3EFSA

Biotin protein ligase from aquifex aeolicus in complex with biotin and atp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
232
structure length
232
Chain Sequence
FKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKGRGRLGRKWLSQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
total genus 61
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3efsA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3efsA01
2IY5A 4H2TA 1G51A 1N9SA 5LJ3d 3HXXA 4HWPA 4C92C 2E3CA 4C92E 3RESA 4CH5A 3GIBA 1MGQA 1I8FA 4YREA 1B34B 1YB3A 5GANd 2AKWB 4C8QD 4J6WA 3M4QA 4X9DA 4UP9A 3JCMQ 1NNHA 4H2UA 2ZT8A 4C8QC 4UPAA 2DEQA 4TVAA 5ELNA 3UFGA 5GAOp 1WLEA 2P5IA 4RCBA 4CS4A 4F7UF 1BIBA 1N9WA 1X2HA 4P75A 4P74A 3HFZA 3QSUA 2EL9A 3IKLA 3A5ZA 2RM4A 1B7YB 4J5YA 1WPYA 1NJ2A 4PG3A 3BFMA 2DZCA 3TEGA 5GANg 1NJ5A 2DTHA 2E65A 1SETA 2ZIMA 4YRFA 4XQ3A 3V7SA 2I4OA 4M7AG 1U1SA 1J5WA 1M8VA 4XTWA 3JCMc 4Q15A 5C53B 3R07A 1BBWA 2RHSB 3LC0A 2QTXA 3JCMb 1ADJA 1ASZA 4F7UA 1X56A 4KQEA 4P73A 4TQDA 1Y96A 4YDQA 5C51B 4YYEA 3TEHA 1JJCB 1B7YA 2CJAA 1G5HA 5GAMd 2AMCB 5GMKm 1D3BA 2DJZA 3TUPA 3V8LA 2E5AA 3E9HA 4YRGA 4MMLA 3EFRA 4XU3A 2ZT7A 3JCMW 5GAN5 4NL3A 4EMKA 4C8QB 4V2SA 5GMKe 5GANf 4HT8A 4JRIA 4F7UG 1B34A 4Q6GA 1JBMA 3NETA 4YRNA 4M75A 2VXFA 3MF1A 4YRRA 5GAN7 3VQXA 4YPFA 2ODRC 1SERA 1H4SA 2QHSA 2ZR3A 3BJUA 4M78D 1BIAA 2IY5B 3RIRA 4YRIA 3HTZA 4PJOF 4K88A 1YCYA 3VQYA 2DXTA 1KOGA 3JB9H 4PNOA 1WYDA 3AHUA 4UP7A 2G4CA 2DQ0A 4ZIBA 1N9RA 4CS2A 4H2VA 4AH6A 2DDZA 2CIMA 1C0AA 3IALA 2XTIA 2DTOA 2EJ9A 1H641 2FYKA 2ARSA 4EMKC 3HFNA 4M7DA 1NJ6A 2DU7A 4H2YA 4M77A 4EO4A 3JCMh 4PJOC 3RKYA 2ZXFA 3E9IA 4P75C 2CJ9A 1LNXA 4XTZA 4OP0A 1PYSB 4XTXA 1B70B 3PCOA 2Q5IA 1B8AA 3QNEA 4H02A 1KMNA 4H2XA 4EX5A 1LYLA 1LOJA 4G85A 2QHVA 1SRYA 2ARTA 4YRQA 3HXVA 2DQ3A 1WU7A 4UP8A 1Z7MA 3HFOA 4WJ3M 2ALYB 2DKGA 3FB9A 4M7DG 4DQ2A 1NJ1A 4J6XA 3P8TA 1YGBA 2RHQA 5LJ3h 3JB9I 1KQ1A 1EFWA 2Q7GA 4M75G 2ZZEA 4HWSA 4C92D 5LJ3j 5KNNA 1NYRA 4CH4A 4M7DE 5GAMe 2ZINA 4HWTA 4X9CA 3VU3C 4M78E 3V8KA 5GAOn 3JB9G 4QVDA 2QHTA 1H4VB 1B76A 3G1ZA 2Q7EA 4YCWA 2I4LA 3PGGA 1E24A 4RCCA 3DSQA 4XU2A 4P71C 4HWRA 4M78G 4JRKA 5GAMf 2YHTA 3HY0A 5GAN3 4M7AC 4EMKB 3L4GB 4G84A 4PJOB 4YRPA 3QO5A 5LJ5f 3HRIA 4EMHA 4RQFA 1W66A 5CAIA 3JCMg 1LJOA 4M77G 2DVEA 3NEMA 4HWOA 4A53A 2YLCA 4C92F 4YRJA 3V7CA 4J15A 4C8QG 2RA2A 2C7IA 2Q5HA 4YCUA 4OLFA 3JCMP 5GANh 4M78A 3WQZA 1HTTA 5GAN2 2RD1A 2C8MA 1WQ7A 1TH7A 3UGQA 3A5YA 5GANj 3JCMV 3W3SA 3A31A 2ZNJA 5GMKi 3LSSA 5GAOr 2JN0A 3A32A 4CH3A 4ZTZB 4F7UE 1H4TA 1PYSA 4C8QA 1VQZA 3M4PA 3NENA 3BW1A 4M7AD 4M7DD 4X5OA 4NOYA 3SWNB 1I4K1 4LNSA 4YRLA 3HFZB 5F5WA 4PJOE 2ZGWA 4YP0A 2QHUA 4BWAA 5GAMg 3PZCA 5GAMj 4YRCA 4TVAB 3M4GA 4M7AB 4TVWA 1HK9A 3REUA 2DTIA 2RB6A 4CH6A 1ADYA 2E10A 2AMCA 3RKWA 4P3PA 3QHSA 4P72C 3EFSA 4O2DA 3TEHB 1GGMA 3BDUA 1QE0A 4J6YA 4PHCA 3SWNC 2Q7HA 2DU5A 5GMKl 4Y91A 2E41A 3UGTA 5GAN4 2XGTA 3P8YA 2ZT5A 5LJ3g 4C8QF 5LJ3f 3RL6A 1EQRA 3IKMB 5K1XA 3HXZA 1FYFA 4TWAA 1Z7NA 1IL2A 4K87A 4M77F 5GAOm 1H4QA 3REXA 3MF2A 3VQWA 4KR3A 3RGLA 2ZTGA 1RIQA 1G5IA 4C92A 2EAYA 4HT9A 3L2ZA 1M5Q1 4P3NA 4PJOD 4YRTA 4XU0A 3P8VA 4M75E 3JCMJ 3OD1A 2ZNIA 4JLIA 3V7RA 4HA8A 1EIYA 1KQ2A 2EJGA 1X01A 3QO8A 5ELOA 1NJ8A 3A7UA 4H2XB 4PJOA 1EVKA 1JRIA 4M77C 4P74C 3V8JA 3L4GA 5LJ5h 3A74A 5K1PA 3RF1A 3RKXA 4A54A 4P3OA 4XU1A 2J3MA 1U1TA 1SESA 1E1TA 1Y96B 2EWNA 2E64A 2HNIA 4HVCA 3L1AA 2ZCEA 3VQVA 2E1HA 3NELA 1I5LA 2ZT6A 1I81A 3HXUA 3HXYA 1X55A 4K86A 1USYC 5LJ5d 1E1OA 4M7AE 3RUXA 4XTYA 1USYA 3MEYA 4M78B 2Y90A 5GMKh 2PMEA 1WNLA 4WI1A 4WJ4A 3QUIA 3QO3A 3SB2A 3BY7A 12ASA 4XTVA 5GANe 4RDXA 3IG2A 4ZTUB 2CGHA 3CMQA 2ZZGA 1ASYA 4M75B 4M78C 1NYQA 4N0AA 5LJ5e 2I4MA 4P71A 4TTVA 2EJFA 2K57A 3SWNA 5LJ3e 5GAMh 4L87A 4M75D 4C92G 1X54A 4YRKA 5C52B 3UH0A 2I2LA 4P73C 2VXEA 4M77B 4TQFA 5GAOq 3JB9D 4M7DB 4BW9A 3INZA 4E51A 2YLBA 3JCMf 3JB9J 4PJOG 4M75C 4NL2A 3JCMd 5E3IA 4RMFA 1EVLA 5DY9A 4YCVA 4YRMA 4M78F 4MMKA 1YFTA 4YRSA 3A7AA 3KFUA 3HFVA 2PMFA 3VBBA 3RACA 4NCXA 4XEMA 2FB7A 2I4NA 2RHQB 2ODRD 4CS3A 4YROA 3JB9F 1BBUA 2ZR2A 4JUVA 5GAN8 4M77D 2RHSA 3HSBA 1YFRA 1X2GA 4M75F 2J3LA 5GAN6 3JCMX 2ZZFA 4QVCA 3FIFA 4TVYA 3HXWA 4M7DF 4DPGA 1B70A 3PCOB 4EMGA 1HC7A 5LJ5j 11ASA 1KMMA 1YFSA 3A7RA 4M77E 5GAOl 1QF6A 2ARUA 4M7AA 2DXUA 4C8QE 3I7FA 4KR2A 3HY1A 1EIYB 2VC8A 1ATIA 1D3BB 4N0AC 3RERA 4H2WA 1EOVA 3JCMe 1JJCA 4C92B 4RQEA 4XTUA 4M7DC 2DZ9A 3ERRA 4P72A 2AKWA 1E22A 3ICAA 5GMKj 2CJBA 4M7AF 1L0WA 5I21A 1WQWA 3FJPA 4F7UB 3QO7A 5HGQA 4XEOA 3HRKA 3QTCA 5LJ5g 2P0LA 3LSQA 2ZIOA 2ALYA 4WF2A 4H2SA 1HXDA
chains in the Genus database with same CATH superfamily
3QDFA 1KD1R 2IY5A 2P0PA 3HXXA 1KHCA 4HWPA 1GCQC 4C92C 4C92E 2DO3A 3RESA 1WJQA 1VQ8Q 4RTXA 5FRMA 3M57A 2DYBA 1B34B 3OW2P 2DL3A 3OW2S 5GANd 4B9WA 1P92A 3E19A 1Y0MA 3FJ5A 1GRIA 4M4ZA 4H2UA 3I56T 4J9BA 2ZT8A 3MP6A 4PJLA 1KHIA 3EGXB 2VB6A 1S72A 2HBWA 2EVRA 4RCBA 2LNVA 3C95A 1ZUUA 4F7UF 4ZGDB 2LCSA 2EL9A 3JV3A 3A5ZA 1B7YB 1NJ2A 4ZNXA 3GBQA 2DZCA 1ACMB 2HSEB 2O88A 5CKFA 1SETA 4YRFA 2HD0A 2ROLA 3OYJA 3TSZA 4XTWA 1QVFP 1QVFS 1D0YA 2PVOB 3PFSA 3LC0A 4HT4A 2KE9A 2QTXA 5IN1A 5M9OA 3EG2A 3OS2A 4F7UA 1X56A 5J3BA 3GNGA 2QEXT 1I0CA 3PE0A 4VUBA 3A8HB 1WXTA 3NTHA 2YUPA 1G5HA 1VQKA 3DB3A 3OYYA 5GMKm 2HDAA 3EG3A 4IIMA 5CVIA 2DJZA 1Z9QA 3I9QA 3VRZA 3V8LA 1Q95G 3E9HA 2QGFB 4MMLA 3EFRA 1QWFA 4O6JA 1PSFA 5FRNA 5CK9A 3G4SQ 2NLUA 3MEVA 1RI0A 2DF6A 4C8QB 5GANf 1C1AA 2H3JA 2SRCA 4RKUE 1VQ4T 4HT8A 1VQ5A 1JBMA 4HVVA 2NYSA 2IPOB 4YPFA 2ODRC 2PUKB 2EKHA 3LYIA 1PRMC 1BI2A 1S72Q 3BJUA 2BIVA 1BIAA 1I1JA 4RTWA 3P8HA 2RJEA 3RIRA 4YRIA 4K88A 1IO6A 1S1NA 4OMPA 2CSIA 2QG9B 4LVIA 3AHUA 3CCMT 2JJ9A 2JS0A 3LGLA 4AH6A 2HQEA 3M56A 3MEUA 1M2OA 3G7ZA 3OMGA 4IUPA 2XTIA 2DTOA 3TSWA 1OI1A 2KXCA 4FYWB 1HJDA 2K3XA 3OMCA 1H3HA 1HD3A 2JTEA 3JSCA 4EO4A 2F69A 3VYHB 3OYKA 3JCMh 1MMDA 3RKYA 4P75C 4BACA 1LNXA 4OP0A 1PYSB 3PCOA 5J26A 2D0NA 3OBYA 1GXIE 3URGA 4H2XA 1VQLQ 1YCSB 2DVJA 2RHYA 2J6FA 2F1LA 2AIRB 2CDTA 2E5KA 1O75A 1XTDA 1IGQA 2YSQA 4WJ3M 3H0FA 3ME9A 2XG8D 4ZGJB 3I5SA 2LRQA 3JB9I 2Y4XA 2Q7GA 1TG0A 4DBRA 3OYFA 3CCVA 3S3OA 2R57A 3HRSA 4M7DE 5L8RE 3L2UA 4HWTA 3EFOB 3JB9G 1KK7A 2QHTA 4BE2A 1NLOC 1WHGA 1H4VB 4YCWA 4IUVA 3PT9A 4CC3A 2EFIA 4HWRA 2RI5A 1LPLA 4LXCA 4EMKB 2AZSA 4AT1B 1NM7A 3WVDB 3TU4K 2RH2A 3MO8A 3VRYA 4IKFA 3H0HA 4F14A 5LJ5f 2ZPGB 2RQWA 5KCHA 2LJ1A 2DILA 4HWOA 1BBZA 1IREB 4J15A 1QVPA 1VQMA 1WXUA 4C0DB 1YIJA 1GCQA 1QP3A 2KSSA 3TQ7P 3OYHA 3JCMP 1OULA 3OYDA 5GAN2 1VQ5Q 1TH7A 1G8XA 2CZ7B 5GANj 2DL4A 1N27A 4J9FA 2QI2A 3NPFA 4ZN1A 4MZTA 2JTFA 2JN0A 1OZ3A 2KGTA 2XMFA 3NENA 3BW1A 5LL6S 1UTIA 1WIEA 5F5WA 2OAUA 4YP0A 2C0TA 1YJNT 1VQ5T 3PZCA 4M7AB 2YUNA 2BZXA 3MHXA 4GLKA 4P3PA 5HCKA 1B3QA 1RAAB 2CZ6B 2ATCB 2L5QA 3EFSA 3OSVA 3BDUA 3QYGB 2Y4YA 1QE0A 1JO8A 4E6RA 3KBGA 2DETA 4A4EA 3HKSA 2QXFA 2DU5A 1ZLMA 3NTKA 5GMKl 3M54A 4KUIA 3UGTA 2XGTA 4E7JA 4E7IA 1HSQA 6AT1B 5FWCA 4TWAA 1IL2A 4K87A 1CKBA 5GAOm 2FZCB 3X26B 2EKOA 3MF2A 1RIQA 8AT1B 3P8VA 4M75E 3OD1A 1IB8A 2FRYA 3BE3A 2RHUA 1EIYA 5FU6C 3M0UA 3QO8A 4WTOB 4PJOA 2MAMA 2P4RA 1YBYA 2KI7A 4J9EA 5K1PA 2WACA 3RF1A 4F17A 3FDRA 1G3YA 1U1TA 1V29B 1Y96B 2EWNA 1GFCA 2E64A 2CP6A 4HVCA 3L1AA 3RMQA 3LH5A 2ZCEA 3VQVA 2EQMA 2HQHA 1Q82C 4DOVA 5J39A 5D6YA 1I5LA 1D0ZA 1MV0B 4B9XA 3LWIA 4R56A 1Q7YC 1X75C 4K86A 1X6GA 2ECZA 1VQPT 1VQ7A 1QVFA 2FPEA 4E2FB 1NYFA 2IG0A 1TUCA 2DA9A 4WJ4A 2ZPHB 3QUIA 3DLMA 2BZ8A 3QO3A 3SB2A 2EYYA 3BY7A 12ASA 1BYMA 1PCXA 2XICA 2YUQA 5AT1B 4N4GA 3CMQA 2ROTA 1ASYA 3LWHA 4J8OA 1LVKA 2MOXA 3OS5A 4N0AA 2EJFA 4Z8AA 5D6WA 5LJ3e 2A0FB 1ABQA 3I55A 4YRKA 3UH0A 2I2LA 3ZFJA 1SHGA 4M77B 3META 1F1BB 2KRMA 3JB9D 4BW9A 2DRKA 1YITT 1D1BA 4PJOG 5E3IA 4RMFA 1GCPA 2DIQA 4M78F 4MMKA 1WJSA 1V76A 2A36A 3A7AA 2DYIA 1G3WA 2PMFA 2KRNA 3CXCP 3CXCS 3CC2Q 4ELZC 2ODRD 3JB9F 1OPKA 2O4XB 4RTYA 5GAN8 1YJWQ 1YP5A 3FEOA 4DBQA 1KQSA 2MPXC 4M75F 3JCMX 2YUOA 2X4XA 1T0HA 2RK1A 1NPRA 4ME7A 4OB1B 1BU1A 1OYXA 2L8DA 4WCIA 3HRTA 2CKKA 1ZUKA 4M77E 4OMQA 1IHWA 2M0YA 4M7AA 2C06A 1PG5B 1BB9A 3AT1B 3QYHB 1D3BB 4LUDA 3QKJA 3EH2A 3VS6A 1EOVA 5KYXA 1JJCA 4C92B 4RQEA 1J3TA 4M7DC 2VV5A 2HL5C 4PFPA 3P8BB 4BDYA 5I21A 1TOVA 2M9UA 4XEOA 3QTCA 4ANJA 3CD6T 3LSQA 4WF2A 5IT9E 2QDYB 1B07A 2GFAA 4H2TA 4BE0A 1G51A 1N9SA 2HSPA 1OQKA 4OMOA 3GIBA 1RAIB 1I8FA 4FYYB 4YREA 1YB3A 1K8AR 4OB0B 2NUPB 1VQ6T 3M4QA 1VQ7Q 4X9DA 4PKCC 5IXBA 2X35A 2DEQA 4UPAA 5ELNA 4JJCA 5GAOp 3EAEA 2GQVA 4ZTFA 2BTTA 2V8JA 5KE2A 1N9WA 3ZL7C 4P74A 3QSUA 2OX7A 1PRLC 3IKLA 4GBQA 1K0XA 4J5YA 4PG3A 1MMGA 3BFMA 5CQYA 1NG2A 2JW4A 4JDSA 3M0RA 5GANg 1NJ5A 3TEGA 2E65A 2K3YA 3OYEA 3ASKA 2ZIMA 1UDLA 2OJ2A 4XQ3A 2E6ZA 4FT4A 4M7AG 1U1SA 4NS5A 4XK8E 4J9HA 3JCMc 2OTJA 3R07A 2AHJB 1BBWA 1RUWA 3CEYA 1M1KC 2VVKA 3JCMb 4KQEA 4PFZA 3CCEQ 3DKMA 2G6FX 1VQ4A 5C51B 3G6EA 2ZAEA 1K4US 3G4ST 4RUGA 1D3BA 1UHCA 2QQ9A 2MF2A 2CH4A 3KUFA 4A4KA 3TUPA 2L3QA 2RHIA 2EYXA 4XU3A 1QP2A 