q6GA 3H6ZA 4PJLA 3HXZA 1YIJA 1E7OA 2E70A 2VVKA 1V29B 2COYA 5IN1A 2MMPA 3QWYA 3CCQQ 1OQKA 2JVVA 1B34A 4A4KA 4M78G 1VQKQ 2EQIA 2JM8A 3A7RA 2VXFA 2DTOA 4FW2A 2DTHA 3RACA 3TEHA 4C8QD 3RGLA 1JJCA 4L6V5 3MHXA 1IGUA 2XG8D 2IY5B 2O4XB 3AHUA 2HZYA 1N8RR 2VYTA 3GLXA 1C0MA 4F7UB 5IXBA 1C0AA 4J6WA 1BB9A 2F2VA 3TVTA 1WIEA 3EGDA 2V8KA 2L3RA 2RJEA 2ZT6A 3X24B 5A0DA 1UJ0A 2DERA 3CCVA 4CH6A 5D7UA 4M77D 1X69A 2EW3A 2KEAA 5IHNA 1QCOA 3Q1JA 5GMKl 1K73C 4BACA 3CCEA 4PFPA 1S72Q 1XNIA 4ELYC 3HXWA 4JS4A 2RQWA 3FEOA 3OS1A 2OAWA 5A2QE 5C51B 1VUBA 3G71A 3BFMA 3ERRA 4PFZA 3JCMd 5KYYB 3RBBB 1YJ9A 3FJ5A 1QKWA 3J81E 1TTHB 4A4HA 3FDRA 5GAMd 1M5Q1 1PCXA 2OTLA 1GBQA 1PRMC 2R57A 5K1PA 4BW9A 5LJ5g 1ADJA 3RF1A 1SERA 2ODRD 3CC7T 3A1PA 2KRNA 2K2VA 2Q5HA 3MO8A 3M54A 4YRKA 1NEGA 4NOYA 1YI2Q 2KAFA 1I81A 2LVMA 2L2PA 3MPUB 4PJOC 1NJ6A 1D09B 2W10A 4BE2A 4R55A 2ZPHB 2DA9A 2JS2A 4WJ3M 1X43A 12ASA 3RMQA 3MEUA 4ATOA 4XU0A 2M0OA 2CIMA 2AZSA 3DLMA 5LJ5h 2DL4A 3VQYA 2NUZA 2ZXFA 3L4GA 5M9OA 2GTOA 4OP0A 4BUGA 1G3TA 1VQPA 1M90U 4CS3A 4M75G 1Y96B 4DBHA 2EKHA 1R77A 1VQLA 1WXBA 4AFQC 5IXFA 1K9MC 1C6VX 3CC2Q 4M7DG 4M78D 1NZ9A 3KBGA 1JB0E 8AT1B 2FRYA 2LQWA 3JCMc 1TUCA 1PRLC 1D0XA 1U3OA 2YUQA 5LJ3e 3ULRB 2LDMA 1WXTA 4QVDA 2QDLA 1C1AA 4EO4A 1YNZA 4QQ6A 1VQ4Q 1VQ7Q 3I56A 4FYXB 3I35A 3PE0A 2DU5A 2AMCB 2KK4A 4TVAB 2J05A 1ZBXA 2IY5A 4J9BA 3MJXA 1ZA1B 3CQTA 3CMQA 2O4XA 3HFZB 1SHFA 3FC3A 2ZPGB 4ORZA 3CMEA 3L2VA 1ACMB 2QQBA 4E51A 1IXDA 1WJSA 3QJ6A 3CBOA 2EQKA 1NYRA 3VS6A 2QQRA 2CUDA 2SEMA 3N5BB 1KD1R 4YRMA 4C0DC 3HPWA 2CT3A 3SWNC 3CCRQ 3PMTA 4PK4A 3HSBA 1OV3A 1JXOA 2EYYA 2RB6A 2LC4A 3TEGA 2O88A 4LUDA 2COZA 3JCMg 5KYYA 2CP5A 4YRFA 2JJ9A 4M7AC 3LGFA 3CCMA 3E9GA 1TG0A 2DRMA 2FZGB 4QVCA 1K8AR 4P74C 3EFRA 3REUA 2JM9A 4KBMB 5GAMg 1SRMA 2HMAA 2X3WD 2RHYA 3V7CA 1M1GA 1VQPT 2QGGA 2CS7A 5GMKj 2BE7D 3I5SA 2HSPA 5I11A 1VQLT 3LSQA 4BI4A 3I7FA 3GPLA 4FSXA 1E6GA 2V26A 2WSFE 1VQMA 1PHTA 2LCCA 2XD0A 5KYNA 2YWWA 1WX6A 3OW2A 5C53B 4M75D 3QDFA 3I55A 1OULA 4IUTA 2ZT8A 4HCBA 2KROA 1PD1A 3V8LA 3I56T 2RHQB 4XTXA 3HTRA 2DL5A 1WJRA 1GFCA 2LNHB 1N8RC 2VUBA 1YFTA 4HA8A 1Y96A 3QUIA 2J7IA 5DLQE 2IVWA 1UHFA 1HK9A 3CMET 4UC4A 2EQJA 1NPPA 3VS4A 1W6XA 3M4PA 3CCSA 3ASKA 3EH1A 1O9SA 4XTZA 4YRPA 4C92G 4OB0B 1K0XA 4MMKA 1U5SA 3VRYA 3VQWA 2X4XA 3LH5A 1MMNA 3A5ZB 1D1BA 3M55A 1KQ2A 1WHHA 2FZCB 2KSSA 2AMCA 2PQWA 2L3QA 3C4SA 4RQFA 2VKNA 4QT7A 1T0JA 5GMKe 2L3PA 3HFZA 4F04B 1Q7YC 1YN8A 1N9WA 3VS3A 2ZGWA 2AT1B 2DE0X 3KFVA 4FIBA 4RTTA 4C0FA 3HRIA 4PJJA 2X4JA 1B3QA 3EG1A 1I5OB 1VQNT 1NJ2A 3CBMA 1MMGA 4JJDA 1YJNA 3NPFA 3OYMA 1OYXA 1U1SA 1I8FA 1X27A 4ZTFA 1USYA 1G8XA 2DPPB 1K1ZA 2DILA 1H3ZA 1UGVA 2FVUA 4FSSA 1Y07A 1RABB 3PMIA 2RJDA 1HXDA 4IKFA 2OX7A 1H92A 3I55T 1EVKA 2EBPA 4G85A 4NL2A 4HVUA 2LJ3A 4YRGA 2F2WA 1UG1A 1SEMA 1W2BA 3DB3A 2J6FA 2DJQA 1Q86U 3WQZA 1YJWQ 4KR3A 2V1QA 2EJ9A 4J9FA 4PJOB 3RR6A 1CSKA 2QXFA 2F2XA 1BK2A 4DQ2A 1KQSA 2EQMA 3ZL7C 2ZAEA 3I5RA 1QE0A 2ARUA 3G7ZA 3R6OA 1VYUA 2AHJB 5CAIA 3M4QA 3V7RA 3INZA 1X6BA 2FEIA 1BU1A 5KYUB 3OQ5A 1PM3A 1NBEB 3VS1A 1K76A 1R0BG 1AEYA 2RM4A 2O2OA 5GAN4 5FU7C 3CPWA 2RHQA 2CGHA 3NETA 2KDSA 1QVPA 4WF2A 8ATCB 2ZIOA 2J06A 3UGTA 5GAN7 2OTJA 2V1RA 4MDWA 1BI2A 1HD3A 3A8OB 1YHQT 4C92D 1M1KU 2ENMA 1RAFB 2EYXA 2EL9A 4RCBA 1I07A 3ZEHA 4PG3A 2X4YA 1WI7A 2E64A 1VQOA 4FW1A 3QSUA 3M56A 4KUIA 5FWCA 3V7SA 2QK0A 1GCQC 3A5ZA 1YJNT 5CO7A 4ZGEB 2C8MA 2ECZA 2EYWA 5LJ3h 2RK2A 3CCQA 3HXYA 4BE1A 1M2VB 4LXCA 1U8RA 1VQKA 2YHTA 1WHGA 1SG5A 4IIMA 2HQEA 1GFDA 1OU9A 1K8AC 2QEXT 3NMZC 2M51A 3WXMB 3CCJQ 1YITQ 2IG0A 3LGLA 4C0DB 3SEMA 3SWNB 4MZPA 4F16A 1PWTA 2Z0WA 4Y28E 2P5IA 4LDWA 3RNJA 4EDUA 4H2WA 4P72C 2CJ9A 1FWZA 3QIIA 1FYFA 1G83A 1WHMA 3MEVA 4P73A 4M7AB 3CC4T 3VS0A 5GAMf 1YFSA 4MMLA 1K73R 1OZ2A 5GMKm 4RDXA 2EQUA 3OYIA 3X28B 1S72A 4YCVA 2EPDA 5EG2A 4TVYA 1VQ9Q 1OX8A 2BE9B 2E3CA 2BZYA 2IIMA 3QWXX 4J9HA 2J3LA 2LT4A 3BY7A 2OTJT 3MEAA 4CC3A 1AZGB 4PJOA 3CCLQ 1QMCA 2A28A 1Q81R 4GY5A 1HJDA 3G6EQ 4H02A 1WDXA 5KYUA 1NLOC 1R0CB 1ZA2B 3OYEA 2VGNA 4C8QC 2CP3A 3JCMP 3CMAT 1EFNA 2F5TX 3HHTB 2Q7HA 4J6XA 2QQAA 3TUPA 3EG2A 4ZTJA 1MV3A 2ARSA 4P3OA 2A0FB 2VV5A 2QHVA 2J6OA 3E9HA 3H0HA 4YCUA 2HKNA 4C5IA 4CI0C 3OBYA 3L1AA 2XK0A 2KNBB 3JRZA 4J9IA 2KVQG 1EOVA 5D6XA 3SB2A 1YWOA 3M5AA 4ELZC 3G4SQ 2M9UA 3CC2A 4G84A 4ZN1A 2KT8A 5HKCA 2FG0A 2DXCA 4PJOF 2DFUA 5FWBA 3H9NA 4JJNK 3MCAB 2QG9B 2E5AA 4DBFA 1JO8A 2ESWA 3OA6A 4O2DA 3CD6A 2COWA 4HCKA 5J26A 2YRDA 3MP8A 2DQ3A 4HWSA 2PMFA 3HP9A 1M2VA 1AWXA 5D6YA 4AFZC 1VQ4A 1VYVA 4KQEA 3QZ5B 1VQ7A 1RAGB 1UGPB 3JCMJ 1QVGA 4HVCA 1EIYB 1AWOA 4LD6A 2BIVA 2ODRC 4N4GA 2O01E 1FMWA 4TWAA 1UHCA 1OI1A 1EQRA 3SWNA 3OYFA 3EHRA 2NS6A 3QYHB 1QVFP 3NTKA 2G6FX 2DXBA 1SETA 4PNOA 1X2KA 2QI2A 1Z9QA 5F5WA 1XOVA 2PVOB 3ZBDA 3S3MA 1X2GA 1BIBA 4M7AA 1RI9A 3I9QA 4J9CA 4H2TA 5GAMe 4P74A 2ZZDA 3CCRA 1ZBJA 1A0NB 1VQ6A 3PGGA 5GAOl 1IB8A 1FMKA 4N0AC 4QVZA 1QQJA 2DIQA 4M78C 2MAMA 5ELOA 1PD0A 1M27C 2LCLA 2CP0A 1TXQA 2DMOA 3L2UA 2EGAA 4JRQA 3A8MB 3P8TA 4JRIA 1FXXA 3D7SB 5I2MA 2GNCA 4CC4B 4XAXB 5C52B 1QLYA 3MF2A 5FU7B 1YWPA 3RKYA 4WTOB 4D8KA 2GF7A 3RDVA 3G1ZA 4OMNA 4A53A 4PKCC 2DYIA 1NM7A 5CKDA 4DBRA 1KOGA 2P4TA 3NELA 4TVRA 5GMKi 3TU4K 1OPLA 3LC0A 4KH0B 4L87A 4H2SA 3DKMA 2QASA 3CD6T 2D6FA 4QW2A 2DJZA 4O5VA 1WHKA 3QPHA 3BW1A 3GBQA 2JOYA 3A5YA 4DA4A 3E19A 4ZN3A 2JZ2A 3M0TA 1VQ8Q 2NUTB 3QYGB 2JXBA 3JB9J 2X4WA 2XDPA 3JB9G 4K87A 3HL8A 7AT1B 1UJYA 3OSVA 2QA4A 4HKEA 2YUNA 2K5FA 4BI8B 2VXEA 2ZIMA 1HYOA 4VUBA 1T3LA 2V8IA 1G3SA 1NJIR 1Q82R 2GQIA 2RH2A 2JTEA 3C95A 1VQ6T 1EIYA 4PJNA 2HD0A 5FROA 2DF6A 3L42A 2XMFA 4XTWA 5HK0A 1X01A 3OYJA 1Q7YR 3V8KA 5FRNA 4QQDA 1Q81C 4EIKA 2K2MA 3HRKA 4C5HA 1UGQB 1P92A 1N5ZA 4FM4B 1VOMA 1K9MU 2HDAA 4M75C 2DEQA 3A74A 2CSQA 3M4YA 3X25B 4LVKA 4M7DC 4NS5A 4PLIA 3PT9A 4LD9K 3RL6A 2DL8A 1YIJT 4FYYB 1T0HA 4ZNXA 3DSQA 1RLQC 2MPXC 2DVJA 3OW2S 3RMSA 2VC8A 1U1TA 2LQKA 1WPYA 3U23A 5I2SA 3HRSA 1IHWA 4DEYA 3NFCA 2DYBA 3PTAA 3VS7A 4AFSC 4M4ZA 4F7UE 5CCAA 4LUEA 2ZCFB 4H2YA 4C8QB 1WQWA 1YJWA 4RG8A 2ZZFA 5FLXE 3OYYA 1M3CA 2LX7A 4E2FB 1VQ5A 4H2XB 2DXTA 2RQVA 2AKWB 2MOXA 3KXTA 5CKHA 4JS5A 1WYXA 3OS5A 4P71C 3CCVT 1GL5A 2QA4T 1UUEA 1Z7MA 1H8KA 1KHCA 3E9FA 2RJFA 3CCET 2E4HA 4M77B 4OMLA 5KE2A 2FPEA 4BD3A 2KR3A 2K7AA 2DXUA 1BBWA 3OYAA 3G71T 1OX9A 3OMGA 4XK8E 3JB9D 3EGUA 1SKUB 4IUUA 4KGXB 1LOJA 5IH2A 2XICA 1KJWA 1W66A 1YFRA 4F7UA 1YJ9T 3MEWA 4OGCA 4FYVB 1GCQA 1XJWB 1T3SA 4OMOA 1LPLA 5KYXB 5FRMA 4J15A 2CZ0B 1NYGA 2RI3A 2E1HA 2OTLT 4IURA 1QP2A 1GCPA 2RHZA 4C5GA 2KGTA 2GGRA 3CCUA 2RN8A 2CZ7B 1M90C 1W1FA 4LVMA 4RMOA 4EMKC 3TREA 3PIPA 3FB9A 4FCYA 3VBBA 1Q86R 4Y91A 1KC8R 2A8EA 1SESA 1NE8A 2L89A 3UA6A 4AMCA 1WHJA 1B76A 2DEUA 1X56A 2ZCEA 1ZHIA 4LVJA 3RIRA 4V2SA 4IUQA 1G51A 4JJBA 3EG3A 3LH0A 1JJ2A 2DO3A 5AYFA 3VS2A 2VGMA 5DY9A 2FPFA 5L8RE 4LNPA 5CK9A 1N8RU 1QW1A 1YITA 1W2BS 5HGQA 2QQSA 4F7UF 2C0IA 5E3IA 4HVWA 1Y7XA 1KQSS 3JCMh 1VQ5T 4DOVA 2CYZB 4LDVA 1O75A 2HQHA 4JRPA 2A7YA 4FYWB 4M78B 4BY6C 3CC7Q 2K9GA 4YRSA 4M77E 5GAMh 4CC7A 4C92C 4J9GA 4XTVA 4M7DD 4HT4A 4E47A 3FLGA 3M9QA 3CPWS 4YCWA 1OZ3A 1H3HA 1BI0A 3CXCA 1VQ9A 4OVAA 2VASA 2PU9B 2OAUA 3ER0A 3LX7A 3QDRB 1G5VA 3RUXA 1SRLA 4K86A 3PCOB 1B8AA 1VIEA 2ZPBB 2NYSA 2ALYB 3T9NA 1ABQA 3GOXA 4C8QA 4L59A 2PVGB 2GCXA 2RJCA 1EVLA 2QHSA 3HRTA 4H2XA 4P3NA 2AZVA 5KYWB 3CCLA 3JCMX 2KYMA 4J8OA 1QP3A 2K3BA 2C7IA 1XQHA 3JB9I 2GBQA 1X6GA 3M53A 4C0ZA 4CRIA 4J6YA 2I4LA 4BB7A 1NJIC 1Q82C 1NLPC 4KGVB 3CCUT 3HKSA 3QO3A 1KQ1A 1SF9A 3M0UA 4M77A 1OU8A 4TVAA 2QGFB 3S3OA 4GBQA 3QG1A 3R07A 4YYEA 3EG9B 5GAN6 3KFUA 3X20B 2JUFA 1S1NA 5CKFA 1WQ7A 3CCMT 2LT1A 5HCKA 1ATIA 2DIGA 5KYXA 1J3TA 2FO0A 4KR2A 1AT1B 1BI3A 3PNWC 4HWPA 4R56A 1ZSZC 1MMAA 4X34A 2LX9A 2VB6A 4C8QF 3G4SA 3FRNA 2Q7EA 2E12A 5I22A 5KE3A 1DJ7B 4J9DA 1PYSB 2HKQB 4UP9A 1WU7A 3OYNA 1H4SA 1IRXA 3NHNA 1EIFA 2V8JA 1WNLA 1VQMT 4E7JA 1B07A 2I0NA 2AKLA 4Q15A 2XU8A 4B9XA 5L23A 1IGQA 3UDCA 4M77F 4AG2C 1RLPC 1RAEB 3J80E 4M75B 4FT4A 5CIUA 3EFOB 4N4IA 1ADYA 2L0AA 4M7DB 2ZR2A 3MQZA 1Y71A 5GANd 1OPKA 4F17A 2ED1A 