3EFSA

Biotin protein ligase from aquifex aeolicus in complex with biotin and atp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
232
structure length
232
Chain Sequence
FKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKGRGRLGRKWLSQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 61
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3efsA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3efsA01
4RDXA 3JB9J 1X2HA 2AMCB 4C92A 2PMEA 3BJUA 4YRTA 5LJ5g 2Q7EA 2ZXFA 4TVYA 1QE0A 3NENA 3QSUA 4H2YA 5LJ5e 3JCMh 3FIFA 3QTCA 5E3IA 3HFZB 1H4TA 1HC7A 4AH6A 2PMFA 4M78E 4M77C 4F7UA 1JJCB 3A74A 2DXUA 3CMQA 1E24A 4PNOA 1GGMA 4H2VA 4YRQA 4P75A 4CS2A 1BIAA 4UP7A 5GAN2 2DZ9A 3TEGA 1EFWA 1D3BA 4YRRA 2XTIA 2ZZFA 4M7DA 3BDUA 5GMKl 3HFNA 4F7UF 4HA8A 4M78B 1ADYA 3RKWA 5C53B 4RQFA 4PJOE 5GANg 2ODRD 2P0LA 5GAMg 2E10A 4RCBA 2QTXA 1KMMA 3M4QA 3A7UA 4KQEA 4YREA 2RD1A 4M7DF 5GANe 4J6WA 4BWAA 1EIYB 5GAMe 5GANf 3QO8A 1EQRA 1W66A 3JB9F 4YRLA 4CS3A 1H4VB 4PJOB 1USYA 4M77G 4J15A 3FJPA 2ZGWA 3HXZA 4YROA 2E3CA 1X54A 1FYFA 3VQWA 4Y91A 2I4MA 2ZTGA 3HFZA 4P71A 4BW9A 2C8MA 1JJCA 2RM4A 3V8LA 1G51A 1SETA 4YCUA 3RESA 1H641 4P3PA 1H4QA 4HWSA 2DTOA 2DKGA 4C92E 3HXYA 1NJ5A 1TH7A 3QO3A 3RERA 4HWRA 1YFTA 2ALYB 5LJ3d 4C8QC 5LJ5d 2RHQA 4N0AC 3HTZA 3HY0A 4TQFA 4DPGA 5GAN5 3NETA 5GAN6 3ERRA 4F7UE 2Q5IA 1NYRA 4M78F 3E9HA 2Q7HA 4CH3A 1WYDA 4PJOA 4K88A 1NJ1A 3BW1A 4TVWA 3RF1A 2ZT6A 3HFVA 2ZT7A 3LC0A 4XEOA 1SERA 4X9DA 1YFSA 4M7AC 3LSQA 4JRIA 1L0WA 4PJOF 3SB2A 4G84A 4H2TA 2QHUA 2ZR3A 3JCMX 2CIMA 5C51B 4C8QG 3ICAA 1WNLA 5GAMd 2ARSA 2ZINA 1KQ1A 4J6XA 2ALYA 1NJ6A 1I81A 5LJ3h 5LJ5h 3A5ZA 3JB9H 4ZTZB 2DU5A 4X5OA 1N9SA 1M5Q1 4N0AA 3P8VA 1IL2A 2DQ0A 4EO4A 