5IAYA 2KAFA 1YHQA 1Y71A 1Y7XA 5GMKe 4V2SA 4BD3A 4F7UG 4HCBA 1B34A 2RHZA 4BI8B 3OYLA 1VQNT 4Q6GA 2MK5A 3WXMB 2CP3A 3NETA 4M75A 2XDDA 4YRNA 2VXFA 4YRRA 3N5BB 1M3CA 2HCKA 1VQ9A 1UUEA 2XDPA 2EGEA 3H6ZA 4MZPA 1QWEA 4PL6A 2DXTA 1KOGA 1WHJA 3CC7Q 2KDSA 1YN8A 2RI3A 1WYDA 4UP7A 5IHIA 1KQSS 4CC2A 1KQSP 1A0NB 3TVTA 1N9RA 3CCEA 2DDZA 4FU6A 1PKTA 1M30A 3A1PA 1UG1A 1X43A 3UT1A 2FYKA 2ARSA 3HFNA 4M7DA 3IQLA 2CREA 2EQUA 5A0DA 3H0IA 3I56A 3L2VA 3CCET 4C0ZA 4QQGA 3CPWA 4Z89A 2VUBA 2EYWA 1WZOA 1C6VX 1B70B 4OMFB 2COYA 2HKQB 2IVWA 4C0DC 2VWFA 1SRYA 3LGFA 1W4SA 2RQRA 3HXVA 2DQ3A 2LDMA 1AD5A 3HRUA 1D09B 2QA4Q 2RF0A 3HFOA 2KVQG 1GBQA 2DKGA 1VQMT 4EPCA 2Z0WA 2GFUA 4DQ2A 1NJ1A 3P8TA 2K2MA 2RHQA 4N4HA 1D0XA 4K11A 1VQNA 2D8HA 4M75G 2ZZEA 4HWSA 4C92D 2JUFA 2G3RA 3EHQA 3OYMA 1NYRA 1M1KU 1VYTA 1KD1C 2XU8A 4Y28E 3G1ZA 1T3SA 2Q7EA 4D6WA 2I4LA 2DL5A 3H41A 2QEXA 4M78G 4JRKA 5GAMf 2YHTA 2RJCA 3HY0A 4M7AC 3GOXA 3OB9A 3L4GB 1NEBA 2KEAA 5FWBA 1KD1U 4PJOB 3H9NA 4YRPA 2VGMA 4EMHA 4RQFA 1W66A 2DL8A 2FZGB 1YJNQ 1TTHB 2DVEA 5CO7A 1QCFA 3CCLQ 3NEMA 2YLCA 3X25B 4BE1A 1YNZA 3V7CA 4C8QG 2RA2A 5IXFA 2OTLQ 4YCUA 1JXMA 4E7LA 2MMPA 1K9MC 4KUDK 3E1SA 2HQXA 1HTTA 5I2MA 2M1HA 2A37A 2GTJA 1WQ7A 2DMOA 4IUTA 4LUEA 5D7UA 1M2VA 3JCMV 3OYAA 1OU9A 3A31A 3FC3A 1EFNA 2AKKA 3LSSA 1NBEB 1K9MU 3HTRA 3C4SA 2BKDN 5EG2A 2NWMA 2PNIA 2GTOA 5FROA 4E7KA 4F7UE 5HK3A 5DLOA 3CC7A 1VQZA 4M7AD 4M7DD 4X5OA 2J6OA 1VQNQ 2L3RA 2MWOA 4J9CA 3QBYA 4BWAA 2LQWA 3LX7A 4YRCA 3M4GA 2OI3A 2CZ1B 2SEMA 1ZBJA 3GF5A 2E4HA 1JJ2P 1JJ2S 2DTIA 1T0JA 5I11A 2LX7A 2ZCFB 3M0QA 5FU7C 4O2DA 3TEHB 2QQBA 4PHCA 5D6XA 1YHQT 1TWBA 2FPFA 2DLPA 3G71T 3CC4A 5GAN4 3PTAA 3I5RA 3P8YA 2XD0A 2ZT5A 5LJ3g 5LJ3f 1OU8A 2YRCA 2MYSA 1EQRA 3UDCA 5C0MA 5K1XA 3EG0A 1FYFA 2YRVA 1YHQQ 2HEQA 1WXBA 1BK2A 1H4QA 3M5AA 5A0LA 1X2QA 1WDXA 2E6NA 1W2BA 1M4ZA 2ZTGA 3CCRT 2KQWA 1G5IA 4FYVB 4IURA 4C92A 2EAYA 3M9QA 4HT9A 3L2ZA 2RJDA 4PJOD 4YRTA 2CZ0B 4XU0A 4HCKA 3A8GB 2ZNIA 4JLIA 3V7RA 1OOTA 2O9SA 1KQ2A 3JRZA 2HZYA 1CSKA 1Y57A 3A7UA 1AZGB 1YI2A 1K73C 4J9IA 1KC8U 4M77C 1ZA1B 3A74A 5CKEA 3RKXA 1K8AC 4KGXB 2L3SA 5HY6A 1SESA 1E1TA 8ATCB 3SHWA 2JM8A 1U06A 1M1GA 2GNCA 3MP1A 1FMVA 3L42A 2E1HA 1YIJQ 3NGPA 3PVLA 1UFFA 3CCMA 2ZT6A 3CXCA 3HXUA 3HXYA 2JMCA 1USYC 2OTLT 4M7AE 2CUDA 3RUXA 3VS7A 1R0CB 1WHHA 2P0KA 1RABB 2Y90A 2LT4A 5CQXA 3E9GA 2M16A 1WHMA 2NS6A 1YITQ 1CKAA 1VQ4Q 3SFMA 4CC7A 2HAXA 1M27C 1V1CA 3OA6A 1SF9A 4RDXA 3QIIA 2V8KA 1W6XA 1NYQA 5C6SA 4P71A 2HKNA 2K57A 1K8AU 4M75D 4C92G 5KYUB 2KROA 4PJJA 5C52B 2LJ3A 2DK3A 5KCOA 2X4YA 4YTLA 2ZPFB 1TS9A 3E9FA 3VS0A 1ZX6A 4RTZA 2XI9A 3OYNA 1EVLA 4JJNK 2J6KA 1TSFA 2MWPA 2DD4A 3S6WA 3VBBA 4R0KA 2I4NA 2RHQB 4JS5A 1ABOA 2KYMA 2PTKA 1VOMA 4D8KA 2NUZA 3GP8A 4M77D 4LVKA 2LC4A 2HBPA 4KH0B 1XNIA 2D6FA 5GAN6 1UJ0A 4QVCA 2L0AA 2CP7A 2EYQA 4TVYA 3CMEQ 4Y92A 4DPGA 1HC7A 4ORZA 3J81E 11ASA 5KYWB 2OAWA 3CC4Q 3CCVT 3A7RA 1WX6A 4LDUA 3VYGA 4XAXB 4AFSC 5GAOl 3A8OB 2DXUA 4C8QE 3CPWP 3CPWS 1PC0A 2XHCA 3HY1A 2VC8A 1EIYB 1KG1A 2P0QA 1ATIA 4A63B 2DNUA 3VS5A 3RERA 2QA4A 2DL7A 2A28A 2RO0A 1QCNA 3ERRA 3NFCA 1SHFA 4P72A 2CT3A 4M7AF 2CJBA 1L0WA 1E6GA 1X27A 1NJIR 4H2SA 5HKCA 1Q7YR 1HXDA 2RQUA 3C12A 2LMJA 3CMAA 3UATA 5LJ3d 4QW2A 2KY9A 1VQ6A 2RN8A 3OYBA 3L2QA 1VQ8A 2E3CA 3M59A 5A2QE 4PLIA 1MGQA 2L2PA 2AKWB 1VQKQ 4J6WA 2QA4T 3A5ZB 3CBOA 4UP9A 3JCMQ 2EW3A 2KRSA 3L2WA 4JRPA 1VQOT 4OMLA 3CD6A 4BI3A 2EGAA 4C8QC 4TVAA 2A7YA 2PUOB 2P5IA 4DBFA 2MIOA 4CS4A 1U5SA 1BIBA 2CS7A 4IUQA 3HFZA 2K5LA 1QKXA 5KYWA 2RM4A 1WPYA 2DTHA 3OBWA 3A98A 2O9VA 3V7SA 2I4OA 1M8VA 1NEGA 1N6AA 2EIFA 3NHNA 2F5KA 1GFDA 5C53B 1RAFB 1M90R 4A4HA 3OS0A 1ADJA 1ASZA 1PWTA 2DERA 1U8RA 2V1RA 2LQKA 4TQDA 1K73R 2DRMA 2EPDA 3M4YA 4YDQA 1TUGB 4TVRA 4YYEA 3RR6A 4J7IA 5CIUA 1Y07A 2CJAA 2COWA 2MI6A 1YJWT 1WA7A 5IHNA 2VASA 4MDWA 2DIGA 2FL7A 2O2OA 3I35A 5IHKA 4OMMA 3X24B 3MQZA 3CCUT 1RLQC 4RTUA 3CCMQ 2AK5A 4PJNA 5GAN5 2JM9A 5KYUA 2AT1B 2QQAA 4EMKA 1ZA2B 4FSSA 5KE3A 3ZBDA 5CKHA 1QKWA 4JJBA 3VQXA 5GAN7 3UA6A 1Q86C 1I07A 1OX8A 2QK0A 2LCLA 2R5AA 3RMSA 2ZR3A 4M78D 2JT4A 3EGUA 2LQNA 3M0TA 4CRIA 2W0ZA 5KYYB 4PJOF 3LLRA 3HTZA 1YCYA 1JQQA 2FO0A 1M90U 3VQYA 1B7TA 2AZVA 3PVQA 1VQOQ 2G4CA 1Q81R 1X6BA 2V26A 2WSFE 1OPLA 4N4IA 1C0AA 1MNDA 1R0BG 1TU0B 2EJ9A 1W2BP 1W2BS 1QMCA 1T3LA 4EMKC 1NJIC 1NJ6A 3OYCA 2DU7A 4BI4A 4PJOC 3UA7A 4LVJA 2ZXFA 4RTTA 2CJ9A 1VUBA 4X1VA 5I22A 4XTZA 1XOVA 2KT1A 2NUPA 1M3AA 2QQSA 4H02A 1SRMA 1LOJA 4G85A 2QHVA 4O5VA 4HKEA 3EFOA 2ARTA 5CCAA 4YRQA 1WU7A 2X3XD 4PFOA 3TCJA 1FMKA 1VQMQ 1M90C 2GF7A 2ALYB 4M7DG 1GL5A 3ER0A 1YGBA 1EFWA 1KQ1A 3G4SA 3E2UA 3M53A 5KNNA 4CH4A 4JRQA 4FL6A 4A4GA 3VU3C 1Q81U 4QVDA 4J83A 2QGGA 3I56Q 1B76A 2E70A 4QT7A 3PGGA 1E24A 2DE0X 1SSHA 4XU2A 3CCUA 1M1KR 1VQKT 1KSWA 4EIKA 2DBMA 2DBKA 1BI0A 2CP5A 5FU7B 3QO5A 3DLLA 1Q86U 1ZSGA 5CAIA 3JCMg 1LJOA 2D1XA 1PNJA 4A53A 3QG1A 4YRJA 3PNWC 3OSSC 2Q5HA 3CBMA 4OLFA 2JXBA 5GANh 4M78A 1EIFA 3CC2T 3WQZA 4JS4A 2RD1A 3RDVA 1KIKA 2C8MA 3CCRQ 1YJNA 1Q81C 2QYZA 4ESRA 2BE9B 2PU9B 4E7HA 2K4YA 2RHXA 3CC4T 4DA4A 2ENMA 3W3SA 4DOWA 4FW1A 5GAOr 3QJYA 3A32A 5L23A 3T9NA 4KRTA 1YITA 4LNPA 2DFUA 2RJFA 1H4TA 2JTMA 4C8QA 1XQHA 3M4PA 2FZKB 3C94A 1X2KA 4YRLA 3HFZB 4LD9K 4FT2A 4C0GA 2ED1A 3JAME 4C5GA 3I55T 2LQ8A 4TVAB 2XKOC 1FX7A 4QQDA 4JPBW 1PM3A 3REUA 4CH6A 2E10A 4AFQC 3PIPA 4GLMA 2EGCA 1SRLA 1W70A 2FHDA 3SWNC 4R55A 2Q7HA 4HCCA 1BI3A 4Y91A 3D7SB 2B86A 2CP2A 4HVUA 3UF4A 2LTOA 1OEBA 4C8QF 3ZEHA 3OS1A 1WHLA 2NUTA 3HXZA 1WFWA 2DM1A 2ZPBB 2CUBA 2KBTA 2PVDB 2RI2A 4OMNA 4JJDA 3L2RA 1UGRB 4L59A 1O9SA 4ZGEB 3RGLA 4KR3A 4KGZB 2CT4A 4OGCA 3THKA 2RK2A 3RBBB 1SSFA 4D8DA 2K79A 3PMIA 3KFVA 3JCMJ 4PJMA 2DXCA 1YWOA 4C5EA 3CBPA 5ELOA 2H8HA 2FPDA 4AFZC 4P74C 3V8JA 1K9MR 3L4GA 5LJ5h 1UGVA 2RPNA 1G3SA 1RLPC 2K6DA 4UC4A 2XDBA 1KC8R 3X20B 2LX9A 3VUBA 1D1AA 2JVVA 1M3BA 3M58A 4E7ZA 1YJ9T 1EX4A 4OB2B 2F2XA 2DX1A 2KNBB 3QDRB 1X55A 4C5HA 1FXXA 4MZMA 1E1OA 4BY6B 4XTYA 4M78B 3EH1A 3C0CA 3SDZA 1WNLA 2QASA 1AWXA 2FVUA 1Q7YU 1RAEB 2K5FA 2YWWA 2D0QB 3P8DA 2WSCE 4XTVA 3O8VA 3UWNA 4ZTUB 2COZA 2J06A 2ZZGA 1C0MA 4M75B 4M78C 5LJ5e 2I4MA 4TTVA 3LH0A 4L87A 2KR3A 1X54A 3MEAA 3GNFB 3CCVQ 4P73C 2VXEA 2LVMA 4M7DB 1WLPB 5CR2A 3JCMf 1YJ9A 3JB9J 2E5QA 4J7FA 4M75C 4NL2A 3QWXX 1FWZA 2BZYA 4KT0E 5DY9A 4YCVA 4YRMA 2F5TX 4HVWA 3KFUA 1Q86R 1M9SA 1RI9A 2R5MA 5HK0A 2KMTA 3G6ET 1H3ZA 3GPLA 4NCXA 1M1FA 4XEMA 1NLPC 1QQJA 4CS3A 1BBUA 2ZR2A 9ATCB 2EQJA 3U23A 2RHSA 3MPUB 4JZ4A 3FRNA 2J3LA 2HMAA 3VKIA 2ZZFA 3CCSA 3FIFA 4OB3B 3CCQQ 3HXWA 3Q1JA 4M7DF 4RTVA 4DBHA 3PCOB 1VIEA 1IZ6A 1RACB 4EMGA 2GCXA 2V8IA 4F16A 1SG5A 4CC4B 1BCOA 1K0SA 2ARUA 3I7FA 3QXEB 1VYVA 4KULA 4F04B 1IHVA 1WI7A 2OTJQ 1WGSA 3DB4A 3M0PA 2P84A 3CCJT 4H2WA 2V1QA 4XTUA 1UGSB 1YJ9Q 3MP8A 5GMKj 3M55A 3ICAA 3CQTA 1KFZA 3VS3A 1S72T 5HGQA 3CCLT 4Z88A 2P0LA 1WJRA 2ALYA 3G71A 5FLXE 1JB0E 4RG2A 4KH1B 1AWJA 1YFNA 4P5NA 2K3BA 1I5OB 2OTJT 2X4WA 2GGRA 1AWWA 4CH5A 1W1FA 1AOJA 3CCUQ 2D9TA 4C8QD 1H8KA 1SKUB 3OQ5A 1NNHA 1RL2A 2X9HA 1JU5C 2CYZB 4PK4A 4ATOA 2K9GA 3CC7T 3UFGA 3X28B 1WLEA 1U3OA 3VS4A 1H92A 3CMAQ 2QTVA 1ARKA 1PD0A 1X2HA 2QDLA 4P75A 1MHNA 2X4JA 1NE8A 1MNEA 1ZBXA 3RNJA 1D1CA 4HXJA 4FM4B 1QVGA 5ECAA 2I0NA 1RAHB 4BDZA 2JMAA 1J5WA 1OX9A 5KYYA 2EBPA 4Q15A 1VIFA 3BDLA 1ZSZA 2QQRA 2RHSB 1UJYA 1ZHIA 5EC7A 2O01E 1Q82U 3I55Q 3REAB 4P73A 1X6OA 1Y96A 3G6EQ 3O5ZA 2M02A 2ABLA 1SEMA 1E7OA 4L5GA 1UHFA 3TEHA 3WVEB 5KYXB 1B7YA 1JJCB 1G3TA 2PVGB 3R6NA 3EG9A 5GAMd 2AMCB 1MMNA 5GJVB 1OV3A 3OW2A 1YJWA 3EHRA 2E5AA 4YRGA 1VQOA 2WSEE 2ZT7A 1UB4A 3JCMW 4NL3A 4JRIA 1MV3A 2ED0A 3UPUA 1BKBA 3MF1A 1SERA 1H4SA 2DJQA 3OY9A 4ZTJA 2QHSA 1M2VB 4HCZA 2IY5B 2JZ2A 1K1ZA 4X34A 4BB7A 2O4XA 2ZPEB 1VQLA 1ZQ1A 2CH4W 2QEXQ 4DEXA 4QVZA 3JB9H 4PNOA 1VQPA 1VQ7T 3EGDB 4JLGA 1AWOA 1Q82R 2DQ0A 4ZIBA 1PKSA 4CS2A 4H2VA 2QAZA 1N8RR 4AMCA 1VQ6Q 2CIMA 3IALA 1G83A 4JZ3A 1UEBA 1FMWA 3QZ5B 1H641 3EGXA 1NPPA 4H2YA 4M77A 3PIOA 4PLLA 3QJ6A 2LCCA 3CMET 1VA7A 3E9IA 2ZPIB 1SPKA 3HPWA 3QPHA 3KXTA 4CI0C 3SEMA 4XTXA 2J05A 4FW2A 4LD6A 4AG1C 1JEGA 2Q5IA 1B8AA 3QNEA 4Q5WA 5GJWB 1EZZB 2O31A 4OVAA 1KMNA 3VUZA 1YIJT 4FSXA 4EX5A 1VQ8T 1LYLA 1VQLT 4LN2A 5DM7R 4UP8A 3CCJQ 1NYGA 1Z7MA 3NMZC 3REBB 3FB9A 4C5IA 3EGDA 4J6XA 3ULRB 5LJ3h 4EDUA 2KYBA 3H8ZA 2DD5A 5LJ3j 3G1JA 5GAMe 2ZINA 1NZ9A 1YI2Q 3VS2A 4X9CA 1QLYA 4M78E 3V8KA 5GAOn 2M0OA 2LNHB 1K76A 3CCST 1UECA 3HHTB 3HP9A 4RCCA 3A8MB 3DSQA 4P71C 4BUGA 1AVZC 2XIDA 4FCYA 5DLQE 5GAN3 3QZ9B 2L3PA 4G84A 4RMOA 1N5ZA 3J80E 3HRIA 3A8LB 4LDWA 4M77G 2PQWA 4C92F 1IXDA 2C7IA 3LW5E 4A4FA 1KJWA 2YXYA 2ESWA 3VV0A 3VJPA 3OYGA 3S3MA 2VYTA 2FRWA 1RADB 3UGQA 3A5YA 5KYNA 2RQTA 1G5VA 2C0IA 5A0GA 4ZN3A 2X3WD 2ZNJA 5GMKi 2LZ6B 2DPPB 4CH3A 1BCMA 4ZTZB 4E47A 2BUDA 2X51A 3TREA 3CCQT 1G2BA 1PYSA 1VQ9T 4NOYA 3SWNB 1I4K1 4LNSA 2K2VA 4PJOE 1JXOA 2ZGWA 4LDYA 2QHUA 3TEEA 5GAMg 1VQPQ 1NJIU 5GAMj 4RG8A 4TVWA 4LVLA 1HK9A 1TXQA 2RB6A 1ADYA 1MMAA 1ZSZC 3EG9B 