3MKDA 4XU3A 2I4NA 4KULA 3EAEA 1KD1U 3O5ZA 2LJ1A 4K88A 1VQPQ 5GAOp 3M0SA 2RA2A 3CCST 4OGEA 3NEMA 4HWRA 1VQLQ 4ME7A 2YRCA 3JAME 2YXYA 1WFWA 5GAOm 2ATCB 2CKKA 4OB3B 5GAN5 1TS9A 2KYBA 1UTIA 3PCOA 4F14A 2ALYA 3L2WA 1EX4A 2KE9A 1G3WA 2FPDA 3H41A 3I56Q 1KG1A 1WLPB 1SSFA 1QWFA 1GRIA 5GAOq 4RMFA 5KYWA 2J3MA 2X51A 4JJCA 3SD4A 2YSQA 5A0GA 2XDBA 4E7HA 4LDUA 3OS2A 2C0OA 1WHLA 3CMEQ 4DOWA 1Q86C 1KC8C 1G5IA 2IPOB 3L2QA 1NYQA 2DBMA 3EGXB 1W4SA 4JZ3A 5FW9A 1B70B 2RD1A 1OOTA 2YDLA 2FB7A 4RTYA 1AD5A 1JBMA 3EG9A 4IIOA 1M4ZA 5GAN8 3L2ZA 1FX7A 5CR2A 1QVGS 5CKBA 4TQDA 1OEBA 2E6ZA 4ANJA 3M0QA 2ROLA 3L2RA 2ARTA 5CQYA 3GF5A 1K0SA 1H4VB 2MYSA 1LNXA 4PJOE 1VQ8A 2KMTA 2EWNA 3VS5A 4XQ3A 1WZOA 2GFAA 1PYSA 3H8ZA 4OMQA 1GBRA 1I0CA 2L8DA 4JLIA 4CC2A 3OYCA 1M1KC 2Y90A 2XTIA 4RQEA 1VQNQ 4YRLA 3TCJA 1YBYA 4J7IA 3QKJA 2D0QB 4PJMA 1E24A 4F7UG 2QTVA 1SRYA 1QKXA 4HCCA 2RPNA 5C0MA 4RKUE 3HFOA 3OW2P 4CS4A 1VQMQ 1IL2A 5KCHA 5IHIA 4PHCA 2JTFA 1GXIE 2J6KA 2R5AA 5D6WA 3I55Q 4CH4A 2EGEA 2RQRA 2JTMA 4BY6B 2K5LA 2KT1A 4LN2A 4RUGA 4FT2A 1X6OA 4C92B 1VYTA 2KXCA 3C12A 2ROTA 4YRNA 2B86A 2K6DA 3S6WA 3LWIA 4O6JA 4LDYA 1VQOT 4PFOA 1YI2A 2R58A 3RERA 1IREB 3F70A 3LYIA 3JSCA 2ZNJA 4HXJA 3JCMQ 4EX5A 3OYDA 2DL3A 4DBQA 3H0FA 5J39A 2D0NA 1V1CA 3CCQT 1VQKT 4N4HA 1J5WA 4OLFA 5ECAA 1HC7A 2K3YA 3LSSA 2HCKA 4P71A 4YP0A 2CUBA 5KH6A 4NL3A 2L3SA 4KGZB 4WI1A 2JN0A 4EPCA 2F5KA 2YRVA 3GNFB 1YHQQ 4LDXA 2E6NA 1D1AA 1JU5C 1IZ6A 4YROA 6AT1B 2D8HA 3HY1A 4M7AE 4JUVA 3EGXA 4A4EA 1E6HA 1B70A 1KSWA 3TSWA 4E7SA 3OB9A 2A3LA 1NEBA 1TOVA 1S72T 1YJNQ 3OYLA 2P0KA 2HL5C 2R5MA 1ZSZB 4PL6A 4JDSA 3KUFA 2PUKB 1YP5A 2D1XA 1AZEA 5GMKh 4LE9A 4HWOA 1WGSA 4Z02A 4JZ4A 2QEXQ 3M57A 4M77G 1W2BP 3AT1B 2ZPFB 2K4YA 2CREA 2LNVA 1TUGB 2XI9A 4P5NA 1BBUA 2MK5A 2BUDA 3HXVA 1AOJA 1KQSP 1M90R 1M1FA 3QTCA 3NTIA 2YLCA 3P8VA 1X55A 1YI2T 2GFUA 3P8BB 4OF1A 2ZR3A 4XEMA 3CC4Q 2DKGA 2XGTA 5LJ5d 2CH4A 4BDZA 4LVLA 3EFSA 2ZT7A 1GGMA 1JRIA 2E3IA 4H2VA 4MZTA 2K3XA 2W0ZA 2E5QA 4X5OA 5GJWB 3CPWP 1PSEA 2XIDA 2EYQA 1EZZB 3OD1A 4RTWA 2X35A 2DNUA 1WLEA 1H4TA 3UA7A 2GTJA 4C92A 2OTJQ 2NLUA 1R8OB 3CC2T 3MF1A 2ZZGA 9ATCB 4HT8A 1D3BB 1RAHB 2YLBA 2ED0A 1K73U 4M7AF 1V76A 3A8GB 2EJGA 2D9TA 4ZGJB 1NJ5A 3CMAQ 4YRIA 1F1BB 1RUWA 1JQQA 2QAZA 5KCOA 1VQ4T 1VQ7T 5LJ3f 4YRQA 2LQ8A 4KH1B 2DD4A 1RACB 1M2OA 2CJBA 4LVIA 2HBWA 2JW4A 3EH2A 1Q81U 1AWJA 1QCFA 2EYZA 2BZXA 2E3HA 5DLOA 4YTLA 2CH4W 2F69A 2FL7A 4Z89A 1B7YB 1TH7A 3GNGA 2D8JA 3HXXA 2CP6A 4NCXA 1UEBA 3OBWA 3NTHA 2C0TA 4C92F 2XDDA 1LYLA 1ZQ1A 2QDYB 3V8JA 2RQUA 1ZUKA 5CQXA 5LL6S 4TVWA 3HRUA 1QWEA 3CCRT 2NWMA 2CP2A 3JV3A 5GAOr 3C94A 3ZFJA 1ZSZA 3GP8A 4JRKA 3LLRA 1JJ2S 4UPAA 2QTXA 3OS0A 3QBYA 2AK5A 4DPGA 1D0YA 1N27A 3HTZA 4BWAA 4AT1B 2Y4XA 1TSFA 1N6AA 1SSHA 4ZGDB 2B8AA 4YREA 1ABOA 2EFIA 3URGA 4P73C 5LJ3j 3DB4A 2P0LA 2EKOA 2L5QA 4YRCA 4AFUC 4R0KA 2DL7A 4XU2A 1M8MA 3CPFA 3IALA 5GANf 4ZTZB 2VWFA 2PNIA 1UECA 1PNJA 3REAB 4J7FA 3OSSC 4Z8AA 1G5HA 2H3EB 3MP1A 3CXCS 2I2LA 3P8HA 2MWOA 1ARKA 1NNHA 2KBTA 1Q95G 1EFWA 3OYKA 1AWWA 2ZPEB 1TUDA 3HFNA 3VV0A 3G1JA 1D3BA 3NGPA 4XU1A 1KIKA 4HWTA 2A36A 4BI3A 3GIBA 1MMDA 1FYNA 4B6MA 2QQ9A 3OYGA 4HCZA 2I4OA 4AG1C 2FZKB 5GAOn 2LJ0A 4PJOG 3ME9A 4J5YA 2ZINA 2HNIA 2ZPIB 2DM1A 3MEYA 2QHTA 4P75C 3CD6Q 1UB4A 5HY6A 2NUTA 1QVGP 5GANj 1NG2A 3HY0A 3BDLA 2HEQA 1KK7A 2DBKA 2WACA 3DLLA 2QHUA 4TTVA 4WCIA 2DVEA 4X1VA 4XTYA 1B7YA 2DRKA 1BCOA 4OB2B 1LCKA 2LZ6B 2KRMA 5DM7R 1BI1A 2CDTA 3JCMV 3QO7A 3UATA 1UFFA 2DD5A 2P4RA 1IO6A 4MDXA 4P72A 4HVVA 2MI6A 2DU7A 4RCCA 4K11A 4BE0A 3CCJA 1VQ6Q 3VQVA 5CVIA 4C8QE 5C6SA 4P3PA 2RI2A 1PC0A 4YRJA 3JB9H 3O8VA 1YJWT 2P0QA 2DZCA 1KMMA 2FHDA 3THKA 4E7IA 1UGRB 1X2HA 1VQZA 1RL2A 1QVFS 1G3YA 2RI5A 3RKXA 3LWHA 1WYDA 1M1KR 3E1SA 1MNDA 5GANe 1VQNA 3REBB 1NJIU 1Q82U 1X54A 1MNEA 1MV0B 3M58A 1RADB 3UPUA 1YIJQ 4D8DA 2G3RA 1Q7YU 4X9CA 4M7AG 4C5EA 1ASYA 2RMOA 3EG0A 2F1LA 4OMFB 2HSEB 3CBPA 3QXEB 1RIQA 2AKWA 2EVRA 1L0WA 5KNNA 3MP6A 3HXUA 2JMAA 2Q7GA 4E7KA 4PJOD 1M30A 2BKDN 3G6EA 2ZT5A 1RI0A 1XTDA 2JS0A 5I21A 2BTTA 3S3NA 1BCMA 2LMJA 5LJ3d 2JT4A 1Y0MA 1PKTA 3UWNA 4ZTUB 3CCVQ 2QA4Q 1KFZA 1CKAA 3CCEQ 3SDZA 4RTXA 2ABLA 4E6RA 2M1HA 2RK1A 3UT1A 3QNEA 3IG2A 3G71Q 2X9HA 4XEOA 3QHSA 3CCJT 1YITT 1YGBA 1YFNA 1YHQA 2YUPA 1YJ9Q 1NJ8A 2AIRB 2I4MA 1I4K1 2H8HA 2RF0A 4KRTA 1FMVA 4M78E 3X26B 3A98A 2OTLQ 2O9SA 2DK3A 1H4QA 2LQNA 3M59A 2RNAA 2O9VA 2E65A 4YPFA 2M02A
chains in the Genus database with same CATH topology
4YRTA 1VIFA 2CJAA 2ZZEA 2E41A 3NENA 5IT9E 4EMHA 4BDYA 1VQ9T 2FYKA 3HFVA 1N9RA 3A32A 2QEXA 5LJ5f 2Q5IA 3JCMW 2DTIA 5CKEA 4N0AA 2PVDB 3CCLT 1QVFA 4M78A 5A0LA 1X75C 3VUBA 2K57A 4GLKA 3G6ET 4OB1B 1KC8U 4M7AD 4D6WA 4TQFA 3CC4A 4E7LA 3FJPA 2DAQA 2H3JA 3RKWA 4KUDK 3OMCA 1K8AU 4CS2A 3META 1MGQA 1ASZA 3JCMb 3P8DA 1AHJB 4WJ4A 1Z7NA 5FU6C 2DQ0A 2WSCE 3A8HB 4JLGA 3IKMB 2LTOA 3M4GA 3G4ST 2PUOB 3UGQA 5LJ3g 4CH5A 5LJ5j 3VUZA 1M8VA 4M78F 4YRRA 2GQVA 1KD1C 3PIOA 3QJYA 3CMAA 4UP7A 4M75E 1YCYA 4M7DE 4A4GA 4EMKB 3VQXA 2RHXA 2CZ1B 2K5IA 3JB9F 4J83A 1MHNA 1M9SA 3QZ9B 4L5GA 4FU6A 1E1OA 2ZNIA 2KY9A 3VYHB 2EAYA 2M16A 3RESA 1BIAA 3JCMf 5GAN2 3ICAA 2RHSB 1QF6A 4M75A 4YDQA 3SFMA 2RHIA 4M7DA 3FIFA 5GANg 5LJ5e 2CZ6B 2EJFA 3W3SA 4IUPA 3PZCA 1N9SA 2Y4YA 2E10A 3J7AF 1WJQA 3WVEB 2RHUA 4FL6A 3A31A 4RG2A 4II1A 2P0PA 4EMGA 2G4CA 3E9IA 5GANh 2DDZA 4HT9A 3OY9A 2XHCA 3A8LB 4Q5WA 4M75F 1B34B 4A54A 2KQWA 4M7DF 3QO8A 1KMNA 1E1TA 1VQ8T 5J3BA 2LRQA 2EIFA 2HBPA 1BYMA 3TEHB 3VJPA 5GAMj 1JJCB 1LJOA 2RO0A 4P75A 1H641 4M77C 3VKIA 1NPRA 3A7AA 3QO5A 4PLLA 3PFSA 5ELNA 4C8QG 1UGSB 3BDUA 4EMKA 3UFGA 2HQXA 3REXA 1YB3A 3BJUA 2C06A 4AH6A 4X9DA 5K1XA 3P8YA 2MF2A 3LW5E 4C92E 3VU3C 4LNSA 1USYC 3IKLA 5GAN3 3UH0A 1NJ1A 4XTUA 5HK3A 1KHIA 2WSEE 3JCMe 2RHSA 1E22A 2MWPA 3CEYA 3OYHA 2JNGA 4MZMA 1I5LA 4C0GA 4QQGA 3TEEA 4B9WA 3A7UA 3VYGA 3OYBA 11ASA 4CH3A 2HAXA 2XKOC 4IUVA 3WVDB 2PMEA 5IAYA 4H2UA 4KT0E 3L4GB 4ZIBA 4UP8A 1BKBA 2DZ9A 3CC7A 2ZTGA 1HTTA 1PSFA 5FU6B 4A4FA 4Q6GA 3H6ZA 3HXZA 1YIJA 2E70A 1V29B 5IN1A 2MMPA 2JVVA 1B34A 4A4KA 4M78G 3A7RA 2VXFA 2DTOA 2DTHA 3RACA 3TEHA 4C8QD 3RGLA 1JJCA 4L6V5 3MHXA 2XG8D 2IY5B 2O4XB 3AHUA 2VYTA 3GLXA 4F7UB 1C0AA 4J6WA 2V8KA 2L3RA 2RJEA 2ZT6A 3X24B 5A0DA 3CCVA 4CH6A 4M77D 3Q1JA 5GMKl 1K73C 4BACA 3CCEA 1XNIA 4ELYC 3HXWA 4JS4A 3FEOA 3OS1A 5A2QE 5C51B 1VUBA 3G71A 3BFMA 3ERRA 3JCMd 1YJ9A 3J81E 4A4HA 3FDRA 5GAMd 1M5Q1 2OTLA 2R57A 5K1PA 4BW9A 5LJ5g 1ADJA 3RF1A 1SERA 2ODRD 3CC7T 2K2VA 2Q5HA 3MO8A 3M54A 4YRKA 4NOYA 2KAFA 1I81A 2LVMA 4PJOC 1NJ6A 4BE2A 4R55A 2ZPHB 4WJ3M 12ASA 3RMQA 3MEUA 4ATOA 4XU0A 2M0OA 2CIMA 3DLMA 5LJ5h 3VQYA 2ZXFA 3L4GA 5M9OA 4OP0A 4BUGA 1G3TA 1VQPA 1M90U 4CS3A 4M75G 1Y96B 1VQLA 1K9MC 4M7DG 4M78D 1NZ9A 3KBGA 1JB0E 3JCMc 5LJ3e 2LDMA 4QVDA 4EO4A 4QQ6A 3I56A 2DU5A 2AMCB 2KK4A 4TVAB 1ZBXA 2IY5A 3CMQA 2O4XA 3HFZB 3FC3A 2ZPGB 3CMEA 3L2VA 2QQBA 4E51A 1WJSA 3QJ6A 3CBOA 2EQKA 1NYRA 2QQRA 3N5BB 4YRMA 4C0DC 3HPWA 3SWNC 3PMTA 3HSBA 2RB6A 2LC4A 3TEGA 3JCMg 4YRFA 4M7AC 3LGFA 3CCMA 3E9GA 4QVCA 4P74C 3EFRA 3REUA 4KBMB 5GAMg 2RHYA 3V7CA 1M1GA 1VQPT 2CS7A 5GMKj 1VQLT 3LSQA 4BI4A 3I7FA 3GPLA 4FSXA 2WSFE 1VQMA 2LCCA 2XD0A 3OW2A 5C53B 4M75D 3I55A 4IUTA 2ZT8A 4HCBA 3I56T 3V8LA 2RHQB 4XTXA 1WJRA 1N8RC 2VUBA 1YFTA 4HA8A 1Y96A 3QUIA 5DLQE 2IVWA 1HK9A 3CMET 4UC4A 2EQJA 1NPPA 3M4PA 3CCSA 3ASKA 1O9SA 4XTZA 4YRPA 4C92G 4OB0B 4MMKA 3VQWA 2X4XA 3A5ZB 3M55A 1KQ2A 2KSSA 2AMCA 2PQWA 3C4SA 4RQFA 5GMKe 3HFZA 1Q7YC 1N9WA 2ZGWA 3HRIA 4FIBA 4C0FA 2X4JA 1VQNT 1NJ2A 3CBMA 1YJNA 3OYMA 1OYXA 1U1SA 1I8FA 4ZTFA 1USYA 2DPPB 1H3ZA 2FVUA 1Y07A 3PMIA 2RJDA 1HXDA 4IKFA 3I55T 1EVKA 4G85A 4NL2A 4YRGA 1W2BA 3DB3A 4KR3A 1Q86U 3WQZA 2EJ9A 4PJOB 2QXFA 4DQ2A 1KQSA 2EQMA 1QE0A 2ARUA 3G7ZA 3R6OA 2AHJB 5CAIA 3M4QA 3V7RA 3INZA 3OQ5A 2RM4A 5GAN4 5FU7C 3CPWA 2RHQA 2CGHA 3NETA 2KDSA 1QVPA 4WF2A 2ZIOA 3UGTA 5GAN7 2OTJA 4MDWA 1BI2A 3A8OB 1YHQT 4C92D 1M1KU 2EL9A 4RCBA 3ZEHA 4PG3A 2X4YA 2E64A 1VQOA 3QSUA 3M56A 4KUIA 3V7SA 3A5ZA 1YJNT 5CO7A 4ZGEB 2C8MA 5LJ3h 3HXYA 2RK2A 3CCQA 4BE1A 1U8RA 1VQKA 2YHTA 2HQEA 1K8AC 