4M7DD 1ATIA 4M7AG 5ELNA 1Z7NA 4M77E 3R07A 3JB9D 2ZNIA 3P8TA 4XU2A 4C92F 4YRKA 4H2WA 1NJ8A 3I7FA 2DXTA 4A53A 3TEHA 2ZT5A 3L2ZA 5GAOn 4M77B 1KOGA 1JBMA 5GAOq 4M7AA 4XU0A 1EVLA 1G5HA 3REUA 3TUPA 1KMNA 1G5IA 4YYEA 1X56A 3NEMA 4CH6A 2ODRC 4YRIA 5GMKe 1EOVA 1C0AA 4NOYA 3JCMg 4HT9A 4YDQA 4EMKC 2YHTA 1I8FA 2J3MA 5GAMh 1B7YA 2RHQB 2ARTA 3PCOB 4M75C 3JCMe 3INZA 5C52B 2Q7GA 1Y96B 4A54A 3JCMf 3QO5A 3HXUA 3PZCA 4M75D 1NNHA 5I21A 4EMGA 2YLCA 4XTVA 4YRCA 1YCYA 4YRSA 5GAN8 5CAIA 4M78D 2DTHA 4L87A 3L1AA 1J5WA 1N9WA 4EX5A 1U1SA 2C7IA 1U1TA 3UGTA 2I4OA 1ADJA 2CJAA 3UH0A 3RKXA 4TVAB 1B8AA 2QHSA 3OD1A 3V7RA 4M77A 2ZR2A 3RL6A 3JCMb 2VC8A 3HXWA 4M75G 1HXDA 4HVCA 4PJOD 4C8QE 1WQWA 3MF1A 4YCWA 2AKWB 2CJ9A 1B34A 4CH5A 3RGLA 4DQ2A 5K1PA 4M77F 4OP0A 5LJ3j 2ZIOA 3PCOA 2DQ3A 4H2UA 4XTXA 4P74C 4JRKA 1Y96A 1WQ7A 1JRIA 4C8QB 2QHVA 4HWOA 3W3SA 2ZT8A 2G4CA 3V7SA 3P8YA 4ZTUB 1LNXA 2FB7A 4M7AE 1ASYA 2YLBA 5GAN3 1E22A 1N9RA 4UP8A 11ASA 3A31A 3M4GA 3PGGA 4E51A 4K87A 3HFOA 3IG2A 4WJ4A 2DDZA 3REXA 1WPYA 3RIRA 4RQEA 4X9CA 2EJGA 2ARUA 3TEHB 2FYKA 5GAOp 4P72C 4C92D 2J3LA 1MGQA 3SWNC 2I4NA 3DSQA 4M7AB 4TVAA 3HRKA 2P5IA 2VXEA 4TTVA 3HXVA 3M4PA 4TQDA 4QVDA 5GANd 1YB3A 3G1ZA 1E1TA 1YGBA 4XTZA 4G85A 4PHCA 3IKMB 1PYSB 2AKWA 3LSSA 3QNEA 1B7YB 4K86A 3V8KA 3L4GB 4P75C 3MF2A 5GAOl 5GAOm 4YPFA 4YRFA 2DTIA 4JUVA 4M7DC 1BBWA 1Z7MA 4WF2A 1LYLA 1HTTA 12ASA 3HRIA 3UGQA 4C8QA 4C92G 4Q15A 2VXFA 3HY1A 1VQZA 3KFUA 4P74A 4XTWA 2E64A 3BY7A 4HWTA 1X55A 3A32A 4C8QF 2DZCA 3WQZA 5F5WA 5GAN4 3IALA 1USYC 2EJFA 4H2XB 3RKYA 4F7UG 5GMKh 4YP0A 5LJ3g 2CGHA 4NL3A 4KR2A 3JCMc 2ZZEA 4XEMA 4H2SA 4P72A 4M75E 3VU3C 5LJ3e 3SWNA 2QHTA 4P71C 1B34B 5LJ3f 5LJ5f 4M7DG 5GANh 2ZCEA 1PYSA 3NELA 