3RKWA 2AMCA 3QHSA 2C0OA 4QKUA 4P72C 3CCLA 2LP5A 1GGMA 1PD1A 4J6YA 5I2SA 1DJ7B 2E41A 2K5IA 3F70A 3CD6Q 3R6OA 1IGUA 3RL6A 1PSEA 3IKMB 1HYOA 1ZSZB 4GY5A 2IIMA 1Z7NA 4M77F 7AT1B 3REXA 1Z9ZA 2GQIA 3MEWA 1OZ2A 2H3EB 2KXDA 2JS2A 3VQWA 3VS1A 3EG1A 2CP0A 2YDLA 1M5Q1 4P3NA 4J9DA 3GLXA 3CCSQ 2DAQA 1YI2T 4B6MA 4IUUA 4HA8A 1AT1B 2KK4A 2DXBA 1X01A 2EJGA 2W10A 3HL8A 1NJ8A 1UE9A 1BI1A 4H2XB 4J9GA 1EVKA 1JRIA 1N8RU 1TUDA 4A54A 3CCRA 3M0SA 4BY6C 4P3OA 4XU1A 2J3MA 1JJ2A 1K9AA 3PMTA 2HNIA 2L89A 3FLGA 2BE7D 4ELYC 5FU6B 1QCOA 3NELA 2VGNA 2D8JA 4OGEA 1I81A 2LJ0A 1QVGP 4KBMB 1QVGS 2GBQA 5LJ5d 2LT1A 4II1A 2VKNA 3CPFA 1VYUA 3CMEA 1USYA 3MEYA 4LDXA 2E3HA 1YWPA 5GMKh 2PMEA 3MCAB 4C0FA 4WI1A 1AEYA 2A08A 2F2WA 1X69A 5KH6A 3J7AF 5GANe 2HL3A 3IG2A 2CGHA 2FEIA 3G71Q 3NTIA 4FYXB 4LVMA 2A8EA 1GBRA 4MDXA 5GAMh 3SWNA 3OYIA 2OTLA 1VQ9Q 4FIBA 3CCJA 2FG0A 4Z02A 3CC2A 2R58A 2EQIA 4TQFA 2CSQA 2RMOA 5GAOq 3INZA 4E51A 2YLBA 1M8MA 5AYFA 2J7IA 1IRXA 3JCMd 2DEUA 1FYNA 2KT8A 2YT6A 4YRSA 1YFTA 2EYZA 2M51A 2PZ1A 4DEYA 1AZEA 3HFVA 3RACA 2RNAA 3QWYA 2FB7A 2E3IA 2EQKA 1PHTA 2P4TA 4YROA 4LE9A 5CKDA 4L6V5 3MJXA 1AHJB 4JUVA 2JNGA 3HSBA 4LDVA 1YFRA 1X2GA 4AG2C 3S3NA 4QQ6A 1UGQB 4IIOA 2XK0A 1R8OB 4KGVB 2RQVA 2K7AA 1N8RC 2B8AA 1K73U 1LCKA 1KC8C 1B70A 3SD4A 2E12A 2YRDA 5LJ5j 5IH2A 2MCNA 4E7SA 1KMMA 5CKBA 1WYXA 4OF1A 1YFSA 4AFUC 2AKLA 1QF6A 1E6HA 1ZUYA 4KR2A 2A3LA 1MUZA 4N0AC 1WHKA 3JCMe 3MKDA 2F2VA 2DZ9A 2AKWA 1E22A 3CMAT 1WQWA 5FW9A 1QW1A 3FJPA 4F7UB 3QO7A 3HRKA 2JOYA 5LJ5g 1R77A 1RAGB 1XJWB 2ZIOA 2NUTB 3CCQA 2ZZDA 1UGPB
chains in the Genus database with same CATH topology
2IY5A 2P0PA 3HXXA 1KHCA 4HWPA 4C92C 4C92E 2DO3A 3RESA 1WJQA 5FRMA 3M57A 1B34B 3OW2S 5GANd 4B9WA 1P92A 3E19A 4H2UA 3I56T 2ZT8A 3MP6A 1KHIA 1S72A 4RCBA 2LNVA 3C95A 4F7UF 4ZGDB 2EL9A 3A5ZA 1B7YB 1NJ2A 2DZCA 5CKFA 1SETA 4YRFA 2HD0A 3OYJA 4XTWA 1QVFS 2PVOB 3PFSA 3LC0A 4HT4A 2QTXA 5IN1A 5M9OA 3OS2A 4F7UA 1X56A 5J3BA 3GNGA 2QEXT 4VUBA 3A8HB 3NTHA 1G5HA 1VQKA 3DB3A 3OYYA 5GMKm 5CVIA 2DJZA 3V8LA 3E9HA 4MMLA 3EFRA 4O6JA 1PSFA 5FRNA 5CK9A 2NLUA 3MEVA 1RI0A 4C8QB 5GANf 2H3JA 4RKUE 1VQ4T 4HT8A 1VQ5A 1JBMA 4YPFA 2ODRC 2PUKB 3LYIA 1BI2A 3BJUA 2BIVA 1BIAA 3P8HA 2RJEA 3RIRA 4YRIA 4K88A 4LVIA 3AHUA 3CCMT 3LGLA 4AH6A 2HQEA 3M56A 3MEUA 3OMGA 3G7ZA 4IUPA 2XTIA 2DTOA 1OI1A 2K3XA 3OMCA 3JSCA 4EO4A 2F69A 3VYHB 3OYKA 3JCMh 3RKYA 4P75C 4BACA 1LNXA 4OP0A 1PYSB 3PCOA 5J26A 3OBYA 1GXIE 3URGA 4H2XA 2RHYA 1O75A 1XTDA 4WJ3M 3ME9A 2XG8D 4ZGJB 2LRQA 3JB9I 2Y4XA 2Q7GA 3OYFA 3CCVA 3S3OA 2R57A 3HRSA 4M7DE 5L8RE 3L2UA 4HWTA 3JB9G 2QHTA 4BE2A 1H4VB 4YCWA 4IUVA 3PT9A 2EFIA 4HWRA 2RI5A 4EMKB 3WVDB 3TU4K 2RH2A 3MO8A 4IKFA 5LJ5f 2ZPGB 5KCHA 4HWOA 1IREB 4J15A 1QVPA 1VQMA 1YIJA 4C0DB 1QP3A 2KSSA 3OYHA 3JCMP 3OYDA 5GAN2 1TH7A 2CZ7B 5GANj 1N27A 2QI2A 4ZN1A 4MZTA 2JTFA 2JN0A 1OZ3A 3NENA 3BW1A 5LL6S 5F5WA 2OAUA 4YP0A 1YJNT 1VQ5T 3PZCA 4M7AB 3MHXA 4GLKA 4P3PA 2CZ6B 2L5QA 3EFSA 3OSVA 3BDUA 3QYGB 2Y4YA 1QE0A 3KBGA 4A4EA 3HKSA 2QXFA 2DU5A 3NTKA 5GMKl 3M54A 4KUIA 3UGTA 2XGTA 4E7JA 4E7IA 4TWAA 1IL2A 4K87A 5GAOm 3X26B 2EKOA 3MF2A 1RIQA 3P8VA 4M75E 3OD1A 2RHUA 1EIYA 5FU6C 3QO8A 4PJOA 2MAMA 5K1PA 1YBYA 2WACA 3RF1A 3FDRA 1G3YA 1U1TA 1V29B 1Y96B 2EWNA 2E64A 4HVCA 3L1AA 2ZCEA 3RMQA 3VQVA 2EQMA 1Q82C 4DOVA 5J39A 5D6YA 1I5LA 4B9XA 3LWIA 4R56A 1Q7YC 1X75C 4K86A 1VQPT 1VQ7A 1QVFA 2IG0A 4WJ4A 2ZPHB 3QUIA 3DLMA 3QO3A 3SB2A 3BY7A 12ASA 1BYMA 2XICA 4N4GA 3CMQA 1ASYA 3LWHA 4J8OA 3OS5A 4N0AA 2EJFA 5D6WA 5LJ3e 3I55A 4YRKA 3UH0A 2I2LA 3ZFJA 4M77B 3META 3JB9D 4BW9A 1YITT 4PJOG 5E3IA 4RMFA 2DIQA 1WJSA 4M78F 4MMKA 3A7AA 1G3WA 2PMFA 3CXCS 4ELZC 2ODRD 3JB9F 2O4XB 5GAN8 3FEOA 1KQSA 4M75F 3JCMX 2X4XA 2RK1A 1NPRA 4ME7A 4OB1B 1OYXA 2L8DA 3HRTA 2CKKA 4M77E 4M7AA 2C06A 3QYHB 1D3BB 3QKJA 1EOVA 1JJCA 4C92B 4RQEA 4M7DC 2VV5A 3P8BB 4BDYA 5I21A 2M9UA 4XEOA 3QTCA 3CD6T 3LSQA 4WF2A 5IT9E 2QDYB 2GFAA 4H2TA 4BE0A 1G51A 1N9SA 3GIBA 1I8FA 4YREA 1YB3A 4OB0B 1VQ6T 3M4QA 4X9DA 4PKCC 2X35A 2DEQA 4UPAA 5ELNA 5GAOp 3EAEA 2GQVA 4ZTFA 2V8JA 5KE2A 1N9WA 4P74A 3QSUA 3IKLA 4J5YA 4PG3A 3BFMA 5CQYA 4JDSA 3TEGA 5GANg 1NJ5A 2E65A 2K3YA 3OYEA 3ASKA 2ZIMA 4XQ3A 2E6ZA 4FT4A 4M7AG 1U1SA 4NS5A 4XK8E 3JCMc 2OTJA 3R07A 2AHJB 1BBWA 3CEYA 1M1KC 3JCMb 4KQEA 3DKMA 1VQ4A 5C51B 3G6EA 3G4ST 1D3BA 2QQ9A 2MF2A 3KUFA 4A4KA 3TUPA 2RHIA 4XU3A 1QP2A 5IAYA 2KAFA 1YHQA 1Y71A 1Y7XA 5GMKe 4V2SA 4BD3A 4F7UG 4HCBA 1B34A 2RHZA 4BI8B 3OYLA 1VQNT 4Q6GA 3WXMB 3NETA 4YRNA 4M75A 2XDDA 2VXFA 4YRRA 3N5BB 1VQ9A 2XDPA 3H6ZA 4MZPA 4PL6A 2DXTA 1KOGA 2KDSA 2RI3A 1WYDA 4UP7A 1KQSS 1N9RA 3CCEA 2DDZA 4FU6A 3UT1A 2FYKA 2ARSA 3HFNA 4M7DA 2EQUA 5A0DA 3I56A 3L2VA 3CCET 4C0ZA 4QQGA 3CPWA 2VUBA 1B70B 4OMFB 2IVWA 4C0DC 1SRYA 3LGFA 1W4SA 3HXVA 2DQ3A 2LDMA 3HRUA 3HFOA 1VQMT 2KVQG 2DKGA 4EPCA 2GFUA 4DQ2A 1NJ1A 3P8TA 2RHQA 4N4HA 1VQNA 4M75G 2ZZEA 4HWSA 4C92D 2JUFA 2G3RA 3OYMA 1NYRA 1M1KU 1KD1C 2XU8A 4Y28E 3G1ZA 2Q7EA 4D6WA 2I4LA 2QEXA 4M78G 4JRKA 5GAMf 2YHTA 2RJCA 3HY0A 4M7AC 3GOXA 3OB9A 3L4GB 1KD1U 4PJOB 4YRPA 2VGMA 4EMHA 4RQFA 1W66A 2DVEA 5CO7A 3NEMA 2YLCA 3X25B 4BE1A 3V7CA 4C8QG 2RA2A 4YCUA 4E7LA 2MMPA 1K9MC 4KUDK 3E1SA 2HQXA 1HTTA 5I2MA 2M1HA 1WQ7A 4IUTA 3JCMV 3OYAA 3A31A 3FC3A 3LSSA 1K9MU 3C4SA 2BKDN 5EG2A 5FROA 4E7KA 4F7UE 5HK3A 5DLOA 3CC7A 1VQZA 4M7AD 4M7DD 4X5OA 2L3RA 2MWOA 3QBYA 4BWAA 3LX7A 4YRCA 3M4GA 2CZ1B 3GF5A 1JJ2S 2DTIA 2ZCFB 5FU7C 4O2DA 3TEHB 2QQBA 4PHCA 5D6XA 1YHQT 3G71T 3CC4A 5GAN4 3PTAA 3P8YA 2XD0A 2ZT5A 5LJ3g 5LJ3f 1EQRA 3UDCA 5C0MA 5K1XA 1FYFA 2YRVA 1H4QA 3M5AA 5A0LA 2E6NA 1W2BA 1M4ZA 2ZTGA 3CCRT 2KQWA 1G5IA 4IURA 4C92A 2EAYA 3M9QA 4HT9A 3L2ZA 2RJDA 4PJOD 4YRTA 2CZ0B 4XU0A 3A8GB 2ZNIA 4JLIA 3V7RA 1KQ2A 3JRZA 3A7UA 1YI2A 1K73C 1KC8U 4M77C 3A74A 5CKEA 3RKXA 1K8AC 5HY6A 1SESA 1E1TA 1M1GA 3MP1A 3L42A 2E1HA 3CCMA 2ZT6A 3CXCA 3HXUA 3HXYA 1USYC 2OTLT 4M7AE 3RUXA 2P0KA 2Y90A 2LT4A 5CQXA 3E9GA 2M16A 2NS6A 3SFMA 2HAXA 3OA6A 4RDXA 3QIIA 2V8KA 1NYQA 5C6SA 4P71A 2K57A 1K8AU 4M75D 4C92G 5C52B 2DK3A 5KCOA 2X4YA 4YTLA 2ZPFB 3E9FA 2XI9A 3OYNA 1EVLA 4JJNK 2MWPA 2DD4A 3S6WA 3VBBA 2I4NA 2RHQB 4JS5A 3GP8A 4M77D 4LVKA 2LC4A 2HBPA 1XNIA 2D6FA 5GAN6 4QVCA 2EYQA 4TVYA 4DPGA 1HC7A 3J81E 11ASA 3CCVT 3A7RA 4LDUA 3VYGA 4XAXB 5GAOl 3A8OB 2DXUA 4C8QE 3CPWS 2XHCA 3HY1A 1EIYB 2VC8A 1KG1A 2P0QA 1ATIA 3RERA 2QA4A 2RO0A 3ERRA 3NFCA 4P72A 2CJBA 4M7AF 1L0WA 4H2SA 5HKCA 1HXDA 3C12A 3CMAA 5LJ3d 4QW2A 2KY9A 1VQ6A 3OYBA 3L2QA 1VQ8A 2E3CA 3M59A 5A2QE 4PLIA 1MGQA 2AKWB 4J6WA 2QA4T 3A5ZB 3CBOA 4UP9A 3JCMQ 3L2WA 4JRPA 1VQOT 3CD6A 4BI3A 4C8QC 4TVAA 2A7YA 2PUOB 2P5IA 4CS4A 1BIBA 2CS7A 4IUQA 3HFZA 2K5LA 2RM4A 1WPYA 2DTHA 3OBWA 3V7SA 2I4OA 1M8VA 1N6AA 2EIFA 2F5KA 5C53B 4A4HA 3OS0A 1ADJA 1ASZA 1U8RA 2LQKA 4TQDA 3M4YA 4YDQA 4TVRA 4YYEA 4J7IA 5CIUA 1Y07A 2CJAA 2MI6A 1YJWT 4MDWA 2DIGA 2FL7A 3X24B 3MQZA 3CCUT 5GAN5 2QQAA 4EMKA 5KE3A 3ZBDA 5CKHA 3VQXA 5GAN7 1Q86C 2R5AA 2LCLA 3RMSA 2ZR3A 4M78D 4CRIA 3HTZA 4PJOF 3LLRA 1YCYA 1M90U 3VQYA 2G4CA 2WSFE 4N4IA 1C0AA 2EJ9A 1W2BS 4EMKC 1NJIC 1NJ6A 3OYCA 2DU7A 4BI4A 4PJOC 4LVJA 2ZXFA 2CJ9A 1VUBA 1XOVA 4XTZA 2QQSA 4H02A 1LOJA 4G85A 2QHVA 4O5VA 4HKEA 2ARTA 4YRQA 5CCAA 1WU7A 3TCJA 1M90C 2GF7A 2ALYB 4M7DG 3ER0A 1YGBA 1EFWA 1KQ1A 3G4SA 3M53A 5KNNA 4CH4A 4JRQA 4FL6A 4A4GA 3VU3C 1Q81U 4QVDA 4J83A 1B76A 2E70A 3PGGA 1E24A 4XU2A 3CCUA 1VQKT 1BI0A 5FU7B 3QO5A 3DLLA 1Q86U 5CAIA 3JCMg 1LJOA 4A53A 3QG1A 4YRJA 3PNWC 3OSSC 2Q5HA 3CBMA 4OLFA 5GANh 4M78A 3CC2T 1EIFA 3WQZA 4JS4A 2RD1A 2C8MA 1YJNA 1Q81C 2PU9B 4E7HA 2K4YA 2RHXA 3CC4T 4DA4A 3W3SA 4DOWA 5GAOr 3QJYA 3A32A 3T9NA 1YITA 2RJFA 1H4TA 2JTMA 4C8QA 1XQHA 3M4PA 3C94A 4YRLA 3HFZB 4LD9K 4FT2A 4C0GA 3JAME 4C5GA 3I55T 2LQ8A 4TVAB 2XKOC 1FX7A 4QQDA 3REUA 4CH6A 2E10A 3PIPA 2FHDA 3SWNC 4R55A 2Q7HA 4HCCA 1BI3A 4Y91A 2LTOA 4C8QF 3ZEHA 3OS1A 3HXZA 2ZPBB 2PVDB 2RI2A 3L2RA 1UGRB 4L59A 1O9SA 4ZGEB 3RGLA 4KR3A 4OGCA 2RK2A 1SSFA 3PMIA 3JCMJ 2DXCA 4C5EA 3CBPA 5ELOA 4P74C 3V8JA 3L4GA 5LJ5h 1G3SA 4UC4A 2XDBA 3X20B 2LX9A 3VUBA 2JVVA 3M58A 1YJ9T 4OB2B 3QDRB 1X55A 4C5HA 1FXXA 4MZMA 1E1OA 4BY6B 4XTYA 4M78B 3SDZA 1WNLA 2FVUA 1Q7YU 2K5FA 2D0QB 3P8DA 2WSCE 4XTVA 3O8VA 3UWNA 4ZTUB 2ZZGA 4M75B 4M78C 5LJ5e 2I4MA 4TTVA 3LH0A 4L87A 1X54A 3MEAA 3GNFB 4P73C 2VXEA 2LVMA 4M7DB 5CR2A 3JCMf 1YJ9A 3JB9J 2E5QA 4J7FA 4M75C 4NL2A 1FWZA 4KT0E 5DY9A 4YCVA 4YRMA 2F5TX 3KFUA 1M9SA 2R5MA 5HK0A 1H3ZA 2KMTA 3G6ET 3GPLA 4NCXA 1M1FA 4XEMA 4CS3A 1BBUA 2ZR2A 2EQJA 2RHSA 3FRNA 2J3LA 3VKIA 2ZZFA 3CCSA 3FIFA 4OB3B 3HXWA 3Q1JA 4M7DF 3PCOB 1VIEA 1IZ6A 4EMGA 2GCXA 2V8IA 2ARUA 3I7FA 3QXEB 4KULA 1WGSA 3DB4A 3CCJT 4H2WA 4XTUA 1UGSB 3MP8A 5GMKj 3M55A 3ICAA 1S72T 5HGQA 3CCLT 2P0LA 1WJRA 2ALYA 3G71A 5FLXE 1JB0E 4RG2A 4P5NA 2OTJT 2X4WA 4CH5A 2D9TA 4C8QD 3OQ5A 1NNHA 1RL2A 2CYZB 4ATOA 3CC7T 3UFGA 3X28B 1WLEA 1X2HA 4P75A 1MHNA 2X4JA 1NE8A 1ZBXA 4FM4B 1QVGA 4BDZA 1J5WA 4Q15A 1VIFA 3BDLA 2QQRA 2RHSB 1ZHIA 2O01E 1Q82U 