2QEXT 3WXMB 2IG0A 3LGLA 4C0DB 3SWNB 4MZPA 4Y28E 2P5IA 4LDWA 4EDUA 4H2WA 4P72C 2CJ9A 1FWZA 3QIIA 1FYFA 3MEVA 4P73A 4M7AB 3CC4T 5GAMf 1YFSA 4MMLA 1OZ2A 5GMKm 4RDXA 2EQUA 3OYIA 3X28B 1S72A 4YCVA 5EG2A 4TVYA 2E3CA 2J3LA 2LT4A 3BY7A 2OTJT 3MEAA 4PJOA 4GY5A 4H02A 3OYEA 2VGNA 4C8QC 3JCMP 3CMAT 2F5TX 3HHTB 2Q7HA 4J6XA 2QQAA 3TUPA 4ZTJA 2ARSA 4P3OA 2VV5A 2QHVA 4YCUA 3E9HA 4C5IA 4CI0C 3OBYA 3L1AA 2XK0A 3JRZA 2KVQG 1EOVA 5D6XA 3SB2A 3M5AA 4ELZC 2M9UA 3CC2A 4G84A 4ZN1A 5HKCA 2DXCA 4PJOF 4JJNK 3MCAB 2E5AA 3OA6A 4O2DA 3CD6A 5J26A 2DQ3A 3MP8A 4HWSA 2PMFA 3HP9A 5D6YA 1VQ4A 4KQEA 3QZ5B 1VQ7A 1UGPB 3JCMJ 1QVGA 4HVCA 1EIYB 4LD6A 2BIVA 2ODRC 4N4GA 2O01E 4TWAA 1OI1A 1EQRA 3SWNA 3OYFA 2NS6A 3QYHB 3NTKA 2DXBA 1SETA 4PNOA 2QI2A 5F5WA 1XOVA 2PVOB 3ZBDA 3S3MA 1X2GA 1BIBA 4M7AA 4H2TA 5GAMe 4P74A 2ZZDA 3CCRA 1VQ6A 3PGGA 5GAOl 4N0AC 4QVZA 2DIQA 4M78C 2MAMA 5ELOA 2LCLA 3L2UA 4JRQA 3A8MB 3P8TA 4JRIA 1FXXA 5I2MA 4XAXB 5C52B 3MF2A 5FU7B 3RKYA 2GF7A 3G1ZA 4A53A 4PKCC 5CKDA 1KOGA 2P4TA 3NELA 5GMKi 4TVRA 3TU4K 3LC0A 4L87A 4H2SA 3DKMA 3CD6T 2D6FA 4QW2A 2DJZA 4O5VA 3QPHA 3BW1A 2JOYA 3A5YA 4DA4A 3E19A 4ZN3A 2JZ2A 3QYGB 3JB9J 2X4WA 2XDPA 3JB9G 4K87A 3HL8A 3OSVA 2QA4A 4HKEA 2K5FA 4BI8B 2VXEA 2ZIMA 4VUBA 2V8IA 1G3SA 2RH2A 3C95A 1VQ6T 1EIYA 2HD0A 5FROA 3L42A 4XTWA 5HK0A 1X01A 3OYJA 5FRNA 3V8KA 4QQDA 1Q81C 3HRKA 4C5HA 1UGQB 1P92A 4FM4B 1K9MU 4M75C 2DEQA 3A74A 3M4YA 3X25B 4LVKA 4M7DC 4NS5A 4PLIA 3PT9A 4LD9K 3RL6A 1YIJT 3DSQA 3OW2S 3RMSA 2VC8A 1U1TA 2LQKA 1WPYA 5I2SA 3HRSA 3NFCA 3PTAA 4F7UE 5CCAA 2ZCFB 4H2YA 4C8QB 1WQWA 1YJWA 4RG8A 2ZZFA 5FLXE 3OYYA 4H2XB 1VQ5A 2DXTA 2AKWB 3KXTA 5CKHA 4JS5A 3OS5A 4P71C 3CCVT 2QA4T 1Z7MA 1KHCA 3E9FA 2RJFA 3CCET 4M77B 5KE2A 4BD3A 1BBWA 2DXUA 3OYAA 3G71T 3OMGA 4XK8E 3JB9D 4IUUA 1LOJA 2XICA 1W66A 1YFRA 4F7UA 1YJ9T 3MEWA 4OGCA 5FRMA 4J15A 2CZ0B 2RI3A 2E1HA 2OTLT 4IURA 1QP2A 4C5GA 2RHZA 3CCUA 1M90C 2CZ7B 4LVMA 4RMOA 4EMKC 3TREA 3PIPA 3FB9A 3VBBA 4Y91A 2A8EA 1SESA 1NE8A 2L89A 1B76A 1X56A 2ZCEA 1ZHIA 4LVJA 3RIRA 4V2SA 4IUQA 1G51A 3LH0A 1JJ2A 2DO3A 5AYFA 2VGMA 5DY9A 5L8RE 5CK9A 1N8RU 1QW1A 1YITA 1W2BS 5HGQA 2QQSA 4F7UF 5E3IA 1Y7XA 1KQSS 3JCMh 1VQ5T 4DOVA 2CYZB 4LDVA 1O75A 4JRPA 2A7YA 4M78B 4BY6C 4YRSA 4M77E 5GAMh 4C92C 4XTVA 4M7DD 4HT4A 4E47A 3FLGA 3M9QA 3CPWS 4YCWA 1OZ3A 1BI0A 3CXCA 1VQ9A 4OVAA 2PU9B 2OAUA 3ER0A 3LX7A 3QDRB 1G5VA 3RUXA 4K86A 3PCOB 1B8AA 1VIEA 2ZPBB 2ALYB 3T9NA 3GOXA 4C8QA 4L59A 2PVGB 2GCXA 2RJCA 1EVLA 2QHSA 3HRTA 4H2XA 4P3NA 3CCLA 3JCMX 4J8OA 1QP3A 2C7IA 1XQHA 3JB9I 3M53A 4C0ZA 4CRIA 4J6YA 2I4LA 4BB7A 1NJIC 1Q82C 3CCUT 3HKSA 3QO3A 1KQ1A 4M77A 4TVAA 3S3OA 3QG1A 3R07A 4YYEA 5GAN6 3KFUA 3X20B 2JUFA 5CKFA 1WQ7A 3CCMT 2LT1A 1ATIA 2DIGA 4KR2A 1BI3A 3PNWC 4HWPA 4R56A 4C8QF 4X34A 2LX9A 3G4SA 2Q7EA 3FRNA 2E12A 5KE3A 1DJ7B 1PYSB 4UP9A 1WU7A 3OYNA 1H4SA 1EIFA 2V8JA 1WNLA 1VQMT 4E7JA 4Q15A 2XU8A 4B9XA 3UDCA 4M77F 3J80E 4M75B 4FT4A 5CIUA 4N4IA 1ADYA 4M7DB 2ZR2A 3MQZA 1Y71A 5GANd 4XU3A 2I4NA 4KULA 3EAEA 1KD1U 4K88A 5GAOp 2RA2A 3CCST 4OGEA 3NEMA 4HWRA 4ME7A 3JAME 5GAOm 2CKKA 4OB3B 5GAN5 3PCOA 2ALYA 3L2WA 1G3WA 1KG1A 1SSFA 5GAOq 4RMFA 2J3MA 3SD4A 5A0GA 2XDBA 4E7HA 4LDUA 3OS2A 4DOWA 1Q86C 1KC8C 1G5IA 3L2QA 1NYQA 1W4SA 1B70B 2RD1A 2FB7A 1JBMA 1M4ZA 5GAN8 3L2ZA 1FX7A 5CR2A 1QVGS 5CKBA 4TQDA 2E6ZA 3L2RA 2ARTA 5CQYA 3GF5A 1H4VB 1LNXA 4PJOE 1VQ8A 2KMTA 2EWNA 4XQ3A 2GFAA 1PYSA 3H8ZA 2L8DA 4JLIA 3OYCA 1M1KC 2Y90A 2XTIA 4RQEA 4YRLA 3TCJA 1YBYA 4J7IA 3QKJA 2D0QB 1E24A 4F7UG 1SRYA 4HCCA 5C0MA 4RKUE 3HFOA 4CS4A 1IL2A 5KCHA 4PHCA 2JTFA 1GXIE 2R5AA 5D6WA 4CH4A 2JTMA 4BY6B 2K5LA 4FT2A 1X6OA 4C92B 3C12A 4YRNA 3S6WA 3LWIA 4O6JA 4LDYA 1VQOT 1YI2A 2R58A 3RERA 1IREB 3F70A 3LYIA 3JSCA 2ZNJA 3JCMQ 4EX5A 3OYDA 5J39A 3CCQT 1VQKT 4N4HA 1J5WA 4OLFA 1HC7A 2K3YA 3LSSA 4YP0A 4P71A 5KH6A 4NL3A 4WI1A 2JN0A 4EPCA 2F5KA 2YRVA 3GNFB 4LDXA 2E6NA 1IZ6A 4YROA 3HY1A 4M7AE 4JUVA 4A4EA 1B70A 3OB9A 2A3LA 1S72T 3OYLA 2P0KA 2R5MA 4PL6A 4JDSA 3KUFA 2PUKB 5GMKh 4HWOA 1WGSA 4Z02A 3M57A 4M77G 2ZPFB 2K4YA 2LNVA 2XI9A 4P5NA 1BBUA 2BUDA 3HXVA 1M1FA 3QTCA 3NTIA 2YLCA 3P8VA 1X55A 1YI2T 2GFUA 3P8BB 4OF1A 2ZR3A 4XEMA 2DKGA 2XGTA 5LJ5d 4BDZA 4LVLA 3EFSA 2ZT7A 1GGMA 1JRIA 4H2VA 4MZTA 2K3XA 2E5QA 4X5OA 1PSEA 2XIDA 2EYQA 3OD1A 2X35A 1WLEA 1H4TA 4C92A 2NLUA 1R8OB 3CC2T 3MF1A 2ZZGA 4HT8A 1D3BB 2YLBA 1K73U 4M7AF 3A8GB 2EJGA 2D9TA 4ZGJB 1NJ5A 4YRIA 5KCOA 1VQ4T 1VQ7T 5LJ3f 4YRQA 2LQ8A 2DD4A 2CJBA 4LVIA 1Q81U 5DLOA 4YTLA 2F69A 2FL7A 1B7YB 1TH7A 3GNGA 3HXXA 4NCXA 1UEBA 3OBWA 3NTHA 4C92F 2XDDA 1LYLA 1ZQ1A 2QDYB 3V8JA 5CQXA 5LL6S 4TVWA 3HRUA 3CCRT 5GAOr 3C94A 3ZFJA 3GP8A 4JRKA 3LLRA 1JJ2S 4UPAA 2QTXA 3OS0A 3QBYA 4DPGA 1N27A 4BWAA 3HTZA 2Y4XA 1N6AA 4ZGDB 2B8AA 4YREA 2EFIA 3URGA 4P73C 5LJ3j 3DB4A 2P0LA 2EKOA 2L5QA 4YRCA 4XU2A 3CPFA 3IALA 5GANf 4ZTZB 4J7FA 3OSSC 1G5HA 3MP1A 3CXCS 2I2LA 3P8HA 2MWOA 1NNHA 1EFWA 3OYKA 2ZPEB 3HFNA 3VV0A 1D3BA 4XU1A 4HWTA 4BI3A 3GIBA 2QQ9A 3OYGA 4HCZA 2I4OA 5GAOn 4PJOG 3ME9A 4J5YA 2ZINA 2HNIA 2ZPIB 3MEYA 2QHTA 4P75C 1UB4A 5HY6A 5GANj 3HY0A 3BDLA 2WACA 3DLLA 2QHUA 4TTVA 2DVEA 4XTYA 1B7YA 4OB2B 5DM7R 1BI1A 3JCMV 3QO7A 2DD5A 4MDXA 4P72A 2MI6A 2DU7A 4RCCA 4BE0A 3CCJA 3VQVA 5CVIA 4C8QE 5C6SA 4P3PA 2RI2A 4YRJA 3JB9H 3O8VA 1YJWT 2P0QA 2DZCA 1KMMA 2FHDA 1X2HA 1UGRB 4E7IA 1VQZA 1RL2A 1QVFS 1G3YA 2RI5A 3RKXA 3LWHA 1WYDA 3E1SA 5GANe 1VQNA 1NJIU 1Q82U 1X54A 3M58A 3UPUA 2G3RA 1Q7YU 4X9CA 4M7AG 4C5EA 1ASYA 4OMFB 3CBPA 3QXEB 1RIQA 2AKWA 1L0WA 5KNNA 3MP6A 3HXUA 2Q7GA 4E7KA 4PJOD 2BKDN 3G6EA 2ZT5A 1RI0A 1XTDA 5I21A 3S3NA 5LJ3d 3UWNA 4ZTUB 3SDZA 2M1HA 2RK1A 3UT1A 3QNEA 3IG2A 4XEOA 3QHSA 3CCJT 1YITT 1YGBA 1YHQA 1NJ8A 2I4MA 1I4K1 4M78E 3X26B 2DK3A 1H4QA 3M59A 2E65A 4YPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRT A;  3LC0 A;  4L87 A;  4H2S A;  2CJA A;  2ZZE A;  2E41 A;  4C92 B;  3NEN A;  4EMH A;  2DJZ A;  4E51 A;  4YRN A;  2FYK A;  3HFV A;  3BW1 A;  1N9R A;  3A5Y A;  1NYR A;  3RER A;  3A32 A;  5LJ5 f;  2Q5I A;  2ZNJ A;  3JCM W;  4YRM A;  3JCM Q;  4EX5 A;  2DTI A;  3JB9 J;  4N0A A;  3SWN C;  4M78 A;  3HSB A;  3JB9 G;  4K87 A;  1J5W A;  4OLF A;  2RB6 A;  3TEG A;  2K57 A;  1HC7 A;  3JCM g;  3LSS A;  4YP0 A;  4P71 A;  2VXE A;  4NL3 A;  4YRF A;  4M7A D;  2ZIM A;  4M7A C;  4WI1 A;  2JN0 A;  4TQF A;  4QVC A;  4P74 C;  3EFR A;  3FJP A;  3REU A;  3RKW A;  4YRO A;  5GAM g;  4CS2 A;  1EIY A;  3HY1 A;  4M7A E;  3V7C A;  1MGQ A;  4JUV A;  1ASZ A;  3JCM b;  5GMK j;  4WJ4 A;  1B70 A;  3LSQ A;  1Z7N A;  4XTW A;  2DQ0 A;  3I7F A;  1X01 A;  3V8K A;  3HRK A;  3IKM B;  3M4G A;  3UGQ A;  5LJ3 g;  4CH5 A;  5C53 B;  4M75 D;  4M75 C;  5LJ5 j;  2DEQ A;  3A74 A;  2ZT8 A;  5GMK h;  1M8V A;  4HWO A;  4M78 F;  4M7D C;  4YRR A;  3V8L A;  2RHQ B;  4XTX A;  3RL6 A;  1YFT A;  4HA8 A;  4UP7 A;  1Y96 A;  4M77 G;  4M75 E;  3QUI A;  3DSQ A;  1YCY A;  2VC8 A;  1HK9 A;  1BBU A;  1U1T A;  4M7D E;  3HXV A;  1WPY A;  4EMK B;  3VQX A;  3M4P A;  3QTC A;  4XTZ A;  2YLC A;  4YRP A;  3P8V A;  4F7U E;  1X55 A;  4C92 G;  3JB9 F;  2ZR3 A;  4XEM A;  4MMK A;  4H2Y A;  3VQW A;  4C8Q B;  2DKG A;  2XGT A;  5LJ5 d;  1WQW A;  3EFS A;  2ZT7 A;  2ZZF A;  1KQ2 A;  1GGM A;  1JRI A;  4H2X B;  4H2V A;  1E1O A;  2DXT A;  2AKW B;  2AMC A;  2ZNI A;  2EAY A;  4X5O A;  4P71 C;  4RQF A;  3RES A;  1BIA A;  3JCM f;  5GMK e;  3HFZ A;  5GAN 2;  3ICA A;  3OD1 A;  1Z7M A;  1N9W A;  2RHS B;  1WLE A;  1H4T A;  2ZGW A;  1QF6 A;  4M75 A;  4YDQ A;  4M77 B;  4C92 A;  3HRI A;  4M7D A;  3MF1 A;  1BBW A;  2DXU A;  2ZZG A;  3JB9 D;  4HT8 A;  1D3B B;  3FIF A;  5GAN g;  1LOJ A;  5LJ5 e;  1NJ2 A;  2YLB A;  1W66 A;  1YFR A;  2EJF A;  4F7U A;  4M7A F;  3W3S A;  2EJG A;  1NJ5 A;  3PZC A;  1N9S A;  2E10 A;  4YRI A;  1U1S A;  1I8F A;  4J15 A;  1USY A;  2E1H A;  3A31 A;  5LJ3 f;  4YRQ A;  4EMG A;  2G4C A;  4EMK C;  1HXD A;  2CJB A;  3FB9 A;  1EVK A;  3E9I A;  4G85 A;  5GAN h;  3VBB A;  4NL2 A;  2DDZ A;  4Y91 A;  4YRG A;  4HT9 A;  1SES A;  4KR3 A;  1B76 A;  3WQZ A;  1X56 A;  2ZCE A;  1B7Y B;  