2DJZA 4UP9A 3L4GA 4YCVA 3JB9G 4M7AF 4YRGA 2EJ9A 4EMKB 4EMHA 4P3OA 1B70B 2XGTA 4M75B 1QF6A 4M77D 4KR3A 4M78C 4YRNA 1HK9A 2DVEA 4CS4A 5GMKm 1SESA 3E9IA 4NCXA 2CJBA 3UFGA 3IKLA 3QO7A 2JN0A 1X2GA 4MMLA 3VBBA 4XU3A 2ZIMA 1ASZA 1KQ2A 4QVCA 3BFMA 2RHSA 3MEYA 2I4LA 5KNNA 4PJOC 4H02A 2AMCA 4H2XA 1WLEA 4XTYA 5GAMf 4O2DA 4P73C 5DY9A 4OLFA 2HNIA 3A5YA 4ZIBA 3RACA 3JCMW 3EFRA 1BBUA 4PG3A 5HGQA 4WJ3M 4CH4A 1NJ2A 3V8JA 3RUXA 4M78G 2Q5HA 5LJ5j 4XTUA 3FB9A 3AHUA 1BIBA 4EMKA 1M8VA 5ELOA 1E1OA 2K57A 1B70A 1H4SA 4M75A 2E1HA 4RMFA 2IY5B 2E65A 5GMKi 1RIQA 1WU7A 4HWPA 4M78A 2ZNJA 5K1XA 3A7AA 2EAYA 4PJOG 2ZZGA 1I5LA 4C92C 4M75F 3HXXA 1X01A 2E5AA 2EWNA 4JLIA 5GMKj 3QHSA 4Q6GA 4C92B 2DU7A 3A7RA 3VQYA 4MMKA 4C8QD 1EIYA 1YFRA 2E41A 4TWAA 3JCMd 2EL9A 3SWNB 1NYQA 4UPAA 4J5YA 5GANj 2I2LA 5GAMj 4WI1A 4M7DE 3VQVA 4P73A 3HSBA 3JCMP 4F7UB 4J6YA 4HT8A 4LNSA 1SRYA 2DEQA 1LJOA 2Y90A 2RA2A 3QUIA 4YRJA 4NL2A 4M7AD 1D3BB 2RB6A 1I4K1 3JCMJ 4XU1A 4M7DB 4RCCA 4XQ3A 3V7CA 3VQXA 1LOJA 3EFSA 1B76A 3JCMV 3JB9I 4P3NA 2IY5A 3GIBA 5GAOr 1EVKA 4V2SA 3JCMQ 4YRPA 4YRMA 5GAN7 2RHSB
chains in the Genus database with same CATH superfamily
1X2HA 3NPFA 1IGQA 2AMCB 2Q7EA 4YRTA 1YHQT 1UGSB 3G71A 2ZXFA 4X1VA 3X24B 4RTTA 1QVFS 3QSUA 2BZYA 3H0FA 3QTCA 2LC4A 3CCRA 3JRZA 1JJCB 1R8OB 1D0ZA 1GGMA 2QQRA 3JV3A 3CC4Q 1BIAA 2ESWA 5GAN2 1KSWA 4OB3B 2FZKB 2L3PA 1WJQA 2L3SA 3BDUA 4MZPA 1KD1R 4M78B 1Q82C 2V8IA 2A28A 2KGTA 5IN1A 2YUQA 5C53B 1MHNA 4RQFA 2FPDA 2CP5A 3NTIA 5KYYB 2EYQA 4RCBA 3H9NA 1KMMA 4YREA 2RD1A 4J6WA 5GAMe 5GANf 2DL7A 3C12A 3M0QA 3I55A 4CS3A 1WXUA 4PJOB 1USYA 2K3XA 3SDZA 4Y91A 5DM7R 3P8DA 2RN8A 4C0FA 3VS6A 2PUKB 2ED0A 1RAIB 2AZSA 4P71A 2IG0A 3M0PA 2QGGA 1JJCA 5M9OA 