4P73A 1X6OA 1Y96A 4L5GA 3TEHA 3WVEB 1B7YA 1JJCB 1G3TA 2PVGB 5GAMd 2AMCB 3OW2A 1YJWA 2E5AA 4YRGA 1VQOA 2WSEE 2ZT7A 1UB4A 3JCMW 4NL3A 4JRIA 3UPUA 1BKBA 3MF1A 1SERA 1H4SA 3OY9A 4ZTJA 2QHSA 4HCZA 2IY5B 2JZ2A 4X34A 4BB7A 2O4XA 2ZPEB 1VQLA 1ZQ1A 4QVZA 3JB9H 4PNOA 1VQPA 1VQ7T 4JLGA 2DQ0A 4ZIBA 4CS2A 4H2VA 2CIMA 3IALA 1UEBA 3QZ5B 1H641 1NPPA 4H2YA 4M77A 3PIOA 4PLLA 3QJ6A 2LCCA 3CMET 3E9IA 2ZPIB 3HPWA 3QPHA 3KXTA 4CI0C 4XTXA 4LD6A 2Q5IA 1B8AA 3QNEA 4Q5WA 1KMNA 4OVAA 3VUZA 1YIJT 4FSXA 4EX5A 1VQ8T 1LYLA 1VQLT 5DM7R 4UP8A 1Z7MA 3FB9A 4C5IA 4J6XA 5LJ3h 4EDUA 3H8ZA 2DD5A 5LJ3j 5GAMe 2ZINA 1NZ9A 4X9CA 4M78E 3V8KA 5GAOn 2M0OA 3CCST 3HHTB 3HP9A 4RCCA 3A8MB 3DSQA 4P71C 4BUGA 2XIDA 5DLQE 5GAN3 3QZ9B 4G84A 4RMOA 3J80E 3HRIA 3A8LB 4LDWA 4M77G 2PQWA 4C92F 2C7IA 3LW5E 4A4FA 3VV0A 3VJPA 3OYGA 3S3MA 2VYTA 3UGQA 3A5YA 1G5VA 5A0GA 4ZN3A 2ZNJA 5GMKi 2DPPB 4CH3A 4ZTZB 4E47A 2BUDA 3CCQT 3TREA 1PYSA 1VQ9T 4NOYA 3SWNB 1I4K1 4LNSA 2K2VA 4PJOE 2ZGWA 4LDYA 2QHUA 3TEEA 5GAMg 1NJIU 5GAMj 4RG8A 4TVWA 4LVLA 1HK9A 2RB6A 1ADYA 2AMCA 3RKWA 3QHSA 4P72C 3CCLA 1GGMA 4J6YA 5I2SA 1DJ7B 2E41A 2K5IA 3F70A 3R6OA 3RL6A 1PSEA 3IKMB 4GY5A 1Z7NA 4M77F 3REXA 3MEWA 1OZ2A 3VQWA 1M5Q1 4P3NA 3GLXA 2DAQA 1YI2T 4IUUA 4HA8A 2KK4A 2DXBA 1X01A 2EJGA 3HL8A 1NJ8A 1BI1A 4H2XB 1EVKA 1JRIA 1N8RU 4A54A 3CCRA 4BY6C 4P3OA 4XU1A 2J3MA 1JJ2A 3PMTA 2HNIA 2L89A 3FLGA 4ELYC 5FU6B 3NELA 2VGNA 4OGEA 1I81A 1QVGS 4KBMB 5LJ5d 2LT1A 4II1A 3CPFA 3CMEA 1USYA 3MEYA 4LDXA 5GMKh 2PMEA 3MCAB 4C0FA 4WI1A 5KH6A 3J7AF 5GANe 3IG2A 2CGHA 3NTIA 4LVMA 2A8EA 4MDXA 5GAMh 3SWNA 3OYIA 2OTLA 4FIBA 3CCJA 4Z02A 3CC2A 2R58A 4TQFA 5GAOq 3INZA 4E51A 2YLBA 5AYFA 3JCMd 4YRSA 1YFTA 3HFVA 3RACA 2FB7A 2EQKA 2P4TA 4YROA 5CKDA 4L6V5 1AHJB 4JUVA 2JNGA 3HSBA 4LDVA 1YFRA 1X2GA 3S3NA 4QQ6A 1UGQB 2XK0A 1R8OB 1N8RC 2B8AA 1K73U 1KC8C 1B70A 3SD4A 2E12A 5LJ5j 1KMMA 5CKBA 4OF1A 1YFSA 1QF6A 4KR2A 2A3LA 4N0AC 3JCMe 2DZ9A 2AKWA 1E22A 3CMAT 1WQWA 1QW1A 3FJPA 4F7UB 3QO7A 3HRKA 2JOYA 5LJ5g 2ZIOA 3CCQA 2ZZDA 1UGPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY5 A;  4H2T A;  1G51 A;  1N9S A;  5LJ3 d;  3HXX A;  4HWP A;  4C92 C;  2E3C A;  4C92 E;  3RES A;  4CH5 A;  3GIB A;  1MGQ A;  1I8F A;  4YRE A;  1B34 B;  1YB3 A;  5GAN d;  2AKW B;  4C8Q D;  4J6W A;  3M4Q A;  4X9D A;  4UP9 A;  3JCM Q;  1NNH A;  4H2U A;  2ZT8 A;  4C8Q C;  4UPA A;  2DEQ A;  4TVA A;  5ELN A;  3UFG A;  5GAO p;  1WLE A;  2P5I A;  4RCB A;  4CS4 A;  4F7U F;  1BIB A;  1N9W A;  1X2H A;  4P75 A;  4P74 A;  3HFZ A;  3QSU A;  2EL9 A;  3IKL A;  3A5Z A;  2RM4 A;  1B7Y B;  4J5Y A;  1WPY A;  1NJ2 A;  4PG3 A;  3BFM A;  2DZC A;  3TEG A;  5GAN g;  1NJ5 A;  2DTH A;  2E65 A;  1SET A;  2ZIM A;  4YRF A;  4XQ3 A;  3V7S A;  2I4O A;  4M7A G;  1U1S A;  1J5W A;  1M8V A;  4XTW A;  3JCM c;  4Q15 A;  5C53 B;  3R07 A;  1BBW A;  2RHS B;  3LC0 A;  2QTX A;  3JCM b;  1ADJ A;  1ASZ A;  4F7U A;  1X56 A;  4KQE A;  4P73 A;  4TQD A;  1Y96 A;  4YDQ A;  5C51 B;  4YYE A;  3TEH A;  1JJC B;  1B7Y A;  2CJA A;  1G5H A;  5GAM d;  2AMC B;  5GMK m;  1D3B A;  2DJZ A;  3TUP A;  3V8L A;  2E5A A;  3E9H A;  4YRG A;  4MML A;  3EFR A;  4XU3 A;  2ZT7 A;  3JCM W;  5GAN 5;  4NL3 A;  4EMK A;  4C8Q B;  4V2S A;  5GMK e;  5GAN f;  4HT8 A;  4JRI A;  4F7U G;  1B34 A;  4Q6G A;  1JBM A;  3NET A;  4YRN A;  4M75 A;  2VXF A;  3MF1 A;  4YRR A;  5GAN 7;  3VQX A;  4YPF A;  2ODR C;  1SER A;  1H4S A;  2QHS A;  2ZR3 A;  3BJU A;  4M78 D;  1BIA A;  2IY5 B;  3RIR A;  4YRI A;  3HTZ A;  4PJO F;  4K88 A;  1YCY A;  3VQY A;  2DXT A;  1KOG A;  3JB9 H;  4PNO A;  1WYD A;  3AHU A;  4UP7 A;  2G4C A;  2DQ0 A;  4ZIB A;  1N9R A;  4CS2 A;  4H2V A;  4AH6 A;  2DDZ A;  2CIM A;  1C0A A;  3IAL A;  2XTI A;  2DTO A;  2EJ9 A;  1H64 1;  2FYK A;  2ARS A;  4EMK C;  3HFN A;  4M7D A;  1NJ6 A;  2DU7 A;  4H2Y A;  4M77 A;  4EO4 A;  3JCM h;  4PJO C;  3RKY A;  2ZXF A;  3E9I A;  4P75 C;  2CJ9 A;  1LNX A;  4XTZ A;  4OP0 A;  1PYS B;  4XTX A;  1B70 B;  3PCO A;  2Q5I A;  1B8A A;  3QNE A;  4H02 A;  1KMN A;  4H2X A;  4EX5 A;  1LYL A;  1LOJ A;  4G85 A;  2QHV A;  1SRY A;  2ART A;  4YRQ A;  3HXV A;  2DQ3 A;  1WU7 A;  4UP8 A;  1Z7M A;  3HFO A;  4WJ3 M;  2ALY B;  2DKG A;  3FB9 A;  4M7D G;  4DQ2 A;  1NJ1 A;  4J6X A;  3P8T A;  1YGB A;  2RHQ A;  5LJ3 h;  3JB9 I;  1KQ1 A;  1EFW A;  2Q7G A;  4M75 G;  2ZZE A;  4HWS A;  4C92 D;  5LJ3 j;  5KNN A;  1NYR A;  4CH4 A;  4M7D E;  5GAM e;  2ZIN A;  4HWT A;  4X9C A;  3VU3 C;  4M78 E;  3V8K A;  5GAO n;  3JB9 G;  4QVD A;  2QHT A;  1H4V B;  1B76 A;  3G1Z A;  2Q7E A;  4YCW A;  2I4L A;  3PGG A;  1E24 A;  4RCC A;  3DSQ A;  4XU2 A;  4P71 C;  4HWR A;  4M78 G;  4JRK A;  5GAM f;  2YHT A;  3HY0 A;  5GAN 3;  4M7A C;  4EMK B;  3L4G B;  4G84 A;  4PJO B;  4YRP A;  3QO5 A;  5LJ5 f;  3HRI A;  4EMH A;  4RQF A;  1W66 A;  5CAI A;  3JCM g;  1LJO A;  4M77 G;  2DVE A;  3NEM A;  4HWO A;  4A53 A;  2YLC A;  4C92 F;  4YRJ A;  3V7C A;  4J15 A;  4C8Q G;  2RA2 A;  2C7I A;  2Q5H A;  4YCU A;  4OLF A;  3JCM P;  5GAN h;  4M78 A;  3WQZ A;  1HTT A;  5GAN 2;  2RD1 A;  2C8M A;  1WQ7 A;  1TH7 A;  3UGQ A;  3A5Y A;  5GAN j;  3JCM V;  3W3S A;  3A31 A;  2ZNJ A;  5GMK i;  3LSS A;  5GAO r;  2JN0 A;  3A32 A;  4CH3 A;  4ZTZ B;  4F7U E;  1H4T A;  1PYS A;  4C8Q A;  1VQZ A;  3M4P A;  3NEN A;  3BW1 A;  4M7A D;  4M7D D;  4X5O A;  4NOY A;  3SWN B;  1I4K 1;  4LNS A;  4YRL A;  3HFZ B;  5F5W A;  4PJO E;  2ZGW A;  4YP0 A;  2QHU A;  4BWA A;  5GAM g;  3PZC A;  5GAM j;  4YRC A;  4TVA B;  3M4G A;  4M7A B;  4TVW A;  1HK9 A;  3REU A;  2DTI A;  2RB6 A;  4CH6 A;  1ADY A;  2E10 A;  2AMC A;  3RKW A;  4P3P A;  3QHS A;  4P72 C;  3EFS A;  4O2D A;  3TEH B;  1GGM A;  3BDU A;  1QE0 A;  4J6Y A;  4PHC A;  3SWN C;  2Q7H A;  2DU5 A;  5GMK l;  4Y91 A;  2E41 A;  3UGT A;  5GAN 4;  2XGT A;  3P8Y A;  2ZT5 A;  5LJ3 g;  4C8Q F;  5LJ3 f;  3RL6 A;  1EQR A;  3IKM B;  5K1X A;  3HXZ A;  1FYF A;  4TWA A;  1Z7N A;  1IL2 A;  4K87 A;  4M77 F;  5GAO m;  1H4Q A;  3REX A;  3MF2 A;  3VQW A;  4KR3 A;  3RGL A;  2ZTG A;  1RIQ A;  1G5I A;  4C92 A;  2EAY A;  4HT9 A;  3L2Z A;  1M5Q 1;  4P3N A;  4PJO D;  4YRT A;  4XU0 A;  3P8V A;  4M75 E;  3JCM J;  3OD1 A;  2ZNI A;  4JLI A;  3V7R A;  4HA8 A;  1EIY A;  1KQ2 A;  2EJG A;  1X01 A;  3QO8 A;  5ELO A;  1NJ8 A;  3A7U A;  4H2X B;  4PJO A;  1EVK A;  1JRI A;  4M77 C;  4P74 C;  3V8J A;  3L4G A;  5LJ5 h;  3A74 A;  5K1P A;  3RF1 A;  3RKX A;  4A54 A;  4P3O A;  4XU1 A;  2J3M A;  1U1T A;  1SES A;  1E1T A;  1Y96 B;  2EWN A;  2E64 A;  2HNI A;  4HVC A;  3L1A A;  2ZCE A;  3VQV A;  2E1H A;  3NEL A;  1I5L A;  2ZT6 A;  1I81 A;  3HXU A;  3HXY A;  1X55 A;  4K86 A;  1USY C;  5LJ5 d;  1E1O A;  4M7A E;  3RUX A;  4XTY A;  1USY A;  3MEY A;  4M78 B;  2Y90 A;  5GMK h;  2PME A;  1WNL A;  4WI1 A;  4WJ4 A;  3QUI A;  3QO3 A;  3SB2 A;  3BY7 A;  12AS A;  4XTV A;  5GAN e;  4RDX A;  3IG2 A;  4ZTU B;  2CGH A;  3CMQ A;  2ZZG A;  1ASY A;  4M75 B;  4M78 C;  1NYQ A;  4N0A A;  5LJ5 e;  2I4M A;  4P71 A;  4TTV A;  2EJF A;  2K57 A;  3SWN A;  5LJ3 e;  5GAM h;  4L87 A;  4M75 D;  4C92 G;  1X54 A;  4YRK A;  5C52 B;  3UH0 A;  2I2L A;  4P73 C;  2VXE A;  4M77 B;  4TQF A;  5GAO q;  3JB9 D;  4M7D B;  4BW9 A;  3INZ A;  4E51 A;  2YLB A;  3JCM f;  3JB9 J;  4PJO G;  4M75 C;  4NL2 A;  3JCM d;  5E3I A;  4RMF A;  1EVL A;  5DY9 A;  4YCV A;  4YRM A;  4M78 F;  4MMK A;  1YFT A;  4YRS A;  3A7A A;  3KFU A;  3HFV A;  2PMF A;  3VBB A;  3RAC A;  4NCX A;  4XEM A;  2FB7 A;  2I4N A;  2RHQ B;  2ODR D;  4CS3 A;  4YRO A;  3JB9 F;  1BBU A;  2ZR2 A;  4JUV A;  5GAN 8;  4M77 D;  2RHS A;  3HSB A;  1YFR A;  1X2G A;  4M75 F;  2J3L A;  5GAN 6;  3JCM X;  2ZZF A;  4QVC A;  3FIF A;  4TVY A;  3HXW A;  4M7D F;  4DPG A;  1B70 A;  3PCO B;  4EMG A;  1HC7 A;  5LJ5 j;  11AS A;  1KMM A;  1YFS A;  3A7R A;  4M77 E;  5GAO l;  1QF6 A;  2ARU A;  4M7A A;  2DXU A;  4C8Q E;  3I7F A;  4KR2 A;  3HY1 A;  1EIY B;  2VC8 A;  1ATI A;  1D3B B;  4N0A C;  3RER A;  4H2W A;  1EOV A;  3JCM e;  1JJC A;  4C92 B;  4RQE A;  4XTU A;  4M7D C;  2DZ9 A;  3ERR A;  4P72 A;  2AKW A;  1E22 A;  3ICA A;  5GMK j;  2CJB A;  4M7A F;  1L0W A;  5I21 A;  1WQW A;  3FJP A;  4F7U B;  3QO7 A;  5HGQ A;  4XEO A;  3HRK A;  3QTC A;  5LJ5 g;  2P0L A;  3LSQ A;  2ZIO A;  2ALY A;  4WF2 A;  4H2S A;  1HXD A; 
#chains in the Genus database with same CATH topology
 3QDF A;  1KD1 R;  2IY5 A;  2P0P A;  3HXX A;  1KHC A;  4HWP A;  1GCQ C;  4C92 C;  4C92 E;  2DO3 A;  3RES A;  1WJQ A;  1VQ8 Q;  4RTX A;  5FRM A;  3M57 A;  2DYB A;  1B34 B;  3OW2 P;  2DL3 A;  3OW2 S;  5GAN d;  4B9W A;  1P92 A;  3E19 A;  1Y0M A;  3FJ5 A;  1GRI A;  4M4Z A;  4H2U A;  3I56 T;  4J9B A;  2ZT8 A;  3MP6 A;  4PJL A;  1KHI A;  3EGX B;  2VB6 A;  1S72 A;  2HBW A;  2EVR A;  4RCB A;  2LNV A;  3C95 A;  1ZUU A;  4F7U F;  4ZGD B;  2LCS A;  2EL9 A;  3JV3 A;  3A5Z A;  1B7Y B;  1NJ2 A;  4ZNX A;  3GBQ A;  2DZC A;  1ACM B;  2HSE B;  2O88 A;  5CKF A;  1SET A;  4YRF A;  2HD0 A;  2ROL A;  3OYJ A;  3TSZ A;  4XTW A;  1QVF P;  1QVF S;  1D0Y A;  2PVO B;  3PFS A;  3LC0 A;  4HT4 A;  2KE9 A;  2QTX A;  5IN1 A;  5M9O A;  3EG2 A;  3OS2 A;  4F7U A;  1X56 A;  5J3B A;  3GNG A;  2QEX T;  1I0C A;  3PE0 A;  4VUB A;  3A8H B;  1WXT A;  3NTH A;  2YUP A;  1G5H A;  1VQK A;  3DB3 A;  3OYY A;  5GMK m;  2HDA A;  3EG3 A;  4IIM A;  5CVI A;  2DJZ A;  1Z9Q A;  3I9Q A;  3VRZ A;  3V8L A;  1Q95 G;  3E9H A;  2QGF B;  4MML A;  3EFR A;  1QWF A;  4O6J A;  1PSF A;  5FRN A;  5CK9 A;  3G4S Q;  2NLU A;  3MEV A;  1RI0 A;  2DF6 A;  4C8Q B;  5GAN f;  1C1A A;  2H3J A;  2SRC A;  4RKU E;  1VQ4 T;  4HT8 A;  1VQ5 A;  1JBM A;  4HVV A;  2NYS A;  2IPO B;  4YPF A;  2ODR C;  2PUK B;  2EKH A;  3LYI A;  1PRM C;  1BI2 A;  1S72 Q;  3BJU A;  2BIV A;  1BIA A;  1I1J A;  4RTW A;  3P8H A;  2RJE A;  3RIR A;  4YRI A;  4K88 A;  1IO6 A;  1S1N A;  4OMP A;  2CSI A;  2QG9 B;  4LVI A;  3AHU A;  3CCM T;  2JJ9 A;  2JS0 A;  3LGL A;  4AH6 A;  2HQE A;  3M56 A;  3MEU A;  1M2O A;  3G7Z A;  3OMG A;  4IUP A;  2XTI A;  2DTO A;  3TSW A;  1OI1 A;  2KXC A;  4FYW B;  1HJD A;  2K3X A;  3OMC A;  1H3H A;  1HD3 A;  2JTE A;  3JSC A;  4EO4 A;  2F69 A;  3VYH B;  3OYK A;  3JCM h;  1MMD A;  3RKY A;  4P75 C;  4BAC A;  1LNX A;  4OP0 A;  1PYS B;  3PCO A;  5J26 A;  2D0N A;  3OBY A;  1GXI E;  3URG A;  4H2X A;  1VQL Q;  1YCS B;  2DVJ A;  2RHY A;  2J6F A;  2F1L A;  2AIR B;  2CDT A;  2E5K A;  1O75 A;  1XTD A;  1IGQ A;  2YSQ A;  4WJ3 M;  3H0F A;  3ME9 A;  2XG8 D;  4ZGJ B;  3I5S A;  2LRQ A;  3JB9 I;  2Y4X A;  2Q7G A;  1TG0 A;  4DBR A;  3OYF A;  3CCV A;  3S3O A;  2R57 A;  3HRS A;  4M7D E;  5L8R E;  3L2U A;  4HWT A;  3EFO B;  3JB9 G;  1KK7 A;  2QHT A;  4BE2 A;  1NLO C;  1WHG A;  1H4V B;  4YCW A;  4IUV A;  3PT9 A;  4CC3 A;  2EFI A;  4HWR A;  2RI5 A;  1LPL A;  4LXC A;  4EMK B;  2AZS A;  4AT1 B;  1NM7 A;  3WVD B;  3TU4 K;  2RH2 A;  3MO8 A;  3VRY A;  4IKF A;  3H0H A;  4F14 A;  5LJ5 f;  2ZPG B;  2RQW A;  5KCH A;  2LJ1 A;  2DIL A;  4HWO A;  1BBZ A;  1IRE B;  4J15 A;  1QVP A;  1VQM A;  1WXU A;  4C0D B;  1YIJ A;  1GCQ A;  1QP3 A;  2KSS A;  3TQ7 P;  3OYH A;  3JCM P;  1OUL A;  3OYD A;  5GAN 2;  1VQ5 Q;  1TH7 A;  1G8X A;  2CZ7 B;  5GAN j;  2DL4 A;  1N27 A;  4J9F A;  2QI2 A;  3NPF A;  4ZN1 A;  4MZT A;  2JTF A;  2JN0 A;  1OZ3 A;  2KGT A;  2XMF A;  3NEN A;  3BW1 A;  5LL6 S;  1UTI A;  1WIE A;  5F5W A;  2OAU A;  4YP0 A;  2C0T A;  1YJN T;  1VQ5 T;  3PZC A;  4M7A B;  2YUN A;  2BZX A;  3MHX A;  4GLK A;  4P3P A;  5HCK A;  1B3Q A;  1RAA B;  2CZ6 B;  2ATC B;  2L5Q A;  3EFS A;  3OSV A;  3BDU A;  3QYG B;  2Y4Y A;  1QE0 A;  1JO8 A;  4E6R A;  3KBG A;  2DET A;  4A4E A;  3HKS A;  2QXF A;  2DU5 A;  1ZLM A;  3NTK A;  5GMK l;  3M54 A;  4KUI A;  3UGT A;  2XGT A;  4E7J A;  4E7I A;  1HSQ A;  6AT1 B;  5FWC A;  4TWA A;  1IL2 A;  4K87 A;  1CKB A;  5GAO m;  2FZC B;  3X26 B;  2EKO A;  3MF2 A;  1RIQ A;  8AT1 B;  3P8V A;  4M75 E;  3OD1 A;  1IB8 A;  2FRY A;  3BE3 A;  2RHU A;  1EIY A;  5FU6 C;  3M0U A;  3QO8 A;  4WTO B;  4PJO A;  2MAM A;  2P4R A;  1YBY A;  2KI7 A;  4J9E A;  5K1P A;  2WAC A;  3RF1 A;  4F17 A;  3FDR A;  1G3Y A;  1U1T A;  1V29 B;  1Y96 B;  2EWN A;  1GFC A;  2E64 A;  2CP6 A;  4HVC A;  3L1A A;  3RMQ A;  3LH5 A;  2ZCE A;  3VQV A;  2EQM A;  2HQH A;  1Q82 C;  4DOV A;  5J39 A;  5D6Y A;  1I5L A;  1D0Z A;  1MV0 B;  4B9X A;  3LWI A;  4R56 A;  1Q7Y C;  1X75 C;  4K86 A;  1X6G A;  2ECZ A;  1VQP T;  1VQ7 A;  1QVF A;  2FPE A;  4E2F B;  1NYF A;  2IG0 A;  1TUC A;  2DA9 A;  4WJ4 A;  2ZPH B;  3QUI A;  3DLM A;  2BZ8 A;  3QO3 A;  3SB2 A;  2EYY A;  3BY7 A;  12AS A;  1BYM A;  1PCX A;  2XIC A;  2YUQ A;  5AT1 B;  4N4G A;  3CMQ A;  2ROT A;  1ASY A;  3LWH A;  4J8O A;  1LVK A;  2MOX A;  3OS5 A;  4N0A A;  2EJF A;  4Z8A A;  5D6W A;  5LJ3 e;  2A0F B;  1ABQ A;  3I55 A;  4YRK A;  3UH0 A;  2I2L A;  3ZFJ A;  1SHG A;  4M77 B;  3MET A;  1F1B B;  2KRM A;  3JB9 D;  4BW9 A;  2DRK A;  1YIT T;  1D1B A;  4PJO G;  5E3I A;  4RMF A;  1GCP A;  2DIQ A;  4M78 F;  4MMK A;  1WJS A;  1V76 A;  2A36 A;  3A7A A;  2DYI A;  1G3W A;  2PMF A;  2KRN A;  3CXC P;  3CXC S;  3CC2 Q;  4ELZ C;  2ODR D;  3JB9 F;  1OPK A;  2O4X B;  4RTY A;  5GAN 8;  1YJW Q;  1YP5 A;  3FEO A;  4DBQ A;  1KQS A;  2MPX C;  4M75 F;  3JCM X;  2YUO A;  2X4X A;  1T0H A;  2RK1 A;  1NPR A;  4ME7 A;  4OB1 B;  1BU1 A;  1OYX A;  2L8D A;  4WCI A;  3HRT A;  2CKK A;  1ZUK A;  4M77 E;  4OMQ A;  1IHW A;  2M0Y A;  4M7A A;  2C06 A;  1PG5 B;  1BB9 A;  3AT1 B;  3QYH B;  1D3B B;  4LUD A;  3QKJ A;  3EH2 A;  3VS6 A;  1EOV A;  5KYX A;  1JJC A;  4C92 B;  4RQE A;  1J3T A;  4M7D C;  2VV5 A;  2HL5 C;  4PFP A;  3P8B B;  4BDY A;  5I21 A;  1TOV A;  2M9U A;  4XEO A;  3QTC A;  4ANJ A;  3CD6 T;  3LSQ A;  4WF2 A;  5IT9 E;  2QDY B;  1B07 A;  2GFA A;  4H2T A;  4BE0 A;  1G51 A;  1N9S A;  2HSP A;  1OQK A;  4OMO A;  3GIB A;  1RAI B;  1I8F A;  4FYY B;  4YRE A;  1YB3 A;  1K8A R;  4OB0 B;  2NUP B;  1VQ6 T;  3M4Q A;  1VQ7 Q;  4X9D A;  4PKC C;  5IXB A;  2X35 A;  2DEQ A;  4UPA A;  5ELN A;  4JJC A;  5GAO p;  3EAE A;  2GQV A;  4ZTF A;  2BTT A;  2V8J A;  5KE2 A;  1N9W A;  3ZL7 C;  4P74 A;  3QSU A;  2OX7 A;  1PRL C;  3IKL A;  4GBQ A;  1K0X A;  4J5Y A;  4PG3 A;  1MMG A;  3BFM A;  5CQY A;  1NG2 A;  2JW4 A;  4JDS A;  3M0R A;  5GAN g;  1NJ5 A;  3TEG A;  2E65 A;  2K3Y A;  3OYE A;  3ASK A;  2ZIM A;  1UDL A;  2OJ2 A;  4XQ3 A;  2E6Z A;  4FT4 A;  4M7A G;  1U1S A;  4NS5 A;  4XK8 E;  4J9H A;  3JCM c;  2OTJ A;  3R07 A;  2AHJ B;  1BBW A;  1RUW A;  3CEY A;  1M1K C;  2VVK A;  3JCM b;  4KQE A;  4PFZ A;  3CCE Q;  3DKM A;  2G6F X;  1VQ4 A;  5C51 B;  3G6E A;  2ZAE A;  1K4U S;  3G4S T;  4RUG A;  1D3B A;  1UHC A;  2QQ9 A;  2MF2 A;  2CH4 A;  3KUF A;  4A4K A;  3TUP A;  2L3Q A;  2RHI A;  2EYX A;  4XU3 A;  1QP2 A;  5IAY A;  2KAF A;  1YHQ A;  1Y71 A;  1Y7X A;  5GMK e;  4V2S A;  4BD3 A;  4F7U G;  4HCB A;  1B34 A;  2RHZ A;  4BI8 B;  3OYL A;  1VQN T;  4Q6G A;  2MK5 A;  3WXM B;  2CP3 A;  3NET A;  4M75 A;  2XDD A;  4YRN A;  2VXF A;  4YRR A;  3N5B B;  1M3C A;  2HCK A;  1VQ9 A;  1UUE A;  2XDP A;  2EGE A;  3H6Z A;  4MZP A;  1QWE A;  4PL6 A;  2DXT A;  1KOG A;  1WHJ A;  3CC7 Q;  2KDS A;  1YN8 A;  2RI3 A;  1WYD A;  4UP7 A;  5IHI A;  1KQS S;  4CC2 A;  1KQS P;  1A0N B;  3TVT A;  1N9R A;  3CCE A;  2DDZ A;  4FU6 A;  1PKT A;  1M30 A;  3A1P A;  1UG1 A;  1X43 A;  3UT1 A;  2FYK A;  2ARS A;  3HFN A;  4M7D A;  3IQL A;  2CRE A;  2EQU A;  5A0D A;  3H0I A;  3I56 A;  3L2V A;  3CCE T;  4C0Z A;  4QQG A;  3CPW A;  4Z89 A;  2VUB A;  2EYW A;  1WZO A;  1C6V X;  1B70 B;  4OMF B;  2COY A;  2HKQ B;  2IVW A;  4C0D C;  2VWF A;  1SRY A;  3LGF A;  1W4S A;  2RQR A;  3HXV A;  2DQ3 A;  2LDM A;  1AD5 A;  3HRU A;  1D09 B;  2QA4 Q;  2RF0 A;  3HFO A;  2KVQ G;  1GBQ A;  2DKG A;  1VQM T;  4EPC A;  2Z0W A;  2GFU A;  4DQ2 A;  1NJ1 A;  3P8T A;  2K2M A;  2RHQ A;  4N4H A;  1D0X A;  4K11 A;  1VQN A;  2D8H A;  4M75 G;  2ZZE A;  4HWS A;  4C92 D;  2JUF A;  2G3R A;  3EHQ A;  3OYM A;  1NYR A;  1M1K U;  1VYT A;  1KD1 C;  2XU8 A;  4Y28 E;  3G1Z A;  1T3S A;  2Q7E A;  4D6W A;  2I4L A;  2DL5 A;  3H41 A;  2QEX A;  4M78 G;  4JRK A;  5GAM f;  2YHT A;  2RJC A;  3HY0 A;  4M7A C;  3GOX A;  3OB9 A;  3L4G B;  1NEB A;  2KEA A;  5FWB A;  1KD1 U;  4PJO B;  3H9N A;  4YRP A;  2VGM A;  4EMH A;  4RQF A;  1W66 A;  2DL8 A;  2FZG B;  1YJN Q;  1TTH B;  2DVE A;  5CO7 A;  1QCF A;  3CCL Q;  3NEM A;  2YLC A;  3X25 B;  4BE1 A;  1YNZ A;  3V7C A;  4C8Q G;  2RA2 A;  5IXF A;  2OTL Q;  4YCU A;  1JXM A;  4E7L A;  2MMP A;  1K9M C;  4KUD K;  3E1S A;  2HQX A;  1HTT A;  5I2M A;  2M1H A;  2A37 A;  2GTJ A;  1WQ7 A;  2DMO A;  4IUT A;  4LUE A;  5D7U A;  1M2V A;  3JCM V;  3OYA A;  1OU9 A;  3A31 A;  3FC3 A;  1EFN A;  2AKK A;  3LSS A;  1NBE B;  1K9M U;  3HTR A;  3C4S A;  2BKD N;  5EG2 A;  2NWM A;  2PNI A;  2GTO A;  5FRO A;  4E7K A;  4F7U E;  5HK3 A;  5DLO A;  3CC7 A;  1VQZ A;  4M7A D;  4M7D D;  4X5O A;  2J6O A;  1VQN Q;  2L3R A;  2MWO A;  4J9C A;  3QBY A;  4BWA A;  2LQW A;  3LX7 A;  4YRC A;  3M4G A;  2OI3 A;  2CZ1 B;  2SEM A;  1ZBJ A;  3GF5 A;  2E4H A;  1JJ2 P;  1JJ2 S;  2DTI A;  1T0J A;  5I11 A;  2LX7 A;  2ZCF B;  3M0Q A;  5FU7 C;  4O2D A;  3TEH B;  2QQB A;  4PHC A;  5D6X A;  1YHQ T;  1TWB A;  2FPF A;  2DLP A;  3G71 T;  3CC4 A;  5GAN 4;  3PTA A;  3I5R A;  3P8Y A;  2XD0 A;  2ZT5 A;  5LJ3 g;  5LJ3 f;  1OU8 A;  2YRC A;  2MYS A;  1EQR A;  3UDC A;  5C0M A;  5K1X A;  3EG0 A;  1FYF A;  2YRV A;  1YHQ Q;  2HEQ A;  1WXB A;  1BK2 A;  1H4Q A;  3M5A A;  5A0L A;  1X2Q A;  1WDX A;  2E6N A;  1W2B A;  1M4Z A;  2ZTG A;  3CCR T;  2KQW A;  1G5I A;  4FYV B;  4IUR A;  4C92 A;  2EAY A;  3M9Q A;  4HT9 A;  3L2Z A;  2RJD A;  4PJO D;  4YRT A;  2CZ0 B;  4XU0 A;  4HCK A;  3A8G B;  2ZNI A;  4JLI A;  3V7R A;  1OOT A;  2O9S A;  1KQ2 A;  3JRZ A;  2HZY A;  1CSK A;  1Y57 A;  3A7U A;  1AZG B;  1YI2 