1TH7 A;  2EJ9 A;  4PJO B;  3RIR A;  4V2S A;  1G51 A;  4DQ2 A;  3HXX A;  4NCX A;  4M75 F;  1B34 B;  4C92 F;  1LYL A;  1QE0 A;  4A54 A;  5DY9 A;  2ARU A;  3V8J A;  4M7D F;  3QO8 A;  3M4Q A;  5CAI A;  1E1T A;  1KMN A;  3V7R A;  3INZ A;  4TVW A;  5HGQ A;  3TEH B;  5GAO r;  3NEL A;  5GAM j;  1JJC B;  4F7U F;  1LJO A;  5E3I A;  4P75 A;  4JRK A;  1H64 1;  4M77 C;  3A7A A;  2RM4 A;  3QO5 A;  5GAN 4;  3JCM h;  4UPA A;  2QTX A;  2RHQ A;  2CGH A;  3NET A;  4DPG A;  2ZIO A;  4WF2 A;  5ELN A;  4BWA A;  3HTZ A;  4C8Q G;  3UGT A;  5GAN 7;  4M78 B;  3BDU A;  4YRS A;  4M77 E;  5GAM h;  4YRE A;  4C92 D;  4C92 C;  4P73 C;  4XTV A;  4EMK A;  5LJ3 j;  4M7D D;  2P0L A;  2EL9 A;  3UFG A;  4YCW A;  4RCB A;  4YRC A;  4PG3 A;  3REX A;  1YB3 A;  3RUX A;  3BJU A;  4XU2 A;  2E64 A;  4K86 A;  4AH6 A;  3PCO B;  1B8A A;  3IAL A;  3QSU A;  4X9D A;  2ALY B;  5K1X A;  5GAN f;  4ZTZ B;  3P8Y A;  3V7S A;  4C8Q A;  4C92 E;  3A5Z A;  2QHS A;  1EVL A;  3VU3 C;  4LNS A;  4H2X A;  4P3N A;  1G5H A;  5LJ3 h;  1USY C;  3JCM X;  2C8M A;  3HXY A;  3IKL A;  5GAN 3;  3UH0 A;  1NJ1 A;  2YHT A;  2C7I A;  4XTU A;  3JB9 I;  2I2L A;  3JCM e;  4J6Y A;  2I4L A;  2RHS A;  1E22 A;  1NNH A;  3QO3 A;  1KQ1 A;  4M77 A;  1EFW A;  4TVA A;  3HFN A;  3R07 A;  3SWN B;  4YYE A;  5GAN 6;  3KFU A;  1D3B A;  4XU1 A;  1I5L A;  2P5I A;  4H2W A;  4HWT A;  4P72 C;  1WQ7 A;  3GIB A;  2CJ9 A;  3A7U A;  2I4O A;  5GAO n;  1FYF A;  4P73 A;  11AS A;  4CH3 A;  4M7A B;  4PJO G;  1ATI A;  4J5Y A;  4KR2 A;  5GAM f;  1YFS A;  2PME A;  2ZIN A;  2HNI A;  4MML A;  4H2U A;  4RDX A;  5GMK m;  3L4G B;  4HWP A;  4ZIB A;  3MEY A;  2QHT A;  4P75 C;  4YCV A;  4C8Q F;  2Q7E A;  4UP8 A;  2DZ9 A;  4TVY A;  5GAN j;  1PYS B;  2ZTG A;  1HTT A;  4UP9 A;  1WU7 A;  3HY0 A;  1H4S A;  2E3C A;  2QHU A;  4TTV A;  2J3L A;  1WNL A;  3BY7 A;  4Q6G A;  2DVE A;  3HXZ A;  4XTY A;  1B7Y A;  4PJO A;  4Q15 A;  1B34 A;  4M77 F;  4M78 G;  3A7R A;  2VXF A;  4M75 B;  2DTO A;  4H02 A;  1ADY A;  3JCM V;  2DTH A;  4M7D B;  2ZR2 A;  3QO7 A;  4C8Q D;  3RAC A;  4C8Q C;  3RGL A;  3JCM P;  3TEH A;  1JJC A;  2IY5 B;  2Q7H A;  4P72 A;  4J6X A;  5GAN d;  3AHU A;  3TUP A;  4XU3 A;  4F7U B;  2DU7 A;  4RCC A;  2I4N A;  1C0A A;  4J6W A;  2ARS A;  4P3O A;  3VQV A;  4K88 A;  2QHV A;  4C8Q E;  5GAO p;  4YCU A;  3E9H A;  2RA2 A;  2ZT6 A;  3NEM A;  4HWR A;  4P3P A;  4CH6 A;  3L1A A;  4M77 D;  4YRJ A;  5GMK l;  3JB9 H;  2DZC A;  1KMM A;  5GAO m;  1EOV A;  3SB2 A;  1X2H A;  5GAN 5;  3HXW A;  1VQZ A;  4G84 A;  5C51 B;  3PCO A;  3RKX A;  3BFM A;  4PJO F;  1WYD A;  2ALY A;  5GAN e;  3ERR A;  2E5A A;  3JCM d;  1X54 A;  4O2D A;  5GAO q;  4RMF A;  2DQ3 A;  2J3M A;  4HWS A;  2PMF A;  4KQE A;  5GAM d;  1M5Q 1;  3JCM J;  4X9C A;  4M7A G;  4HVC A;  5K1P A;  1EIY B;  4BW9 A;  5LJ5 g;  1ASY A;  1ADJ A;  1G5I A;  3RF1 A;  2ODR D;  1SER A;  2ODR C;  1NYQ A;  1RIQ A;  2Q5H A;  2AKW A;  1L0W A;  1B70 B;  4TWA A;  2RD1 A;  5KNN A;  4YRK A;  4NOY A;  2FB7 A;  1EQR A;  3SWN A;  3HXU A;  1JBM A;  1I81 A;  2Q7G A;  4PJO D;  4PJO C;  1NJ6 A;  2ZT5 A;  5GAN 8;  3L2Z A;  5I21 A;  1SET A;  4PNO A;  4TQD A;  4WJ3 M;  12AS A;  5LJ3 d;  5F5W A;  2ART A;  1X2G A;  1BIB A;  4XU0 A;  4M7A A;  2CIM A;  1H4V B;  1LNX A;  5LJ5 h;  5GAM e;  4PJO E;  4H2T A;  4ZTU B;  3VQY A;  2ZXF A;  3L4G A;  4P74 A;  4OP0 A;  3PGG A;  5GAO l;  2EWN A;  4CS3 A;  4M75 G;  1Y96 B;  4XQ3 A;  1PYS A;  3QNE A;  4N0A C;  4M7D G;  3IG2 A;  4JLI A;  4M78 D;  2Y90 A;  4M78 C;  2XTI A;  4XEO A;  4RQE A;  5ELO A;  3QHS A;  4YRL A;  3JCM c;  1YGB A;  1E24 A;  4F7U G;  1NJ8 A;  5LJ3 e;  3P8T A;  4JRI A;  1I4K 1;  2I4M A;  1SRY A;  4QVD A;  4EO4 A;  4M78 E;  3HFO A;  4CS4 A;  5C52 B;  1IL2 A;  2DU5 A;  3MF2 A;  3RKY A;  2AMC B;  4TVA B;  4PHC A;  1H4Q A;  3G1Z A;  4A53 A;  2IY5 A;  4CH4 A;  1KOG A;  3CMQ A;  2E65 A;  4YPF A;  3HFZ B;  5GMK i; 
#chains in the Genus database with same CATH topology
 4YRT A;  1VIF A;  2CJA A;  2ZZE A;  2E41 A;  3NEN A;  5IT9 E;  4EMH A;  4BDY A;  1VQ9 T;  2PZ1 A;  2FYK A;  3HFV A;  1N9R A;  1ZUY A;  5IHK A;  3VRZ A;  3A32 A;  2QEX A;  1TWB A;  5LJ5 f;  2Q5I A;  1SHG A;  3JCM W;  3SHW A;  2DTI A;  5CKE A;  4N0A A;  3BE3 A;  2PVD B;  3CCL T;  1QVF A;  4M78 A;  5A0L A;  1X75 C;  1ZLM A;  3VUB A;  2K57 A;  4GLK A;  3G6E T;  4OB1 B;  1KC8 U;  1I1J A;  4M7A D;  1VQ5 Q;  1RAA B;  4D6W A;  1G2B A;  1PG5 B;  4TQF A;  2FRW A;  3CC4 A;  4QKU A;  4E7L A;  3FJP A;  2DAQ A;  2H3J A;  3RKW A;  4KUD K;  3OMC A;  1U06 A;  1K8A U;  4CS2 A;  2A08 A;  2NUP B;  1JXM A;  3MET A;  1MGQ A;  1ASZ A;  3JCM b;  3P8D A;  2CT4 A;  1Y57 A;  1AHJ B;  1K9A A;  4WJ4 A;  1Z7N A;  5FU6 C;  1YCS B;  2DQ0 A;  2WSC E;  3A8H B;  5GJV B;  4JLG A;  1WXU A;  3IKM B;  2LTO A;  3M4G A;  3G4S T;  2PUO B;  3UGQ A;  5LJ3 g;  4CH5 A;  3EHQ A;  5LJ5 j;  1Z9Z A;  3VUZ A;  4RTZ A;  1M8V A;  4M78 F;  4YRR A;  2GQV A;  1KD1 C;  3PIO A;  3PVL A;  1W70 A;  3QJY A;  2HL3 A;  3CCU Q;  4J9E A;  3CMA A;  2LCS A;  4UP7 A;  2PTK A;  4M75 E;  1YCY A;  2DET A;  4M7D E;  4A4G A;  4EMK B;  1D0Z A;  3VQX A;  2RHX A;  1JJ2 P;  3R6N A;  2CZ1 B;  2K5I A;  3CCM Q;  3JB9 F;  4J83 A;  5AT1 B;  5EC7 A;  1MHN A;  3E2U A;  1M9S A;  3QZ9 B;  4L5G A;  2LP5 A;  2RQT A;  3UF4 A;  4FU6 A;  1E1O A;  2ZNI A;  2KY9 A;  3VYH B;  2EAY A;  2M16 A;  3RES A;  1BIA A;  3JCM f;  3H0I A;  5GAN 2;  3ICA A;  2RHS B;  1UDL A;  1QF6 A;  4M75 A;  4YDQ A;  3EFO A;  3SFM A;  2RHI A;  2AKK A;  4M7D A;  2CSI A;  2KI7 A;  2OJ2 A;  3CXC P;  1ZX6 A;  4ESR A;  3FIF A;  4DEX A;  5GAN g;  5LJ5 e;  2CZ6 B;  2EJF A;  3W3S A;  2BZ8 A;  2MIO A;  4IUP A;  3PZC A;  1N9S A;  2Y4Y A;  2E10 A;  3J7A F;  1WJQ A;  3WVE B;  2RHU A;  4GLM A;  4FL6 A;  3A31 A;  4RG2 A;  2JMC A;  2P0P A;  1MUZ A;  4II1 A;  4EMG A;  2G4C A;  2P84 A;  3E9I A;  3CCS Q;  5GAN h;  2DDZ A;  2EGC A;  4HT9 A;  2KXD A;  4OMP A;  3OY9 A;  2XHC A;  3A8L B;  4Q5W A;  2NUP A;  4M75 F;  3TSZ A;  1B34 B;  3IQL A;  2YT6 A;  4A54 A;  2KQW A;  1M3B A;  4M7D F;  1LVK A;  3QO8 A;  1KMN A;  1E1T A;  1VQ8 T;  5J3B A;  2LRQ A;  2EIF A;  2HBP A;  1BYM A;  3TEH B;  3VJP A;  1JEG A;  5GAM j;  1JJC B;  1LJO A;  1IHV A;  2RO0 A;  4P75 A;  1X2Q A;  4Y92 A;  1H64 1;  4JPB W;  4M77 C;  1NPR A;  3VKI A;  3A7A A;  3QO5 A;  4PLL A;  4Z88 A;  3PFS A;  2CP7 A;  1AVZ C;  5ELN A;  4C8Q G;  1PKS A;  3EGD B;  1K9M R;  1UGS B;  2OI3 A;  3BDU A;  1B7T A;  1NYF A;  2O31 A;  3TQ7 P;  2M0Y A;  2KRS A;  2X3X D;  4EMK A;  2DLP A;  2E5K A;  3M0P A;  3UFG A;  1RAI B;  2HQX A;  3REX A;  1YB3 A;  3BJU A;  2C06 A;  4AH6 A;  4X9D A;  2MCN A;  5K1X A;  3P8Y A;  2MF2 A;  3LW5 E;  4C92 E;  1WA7 A;  2YUO A;  3VU3 C;  4LNS A;  1ZSG A;  1USY C;  4RTV A;  3IKL A;  5GAN 3;  3UH0 A;  2QYZ A;  1NJ1 A;  4XTU A;  2SRC A;  5HK3 A;  1KHI A;  1SPK A;  2WSE E;  3JCM e;  1QCN A;  2RHS A;  1UE9 A;  1E22 A;  4OMM A;  2MWP A;  1VA7 A;  1D1C A;  3CEY A;  1ZUU A;  2A37 A;  3OYH A;  2JNG A;  4MZM A;  1I5L A;  4C0G A;  4QQG A;  3TEE A;  4RTU A;  4B9W A;  3A7U A;  1CKB A;  1M3A A;  3PVQ A;  3VYG A;  3OYB A;  11AS A;  4CH3 A;  2HAX A;  1BBZ A;  2XKO C;  4IUV A;  3WVD B;  4E7Z A;  2PME A;  5IAY A;  1K4U S;  4H2U A;  1TU0 B;  4KT0 E;  3M0R A;  3L4G B;  4ZIB A;  4UP8 A;  1BKB A;  2DZ9 A;  2DX1 A;  3CC7 A;  2K79 A;  2ZTG A;  1HTT A;  1PSF A;  4A63 B;  3C0C A;  1VQO Q;  1HSQ A;  5FU6 B;  4A4F A;  4Q6G A;  3H6Z A;  4PJL A;  3HXZ A;  1YIJ A;  1E7O A;  2E70 A;  2VVK A;  1V29 B;  2COY A;  5IN1 A;  2MMP A;  3QWY A;  3CCQ Q;  1OQK A;  2JVV A;  1B34 A;  4A4K A;  4M78 G;  1VQK Q;  2EQI A;  2JM8 A;  3A7R A;  2VXF A;  2DTO A;  4FW2 A;  2DTH A;  3RAC A;  3TEH A;  4C8Q D;  3RGL A;  1JJC A;  4L6V 5;  3MHX A;  1IGU A;  2XG8 D;  2IY5 B;  2O4X B;  3AHU A;  2HZY A;  1N8R R;  2VYT A;  3GLX A;  1C0M A;  4F7U B;  5IXB A;  1C0A A;  4J6W A;  1BB9 A;  2F2V A;  3TVT A;  1WIE A;  3EGD A;  2V8K A;  2L3R A;  2RJE A;  2ZT6 A;  3X24 B;  5A0D A;  1UJ0 A;  