4J9DA 2L3QA 4AFSC 2RQTA 1SKUB 4OF1A 4C92E 2IVWA 2JXBA 1NJ5A 3OSSC 2XDBA 3HRTA 4A4FA 2LQWA 3C95A 1K4US 3CCMQ 1TH7A 4YTLA 2BE7D 2KXDA 1RAEB 4PFZA 3OBYA 2ALYB 5LJ3d 4IIMA 2RHQA 1BYMA 5KYYA 3HY0A 4DPGA 2WSCE 4F7UE 3ERRA 2K79A 3G4SQ 1VQ8Q 2Q5IA 3CMEQ 4BE2A 2Q7HA 5AT1B 5KE2A 1WYDA 4PJOA 1F1BB 1Y07A 1K9MU 4LVIA 3Q1JA 1VQKQ 3G6EQ 3QZ9B 1YFSA 2MYSA 1UHCA 3UPUA 3UWNA 3CPFA 1NJIC 3SB2A 2QEXT 4H2TA 2MPXC 2O01E 4BY6C 2MI6A 3JCMX 1YCSB 1I5OB 2R5MA 2QGFB 4BY6B 1PSEA 1BU1A 1WNLA 5GAMd 2ARSA 3DLMA 1KQ1A 1YWOA 3R6NA 5FRNA 2ALYA 3CMAA 1QWEA 1K73C 1NJ6A 5LJ3h 2FRWA 1X6GA 2DFUA 4JZ4A 1N9SA 5KYXB 1S72A 4HT4A 1IL2A 4EO4A 2HCKA 2L0AA 3R07A 2H3EB 2CT4A 1T3LA 2K3YA 4JJDA 4C92F 2HZYA 4YRKA 2MIOA 2F2VA 1G83A 3I7FA 2DXTA 5IXFA 3EGUA 2CH4W 3PNWC 1OOTA 2NS6A 4M77B 1JBMA 5GAOq 3TUPA 1EVLA 1G5IA 4AG1C 1YN8A 1X56A 3NEMA 1OPKA 1EOVA 4HT9A 2KY9A 1YJNT 1I8FA 2X4XA 2J3MA 2VASA 5GAMh 1B7YA 1VQ5A 3PCOB 2ARTA 5I22A 3C4SA 4EPCA 4PJJA 1E7OA 1Y96B 3QO5A 1YJ9T 1K8AC 4JS4A 3OA6A 4KGXB 4EMGA 1D0XA 1ZA2B 1D1BA 5KYXA 2PUOB 5GAN8 2RJCA 2EGEA 1MV0B 3JSCA 5J3BA 1J5WA 1WX6A 3FLGA 2PTKA 4PLLA 1QVPA 3PMIA 3CCLA 4RMOA 1YI2A 1OZ2A 3TREA 1U1TA 1GFDA 2I4OA 1ADJA 4DA4A 3RKXA 1YJWA 1VA7A 4M77A 2X9HA 2HQHA 2ZPGB 4YCWA 2EPDA 2AKWB 2CJ9A 5FROA 4M4ZA 2C0OA 1B34A 3J7AF 4CH5A 1GCPA 5KCOA 1VQ6A 2DPPB 5K1PA 4OP0A 2ZIOA 3PCOA 4P74C 1Y96A 2KDSA 2RI3A 3H6ZA 3EFOB 3VS7A 3V7SA 2RI5A 2AK5A 2FB7A 1VQ6T 11ASA 4QQDA 3A31A 1YP5A 3PGGA 1Q7YU 3IG2A 2QYZA 3REXA 3I56A 3CD6T 3RIRA 4RQEA 4OGEA 1PC0A 3TEHB 2FYKA 4P72C 1JU5C 2RMOA 4C92D 2J3LA 1ZA1B 3OYHA 3DSQA 1TS9A 2AIRB 4M7AB 4ZN1A 3A8MB 4PKCC 2ECZA 4TTVA 1GRIA 2XMFA 4TQDA 1FYNA 2DILA 4P5NA 1E1TA 1NYGA 2AKWA 2H3JA 1ZBXA 2PVGB 2CSQA 1G2BA 1VQMT 