A;  1K73 C;  4J9I A;  1KC8 U;  4M77 C;  1ZA1 B;  3A74 A;  5CKE A;  3RKX A;  1K8A C;  4KGX B;  2L3S A;  5HY6 A;  1SES A;  1E1T A;  8ATC B;  3SHW A;  2JM8 A;  1U06 A;  1M1G A;  2GNC A;  3MP1 A;  1FMV A;  3L42 A;  2E1H A;  1YIJ Q;  3NGP A;  3PVL A;  1UFF A;  3CCM A;  2ZT6 A;  3CXC A;  3HXU A;  3HXY A;  2JMC A;  1USY C;  2OTL T;  4M7A E;  2CUD A;  3RUX A;  3VS7 A;  1R0C B;  1WHH A;  2P0K A;  1RAB B;  2Y90 A;  2LT4 A;  5CQX A;  3E9G A;  2M16 A;  1WHM A;  2NS6 A;  1YIT Q;  1CKA A;  1VQ4 Q;  3SFM A;  4CC7 A;  2HAX A;  1M27 C;  1V1C A;  3OA6 A;  1SF9 A;  4RDX A;  3QII A;  2V8K A;  1W6X A;  1NYQ A;  5C6S A;  4P71 A;  2HKN A;  2K57 A;  1K8A U;  4M75 D;  4C92 G;  5KYU B;  2KRO A;  4PJJ A;  5C52 B;  2LJ3 A;  2DK3 A;  5KCO A;  2X4Y A;  4YTL A;  2ZPF B;  1TS9 A;  3E9F A;  3VS0 A;  1ZX6 A;  4RTZ A;  2XI9 A;  3OYN A;  1EVL A;  4JJN K;  2J6K A;  1TSF A;  2MWP A;  2DD4 A;  3S6W A;  3VBB A;  4R0K A;  2I4N A;  2RHQ B;  4JS5 A;  1ABO A;  2KYM A;  2PTK A;  1VOM A;  4D8K A;  2NUZ A;  3GP8 A;  4M77 D;  4LVK A;  2LC4 A;  2HBP A;  4KH0 B;  1XNI A;  2D6F A;  5GAN 6;  1UJ0 A;  4QVC A;  2L0A A;  2CP7 A;  2EYQ A;  4TVY A;  3CME Q;  4Y92 A;  4DPG A;  1HC7 A;  4ORZ A;  3J81 E;  11AS A;  5KYW B;  2OAW A;  3CC4 Q;  3CCV T;  3A7R A;  1WX6 A;  4LDU A;  3VYG A;  4XAX B;  4AFS C;  5GAO l;  3A8O B;  2DXU A;  4C8Q E;  3CPW P;  3CPW S;  1PC0 A;  2XHC A;  3HY1 A;  2VC8 A;  1EIY B;  1KG1 A;  2P0Q A;  1ATI A;  4A63 B;  2DNU A;  3VS5 A;  3RER A;  2QA4 A;  2DL7 A;  2A28 A;  2RO0 A;  1QCN A;  3ERR A;  3NFC A;  1SHF A;  4P72 A;  2CT3 A;  4M7A F;  2CJB A;  1L0W A;  1E6G A;  1X27 A;  1NJI R;  4H2S A;  5HKC A;  1Q7Y R;  1HXD A;  2RQU A;  3C12 A;  2LMJ A;  3CMA A;  3UAT A;  5LJ3 d;  4QW2 A;  2KY9 A;  1VQ6 A;  2RN8 A;  3OYB A;  3L2Q A;  1VQ8 A;  2E3C A;  3M59 A;  5A2Q E;  4PLI A;  1MGQ A;  2L2P A;  2AKW B;  1VQK Q;  4J6W A;  2QA4 T;  3A5Z B;  3CBO A;  4UP9 A;  3JCM Q;  2EW3 A;  2KRS A;  3L2W A;  4JRP A;  1VQO T;  4OML A;  3CD6 A;  4BI3 A;  2EGA A;  4C8Q C;  4TVA A;  2A7Y A;  2PUO B;  2P5I A;  4DBF A;  2MIO A;  4CS4 A;  1U5S A;  1BIB A;  2CS7 A;  4IUQ A;  3HFZ A;  2K5L A;  1QKX A;  5KYW A;  2RM4 A;  1WPY A;  2DTH A;  3OBW A;  3A98 A;  2O9V A;  3V7S A;  2I4O A;  1M8V A;  1NEG A;  1N6A A;  2EIF A;  3NHN A;  2F5K A;  1GFD A;  5C53 B;  1RAF B;  1M90 R;  4A4H A;  3OS0 A;  1ADJ A;  1ASZ A;  1PWT A;  2DER A;  1U8R A;  2V1R A;  2LQK A;  4TQD A;  1K73 R;  2DRM A;  2EPD A;  3M4Y A;  4YDQ A;  1TUG B;  4TVR A;  4YYE A;  3RR6 A;  4J7I A;  5CIU A;  1Y07 A;  2CJA A;  2COW A;  2MI6 A;  1YJW T;  1WA7 A;  5IHN A;  2VAS A;  4MDW A;  2DIG A;  2FL7 A;  2O2O A;  3I35 A;  5IHK A;  4OMM A;  3X24 B;  3MQZ A;  3CCU T;  1RLQ C;  4RTU A;  3CCM Q;  2AK5 A;  4PJN A;  5GAN 5;  2JM9 A;  5KYU A;  2AT1 B;  2QQA A;  4EMK A;  1ZA2 B;  4FSS A;  5KE3 A;  3ZBD A;  5CKH A;  1QKW A;  4JJB A;  3VQX A;  5GAN 7;  3UA6 A;  1Q86 C;  1I07 A;  1OX8 A;  2QK0 A;  2LCL A;  2R5A A;  3RMS A;  2ZR3 A;  4M78 D;  2JT4 A;  3EGU A;  2LQN A;  3M0T A;  4CRI A;  2W0Z A;  5KYY B;  4PJO F;  3LLR A;  3HTZ A;  1YCY A;  1JQQ A;  2FO0 A;  1M90 U;  3VQY A;  1B7T A;  2AZV A;  3PVQ A;  1VQO Q;  2G4C A;  1Q81 R;  1X6B A;  2V26 A;  2WSF E;  1OPL A;  4N4I A;  1C0A A;  1MND A;  1R0B G;  1TU0 B;  2EJ9 A;  1W2B P;  1W2B S;  1QMC A;  1T3L A;  4EMK C;  1NJI C;  1NJ6 A;  3OYC A;  2DU7 A;  4BI4 A;  4PJO C;  3UA7 A;  4LVJ A;  2ZXF A;  4RTT A;  2CJ9 A;  1VUB A;  4X1V A;  5I22 A;  4XTZ A;  1XOV A;  2KT1 A;  2NUP A;  1M3A A;  2QQS A;  4H02 A;  1SRM A;  1LOJ A;  4G85 A;  2QHV A;  4O5V A;  4HKE A;  3EFO A;  2ART A;  5CCA A;  4YRQ A;  1WU7 A;  2X3X D;  4PFO A;  3TCJ A;  1FMK A;  1VQM Q;  1M90 C;  2GF7 A;  2ALY B;  4M7D G;  1GL5 A;  3ER0 A;  1YGB A;  1EFW A;  1KQ1 A;  3G4S A;  3E2U A;  3M53 A;  5KNN A;  4CH4 A;  4JRQ A;  4FL6 A;  4A4G A;  3VU3 C;  1Q81 U;  4QVD A;  4J83 A;  2QGG A;  3I56 Q;  1B76 A;  2E70 A;  4QT7 A;  3PGG A;  1E24 A;  2DE0 X;  1SSH A;  4XU2 A;  3CCU A;  1M1K R;  1VQK T;  1KSW A;  4EIK A;  2DBM A;  2DBK A;  1BI0 A;  2CP5 A;  5FU7 B;  3QO5 A;  3DLL A;  1Q86 U;  1ZSG A;  5CAI A;  3JCM g;  1LJO A;  2D1X A;  1PNJ A;  4A53 A;  3QG1 A;  4YRJ A;  3PNW C;  3OSS C;  2Q5H A;  3CBM A;  4OLF A;  2JXB A;  5GAN h;  4M78 A;  1EIF A;  3CC2 T;  3WQZ A;  4JS4 A;  2RD1 A;  3RDV A;  1KIK A;  2C8M A;  3CCR Q;  1YJN A;  1Q81 C;  2QYZ A;  4ESR A;  2BE9 B;  2PU9 B;  4E7H A;  2K4Y A;  2RHX A;  3CC4 T;  4DA4 A;  2ENM A;  3W3S A;  4DOW A;  4FW1 A;  5GAO r;  3QJY A;  3A32 A;  5L23 A;  3T9N A;  4KRT A;  1YIT A;  4LNP A;  2DFU A;  2RJF A;  1H4T A;  2JTM A;  4C8Q A;  1XQH A;  3M4P A;  2FZK B;  3C94 A;  1X2K A;  4YRL A;  3HFZ B;  4LD9 K;  4FT2 A;  4C0G A;  2ED1 A;  3JAM E;  4C5G A;  3I55 T;  2LQ8 A;  4TVA B;  2XKO C;  1FX7 A;  4QQD A;  4JPB W;  1PM3 A;  3REU A;  4CH6 A;  2E10 A;  4AFQ C;  3PIP A;  4GLM A;  2EGC A;  1SRL A;  1W70 A;  2FHD A;  3SWN C;  4R55 A;  2Q7H A;  4HCC A;  1BI3 A;  4Y91 A;  3D7S B;  2B86 A;  2CP2 A;  4HVU A;  3UF4 A;  2LTO A;  1OEB A;  4C8Q F;  3ZEH A;  3OS1 A;  1WHL A;  2NUT A;  3HXZ A;  1WFW A;  2DM1 A;  2ZPB B;  2CUB A;  2KBT A;  2PVD B;  2RI2 A;  4OMN A;  4JJD A;  3L2R A;  1UGR B;  4L59 A;  1O9S A;  4ZGE B;  3RGL A;  4KR3 A;  4KGZ B;  2CT4 A;  4OGC A;  3THK A;  2RK2 A;  3RBB B;  1SSF A;  4D8D A;  2K79 A;  3PMI A;  3KFV A;  3JCM J;  4PJM A;  2DXC A;  1YWO A;  4C5E A;  3CBP A;  5ELO A;  2H8H A;  2FPD A;  4AFZ C;  4P74 C;  3V8J A;  1K9M R;  3L4G A;  5LJ5 h;  1UGV A;  2RPN A;  1G3S A;  1RLP C;  2K6D A;  4UC4 A;  2XDB A;  1KC8 R;  3X20 B;  2LX9 A;  3VUB A;  1D1A A;  2JVV A;  1M3B A;  3M58 A;  4E7Z A;  1YJ9 T;  1EX4 A;  4OB2 B;  2F2X A;  2DX1 A;  2KNB B;  3QDR B;  1X55 A;  4C5H A;  1FXX A;  4MZM A;  1E1O A;  4BY6 B;  4XTY A;  4M78 B;  3EH1 A;  3C0C A;  3SDZ A;  1WNL A;  2QAS A;  1AWX A;  2FVU A;  1Q7Y U;  1RAE B;  2K5F A;  2YWW A;  2D0Q B;  3P8D A;  2WSC E;  4XTV A;  3O8V A;  3UWN A;  4ZTU B;  2COZ A;  2J06 A;  2ZZG A;  1C0M A;  4M75 B;  4M78 C;  5LJ5 e;  2I4M A;  4TTV A;  3LH0 A;  4L87 A;  2KR3 A;  1X54 A;  3MEA A;  3GNF B;  3CCV Q;  4P73 C;  2VXE A;  2LVM A;  4M7D B;  1WLP B;  5CR2 A;  3JCM f;  1YJ9 A;  3JB9 J;  2E5Q A;  4J7F A;  4M75 C;  4NL2 A;  3QWX X;  1FWZ A;  2BZY A;  4KT0 E;  5DY9 A;  4YCV A;  4YRM A;  2F5T X;  4HVW A;  3KFU A;  1Q86 R;  1M9S A;  1RI9 A;  2R5M A;  5HK0 A;  2KMT A;  3G6E T;  1H3Z A;  3GPL A;  4NCX A;  1M1F A;  4XEM A;  1NLP C;  1QQJ A;  4CS3 A;  1BBU A;  2ZR2 A;  9ATC B;  2EQJ A;  3U23 A;  2RHS A;  3MPU B;  4JZ4 A;  3FRN A;  2J3L A;  2HMA A;  3VKI A;  2ZZF A;  3CCS A;  3FIF A;  4OB3 B;  3CCQ Q;  3HXW A;  3Q1J A;  4M7D F;  4RTV A;  4DBH A;  3PCO B;  1VIE A;  1IZ6 A;  1RAC B;  4EMG A;  2GCX A;  2V8I A;  4F16 A;  1SG5 A;  4CC4 B;  1BCO A;  1K0S A;  2ARU A;  3I7F A;  3QXE B;  1VYV A;  4KUL A;  4F04 B;  1IHV A;  1WI7 A;  2OTJ Q;  1WGS A;  3DB4 A;  3M0P A;  2P84 A;  3CCJ T;  4H2W A;  2V1Q A;  4XTU A;  1UGS B;  1YJ9 Q;  3MP8 A;  5GMK j;  3M55 A;  3ICA A;  3CQT A;  1KFZ A;  3VS3 A;  1S72 T;  5HGQ A;  3CCL T;  4Z88 A;  2P0L A;  1WJR A;  2ALY A;  3G71 A;  5FLX E;  1JB0 E;  4RG2 A;  4KH1 B;  1AWJ A;  1YFN A;  4P5N A;  2K3B A;  1I5O B;  2OTJ T;  2X4W A;  2GGR A;  1AWW A;  4CH5 A;  1W1F A;  1AOJ A;  3CCU Q;  2D9T A;  4C8Q D;  1H8K A;  1SKU B;  3OQ5 A;  1NNH A;  1RL2 A;  2X9H A;  1JU5 C;  2CYZ B;  4PK4 A;  4ATO A;  2K9G A;  3CC7 T;  3UFG A;  3X28 B;  1WLE A;  1U3O A;  3VS4 A;  1H92 A;  3CMA Q;  2QTV A;  1ARK A;  1PD0 A;  1X2H A;  2QDL A;  4P75 A;  1MHN A;  2X4J A;  1NE8 A;  1MNE A;  1ZBX A;  3RNJ A;  1D1C A;  4HXJ A;  4FM4 B;  1QVG A;  5ECA A;  2I0N A;  1RAH B;  4BDZ A;  2JMA A;  1J5W A;  1OX9 A;  5KYY A;  2EBP A;  4Q15 A;  1VIF A;  3BDL A;  1ZSZ A;  2QQR A;  2RHS B;  1UJY A;  1ZHI A;  5EC7 A;  2O01 E;  1Q82 U;  3I55 Q;  3REA B;  4P73 A;  1X6O A;  1Y96 A;  3G6E Q;  3O5Z A;  2M02 A;  2ABL A;  1SEM A;  1E7O A;  4L5G A;  1UHF A;  3TEH A;  3WVE B;  5KYX B;  1B7Y A;  1JJC B;  1G3T A;  2PVG B;  3R6N A;  3EG9 A;  5GAM d;  2AMC B;  1MMN A;  5GJV B;  1OV3 A;  3OW2 A;  1YJW A;  3EHR A;  2E5A A;  4YRG A;  1VQO A;  2WSE E;  2ZT7 A;  1UB4 A;  3JCM W;  4NL3 A;  4JRI A;  1MV3 A;  2ED0 A;  3UPU A;  1BKB A;  3MF1 A;  1SER A;  1H4S A;  2DJQ A;  3OY9 A;  4ZTJ A;  2QHS A;  1M2V B;  4HCZ A;  2IY5 B;  2JZ2 A;  1K1Z A;  4X34 A;  4BB7 A;  2O4X A;  2ZPE B;  1VQL A;  1ZQ1 A;  2CH4 W;  2QEX Q;  4DEX A;  4QVZ A;  3JB9 H;  4PNO A;  1VQP A;  1VQ7 T;  3EGD B;  4JLG A;  1AWO A;  1Q82 R;  2DQ0 A;  4ZIB A;  1PKS A;  4CS2 A;  4H2V A;  2QAZ A;  1N8R R;  4AMC A;  1VQ6 Q;  2CIM A;  3IAL A;  1G83 A;  4JZ3 A;  1UEB A;  1FMW A;  3QZ5 B;  1H64 1;  3EGX A;  1NPP A;  4H2Y A;  4M77 A;  3PIO A;  4PLL A;  3QJ6 A;  2LCC A;  3CME T;  1VA7 A;  3E9I A;  2ZPI B;  1SPK A;  3HPW A;  3QPH A;  3KXT A;  4CI0 C;  3SEM A;  