2DER A;  3CCV A;  4CH6 A;  5D7U A;  4M77 D;  1X69 A;  2EW3 A;  2KEA A;  5IHN A;  1QCO A;  3Q1J A;  5GMK l;  1K73 C;  4BAC A;  3CCE A;  4PFP A;  1S72 Q;  1XNI A;  4ELY C;  3HXW A;  4JS4 A;  2RQW A;  3FEO A;  3OS1 A;  2OAW A;  5A2Q E;  5C51 B;  1VUB A;  3G71 A;  3BFM A;  3ERR A;  4PFZ A;  3JCM d;  5KYY B;  3RBB B;  1YJ9 A;  3FJ5 A;  1QKW A;  3J81 E;  1TTH B;  4A4H A;  3FDR A;  5GAM d;  1M5Q 1;  1PCX A;  2OTL A;  1GBQ A;  1PRM C;  2R57 A;  5K1P A;  4BW9 A;  5LJ5 g;  1ADJ A;  3RF1 A;  1SER A;  2ODR D;  3CC7 T;  3A1P A;  2KRN A;  2K2V A;  2Q5H A;  3MO8 A;  3M54 A;  4YRK A;  1NEG A;  4NOY A;  1YI2 Q;  2KAF A;  1I81 A;  2LVM A;  2L2P A;  3MPU B;  4PJO C;  1NJ6 A;  1D09 B;  2W10 A;  4BE2 A;  4R55 A;  2ZPH B;  2DA9 A;  2JS2 A;  4WJ3 M;  1X43 A;  12AS A;  3RMQ A;  3MEU A;  4ATO A;  4XU0 A;  2M0O A;  2CIM A;  2AZS A;  3DLM A;  5LJ5 h;  2DL4 A;  3VQY A;  2NUZ A;  2ZXF A;  3L4G A;  5M9O A;  2GTO A;  4OP0 A;  4BUG A;  1G3T A;  1VQP A;  1M90 U;  4CS3 A;  4M75 G;  1Y96 B;  4DBH A;  2EKH A;  1R77 A;  1VQL A;  1WXB A;  4AFQ C;  5IXF A;  1K9M C;  1C6V X;  3CC2 Q;  4M7D G;  4M78 D;  1NZ9 A;  3KBG A;  1JB0 E;  8AT1 B;  2FRY A;  2LQW A;  3JCM c;  1TUC A;  1PRL C;  1D0X A;  1U3O A;  2YUQ A;  5LJ3 e;  3ULR B;  2LDM A;  1WXT A;  4QVD A;  2QDL A;  1C1A A;  4EO4 A;  1YNZ A;  4QQ6 A;  1VQ4 Q;  1VQ7 Q;  3I56 A;  4FYX B;  3I35 A;  3PE0 A;  2DU5 A;  2AMC B;  2KK4 A;  4TVA B;  2J05 A;  1ZBX A;  2IY5 A;  4J9B A;  3MJX A;  1ZA1 B;  3CQT A;  3CMQ A;  2O4X A;  3HFZ B;  1SHF A;  3FC3 A;  2ZPG B;  4ORZ A;  3CME A;  3L2V A;  1ACM B;  2QQB A;  4E51 A;  1IXD A;  1WJS A;  3QJ6 A;  3CBO A;  2EQK A;  1NYR A;  3VS6 A;  2QQR A;  2CUD A;  2SEM A;  3N5B B;  1KD1 R;  4YRM A;  4C0D C;  3HPW A;  2CT3 A;  3SWN C;  3CCR Q;  3PMT A;  4PK4 A;  3HSB A;  1OV3 A;  1JXO A;  2EYY A;  2RB6 A;  2LC4 A;  3TEG A;  2O88 A;  4LUD A;  2COZ A;  3JCM g;  5KYY A;  2CP5 A;  4YRF A;  2JJ9 A;  4M7A C;  3LGF A;  3CCM A;  3E9G A;  1TG0 A;  2DRM A;  2FZG B;  4QVC A;  1K8A R;  4P74 C;  3EFR A;  3REU A;  2JM9 A;  4KBM B;  5GAM g;  1SRM A;  2HMA A;  2X3W D;  2RHY A;  3V7C A;  1M1G A;  1VQP T;  2QGG A;  2CS7 A;  5GMK j;  2BE7 D;  3I5S A;  2HSP A;  5I11 A;  1VQL T;  3LSQ A;  4BI4 A;  3I7F A;  3GPL A;  4FSX A;  1E6G A;  2V26 A;  2WSF E;  1VQM A;  1PHT A;  2LCC A;  2XD0 A;  5KYN A;  2YWW A;  1WX6 A;  3OW2 A;  5C53 B;  4M75 D;  3QDF A;  3I55 A;  1OUL A;  4IUT A;  2ZT8 A;  4HCB A;  2KRO A;  1PD1 A;  3V8L A;  3I56 T;  2RHQ B;  4XTX A;  3HTR A;  2DL5 A;  1WJR A;  1GFC A;  2LNH B;  1N8R C;  2VUB A;  1YFT A;  4HA8 A;  1Y96 A;  3QUI A;  2J7I A;  5DLQ E;  2IVW A;  1UHF A;  1HK9 A;  3CME T;  4UC4 A;  2EQJ A;  1NPP A;  3VS4 A;  1W6X A;  3M4P A;  3CCS A;  3ASK A;  3EH1 A;  1O9S A;  4XTZ A;  4YRP A;  4C92 G;  4OB0 B;  1K0X A;  4MMK A;  1U5S A;  3VRY A;  3VQW A;  2X4X A;  3LH5 A;  1MMN A;  3A5Z B;  1D1B A;  3M55 A;  1KQ2 A;  1WHH A;  2FZC B;  2KSS A;  2AMC A;  2PQW A;  2L3Q A;  3C4S A;  4RQF A;  2VKN A;  4QT7 A;  1T0J A;  5GMK e;  2L3P A;  3HFZ A;  4F04 B;  1Q7Y C;  1YN8 A;  1N9W A;  3VS3 A;  2ZGW A;  2AT1 B;  2DE0 X;  3KFV A;  4FIB A;  4RTT A;  4C0F A;  3HRI A;  4PJJ A;  2X4J A;  1B3Q A;  3EG1 A;  1I5O B;  1VQN T;  1NJ2 A;  3CBM A;  1MMG A;  4JJD A;  1YJN A;  3NPF A;  3OYM A;  1OYX A;  1U1S A;  1I8F A;  1X27 A;  4ZTF A;  1USY A;  1G8X A;  2DPP B;  1K1Z A;  2DIL A;  1H3Z A;  1UGV A;  2FVU A;  4FSS A;  1Y07 A;  1RAB B;  3PMI A;  2RJD A;  1HXD A;  4IKF A;  2OX7 A;  1H92 A;  3I55 T;  1EVK A;  2EBP A;  4G85 A;  4NL2 A;  4HVU A;  2LJ3 A;  4YRG A;  2F2W A;  1UG1 A;  1SEM A;  1W2B A;  3DB3 A;  2J6F A;  2DJQ A;  1Q86 U;  3WQZ A;  1YJW Q;  4KR3 A;  2V1Q A;  2EJ9 A;  4J9F A;  4PJO B;  3RR6 A;  1CSK A;  2QXF A;  2F2X A;  1BK2 A;  4DQ2 A;  1KQS A;  2EQM A;  3ZL7 C;  2ZAE A;  3I5R A;  1QE0 A;  2ARU A;  3G7Z A;  3R6O A;  1VYU A;  2AHJ B;  5CAI A;  3M4Q A;  3V7R A;  3INZ A;  1X6B A;  2FEI A;  1BU1 A;  5KYU B;  3OQ5 A;  1PM3 A;  1NBE B;  3VS1 A;  1K76 A;  1R0B G;  1AEY A;  2RM4 A;  2O2O A;  5GAN 4;  5FU7 C;  3CPW A;  2RHQ A;  2CGH A;  3NET A;  2KDS A;  1QVP A;  4WF2 A;  8ATC B;  2ZIO A;  2J06 A;  3UGT A;  5GAN 7;  2OTJ A;  2V1R A;  4MDW A;  1BI2 A;  1HD3 A;  3A8O B;  1YHQ T;  4C92 D;  1M1K U;  2ENM A;  1RAF B;  2EYX A;  2EL9 A;  4RCB A;  1I07 A;  3ZEH A;  4PG3 A;  2X4Y A;  1WI7 A;  2E64 A;  1VQO A;  4FW1 A;  3QSU A;  3M56 A;  4KUI A;  5FWC A;  3V7S A;  2QK0 A;  1GCQ C;  3A5Z A;  1YJN T;  5CO7 A;  4ZGE B;  2C8M A;  2ECZ A;  2EYW A;  5LJ3 h;  2RK2 A;  3CCQ A;  3HXY A;  4BE1 A;  1M2V B;  4LXC A;  1U8R A;  1VQK A;  2YHT A;  1WHG A;  1SG5 A;  4IIM A;  2HQE A;  1GFD A;  1OU9 A;  1K8A C;  2QEX T;  3NMZ C;  2M51 A;  3WXM B;  3CCJ Q;  1YIT Q;  2IG0 A;  3LGL A;  4C0D B;  3SEM A;  3SWN B;  4MZP A;  4F16 A;  1PWT A;  2Z0W A;  4Y28 E;  2P5I A;  4LDW A;  3RNJ A;  4EDU A;  4H2W A;  4P72 C;  2CJ9 A;  1FWZ A;  3QII A;  1FYF A;  1G83 A;  1WHM A;  3MEV A;  4P73 A;  4M7A B;  3CC4 T;  3VS0 A;  5GAM f;  1YFS A;  4MML A;  1K73 R;  1OZ2 A;  5GMK m;  4RDX A;  2EQU A;  3OYI A;  3X28 B;  1S72 A;  4YCV A;  2EPD A;  5EG2 A;  4TVY A;  1VQ9 Q;  1OX8 A;  2BE9 B;  2E3C A;  2BZY A;  2IIM A;  3QWX X;  4J9H A;  2J3L A;  2LT4 A;  3BY7 A;  2OTJ T;  3MEA A;  4CC3 A;  1AZG B;  4PJO A;  3CCL Q;  1QMC A;  2A28 A;  1Q81 R;  4GY5 A;  1HJD A;  3G6E Q;  4H02 A;  1WDX A;  5KYU A;  1NLO C;  1R0C B;  1ZA2 B;  3OYE A;  2VGN A;  4C8Q C;  2CP3 A;  3JCM P;  3CMA T;  1EFN A;  2F5T X;  3HHT B;  2Q7H A;  4J6X A;  2QQA A;  3TUP A;  3EG2 A;  4ZTJ A;  1MV3 A;  2ARS A;  4P3O A;  2A0F B;  2VV5 A;  2QHV A;  2J6O A;  3E9H A;  3H0H A;  4YCU A;  2HKN A;  4C5I A;  4CI0 C;  3OBY A;  3L1A A;  2XK0 A;  2KNB B;  3JRZ A;  4J9I A;  2KVQ G;  1EOV A;  5D6X A;  3SB2 A;  1YWO A;  3M5A A;  4ELZ C;  3G4S Q;  2M9U A;  3CC2 A;  4G84 A;  4ZN1 A;  2KT8 A;  5HKC A;  2FG0 A;  2DXC A;  4PJO F;  2DFU A;  5FWB A;  3H9N A;  4JJN K;  3MCA B;  2QG9 B;  2E5A A;  4DBF A;  1JO8 A;  2ESW A;  3OA6 A;  4O2D A;  3CD6 A;  2COW A;  4HCK A;  5J26 A;  2YRD A;  3MP8 A;  2DQ3 A;  4HWS A;  2PMF A;  3HP9 A;  1M2V A;  1AWX A;  5D6Y A;  4AFZ C;  1VQ4 A;  1VYV A;  4KQE A;  3QZ5 B;  1VQ7 A;  1RAG B;  1UGP B;  3JCM J;  1QVG A;  4HVC A;  1EIY B;  1AWO A;  4LD6 A;  2BIV A;  2ODR C;  4N4G A;  2O01 E;  1FMW A;  4TWA A;  1UHC A;  1OI1 A;  1EQR A;  3SWN A;  3OYF A;  3EHR A;  2NS6 A;  3QYH B;  1QVF P;  3NTK A;  2G6F X;  2DXB A;  1SET A;  4PNO A;  1X2K A;  2QI2 A;  1Z9Q A;  5F5W A;  1XOV A;  2PVO B;  3ZBD A;  3S3M A;  1X2G A;  1BIB A;  4M7A A;  1RI9 A;  3I9Q A;  4J9C A;  4H2T A;  5GAM e;  4P74 A;  2ZZD A;  3CCR A;  1ZBJ A;  1A0N B;  1VQ6 A;  3PGG A;  5GAO l;  1IB8 A;  1FMK A;  4N0A C;  4QVZ A;  1QQJ A;  2DIQ A;  4M78 C;  2MAM A;  5ELO A;  1PD0 A;  1M27 C;  2LCL A;  2CP0 A;  1TXQ A;  2DMO A;  3L2U A;  2EGA A;  4JRQ A;  3A8M B;  3P8T A;  4JRI A;  1FXX A;  3D7S B;  5I2M A;  2GNC A;  4CC4 B;  4XAX B;  5C52 B;  1QLY A;  3MF2 A;  5FU7 B;  1YWP A;  3RKY A;  4WTO B;  4D8K A;  2GF7 A;  3RDV A;  3G1Z A;  4OMN A;  4A53 A;  4PKC C;  2DYI A;  1NM7 A;  5CKD A;  4DBR A;  1KOG A;  2P4T A;  3NEL A;  4TVR A;  5GMK i;  3TU4 K;  1OPL A;  3LC0 A;  4KH0 B;  4L87 A;  4H2S A;  3DKM A;  2QAS A;  3CD6 T;  2D6F A;  4QW2 A;  2DJZ A;  4O5V A;  1WHK A;  3QPH A;  3BW1 A;  3GBQ A;  2JOY A;  3A5Y A;  4DA4 A;  3E19 A;  4ZN3 A;  2JZ2 A;  3M0T A;  1VQ8 Q;  2NUT B;  3QYG B;  2JXB A;  3JB9 J;  2X4W A;  2XDP A;  3JB9 G;  4K87 A;  3HL8 A;  7AT1 B;  1UJY A;  3OSV A;  2QA4 A;  4HKE A;  2YUN A;  2K5F A;  4BI8 B;  2VXE A;  2ZIM A;  1HYO A;  4VUB A;  1T3L A;  2V8I A;  1G3S A;  1NJI R;  1Q82 R;  2GQI A;  2RH2 A;  2JTE A;  3C95 A;  1VQ6 T;  1EIY A;  4PJN A;  2HD0 A;  5FRO A;  2DF6 A;  3L42 A;  2XMF A;  4XTW A;  5HK0 A;  1X01 A;  3OYJ A;  1Q7Y R;  3V8K A;  5FRN A;  4QQD A;  1Q81 C;  4EIK A;  2K2M A;  3HRK A;  4C5H A;  1UGQ B;  1P92 A;  1N5Z A;  4FM4 B;  1VOM A;  1K9M U;  2HDA A;  4M75 C;  2DEQ A;  3A74 A;  2CSQ A;  3M4Y A;  3X25 B;  4LVK A;  4M7D C;  4NS5 A;  4PLI A;  3PT9 A;  4LD9 K;  3RL6 A;  2DL8 A;  1YIJ T;  4FYY B;  1T0H A;  4ZNX A;  3DSQ A;  1RLQ C;  2MPX C;  2DVJ A;  3OW2 S;  3RMS A;  2VC8 A;  1U1T A;  2LQK A;  1WPY A;  3U23 A;  5I2S A;  3HRS A;  1IHW A;  4DEY A;  3NFC A;  2DYB A;  3PTA A;  3VS7 A;  4AFS C;  4M4Z A;  4F7U E;  5CCA A;  4LUE A;  2ZCF B;  4H2Y A;  4C8Q B;  1WQW A;  1YJW A;  4RG8 A;  2ZZF A;  5FLX E;  3OYY A;  1M3C A;  2LX7 A;  4E2F B;  1VQ5 A;  4H2X B;  2DXT A;  2RQV A;  2AKW B;  2MOX A;  3KXT A;  5CKH A;  4JS5 A;  1WYX A;  3OS5 A;  4P71 C;  3CCV T;  1GL5 A;  2QA4 T;  1UUE A;  1Z7M A;  1H8K A;  1KHC A;  3E9F A;  2RJF A;  3CCE T;  2E4H A;  4M77 B;  4OML A;  5KE2 A;  2FPE A;  4BD3 A;  2KR3 A;  2K7A A;  2DXU A;  1BBW A;  3OYA A;  3G71 T;  1OX9 A;  3OMG A;  4XK8 E;  3JB9 D;  3EGU A;  1SKU B;  4IUU A;  4KGX B;  1LOJ A;  5IH2 A;  2XIC A;  1KJW A;  1W66 A;  1YFR A;  4F7U A;  1YJ9 T;  3MEW A;  4OGC A;  4FYV B;  1GCQ A;  1XJW B;  1T3S A;  4OMO A;  1LPL A;  5KYX B;  5FRM A;  4J15 A;  2CZ0 B;  1NYG A;  2RI3 A;  2E1H A;  2OTL T;  4IUR A;  1QP2 A;  1GCP A;  2RHZ A;  4C5G A;  2KGT A;  2GGR A;  3CCU A;  2RN8 A;  2CZ7 B;  1M90 C;  1W1F A;  4LVM A;  4RMO A;  4EMK C;  3TRE A;  3PIP A;  3FB9 A;  4FCY A;  3VBB A;  1Q86 R;  4Y91 A;  1KC8 R;  2A8E A;  1SES A;  1NE8 A;  2L89 A;  3UA6 A;  4AMC A;  1WHJ A;  1B76 A;  2DEU A;  1X56 A;  2ZCE A;  1ZHI A;  4LVJ A;  3RIR A;  4V2S A;  4IUQ A;  1G51 A;  4JJB A;  3EG3 A;  3LH0 A;  1JJ2 A;  2DO3 A;  5AYF A;  3VS2 A;  2VGM A;  5DY9 A;  2FPF A;  5L8R E;  4LNP A;  5CK9 A;  1N8R U;  1QW1 A;  1YIT A;  1W2B S;  5HGQ A;  2QQS A;  4F7U F;  2C0I A;  5E3I A;  4HVW A;  1Y7X A;  1KQS S;  3JCM h;  1VQ5 T;  4DOV A;  2CYZ B;  4LDV A;  1O75 A;  2HQH A;  4JRP A;  2A7Y A;  4FYW B;  4M78 B;  4BY6 C;  3CC7 Q;  2K9G A;  4YRS A;  4M77 E;  5GAM h;  4CC7 A;  4C92 C;  4J9G A;  4XTV A;  4M7D D;  4HT4 A;  4E47 A;  3FLG A;  3M9Q A;  3CPW S;  4YCW A;  1OZ3 A;  1H3H A;  1BI0 A;  3CXC A;  1VQ9 A;  4OVA A;  2VAS A;  2PU9 B;  2OAU A;  3ER0 A;  3LX7 A;  3QDR B;  1G5V A;  3RUX A;  1SRL A;  4K86 A;  3PCO B;  1B8A A;  1VIE A;  2ZPB B;  2NYS A;  2ALY B;  3T9N A;  1ABQ A;  3GOX A;  4C8Q A;  4L59 A;  2PVG B;  2GCX A;  2RJC A;  1EVL A;  2QHS A;  3HRT A;  4H2X A;  4P3N A;  2AZV A;  5KYW B;  3CCL A;  3JCM X;  2KYM A;  4J8O A;  1QP3 A;  2K3B A;  2C7I A;  1XQH A;  3JB9 I;  2GBQ A;  1X6G A;  3M53 A;  4C0Z A;  4CRI A;  4J6Y A;  2I4L A;  4BB7 A;  1NJI C;  1Q82 C;  1NLP C;  4KGV B;  3CCU T;  3HKS A;  3QO3 A;  1KQ1 A;  1SF9 A;  3M0U A;  4M77 A;  1OU8 A;  4TVA A;  2QGF B;  3S3O A;  4GBQ A;  3QG1 A;  3R07 A;  4YYE A;  3EG9 B;  5GAN 6;  3KFU A;  3X20 B;  2JUF A;  1S1N A;  5CKF A;  1WQ7 A;  3CCM T;  2LT1 A;  5HCK A;  1ATI A;  2DIG A;  5KYX A;  1J3T A;  2FO0 A;  4KR2 A;  1AT1 B;  1BI3 A;  3PNW C;  4HWP A;  4R56 A;  1ZSZ C;  1MMA A;  4X34 A;  2LX9 A;  2VB6 A;  4C8Q F;  3G4S A;  3FRN A;  2Q7E A;  2E12 A;  5I22 A;  5KE3 A;  1DJ7 B;  4J9D A;  1PYS B;  2HKQ B;  4UP9 A;  1WU7 A;  3OYN A;  1H4S A;  1IRX A;  3NHN A;  1EIF A;  2V8J A;  1WNL A;  1VQM T;  4E7J A;  1B07 A;  2I0N A;  2AKL A;  4Q15 A;  2XU8 A;  4B9X A;  5L23 A;  1IGQ A;  3UDC A;  4M77 F;  4AG2 C;  1RLP C;  1RAE B;  3J80 E;  4M75 B;  4FT4 A;  5CIU A;  3EFO B;  4N4I A;  1ADY A;  2L0A A;  4M7D B;  2ZR2 A;  3MQZ A;  1Y71 A;  5GAN d;  1OPK A;  4F17 A;  2ED1 A;  3MKD A;  4XU3 A;  2I4N A;  4KUL A;  3EAE A;  1KD1 U;  3O5Z A;  2LJ1 A;  4K88 A;  1VQP Q;  5GAO p;  3M0S A;  2RA2 A;  3CCS T;  4OGE A;  3NEM A;  4HWR A;  1VQL Q;  4ME7 A;  2YRC A;  3JAM E;  2YXY A;  1WFW A;  5GAO m;  2ATC B;  2CKK A;  4OB3 B;  5GAN 5;  1TS9 A;  2KYB A;  1UTI A;  3PCO A;  4F14 A;  2ALY A;  3L2W A;  1EX4 A;  2KE9 A;  1G3W A;  2FPD A;  3H41 A;  3I56 Q;  1KG1 A;  1WLP B;  1SSF A;  1QWF A;  1GRI A;  5GAO q;  4RMF A;  5KYW A;  2J3M A;  2X51 A;  4JJC A;  3SD4 A;  2YSQ A;  5A0G A;  2XDB A;  4E7H A;  4LDU A;  3OS2 A;  2C0O A;  1WHL A;  3CME Q;  4DOW A;  1Q86 C;  1KC8 C;  1G5I A;  2IPO B;  3L2Q A;  1NYQ A;  2DBM A;  3EGX B;  1W4S A;  4JZ3 A;  5FW9 A;  1B70 B;  2RD1 A;  1OOT A;  2YDL A;  2FB7 A;  4RTY A;  1AD5 A;  1JBM A;  3EG9 A;  4IIO A;  1M4Z A;  5GAN 8;  3L2Z A;  1FX7 A;  5CR2 A;  1QVG S;  5CKB A;  4TQD A;  1OEB A;  2E6Z A;  4ANJ A;  3M0Q A;  2ROL A;  3L2R A;  2ART A;  5CQY A;  3GF5 A;  1K0S A;  1H4V B;  2MYS A;  1LNX A;  4PJO E;  1VQ8 A;  2KMT A;  2EWN A;  3VS5 A;  4XQ3 A;  1WZO A;  2GFA A;  1PYS A;  3H8Z A;  4OMQ A;  1GBR A;  1I0C A;  2L8D A;  4JLI A;  4CC2 A;  3OYC A;  1M1K C;  2Y90 A;  2XTI A;  4RQE A;  1VQN Q;  4YRL A;  3TCJ A;  1YBY A;  4J7I A;  3QKJ A;  2D0Q B;  4PJM A;  1E24 A;  4F7U G;  2QTV A;  1SRY A;  1QKX A;  4HCC A;  2RPN A;  5C0M A;  4RKU E;  3HFO A;  3OW2 P;  4CS4 A;  1VQM Q;  1IL2 A;  5KCH A;  5IHI A;  4PHC A;  2JTF A;  1GXI E;  2J6K A;  2R5A A;  5D6W A;  3I55 Q;  4CH4 A;  2EGE A;  2RQR A;  2JTM A;  4BY6 B;  2K5L A;  2KT1 A;  4LN2 A;  4RUG A;  4FT2 A;  1X6O A;  4C92 B;  1VYT A;  2KXC A;  3C12 A;  2ROT A;  4YRN A;  2B86 A;  2K6D A;  3S6W A;  3LWI A;  4O6J A;  4LDY A;  1VQO T;  4PFO A;  1YI2 A;  2R58 A;  3RER A;  1IRE B;  3F70 A;  3LYI A;  3JSC A;  2ZNJ A;  4HXJ A;  3JCM Q;  4EX5 A;  3OYD A;  2DL3 A;  4DBQ A;  3H0F A;  5J39 A;  2D0N A;  1V1C A;  3CCQ T;  1VQK T;  4N4H A;  1J5W A;  4OLF A;  5ECA A;  1HC7 A;  2K3Y A;  3LSS A;  2HCK A;  4P71 A;  4YP0 A;  2CUB A;  5KH6 A;  4NL3 A;  2L3S A;  4KGZ B;  4WI1 A;  2JN0 A;  4EPC A;  2F5K A;  2YRV A;  3GNF B;  1YHQ Q;  4LDX A;  2E6N A;  1D1A A;  1JU5 C;  1IZ6 A;  4YRO A;  6AT1 B;  2D8H A;  3HY1 A;  4M7A E;  4JUV A;  3EGX A;  4A4E A;  1E6H A;  1B70 A;  1KSW A;  3TSW A;  4E7S A;  3OB9 A;  2A3L A;  1NEB A;  1TOV A;  1S72 T;  1YJN Q;  3OYL A;  2P0K A;  2HL5 C;  2R5M A;  1ZSZ B;  4PL6 A;  4JDS A;  3KUF A;  2PUK B;  1YP5 A;  2D1X A;  1AZE A;  5GMK h;  4LE9 A;  4HWO A;  1WGS A;  4Z02 A;  4JZ4 A;  2QEX Q;  3M57 A;  4M77 G;  1W2B P;  3AT1 B;  2ZPF B;  2K4Y A;  2CRE A;  2LNV A;  1TUG B;  2XI9 A;  4P5N A;  1BBU A;  2MK5 A;  2BUD A;  3HXV A;  1AOJ A;  1KQS P;  1M90 R;  1M1F A;  3QTC A;  3NTI A;  2YLC A;  3P8V A;  1X55 A;  1YI2 T;  2GFU A;  3P8B B;  4OF1 A;  2ZR3 A;  4XEM A;  3CC4 Q;  2DKG A;  2XGT A;  5LJ5 d;  2CH4 A;  4BDZ A;  4LVL A;  3EFS A;  2ZT7 A;  1GGM A;  1JRI A;  2E3I A;  4H2V A;  4MZT A;  2K3X A;  2W0Z A;  2E5Q A;  4X5O A;  5GJW B;  3CPW P;  1PSE A;  2XID A;  2EYQ A;  1EZZ B;  3OD1 A;  4RTW A;  2X35 A;  2DNU A;  1WLE A;  1H4T A;  3UA7 A;  2GTJ A;  4C92 A;  2OTJ Q;  2NLU A;  1R8O B;  3CC2 T;  3MF1 A;  2ZZG A;  9ATC B;  4HT8 A;  1D3B B;  1RAH B;  2YLB A;  2ED0 A;  1K73 U;  4M7A F;  1V76 A;  3A8G B;  2EJG A;  2D9T A;  4ZGJ B;  1NJ5 A;  3CMA Q;  4YRI A;  1F1B B;  1RUW A;  1JQQ A;  2QAZ A;  5KCO A;  1VQ4 T;  1VQ7 T;  5LJ3 f;  4YRQ A;  2LQ8 A;  4KH1 B;  2DD4 A;  1RAC B;  1M2O A;  2CJB A;  4LVI A;  2HBW A;  2JW4 A;  3EH2 A;  1Q81 U;  1AWJ A;  1QCF A;  2EYZ A;  2BZX A;  2E3H A;  5DLO A;  4YTL A;  2CH4 W;  2F69 A;  2FL7 A;  4Z89 A;  1B7Y B;  1TH7 A;  3GNG A;  2D8J A;  3HXX A;  2CP6 A;  4NCX A;  1UEB A;  3OBW A;  3NTH A;  2C0T A;  4C92 F;  2XDD A;  1LYL A;  1ZQ1 A;  2QDY B;  3V8J A;  2RQU A;  1ZUK A;  5CQX A;  5LL6 S;  4TVW A;  3HRU A;  1QWE A;  3CCR T;  2NWM A;  2CP2 A;  3JV3 A;  5GAO r;  3C94 A;  3ZFJ A;  1ZSZ A;  3GP8 A;  4JRK A;  3LLR A;  1JJ2 S;  4UPA A;  2QTX A;  3OS0 A;  3QBY A;  2AK5 A;  4DPG A;  1D0Y A;  1N27 A;  3HTZ A;  4BWA A;  4AT1 B;  2Y4X A;  1TSF A;  1N6A A;  1SSH A;  4ZGD B;  2B8A A;  4YRE A;  1ABO A;  2EFI A;  3URG A;  4P73 C;  5LJ3 j;  3DB4 A;  2P0L A;  2EKO A;  2L5Q A;  4YRC A;  4AFU C;  4R0K A;  2DL7 A;  4XU2 A;  1M8M A;  3CPF A;  3IAL A;  5GAN f;  4ZTZ B;  2VWF A;  2PNI A;  1UEC A;  1PNJ A;  3REA B;  4J7F A;  3OSS C;  4Z8A A;  1G5H A;  2H3E B;  3MP1 A;  3CXC S;  2I2L A;  3P8H A;  2MWO A;  1ARK A;  1NNH A;  2KBT A;  1Q95 G;  1EFW A;  3OYK A;  1AWW A;  2ZPE B;  1TUD A;  3HFN A;  3VV0 