1EX4A 5GAOl 3S3NA 4YRFA 3CBMA 3NTKA 1KHCA 4ANJA 1BBWA 1K9AA 4WF2A 1J3TA 2EQMA 3VKIA 1LYLA 3UGQA 4OMOA 3LWHA 1JQQA 2VXFA 3HY1A 3CCEQ 3OYDA 2EKHA 4P74A 5CVIA 2YXYA 3OS0A 1KFZA 4L6V5 1X55A 2MWOA 3LW5E 2HAXA 1TUGB 2DZCA 2KRNA 4QQ6A 2JM8A 2RQVA 2AZVA 3M58A 1KJWA 4AFQC 4YP0A 2YWWA 4IUQA 3SEMA 4DBQA 2K4YA 2WACA 2K6DA 4P72A 1SPKA 2K7AA 2KK4A 2DX1A 1TOVA 1SEMA 5LJ3f 2ZCEA 2D9TA 2EKOA 2LTOA 2DK3A 2DD4A 4KH1B 1O75A 1M8MA 4YRGA 3RMQA 2EJ9A 4JJCA 2M0OA 2MWPA 1W4SA 2RF0A 2QXFA 1KD1C 2RK1A 3CCQQ 2J7IA 2DVEA 1KIKA 3CBPA 2V1QA 5GMKm 2CZ1B 4RTYA 4NCXA 1VQ4A 2QA4T 4E7LA 4MZMA 3FC3A 3QO7A 1M1KR 2JUFA 4XU3A 2ZIMA 1KC8R 1ASZA 4OMFB 3QKJA 5CK9A 2ROLA 2VWFA 3OQ5A 3CC4A 2SRCA 4X34A 5GAMf 2LCSA 1PKSA 5DY9A 2QEXQ 4OLFA 2DIQA 2HEQA 2JNGA 2V1RA 4II1A 2IPOB 3GF5A 4LUDA 1NJ2A 3RMSA 1H3HA 4XTUA 3AHUA 1VYUA 1UUEA 1AWOA 4FSSA 4J9EA 2RPNA 3S6WA 3OYIA 2EFIA 2OTLT 1Q86R 4JLGA 2CYZB 4AFZC 2COZA 2CP3A 3NTHA 1BI1A 3CBOA 1CKAA 1ZSGA 2DRMA 1M90R 2M1HA 5K1XA 2EAYA 4C92C 1PHTA 1X01A 2QDLA 5DLOA 3E2UA 2HL3A 4C92B 2RHYA 5CKBA 3M56A 4J9CA 4Z8AA 4DBRA 2YRCA 1YWPA 3JCMd 3OS2A 2EL9A 4E7IA 4AFUC 3GPLA 2VV5A 1M2VB 2CP0A 5GAMj 2GQVA 5KYWB 1K0SA 3CCMA 5HCKA 4Z02A 2CUDA 2NUPB 3CPWP 4LN2A 4F7UB 1IO6A 3RNJA 3JCMP 4LNSA 2CT3A 3REBB 1Q82U 1YJNQ 3CQTA 2HQEA 1V76A 1VQ8A 1I4K1 1NPRA 4TVRA 4XU1A 3CMEA 4M7DB 3V7CA 2OAWA 1B76A 1GBRA 2RJDA 4V2SA 3M54A 4FL6A 3CXCS 3VYHB 3G6EA 4J9IA 3G4ST 2RHSB 2LT1A 1RACB 2YUOA 4BB7A 4XAXB 4C92A 3M57A 4HVWA 3CCSA 1KG1A 4H2YA 5C0MA 1VQKT 3JCMh 3G6ET 3OW2A 3FIFA 5E3IA 5KYWA 3TSZA 3CPWA 1H4TA 2NUPA 2PMFA 1G3TA 4F7UA 3A74A 2DXUA 1CKBA 3UT1A 5IXBA 4PNOA 2DLPA 2K5FA 4P75A 1ABQA 5I2MA 2ENMA 2DZ9A 3FEOA 3TEGA 3EGXB 2LJ0A 1N6AA 2XTIA 4M7DA 3X28B 