4XTX A;  2J05 A;  4FW2 A;  4LD6 A;  4AG1 C;  1JEG A;  2Q5I A;  1B8A A;  3QNE A;  4Q5W A;  5GJW B;  1EZZ B;  2O31 A;  4OVA A;  1KMN A;  3VUZ A;  1YIJ T;  4FSX A;  4EX5 A;  1VQ8 T;  1LYL A;  1VQL T;  4LN2 A;  5DM7 R;  4UP8 A;  3CCJ Q;  1NYG A;  1Z7M A;  3NMZ C;  3REB B;  3FB9 A;  4C5I A;  3EGD A;  4J6X A;  3ULR B;  5LJ3 h;  4EDU A;  2KYB A;  3H8Z A;  2DD5 A;  5LJ3 j;  3G1J A;  5GAM e;  2ZIN A;  1NZ9 A;  1YI2 Q;  3VS2 A;  4X9C A;  1QLY A;  4M78 E;  3V8K A;  5GAO n;  2M0O A;  2LNH B;  1K76 A;  3CCS T;  1UEC A;  3HHT B;  3HP9 A;  4RCC A;  3A8M B;  3DSQ A;  4P71 C;  4BUG A;  1AVZ C;  2XID A;  4FCY A;  5DLQ E;  5GAN 3;  3QZ9 B;  2L3P A;  4G84 A;  4RMO A;  1N5Z A;  3J80 E;  3HRI A;  3A8L B;  4LDW A;  4M77 G;  2PQW A;  4C92 F;  1IXD A;  2C7I A;  3LW5 E;  4A4F A;  1KJW A;  2YXY A;  2ESW A;  3VV0 A;  3VJP A;  3OYG A;  3S3M A;  2VYT A;  2FRW A;  1RAD B;  3UGQ A;  3A5Y A;  5KYN A;  2RQT A;  1G5V A;  2C0I A;  5A0G A;  4ZN3 A;  2X3W D;  2ZNJ A;  5GMK i;  2LZ6 B;  2DPP B;  4CH3 A;  1BCM A;  4ZTZ B;  4E47 A;  2BUD A;  2X51 A;  3TRE A;  3CCQ T;  1G2B A;  1PYS A;  1VQ9 T;  4NOY A;  3SWN B;  1I4K 1;  4LNS A;  2K2V A;  4PJO E;  1JXO A;  2ZGW A;  4LDY A;  2QHU A;  3TEE A;  5GAM g;  1VQP Q;  1NJI U;  5GAM j;  4RG8 A;  4TVW A;  4LVL A;  1HK9 A;  1TXQ A;  2RB6 A;  1ADY A;  1MMA A;  1ZSZ C;  3EG9 B;  3RKW A;  2AMC A;  3QHS A;  2C0O A;  4QKU A;  4P72 C;  3CCL A;  2LP5 A;  1GGM A;  1PD1 A;  4J6Y A;  5I2S A;  1DJ7 B;  2E41 A;  2K5I A;  3F70 A;  3CD6 Q;  3R6O A;  1IGU A;  3RL6 A;  1PSE A;  3IKM B;  1HYO A;  1ZSZ B;  4GY5 A;  2IIM A;  1Z7N A;  4M77 F;  7AT1 B;  3REX A;  1Z9Z A;  2GQI A;  3MEW A;  1OZ2 A;  2H3E B;  2KXD A;  2JS2 A;  3VQW A;  3VS1 A;  3EG1 A;  2CP0 A;  2YDL A;  1M5Q 1;  4P3N A;  4J9D A;  3GLX A;  3CCS Q;  2DAQ A;  1YI2 T;  4B6M A;  4IUU A;  4HA8 A;  1AT1 B;  2KK4 A;  2DXB A;  1X01 A;  2EJG A;  2W10 A;  3HL8 A;  1NJ8 A;  1UE9 A;  1BI1 A;  4H2X B;  4J9G A;  1EVK A;  1JRI A;  1N8R U;  1TUD A;  4A54 A;  3CCR A;  3M0S A;  4BY6 C;  4P3O A;  4XU1 A;  2J3M A;  1JJ2 A;  1K9A A;  3PMT A;  2HNI A;  2L89 A;  3FLG A;  2BE7 D;  4ELY C;  5FU6 B;  1QCO A;  3NEL A;  2VGN A;  2D8J A;  4OGE A;  1I81 A;  2LJ0 A;  1QVG P;  4KBM B;  1QVG S;  2GBQ A;  5LJ5 d;  2LT1 A;  4II1 A;  2VKN A;  3CPF A;  1VYU A;  3CME A;  1USY A;  3MEY A;  4LDX A;  2E3H A;  1YWP A;  5GMK h;  2PME A;  3MCA B;  4C0F A;  4WI1 A;  1AEY A;  2A08 A;  2F2W A;  1X69 A;  5KH6 A;  3J7A F;  5GAN e;  2HL3 A;  3IG2 A;  2CGH A;  2FEI A;  3G71 Q;  3NTI A;  4FYX B;  4LVM A;  2A8E A;  1GBR A;  4MDX A;  5GAM h;  3SWN A;  3OYI A;  2OTL A;  1VQ9 Q;  4FIB A;  3CCJ A;  2FG0 A;  4Z02 A;  3CC2 A;  2R58 A;  2EQI A;  4TQF A;  2CSQ A;  2RMO A;  5GAO q;  3INZ A;  4E51 A;  2YLB A;  1M8M A;  5AYF A;  2J7I A;  1IRX A;  3JCM d;  2DEU A;  1FYN A;  2KT8 A;  2YT6 A;  4YRS A;  1YFT A;  2EYZ A;  2M51 A;  2PZ1 A;  4DEY A;  1AZE A;  3HFV A;  3RAC A;  2RNA A;  3QWY A;  2FB7 A;  2E3I A;  2EQK A;  1PHT A;  2P4T A;  4YRO A;  4LE9 A;  5CKD A;  4L6V 5;  3MJX A;  1AHJ B;  4JUV A;  2JNG A;  3HSB A;  4LDV A;  1YFR A;  1X2G A;  4AG2 C;  3S3N A;  4QQ6 A;  1UGQ B;  4IIO A;  2XK0 A;  1R8O B;  4KGV B;  2RQV A;  2K7A A;  1N8R C;  2B8A A;  1K73 U;  1LCK A;  1KC8 C;  1B70 A;  3SD4 A;  2E12 A;  2YRD A;  5LJ5 j;  5IH2 A;  2MCN A;  4E7S A;  1KMM A;  5CKB A;  1WYX A;  4OF1 A;  1YFS A;  4AFU C;  2AKL A;  1QF6 A;  1E6H A;  1ZUY A;  4KR2 A;  2A3L A;  1MUZ A;  4N0A C;  1WHK A;  3JCM e;  3MKD A;  2F2V A;  2DZ9 A;  2AKW A;  1E22 A;  3CMA T;  1WQW A;  5FW9 A;  1QW1 A;  3FJP A;  4F7U B;  3QO7 A;  3HRK A;  2JOY A;  5LJ5 g;  1R77 A;  1RAG B;  1XJW B;  2ZIO A;  2NUT B;  3CCQ A;  2ZZD A;  1UGP B; 
#chains in the Genus database with same CATH homology
 2IY5 A;  2P0P A;  3HXX A;  1KHC A;  4HWP A;  4C92 C;  4C92 E;  2DO3 A;  3RES A;  1WJQ A;  5FRM A;  3M57 A;  1B34 B;  3OW2 S;  5GAN d;  4B9W A;  1P92 A;  3E19 A;  4H2U A;  3I56 T;  2ZT8 A;  3MP6 A;  1KHI A;  1S72 A;  4RCB A;  2LNV A;  3C95 A;  4F7U F;  4ZGD B;  2EL9 A;  3A5Z A;  1B7Y B;  1NJ2 A;  2DZC A;  5CKF A;  1SET A;  4YRF A;  2HD0 A;  3OYJ A;  4XTW A;  1QVF S;  2PVO B;  3PFS A;  3LC0 A;  4HT4 A;  2QTX A;  5IN1 A;  5M9O A;  3OS2 A;  4F7U A;  1X56 A;  5J3B A;  3GNG A;  2QEX T;  4VUB A;  3A8H B;  3NTH A;  1G5H A;  1VQK A;  3DB3 A;  3OYY A;  5GMK m;  5CVI A;  2DJZ A;  3V8L A;  3E9H A;  4MML A;  3EFR A;  4O6J A;  1PSF A;  5FRN A;  5CK9 A;  2NLU A;  3MEV A;  1RI0 A;  4C8Q B;  5GAN f;  2H3J A;  4RKU E;  1VQ4 T;  4HT8 A;  1VQ5 A;  1JBM A;  4YPF A;  2ODR C;  2PUK B;  3LYI A;  1BI2 A;  3BJU A;  2BIV A;  1BIA A;  3P8H A;  2RJE A;  3RIR A;  4YRI A;  4K88 A;  4LVI A;  3AHU A;  3CCM T;  3LGL A;  4AH6 A;  2HQE A;  3M56 A;  3MEU A;  3OMG A;  3G7Z A;  4IUP A;  2XTI A;  2DTO A;  1OI1 A;  2K3X A;  3OMC A;  3JSC A;  4EO4 A;  2F69 A;  3VYH B;  3OYK A;  3JCM h;  3RKY A;  4P75 C;  4BAC A;  1LNX A;  4OP0 A;  1PYS B;  3PCO A;  5J26 A;  3OBY A;  1GXI E;  3URG A;  4H2X A;  2RHY A;  1O75 A;  1XTD A;  4WJ3 M;  3ME9 A;  2XG8 D;  4ZGJ B;  2LRQ A;  3JB9 I;  2Y4X A;  2Q7G A;  3OYF A;  3CCV A;  3S3O A;  2R57 A;  3HRS A;  4M7D E;  5L8R E;  3L2U A;  4HWT A;  3JB9 G;  2QHT A;  4BE2 A;  1H4V B;  4YCW A;  4IUV A;  3PT9 A;  2EFI A;  4HWR A;  2RI5 A;  4EMK B;  3WVD B;  3TU4 K;  2RH2 A;  3MO8 A;  4IKF A;  5LJ5 f;  2ZPG B;  5KCH A;  4HWO A;  1IRE B;  4J15 A;  1QVP A;  1VQM A;  1YIJ A;  4C0D B;  1QP3 A;  2KSS A;  3OYH A;  3JCM P;  3OYD A;  5GAN 2;  1TH7 A;  2CZ7 B;  5GAN j;  1N27 A;  2QI2 A;  4ZN1 A;  4MZT A;  2JTF A;  2JN0 A;  1OZ3 A;  3NEN A;  3BW1 A;  5LL6 S;  5F5W A;  2OAU A;  4YP0 A;  1YJN T;  1VQ5 T;  3PZC A;  4M7A B;  3MHX A;  4GLK A;  4P3P A;  2CZ6 B;  2L5Q A;  3EFS A;  3OSV A;  3BDU A;  3QYG B;  2Y4Y A;  1QE0 A;  3KBG A;  4A4E A;  3HKS A;  2QXF A;  2DU5 A;  3NTK A;  5GMK l;  3M54 A;  4KUI A;  3UGT A;  2XGT A;  4E7J A;  4E7I A;  4TWA A;  1IL2 A;  4K87 A;  5GAO m;  3X26 B;  2EKO A;  3MF2 A;  1RIQ A;  3P8V A;  4M75 E;  3OD1 A;  2RHU A;  1EIY A;  5FU6 C;  3QO8 A;  4PJO A;  2MAM A;  5K1P A;  1YBY A;  2WAC A;  3RF1 A;  3FDR A;  1G3Y A;  1U1T A;  1V29 B;  1Y96 B;  2EWN A;  2E64 A;  4HVC A;  3L1A A;  2ZCE A;  3RMQ A;  3VQV A;  2EQM A;  1Q82 C;  4DOV A;  5J39 A;  5D6Y A;  1I5L A;  4B9X A;  3LWI A;  4R56 A;  1Q7Y C;  1X75 C;  4K86 A;  1VQP T;  1VQ7 A;  1QVF A;  2IG0 A;  4WJ4 A;  2ZPH B;  3QUI A;  3DLM A;  3QO3 A;  3SB2 A;  3BY7 A;  12AS A;  1BYM A;  2XIC A;  4N4G A;  3CMQ A;  1ASY A;  3LWH A;  4J8O A;  3OS5 A;  4N0A A;  2EJF A;  5D6W A;  5LJ3 e;  3I55 A;  4YRK A;  3UH0 A;  2I2L A;  3ZFJ A;  4M77 B;  3MET A;  3JB9 D;  4BW9 A;  1YIT T;  4PJO G;  5E3I A;  4RMF A;  2DIQ A;  1WJS A;  4M78 F;  4MMK A;  3A7A A;  1G3W A;  2PMF A;  3CXC S;  4ELZ C;  2ODR D;  3JB9 F;  2O4X B;  5GAN 8;  3FEO A;  1KQS A;  4M75 F;  3JCM X;  2X4X A;  2RK1 A;  1NPR A;  4ME7 A;  4OB1 B;  1OYX A;  2L8D A;  3HRT A;  2CKK A;  4M77 E;  4M7A A;  2C06 A;  3QYH B;  1D3B B;  3QKJ A;  1EOV A;  1JJC A;  4C92 B;  4RQE A;  4M7D C;  2VV5 A;  3P8B B;  4BDY A;  5I21 A;  2M9U A;  4XEO A;  3QTC A;  3CD6 T;  3LSQ A;  4WF2 A;  5IT9 E;  2QDY B;  2GFA A;  4H2T A;  4BE0 A;  1G51 A;  1N9S A;  3GIB A;  1I8F A;  4YRE A;  1YB3 A;  4OB0 B;  1VQ6 T;  3M4Q A;  4X9D A;  4PKC C;  2X35 A;  2DEQ A;  4UPA A;  5ELN A;  5GAO p;  3EAE A;  2GQV A;  4ZTF A;  2V8J A;  5KE2 A;  1N9W A;  4P74 A;  3QSU A;  3IKL A;  4J5Y A;  4PG3 A;  3BFM A;  5CQY A;  4JDS A;  3TEG A;  5GAN g;  1NJ5 A;  2E65 A;  2K3Y A;  3OYE A;  3ASK A;  2ZIM A;  4XQ3 A;  2E6Z A;  4FT4 A;  4M7A G;  1U1S A;  4NS5 A;  4XK8 E;  3JCM c;  2OTJ A;  3R07 A;  2AHJ B;  1BBW A;  3CEY A;  1M1K C;  3JCM b;  4KQE A;  3DKM A;  1VQ4 A;  5C51 B;  3G6E A;  3G4S T;  1D3B A;  2QQ9 A;  2MF2 A;  3KUF A;  4A4K A;  3TUP A;  2RHI A;  4XU3 A;  1QP2 A;  5IAY A;  2KAF A;  1YHQ A;  1Y71 A;  1Y7X A;  5GMK e;  4V2S A;  4BD3 A;  4F7U G;  4HCB A;  1B34 A;  2RHZ A;  4BI8 B;  3OYL A;  1VQN T;  4Q6G A;  3WXM B;  3NET A;  4YRN A;  4M75 A;  2XDD A;  2VXF A;  4YRR A;  3N5B B;  1VQ9 A;  2XDP A;  3H6Z A;  4MZP A;  4PL6 A;  2DXT A;  1KOG A;  2KDS A;  2RI3 A;  1WYD A;  4UP7 A;  1KQS S;  1N9R A;  3CCE A;  2DDZ A;  4FU6 A;  3UT1 A;  2FYK A;  2ARS A;  3HFN A;  4M7D A;  2EQU A;  5A0D A;  3I56 A;  3L2V A;  3CCE T;  4C0Z A;  4QQG A;  3CPW A;  2VUB A;  1B70 B;  4OMF B;  2IVW A;  4C0D C;  1SRY A;  3LGF A;  1W4S A;  3HXV A;  2DQ3 A;  2LDM A;  3HRU A;  3HFO A;  1VQM T;  2KVQ G;  2DKG A;  4EPC A;  2GFU A;  4DQ2 A;  1NJ1 A;  3P8T A;  2RHQ A;  4N4H A;  1VQN A;  4M75 G;  2ZZE A;  4HWS A;  4C92 D;  2JUF A;  2G3R A;  3OYM A;  1NYR A;  1M1K U;  1KD1 C;  2XU8 A;  4Y28 E;  3G1Z A;  2Q7E A;  4D6W A;  2I4L A;  2QEX A;  4M78 G;  4JRK A;  5GAM f;  2YHT A;  2RJC A;  3HY0 A;  4M7A C;  3GOX A;  3OB9 A;  3L4G B;  1KD1 U;  4PJO B;  4YRP A;  2VGM