A;  3G1J A;  1D3B A;  3NGP A;  4XU1 A;  1KIK A;  4HWT A;  2A36 A;  4BI3 A;  3GIB A;  1MMD A;  1FYN A;  4B6M A;  2QQ9 A;  3OYG A;  4HCZ A;  2I4O A;  4AG1 C;  2FZK B;  5GAO n;  2LJ0 A;  4PJO G;  3ME9 A;  4J5Y A;  2ZIN A;  2HNI A;  2ZPI B;  2DM1 A;  3MEY A;  2QHT A;  4P75 C;  3CD6 Q;  1UB4 A;  5HY6 A;  2NUT A;  1QVG P;  5GAN j;  1NG2 A;  3HY0 A;  3BDL A;  2HEQ A;  1KK7 A;  2DBK A;  2WAC A;  3DLL A;  2QHU A;  4TTV A;  4WCI A;  2DVE A;  4X1V A;  4XTY A;  1B7Y A;  2DRK A;  1BCO A;  4OB2 B;  1LCK A;  2LZ6 B;  2KRM A;  5DM7 R;  1BI1 A;  2CDT A;  3JCM V;  3QO7 A;  3UAT A;  1UFF A;  2DD5 A;  2P4R A;  1IO6 A;  4MDX A;  4P72 A;  4HVV A;  2MI6 A;  2DU7 A;  4RCC A;  4K11 A;  4BE0 A;  3CCJ A;  1VQ6 Q;  3VQV A;  5CVI A;  4C8Q E;  5C6S A;  4P3P A;  2RI2 A;  1PC0 A;  4YRJ A;  3JB9 H;  3O8V A;  1YJW T;  2P0Q A;  2DZC A;  1KMM A;  2FHD A;  3THK A;  4E7I A;  1UGR B;  1X2H A;  1VQZ A;  1RL2 A;  1QVF S;  1G3Y A;  2RI5 A;  3RKX A;  3LWH A;  1WYD A;  1M1K R;  3E1S A;  1MND A;  5GAN e;  1VQN A;  3REB B;  1NJI U;  1Q82 U;  1X54 A;  1MNE A;  1MV0 B;  3M58 A;  1RAD B;  3UPU A;  1YIJ Q;  4D8D A;  2G3R A;  1Q7Y U;  4X9C A;  4M7A G;  4C5E A;  1ASY A;  2RMO A;  3EG0 A;  2F1L A;  4OMF B;  2HSE B;  3CBP A;  3QXE B;  1RIQ A;  2AKW A;  2EVR A;  1L0W A;  5KNN A;  3MP6 A;  3HXU A;  2JMA A;  2Q7G A;  4E7K A;  4PJO D;  1M30 A;  2BKD N;  3G6E A;  2ZT5 A;  1RI0 A;  1XTD A;  2JS0 A;  5I21 A;  2BTT A;  3S3N A;  1BCM A;  2LMJ A;  5LJ3 d;  2JT4 A;  1Y0M A;  1PKT A;  3UWN A;  4ZTU B;  3CCV Q;  2QA4 Q;  1KFZ A;  1CKA A;  3CCE Q;  3SDZ A;  4RTX A;  2ABL A;  4E6R A;  2M1H A;  2RK1 A;  3UT1 A;  3QNE A;  3IG2 A;  3G71 Q;  2X9H A;  4XEO A;  3QHS A;  3CCJ T;  1YIT T;  1YGB A;  1YFN A;  1YHQ A;  2YUP A;  1YJ9 Q;  1NJ8 A;  2AIR B;  2I4M A;  1I4K 1;  2H8H A;  2RF0 A;  4KRT A;  1FMV A;  4M78 E;  3X26 B;  3A98 A;  2OTL Q;  2O9S A;  2DK3 A;  1H4Q A;  2LQN A;  3M59 A;  2RNA A;  2O9V A;  2E65 A;  4YPF A;  2M02 A; 
#chains in the Genus database with same CATH homology
 4YRT A;  1VIF A;  2CJA A;  2ZZE A;  2E41 A;  3NEN A;  5IT9 E;  4EMH A;  4BDY A;  1VQ9 T;  2FYK A;  3HFV A;  1N9R A;  3A32 A;  2QEX A;  5LJ5 f;  2Q5I A;  3JCM W;  2DTI A;  5CKE A;  4N0A A;  2PVD B;  3CCL T;  1QVF A;  4M78 A;  5A0L A;  1X75 C;  3VUB A;  2K57 A;  4GLK A;  3G6E T;  4OB1 B;  1KC8 U;  4M7A D;  4D6W A;  4TQF A;  3CC4 A;  4E7L A;  3FJP A;  2DAQ A;  2H3J A;  3RKW A;  4KUD K;  3OMC A;  1K8A U;  4CS2 A;  3MET A;  1MGQ A;  1ASZ A;  3JCM b;  3P8D A;  1AHJ B;  4WJ4 A;  1Z7N A;  5FU6 C;  2DQ0 A;  2WSC E;  3A8H B;  4JLG A;  3IKM B;  2LTO A;  3M4G A;  3G4S T;  2PUO B;  3UGQ A;  5LJ3 g;  4CH5 A;  5LJ5 j;  3VUZ A;  1M8V A;  4M78 F;  4YRR A;  2GQV A;  1KD1 C;  3PIO A;  3QJY A;  3CMA A;  4UP7 A;  4M75 E;  1YCY A;  4M7D E;  4A4G A;  4EMK B;  3VQX A;  2RHX A;  2CZ1 B;  2K5I A;  3JB9 F;  4J83 A;  1MHN A;  1M9S A;  3QZ9 B;  4L5G A;  4FU6 A;  1E1O A;  2ZNI A;  2KY9 A;  3VYH B;  2EAY A;  2M16 A;  3RES A;  1BIA A;  3JCM f;  5GAN 2;  3ICA A;  2RHS B;  1QF6 A;  4M75 A;  4YDQ A;  3SFM A;  2RHI A;  4M7D A;  3FIF A;  5GAN g;  5LJ5 e;  2CZ6 B;  2EJF A;  3W3S A;  4IUP A;  3PZC A;  1N9S A;  2Y4Y A;  2E10 A;  3J7A F;  1WJQ A;  3WVE B;  2RHU A;  4FL6 A;  3A31 A;  4RG2 A;  4II1 A;  2P0P A;  4EMG A;  2G4C A;  3E9I A;  5GAN h;  2DDZ A;  4HT9 A;  3OY9 A;  2XHC A;  3A8L B;  4Q5W A;  4M75 F;  1B34 B;  4A54 A;  2KQW A;  4M7D F;  3QO8 A;  1KMN A;  1E1T A;  1VQ8 T;  5J3B A;  2LRQ A;  2EIF A;  2HBP A;  1BYM A;  3TEH B;  3VJP A;  5GAM j;  1JJC B;  1LJO A;  2RO0 A;  4P75 A;  1H64 1;  4M77 C;  3VKI A;  1NPR A;  3A7A A;  3QO5 A;  4PLL A;  3PFS A;  5ELN A;  4C8Q G;  1UGS B;  3BDU A;  4EMK A;  3UFG A;  2HQX A;  3REX A;  1YB3 A;  3BJU A;  2C06 A;  4AH6 A;  4X9D A;  5K1X A;  3P8Y A;  2MF2 A;  3LW5 E;  4C92 E;  3VU3 C;  4LNS A;  1USY C;  3IKL A;  5GAN 3;  3UH0 A;  1NJ1 A;  4XTU A;  5HK3 A;  1KHI A;  2WSE E;  3JCM e;  2RHS A;  1E22 A;  2MWP A;  3CEY A;  3OYH A;  2JNG A;  4MZM A;  1I5L A;  4C0G A;  4QQG A;  3TEE A;  4B9W A;  3A7U A;  3VYG A;  3OYB A;  11AS A;  4CH3 A;  2HAX A;  2XKO C;  4IUV A;  3WVD B;  2PME A;  5IAY A;  4H2U A;  4KT0 E;  3L4G B;  4ZIB A;  4UP8 A;  1BKB A;  2DZ9 A;  3CC7 A;  2ZTG A;  1HTT A;  1PSF A;  5FU6 B;  4A4F A;  4Q6G A;  3H6Z A;  3HXZ A;  1YIJ A;  2E70 A;  1V29 B;  5IN1 A;  2MMP A;  2JVV A;  1B34 A;  4A4K A;  4M78 G;  3A7R A;  2VXF A;  2DTO A;  2DTH A;  3RAC A;  3TEH A;  4C8Q D;  3RGL A;  1JJC A;  4L6V 5;  3MHX A;  2XG8 D;  2IY5 B;  2O4X B;  3AHU A;  2VYT A;  3GLX A;  4F7U B;  1C0A A;  4J6W A;  2V8K A;  2L3R A;  2RJE A;  2ZT6 A;  3X24 B;  5A0D A;  3CCV A;  4CH6 A;  4M77 D;  3Q1J A;  5GMK l;  1K73 C;  4BAC A;  3CCE A;  1XNI A;  4ELY C;  3HXW A;  4JS4 A;  3FEO A;  3OS1 A;  5A2Q E;  5C51 B;  1VUB A;  3G71 A;  3BFM A;  3ERR A;  3JCM d;  1YJ9 A;  3J81 E;  4A4H A;  3FDR A;  5GAM d;  1M5Q 1;  2OTL A;  2R57 A;  5K1P A;  4BW9 A;  5LJ5 g;  1ADJ A;  3RF1 A;  1SER A;  2ODR D;  3CC7 T;  2K2V A;  2Q5H A;  3MO8 A;  3M54 A;  4YRK A;  4NOY A;  2KAF A;  1I81 A;  2LVM A;  4PJO C;  1NJ6 A;  4BE2 A;  4R55 A;  2ZPH B;  4WJ3 M;  12AS A;  3RMQ A;  3MEU A;  4ATO A;  4XU0 A;  2M0O A;  2CIM A;  3DLM A;  5LJ5 h;  3VQY A;  2ZXF A;  3L4G A;  5M9O A;  4OP0 A;  4BUG A;  1G3T A;  1VQP A;  1M90 U;  4CS3 A;  4M75 G;  1Y96 B;  1VQL A;  1K9M C;  4M7D G;  4M78 D;  1NZ9 A;  3KBG A;  1JB0 E;  3JCM c;  5LJ3 e;  2LDM A;  4QVD A;  4EO4 A;  4QQ6 A;  3I56 A;  2DU5 A;  2AMC B;  2KK4 A;  4TVA B;  1ZBX A;  2IY5 A;  3CMQ A;  2O4X A;  3HFZ B;  3FC3 A;  2ZPG B;  3CME A;  3L2V A;  2QQB A;  4E51 A;  1WJS A;  3QJ6 A;  3CBO A;  2EQK A;  1NYR A;  2QQR A;  3N5B B;  4YRM A;  4C0D C;  3HPW A;  3SWN C;  3PMT A;  3HSB A;  2RB6 A;  2LC4 A;  3TEG A;  3JCM g;  4YRF A;  4M7A C;  3LGF A;  3CCM A;  3E9G A;  4QVC A;  4P74 C;  3EFR A;  3REU A;  4KBM B;  5GAM g;  2RHY A;  3V7C A;  1M1G A;  1VQP T;  2CS7 A;  5GMK j;  1VQL T;  3LSQ A;  4BI4 A;  3I7F A;  3GPL A;  4FSX A;  2WSF E;  1VQM A;  2LCC A;  2XD0 A;  3OW2 A;  5C53 B;  4M75 D;  3I55 A;  4IUT A;  2ZT8 A;  4HCB A;  3I56 T;  3V8L A;  2RHQ B;  4XTX A;  1WJR A;  1N8R C;  2VUB A;  1YFT A;  4HA8 A;  1Y96 A;  3QUI A;  5DLQ E;  2IVW A;  1HK9 A;  3CME T;  4UC4 A;  2EQJ A;  1NPP A;  3M4P A;  3CCS A;  3ASK A;  1O9S A;  4XTZ A;  4YRP A;  4C92 G;  4OB0 B;  4MMK A;  3VQW A;  2X4X A;  3A5Z B;  3M55 A;  1KQ2 A;  2KSS A;  2AMC A;  2PQW A;  3C4S A;  4RQF A;  5GMK e;  3HFZ A;  1Q7Y C;  1N9W A;  2ZGW A;  3HRI A;  4FIB A;  4C0F A;  2X4J A;  1VQN T;  1NJ2 A;  3CBM A;  1YJN A;  3OYM A;  1OYX A;  1U1S A;  1I8F A;  4ZTF A;  1USY A;  2DPP B;  1H3Z A;  2FVU A;  1Y07 A;  3PMI A;  2RJD A;  1HXD A;  4IKF A;  3I55 T;  1EVK A;  4G85 A;  4NL2 A;  4YRG A;  1W2B A;  3DB3 A;  4KR3 A;  1Q86 U;  3WQZ A;  2EJ9 A;  4PJO B;  2QXF A;  4DQ2 A;  1KQS A;  2EQM A;  1QE0 A;  2ARU A;  3G7Z A;  3R6O A;  2AHJ B;  5CAI A;  3M4Q A;  3V7R A;  3INZ A;  3OQ5 A;  2RM4 A;  5GAN 4;  5FU7 C;  3CPW A;  2RHQ A;  2CGH A;  3NET A;  2KDS A;  1QVP A;  4WF2 A;  2ZIO A;  3UGT A;  5GAN 7;  2OTJ A;  4MDW A;  1BI2 A;  3A8O B;  1YHQ T;  4C92 D;  1M1K U;  2EL9 A;  4RCB A;  3ZEH A;  4PG3 A;  2X4Y A;  2E64 A;  1VQO A;  3QSU A;  3M56 A;  4KUI A;  3V7S A;  3A5Z A;  1YJN T;  5CO7 A;  4ZGE B;  2C8M A;  5LJ3 h;  3HXY A;  2RK2 A;  3CCQ A;  4BE1 A;  1U8R A;  1VQK A;  2YHT A;  2HQE A;  1K8A C;  2QEX T;  3WXM B;  2IG0 A;  3LGL A;  4C0D B;  3SWN B;  4MZP A;  4Y28 E;  2P5I A;  4LDW A;  4EDU A;  4H2W A;  4P72 C;  2CJ9 A;  1FWZ A;  3QII A;  1FYF A;  3MEV A;  4P73 A;  4M7A B;  3CC4 T;  5GAM f;  1YFS A;  4MML A;  1OZ2 A;  5GMK m;  4RDX A;  2EQU A;  3OYI A;  3X28 B;  1S72 A;  4YCV A;  5EG2 A;  4TVY A;  2E3C A;  2J3L A;  2LT4 A;  3BY7 A;  2OTJ T;  3MEA A;  4PJO A;  4GY5 A;  4H02 A;  3OYE A;  2VGN A;  4C8Q C;  3JCM P;  3CMA T;  2F5T X;  3HHT B;  2Q7H A;  4J6X A;  2QQA A;  3TUP A;  4ZTJ A;  2ARS A;  4P3O A;  2VV5 A;  2QHV A;  4YCU A;  3E9H A;  4C5I A;  4CI0 