A;  4EMH A;  4RQF A;  1W66 A;  2DVE A;  5CO7 A;  3NEM A;  2YLC A;  3X25 B;  4BE1 A;  3V7C A;  4C8Q G;  2RA2 A;  4YCU A;  4E7L A;  2MMP A;  1K9M C;  4KUD K;  3E1S A;  2HQX A;  1HTT A;  5I2M A;  2M1H A;  1WQ7 A;  4IUT A;  3JCM V;  3OYA A;  3A31 A;  3FC3 A;  3LSS A;  1K9M U;  3C4S A;  2BKD N;  5EG2 A;  5FRO A;  4E7K A;  4F7U E;  5HK3 A;  5DLO A;  3CC7 A;  1VQZ A;  4M7A D;  4M7D D;  4X5O A;  2L3R A;  2MWO A;  3QBY A;  4BWA A;  3LX7 A;  4YRC A;  3M4G A;  2CZ1 B;  3GF5 A;  1JJ2 S;  2DTI A;  2ZCF B;  5FU7 C;  4O2D A;  3TEH B;  2QQB A;  4PHC A;  5D6X A;  1YHQ T;  3G71 T;  3CC4 A;  5GAN 4;  3PTA A;  3P8Y A;  2XD0 A;  2ZT5 A;  5LJ3 g;  5LJ3 f;  1EQR A;  3UDC A;  5C0M A;  5K1X A;  1FYF A;  2YRV A;  1H4Q A;  3M5A A;  5A0L A;  2E6N A;  1W2B A;  1M4Z A;  2ZTG A;  3CCR T;  2KQW A;  1G5I A;  4IUR A;  4C92 A;  2EAY A;  3M9Q A;  4HT9 A;  3L2Z A;  2RJD A;  4PJO D;  4YRT A;  2CZ0 B;  4XU0 A;  3A8G B;  2ZNI A;  4JLI A;  3V7R A;  1KQ2 A;  3JRZ A;  3A7U A;  1YI2 A;  1K73 C;  1KC8 U;  4M77 C;  3A74 A;  5CKE A;  3RKX A;  1K8A C;  5HY6 A;  1SES A;  1E1T A;  1M1G A;  3MP1 A;  3L42 A;  2E1H A;  3CCM A;  2ZT6 A;  3CXC A;  3HXU A;  3HXY A;  1USY C;  2OTL T;  4M7A E;  3RUX A;  2P0K A;  2Y90 A;  2LT4 A;  5CQX A;  3E9G A;  2M16 A;  2NS6 A;  3SFM A;  2HAX A;  3OA6 A;  4RDX A;  3QII A;  2V8K A;  1NYQ A;  5C6S A;  4P71 A;  2K57 A;  1K8A U;  4M75 D;  4C92 G;  5C52 B;  2DK3 A;  5KCO A;  2X4Y A;  4YTL A;  2ZPF B;  3E9F A;  2XI9 A;  3OYN A;  1EVL A;  4JJN K;  2MWP A;  2DD4 A;  3S6W A;  3VBB A;  2I4N A;  2RHQ B;  4JS5 A;  3GP8 A;  4M77 D;  4LVK A;  2LC4 A;  2HBP A;  1XNI A;  2D6F A;  5GAN 6;  4QVC A;  2EYQ A;  4TVY A;  4DPG A;  1HC7 A;  3J81 E;  11AS A;  3CCV T;  3A7R A;  4LDU A;  3VYG A;  4XAX B;  5GAO l;  3A8O B;  2DXU A;  4C8Q E;  3CPW S;  2XHC A;  3HY1 A;  1EIY B;  2VC8 A;  1KG1 A;  2P0Q A;  1ATI A;  3RER A;  2QA4 A;  2RO0 A;  3ERR A;  3NFC A;  4P72 A;  2CJB A;  4M7A F;  1L0W A;  4H2S A;  5HKC A;  1HXD A;  3C12 A;  3CMA A;  5LJ3 d;  4QW2 A;  2KY9 A;  1VQ6 A;  3OYB A;  3L2Q A;  1VQ8 A;  2E3C A;  3M59 A;  5A2Q E;  4PLI A;  1MGQ A;  2AKW B;  4J6W A;  2QA4 T;  3A5Z B;  3CBO A;  4UP9 A;  3JCM Q;  3L2W A;  4JRP A;  1VQO T;  3CD6 A;  4BI3 A;  4C8Q C;  4TVA A;  2A7Y A;  2PUO B;  2P5I A;  4CS4 A;  1BIB A;  2CS7 A;  4IUQ A;  3HFZ A;  2K5L A;  2RM4 A;  1WPY A;  2DTH A;  3OBW A;  3V7S A;  2I4O A;  1M8V A;  1N6A A;  2EIF A;  2F5K A;  5C53 B;  4A4H A;  3OS0 A;  1ADJ A;  1ASZ A;  1U8R A;  2LQK A;  4TQD A;  3M4Y A;  4YDQ A;  4TVR A;  4YYE A;  4J7I A;  5CIU A;  1Y07 A;  2CJA A;  2MI6 A;  1YJW T;  4MDW A;  2DIG A;  2FL7 A;  3X24 B;  3MQZ A;  3CCU T;  5GAN 5;  2QQA A;  4EMK A;  5KE3 A;  3ZBD A;  5CKH A;  3VQX A;  5GAN 7;  1Q86 C;  2R5A A;  2LCL A;  3RMS A;  2ZR3 A;  4M78 D;  4CRI A;  3HTZ A;  4PJO F;  3LLR A;  1YCY A;  1M90 U;  3VQY A;  2G4C A;  2WSF E;  4N4I A;  1C0A A;  2EJ9 A;  1W2B S;  4EMK C;  1NJI C;  1NJ6 A;  3OYC A;  2DU7 A;  4BI4 A;  4PJO C;  4LVJ A;  2ZXF A;  2CJ9 A;  1VUB A;  1XOV A;  4XTZ A;  2QQS A;  4H02 A;  1LOJ A;  4G85 A;  2QHV A;  4O5V A;  4HKE A;  2ART A;  4YRQ A;  5CCA A;  1WU7 A;  3TCJ A;  1M90 C;  2GF7 A;  2ALY B;  4M7D G;  3ER0 A;  1YGB A;  1EFW A;  1KQ1 A;  3G4S A;  3M53 A;  5KNN A;  4CH4 A;  4JRQ A;  4FL6 A;  4A4G A;  3VU3 C;  1Q81 U;  4QVD A;  4J83 A;  1B76 A;  2E70 A;  3PGG A;  1E24 A;  4XU2 A;  3CCU A;  1VQK T;  1BI0 A;  5FU7 B;  3QO5 A;  3DLL A;  1Q86 U;  5CAI A;  3JCM g;  1LJO A;  4A53 A;  3QG1 A;  4YRJ A;  3PNW C;  3OSS C;  2Q5H A;  3CBM A;  4OLF A;  5GAN h;  4M78 A;  3CC2 T;  1EIF A;  3WQZ A;  4JS4 A;  2RD1 A;  2C8M A;  1YJN A;  1Q81 C;  2PU9 B;  4E7H A;  2K4Y A;  2RHX A;  3CC4 T;  4DA4 A;  3W3S A;  4DOW A;  5GAO r;  3QJY A;  3A32 A;  3T9N A;  1YIT A;  2RJF A;  1H4T A;  2JTM A;  4C8Q A;  1XQH A;  3M4P A;  3C94 A;  4YRL A;  3HFZ B;  4LD9 K;  4FT2 A;  4C0G A;  3JAM E;  4C5G A;  3I55 T;  2LQ8 A;  4TVA B;  2XKO C;  1FX7 A;  4QQD A;  3REU A;  4CH6 A;  2E10 A;  3PIP A;  2FHD A;  3SWN C;  4R55 A;  2Q7H A;  4HCC A;  1BI3 A;  4Y91 A;  2LTO A;  4C8Q F;  3ZEH A;  3OS1 A;  3HXZ A;  2ZPB B;  2PVD B;  2RI2 A;  3L2R A;  1UGR B;  4L59 A;  1O9S A;  4ZGE B;  3RGL A;  4KR3 A;  4OGC A;  2RK2 A;  1SSF A;  3PMI A;  3JCM J;  2DXC A;  4C5E A;  3CBP A;  5ELO A;  4P74 C;  3V8J A;  3L4G A;  5LJ5 h;  1G3S A;  4UC4 A;  2XDB A;  3X20 B;  2LX9 A;  3VUB A;  2JVV A;  3M58 A;  1YJ9 T;  4OB2 B;  3QDR B;  1X55 A;  4C5H A;  1FXX A;  4MZM A;  1E1O A;  4BY6 B;  4XTY A;  4M78 B;  3SDZ A;  1WNL A;  2FVU A;  1Q7Y U;  2K5F A;  2D0Q B;  3P8D A;  2WSC E;  4XTV A;  3O8V A;  3UWN A;  4ZTU B;  2ZZG A;  4M75 B;  4M78 C;  5LJ5 e;  2I4M A;  4TTV A;  3LH0 A;  4L87 A;  1X54 A;  3MEA A;  3GNF B;  4P73 C;  2VXE A;  2LVM A;  4M7D B;  5CR2 A;  3JCM f;  1YJ9 A;  3JB9 J;  2E5Q A;  4J7F A;  4M75 C;  4NL2 A;  1FWZ A;  4KT0 E;  5DY9 A;  4YCV A;  4YRM A;  2F5T X;  3KFU A;  1M9S A;  2R5M A;  5HK0 A;  1H3Z A;  2KMT A;  3G6E T;  3GPL A;  4NCX A;  1M1F A;  4XEM A;  4CS3 A;  1BBU A;  2ZR2 A;  2EQJ A;  2RHS A;  3FRN A;  2J3L A;  3VKI A;  2ZZF A;  3CCS A;  3FIF A;  4OB3 B;  3HXW A;  3Q1J A;  4M7D F;  3PCO B;  1VIE A;  1IZ6 A;  4EMG A;  2GCX A;  2V8I A;  2ARU A;  3I7F A;  3QXE B;  4KUL A;  1WGS A;  3DB4 A;  3CCJ T;  4H2W A;  4XTU A;  1UGS B;  3MP8 A;  5GMK j;  3M55 A;  3ICA A;  1S72 T;  5HGQ A;  3CCL T;  2P0L A;  1WJR A;  2ALY A;  3G71 A;  5FLX E;  1JB0 E;  4RG2 A;  4P5N A;  2OTJ T;  2X4W A;  4CH5 A;  2D9T A;  4C8Q D;  3OQ5 A;  1NNH A;  1RL2 A;  2CYZ B;  4ATO A;  3CC7 T;  3UFG A;  3X28 B;  1WLE A;  1X2H A;  4P75 A;  1MHN A;  2X4J A;  1NE8 A;  1ZBX A;  4FM4 B;  1QVG A;  4BDZ A;  1J5W A;  4Q15 A;  1VIF A;  3BDL A;  2QQR A;  2RHS B;  1ZHI A;  2O01 E;  1Q82 U;  4P73 A;  1X6O A;  1Y96 A;  4L5G A;  3TEH A;  3WVE B;  1B7Y A;  1JJC B;  1G3T A;  2PVG B;  5GAM d;  2AMC B;  3OW2 A;  1YJW A;  2E5A A;  4YRG A;  1VQO A;  2WSE E;  2ZT7 A;  1UB4 A;  3JCM W;  4NL3 A;  4JRI A;  3UPU A;  1BKB A;  3MF1 A;  1SER A;  1H4S A;  3OY9 A;  4ZTJ A;  2QHS A;  4HCZ A;  2IY5 B;  2JZ2 A;  4X34 A;  4BB7 A;  2O4X A;  2ZPE B;  1VQL A;  1ZQ1 A;  4QVZ A;  3JB9 H;  4PNO A;  1VQP A;  1VQ7 T;  4JLG A;  2DQ0 A;  4ZIB A;  4CS2 A;  4H2V A;  2CIM A;  3IAL A;  1UEB A;  3QZ5 B;  1H64 1;  1NPP A;  4H2Y A;  4M77 A;  3PIO A;  4PLL A;  3QJ6 A;  2LCC A;  3CME T;  3E9I A;  2ZPI B;  3HPW A;  3QPH A;  3KXT A;  4CI0 C;  4XTX A;  4LD6 A;  2Q5I A;  1B8A A;  3QNE A;  4Q5W A;  1KMN A;  4OVA A;  3VUZ A;  1YIJ T;  4FSX A;  4EX5 A;  1VQ8 T;  1LYL A;  1VQL T;  5DM7 R;  4UP8 A;  1Z7M A;  3FB9 A;  4C5I A;  4J6X A;  5LJ3 h;  4EDU A;  3H8Z A;  2DD5 A;  5LJ3 j;  5GAM e;  2ZIN A;  1NZ9 A;  4X9C A;  4M78 E;  3V8K A;  5GAO n;  2M0O A;  3CCS T;  3HHT B;  3HP9 A;  4RCC A;  3A8M B;  3DSQ A;  4P71 C;  4BUG A;  2XID A;  5DLQ E;  5GAN 3;  3QZ9 B;  4G84 A;  4RMO A;  3J80 E;  3HRI A;  3A8L B;  4LDW A;  4M77 G;  2PQW A;  4C92 F;  2C7I A;  3LW5 E;  4A4F A;  3VV0 A;  3VJP A;  3OYG A;  3S3M A;  2VYT A;  3UGQ A;  3A5Y A;  1G5V A;  5A0G A;  4ZN3 A;  2ZNJ A;  5GMK i;  2DPP B;  4CH3 A;  4ZTZ B;  4E47 A;  2BUD A;  3CCQ T;  3TRE A;  1PYS A;  1VQ9 T;  4NOY A;  3SWN B;  1I4K 1;  4LNS A;  2K2V A;  4PJO E;  2ZGW A;  4LDY A;  2QHU A;  3TEE A;  5GAM g;  1NJI U;  5GAM j;  4RG8 A;  4TVW A;  4LVL A;  1HK9 A;  2RB6 A;  1ADY A;  2AMC A;  3RKW A;  3QHS A;  4P72 C;  3CCL A;  1GGM A;  4J6Y A;  5I2S A;  1DJ7 B;  2E41 A;  2K5I A;  3F70 A;  3R6O A;  3RL6 A;  1PSE A;  3IKM B;  4GY5 A;  1Z7N A;  4M77 F;  3REX A;  3MEW A;  1OZ2 A;  3VQW A;  1M5Q 1;  4P3N A;  3GLX A;  2DAQ A;  1YI2 T;  4IUU A;  4HA8 A;  2KK4 A;  2DXB A;  1X01 A;  2EJG A;  3HL8 A;  1NJ8 A;  1BI1 A;  4H2X B;  1EVK A;  1JRI A;  1N8R U;  4A54 A;  3CCR A;  4BY6 C;  4P3O A;  4XU1 A;  2J3M A;  1JJ2 A;  3PMT A;  2HNI A;  2L89 A;  3FLG A;  4ELY C;  5FU6 B;  3NEL A;  2VGN A;  4OGE A;  1I81 A;  1QVG S;  4KBM B;  5LJ5 d;  2LT1 A;  4II1 A;  3CPF A;  3CME A;  1USY A;  3MEY A;  4LDX A;  5GMK h;  2PME A;  3MCA B;  4C0F A;  4WI1 A;  5KH6 A;  3J7A F;  5GAN e;  3IG2 A;  2CGH A;  3NTI A;  4LVM A;  2A8E A;  4MDX A;  5GAM h;  3SWN A;  3OYI A;  2OTL A;  4FIB A;  3CCJ A;  4Z02 A;  3CC2 A;  2R58 A;  4TQF A;  5GAO q;  3INZ A;  4E51 A;  2YLB A;  5AYF A;  3JCM d;  4YRS A;  1YFT A;  3HFV A;  3RAC A;  2FB7 A;  2EQK A;  2P4T A;  4YRO A;  5CKD A;  4L6V 5;  1AHJ B;  4JUV A;  2JNG A;  3HSB A;  4LDV A;  1YFR A;  1X2G A;  3S3N A;  4QQ6 A;  1UGQ B;  2XK0 A;  1R8O B;  1N8R C;  2B8A A;  1K73 U;  1KC8 C;  1B70 A;  3SD4 A;  2E12 A;  5LJ5 j;  1KMM A;  5CKB A;  4OF1 A;  1YFS A;  1QF6 A;  4KR2 A;  2A3L A;  4N0A C;  3JCM e;  2DZ9 A;  2AKW A;  1E22 A;  3CMA T;  1WQW A;  1QW1 A;  3FJP A;  4F7U B;  3QO7 A;  3HRK A;  2JOY A;  5LJ5 g;  2ZIO A;  3CCQ A;  2ZZD A;  1UGP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...