C;  3OBY A;  3L1A A;  2XK0 A;  3JRZ A;  2KVQ G;  1EOV A;  5D6X A;  3SB2 A;  3M5A A;  4ELZ C;  2M9U A;  3CC2 A;  4G84 A;  4ZN1 A;  5HKC A;  2DXC A;  4PJO F;  4JJN K;  3MCA B;  2E5A A;  3OA6 A;  4O2D A;  3CD6 A;  5J26 A;  2DQ3 A;  3MP8 A;  4HWS A;  2PMF A;  3HP9 A;  5D6Y A;  1VQ4 A;  4KQE A;  3QZ5 B;  1VQ7 A;  1UGP B;  3JCM J;  1QVG A;  4HVC A;  1EIY B;  4LD6 A;  2BIV A;  2ODR C;  4N4G A;  2O01 E;  4TWA A;  1OI1 A;  1EQR A;  3SWN A;  3OYF A;  2NS6 A;  3QYH B;  3NTK A;  2DXB A;  1SET A;  4PNO A;  2QI2 A;  5F5W A;  1XOV A;  2PVO B;  3ZBD A;  3S3M A;  1X2G A;  1BIB A;  4M7A A;  4H2T A;  5GAM e;  4P74 A;  2ZZD A;  3CCR A;  1VQ6 A;  3PGG A;  5GAO l;  4N0A C;  4QVZ A;  2DIQ A;  4M78 C;  2MAM A;  5ELO A;  2LCL A;  3L2U A;  4JRQ A;  3A8M B;  3P8T A;  4JRI A;  1FXX A;  5I2M A;  4XAX B;  5C52 B;  3MF2 A;  5FU7 B;  3RKY A;  2GF7 A;  3G1Z A;  4A53 A;  4PKC C;  5CKD A;  1KOG A;  2P4T A;  3NEL A;  5GMK i;  4TVR A;  3TU4 K;  3LC0 A;  4L87 A;  4H2S A;  3DKM A;  3CD6 T;  2D6F A;  4QW2 A;  2DJZ A;  4O5V A;  3QPH A;  3BW1 A;  2JOY A;  3A5Y A;  4DA4 A;  3E19 A;  4ZN3 A;  2JZ2 A;  3QYG B;  3JB9 J;  2X4W A;  2XDP A;  3JB9 G;  4K87 A;  3HL8 A;  3OSV A;  2QA4 A;  4HKE A;  2K5F A;  4BI8 B;  2VXE A;  2ZIM A;  4VUB A;  2V8I A;  1G3S A;  2RH2 A;  3C95 A;  1VQ6 T;  1EIY A;  2HD0 A;  5FRO A;  3L42 A;  4XTW A;  5HK0 A;  1X01 A;  3OYJ A;  5FRN A;  3V8K A;  4QQD A;  1Q81 C;  3HRK A;  4C5H A;  1UGQ B;  1P92 A;  4FM4 B;  1K9M U;  4M75 C;  2DEQ A;  3A74 A;  3M4Y A;  3X25 B;  4LVK A;  4M7D C;  4NS5 A;  4PLI A;  3PT9 A;  4LD9 K;  3RL6 A;  1YIJ T;  3DSQ A;  3OW2 S;  3RMS A;  2VC8 A;  1U1T A;  2LQK A;  1WPY A;  5I2S A;  3HRS A;  3NFC A;  3PTA A;  4F7U E;  5CCA A;  2ZCF B;  4H2Y A;  4C8Q B;  1WQW A;  1YJW A;  4RG8 A;  2ZZF A;  5FLX E;  3OYY A;  4H2X B;  1VQ5 A;  2DXT A;  2AKW B;  3KXT A;  5CKH A;  4JS5 A;  3OS5 A;  4P71 C;  3CCV T;  2QA4 T;  1Z7M A;  1KHC A;  3E9F A;  2RJF A;  3CCE T;  4M77 B;  5KE2 A;  4BD3 A;  1BBW A;  2DXU A;  3OYA A;  3G71 T;  3OMG A;  4XK8 E;  3JB9 D;  4IUU A;  1LOJ A;  2XIC A;  1W66 A;  1YFR A;  4F7U A;  1YJ9 T;  3MEW A;  4OGC A;  5FRM A;  4J15 A;  2CZ0 B;  2RI3 A;  2E1H A;  2OTL T;  4IUR A;  1QP2 A;  4C5G A;  2RHZ A;  3CCU A;  1M90 C;  2CZ7 B;  4LVM A;  4RMO A;  4EMK C;  3TRE A;  3PIP A;  3FB9 A;  3VBB A;  4Y91 A;  2A8E A;  1SES A;  1NE8 A;  2L89 A;  1B76 A;  1X56 A;  2ZCE A;  1ZHI A;  4LVJ A;  3RIR A;  4V2S A;  4IUQ A;  1G51 A;  3LH0 A;  1JJ2 A;  2DO3 A;  5AYF A;  2VGM A;  5DY9 A;  5L8R E;  5CK9 A;  1N8R U;  1QW1 A;  1YIT A;  1W2B S;  5HGQ A;  2QQS A;  4F7U F;  5E3I A;  1Y7X A;  1KQS S;  3JCM h;  1VQ5 T;  4DOV A;  2CYZ B;  4LDV A;  1O75 A;  4JRP A;  2A7Y A;  4M78 B;  4BY6 C;  4YRS A;  4M77 E;  5GAM h;  4C92 C;  4XTV A;  4M7D D;  4HT4 A;  4E47 A;  3FLG A;  3M9Q A;  3CPW S;  4YCW A;  1OZ3 A;  1BI0 A;  3CXC A;  1VQ9 A;  4OVA A;  2PU9 B;  2OAU A;  3ER0 A;  3LX7 A;  3QDR B;  1G5V A;  3RUX A;  4K86 A;  3PCO B;  1B8A A;  1VIE A;  2ZPB B;  2ALY B;  3T9N A;  3GOX A;  4C8Q A;  4L59 A;  2PVG B;  2GCX A;  2RJC A;  1EVL A;  2QHS A;  3HRT A;  4H2X A;  4P3N A;  3CCL A;  3JCM X;  4J8O A;  1QP3 A;  2C7I A;  1XQH A;  3JB9 I;  3M53 A;  4C0Z A;  4CRI A;  4J6Y A;  2I4L A;  4BB7 A;  1NJI C;  1Q82 C;  3CCU T;  3HKS A;  3QO3 A;  1KQ1 A;  4M77 A;  4TVA A;  3S3O A;  3QG1 A;  3R07 A;  4YYE A;  5GAN 6;  3KFU A;  3X20 B;  2JUF A;  5CKF A;  1WQ7 A;  3CCM T;  2LT1 A;  1ATI A;  2DIG A;  4KR2 A;  1BI3 A;  3PNW C;  4HWP A;  4R56 A;  4C8Q F;  4X34 A;  2LX9 A;  3G4S A;  2Q7E A;  3FRN A;  2E12 A;  5KE3 A;  1DJ7 B;  1PYS B;  4UP9 A;  1WU7 A;  3OYN A;  1H4S A;  1EIF A;  2V8J A;  1WNL A;  1VQM T;  4E7J A;  4Q15 A;  2XU8 A;  4B9X A;  3UDC A;  4M77 F;  3J80 E;  4M75 B;  4FT4 A;  5CIU A;  4N4I A;  1ADY A;  4M7D B;  2ZR2 A;  3MQZ A;  1Y71 A;  5GAN d;  4XU3 A;  2I4N A;  4KUL A;  3EAE A;  1KD1 U;  4K88 A;  5GAO p;  2RA2 A;  3CCS T;  4OGE A;  3NEM A;  4HWR A;  4ME7 A;  3JAM E;  5GAO m;  2CKK A;  4OB3 B;  5GAN 5;  3PCO A;  2ALY A;  3L2W A;  1G3W A;  1KG1 A;  1SSF A;  5GAO q;  4RMF A;  2J3M A;  3SD4 A;  5A0G A;  2XDB A;  4E7H A;  4LDU A;  3OS2 A;  4DOW A;  1Q86 C;  1KC8 C;  1G5I A;  3L2Q A;  1NYQ A;  1W4S A;  1B70 B;  2RD1 A;  2FB7 A;  1JBM A;  1M4Z A;  5GAN 8;  3L2Z A;  1FX7 A;  5CR2 A;  1QVG S;  5CKB A;  4TQD A;  2E6Z A;  3L2R A;  2ART A;  5CQY A;  3GF5 A;  1H4V B;  1LNX A;  4PJO E;  1VQ8 A;  2KMT A;  2EWN A;  4XQ3 A;  2GFA A;  1PYS A;  3H8Z A;  2L8D A;  4JLI A;  3OYC A;  1M1K C;  2Y90 A;  2XTI A;  4RQE A;  4YRL A;  3TCJ A;  1YBY A;  4J7I A;  3QKJ A;  2D0Q B;  1E24 A;  4F7U G;  1SRY A;  4HCC A;  5C0M A;  4RKU E;  3HFO A;  4CS4 A;  1IL2 A;  5KCH A;  4PHC A;  2JTF A;  1GXI E;  2R5A A;  5D6W A;  4CH4 A;  2JTM A;  4BY6 B;  2K5L A;  4FT2 A;  1X6O A;  4C92 B;  3C12 A;  4YRN A;  3S6W A;  3LWI A;  4O6J A;  4LDY A;  1VQO T;  1YI2 A;  2R58 A;  3RER A;  1IRE B;  3F70 A;  3LYI A;  3JSC A;  2ZNJ A;  3JCM Q;  4EX5 A;  3OYD A;  5J39 A;  3CCQ T;  1VQK T;  4N4H A;  1J5W A;  4OLF A;  1HC7 A;  2K3Y A;  3LSS A;  4YP0 A;  4P71 A;  5KH6 A;  4NL3 A;  4WI1 A;  2JN0 A;  4EPC A;  2F5K A;  2YRV A;  3GNF B;  4LDX A;  2E6N A;  1IZ6 A;  4YRO A;  3HY1 A;  4M7A E;  4JUV A;  4A4E A;  1B70 A;  3OB9 A;  2A3L A;  1S72 T;  3OYL A;  2P0K A;  2R5M A;  4PL6 A;  4JDS A;  3KUF A;  2PUK B;  5GMK h;  4HWO A;  1WGS A;  4Z02 A;  3M57 A;  4M77 G;  2ZPF B;  2K4Y A;  2LNV A;  2XI9 A;  4P5N A;  1BBU A;  2BUD A;  3HXV A;  1M1F A;  3QTC A;  3NTI A;  2YLC A;  3P8V A;  1X55 A;  1YI2 T;  2GFU A;  3P8B B;  4OF1 A;  2ZR3 A;  4XEM A;  2DKG A;  2XGT A;  5LJ5 d;  4BDZ A;  4LVL A;  3EFS A;  2ZT7 A;  1GGM A;  1JRI A;  4H2V A;  4MZT A;  2K3X A;  2E5Q A;  4X5O A;  1PSE A;  2XID A;  2EYQ A;  3OD1 A;  2X35 A;  1WLE A;  1H4T A;  4C92 A;  2NLU A;  1R8O B;  3CC2 T;  3MF1 A;  2ZZG A;  4HT8 A;  1D3B B;  2YLB A;  1K73 U;  4M7A F;  3A8G B;  2EJG A;  2D9T A;  4ZGJ B;  1NJ5 A;  4YRI A;  5KCO A;  1VQ4 T;  1VQ7 T;  5LJ3 f;  4YRQ A;  2LQ8 A;  2DD4 A;  2CJB A;  4LVI A;  1Q81 U;  5DLO A;  4YTL A;  2F69 A;  2FL7 A;  1B7Y B;  1TH7 A;  3GNG A;  3HXX A;  4NCX A;  1UEB A;  3OBW A;  3NTH A;  4C92 F;  2XDD A;  1LYL A;  1ZQ1 A;  2QDY B;  3V8J A;  5CQX A;  5LL6 S;  4TVW A;  3HRU A;  3CCR T;  5GAO r;  3C94 A;  3ZFJ A;  3GP8 A;  4JRK A;  3LLR A;  1JJ2 S;  4UPA A;  2QTX A;  3OS0 A;  3QBY A;  4DPG A;  1N27 A;  4BWA A;  3HTZ A;  2Y4X A;  1N6A A;  4ZGD B;  2B8A A;  4YRE A;  2EFI A;  3URG A;  4P73 C;  5LJ3 j;  3DB4 A;  2P0L A;  2EKO A;  2L5Q A;  4YRC A;  4XU2 A;  3CPF A;  3IAL A;  5GAN f;  4ZTZ B;  4J7F A;  3OSS C;  1G5H A;  3MP1 A;  3CXC S;  2I2L A;  3P8H A;  2MWO A;  1NNH A;  1EFW A;  3OYK A;  2ZPE B;  3HFN A;  3VV0 A;  1D3B A;  4XU1 A;  4HWT A;  4BI3 A;  3GIB A;  2QQ9 A;  3OYG A;  4HCZ A;  2I4O A;  5GAO n;  4PJO G;  3ME9 A;  4J5Y A;  2ZIN A;  2HNI A;  2ZPI B;  3MEY A;  2QHT A;  4P75 C;  1UB4 A;  5HY6 A;  5GAN j;  3HY0 A;  3BDL A;  2WAC A;  3DLL A;  2QHU A;  4TTV A;  2DVE A;  4XTY A;  1B7Y A;  4OB2 B;  5DM7 R;  1BI1 A;  3JCM V;  3QO7 A;  2DD5 A;  4MDX A;  4P72 A;  2MI6 A;  2DU7 A;  4RCC A;  4BE0 A;  3CCJ A;  3VQV A;  5CVI A;  4C8Q E;  5C6S A;  4P3P A;  2RI2 A;  4YRJ A;  3JB9 H;  3O8V A;  1YJW T;  2P0Q A;  2DZC A;  1KMM A;  2FHD A;  1X2H A;  1UGR B;  4E7I A;  1VQZ A;  1RL2 A;  1QVF S;  1G3Y A;  2RI5 A;  3RKX A;  3LWH A;  1WYD A;  3E1S A;  5GAN e;  1VQN A;  1NJI U;  1Q82 U;  1X54 A;  3M58 A;  3UPU A;  2G3R A;  1Q7Y U;  4X9C A;  4M7A G;  4C5E A;  1ASY A;  4OMF B;  3CBP A;  3QXE B;  1RIQ A;  2AKW A;  1L0W A;  5KNN A;  3MP6 A;  3HXU A;  2Q7G A;  4E7K A;  4PJO D;  2BKD N;  3G6E A;  2ZT5 A;  1RI0 A;  1XTD A;  5I21 A;  3S3N A;  5LJ3 d;  3UWN A;  4ZTU B;  3SDZ A;  2M1H A;  2RK1 A;  3UT1 A;  3QNE A;  3IG2 A;  4XEO A;  3QHS A;  3CCJ T;  1YIT T;  1YGB A;  1YHQ A;  1NJ8 A;  2I4M A;  1I4K 1;  4M78 E;  3X26 B;  2DK3 A;  1H4Q A;  3M59 A;  2E65 A;  4YPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...