1K0XA 3RKWA 2FVUA 2CZ6B 2GBQA 1OU9A 4MDWA 5GANg 2ODRD 1KQSP 2QTXA 3UA7A 1WXBA 1TU0B 3T9NA 1TTHB 2BUDA 3P8BB 5D7UA 1TWBA 2O9SA 3FJPA 2ZGWA 3HXZA 2E3CA 1FYFA 4KUDK 2RJFA 1RADB 1UE9A 3CC2T 2I4MA 2OTJA 2RQRA 3G1JA 4KULA 2KR3A 5IT9E 2AHJB 4B9WA 1NEGA 1YIJQ 1SETA 1QP3A 1QP2A 3RESA 1H641 4ZNXA 1H4QA 2DTOA 1K73U 4VUBA 5KCHA 2NUZA 1AZEA 3HXYA 2DYIA 1I0CA 2DO3A 4RUGA 2JMAA 1VIFA 3QYHB 1HJDA 1KQSA 2YRVA 4HCBA 2M16A 3A5ZB 1NG2A 5GJVB 3L2WA 5GAN5 3NETA 3O8VA 5GAN6 2E12A 4LVJA 2AT1B 2X4YA 2YUPA 4PK4A 1SF9A 3O5ZA 1D0YA 3QWXX 1UJYA 4F16A 3BW1A 1MV3A 3CC7Q 1UTIA 5EG2A 1OULA 4XEOA 1SERA 4X9DA 3LSQA 2CP2A 4JRIA 2DIGA 1L0WA 4HKEA 4JJBA 3HPWA 2ZR3A 4PJLA 1SRLA 2DF6A 2CIMA 3THKA 4C8QG 4LDYA 1K8AU 2L5QA 3ICAA 1PSFA 4OB0B 5IHKA 5J39A 5EC7A 4WTOB 1QQJA 1Q81R 3CEYA 1PD0A 2GQIA 1DJ7B 3DKMA 3ZFJA 2QA4Q 4FM4B 2JT4A 1I81A 3A5ZA 3JB9H 1U5SA 2XD0A 4X5OA 4NS5A 4JJNK 4LDWA 1M5Q1 3P8VA 2X51A 1VQOT 4R0KA 1MMNA 1Z7NA 3KBGA 3PVQA 2L2PA 3QPHA 4OMLA 1WHJA 2KI7A 2DL3A 4O6JA 2BZ8A 2ZPFB 4A53A 2ZT5A 2ATCB 1KOGA 3A98A 1M30A 1ABOA 2COYA 4YYEA 1WHHA 2D8JA 2M0YA 2ODRC 4YRIA 1NEBA 3U23A 2OTLQ 4RKUE 2M02A 4EMKC 2YHTA 1RL2A 2RHQB 2XKOC 3FRNA 1VQ7T 4B9XA 3INZA 3M0RA 1OV3A 3JCMf 4E7JA 2LRQA 2HKNA 3CCET 3PZCA 2Z0WA 2EQIA 3OSVA 1XTDA 3EGDA 3OYAA 2NLUA 3S3MA 3M0TA 4HVVA 4IURA 4YRSA 2ZCFB 2EQUA 2QAZA 5CIUA 2RQWA 2EYYA 3H41A 4L87A 3L1AA 4QVZA 3KUFA 3VJPA 3UGTA 3WVDB 4TVAB 1VQ9T 4ZTJA 3OD1A 3WXMB 3V7RA 1A0NB 3HXWA 1HXDA 4M75G 4HVCA 4C8QE 3MF1A 1VQLQ 3EG3A 1IZ6A 5FU7C 4QKUA 2VYTA 4IUVA 4XTXA 3CCQT 4OGCA 4KBMB 3CCVQ 3W3SA 4C0DC 4JRPA 2R58A 5A0LA 2QEXA 1YITT 4MDXA 5CO7A 2YLBA 4C0DB 1E22A 4UP8A 1X2QA 2XHCA 2Y4XA 3L2VA 1D09B 4FYXB 4X9CA 2EJGA 2ARUA 3META 1X75C 2DE0X 4CRIA 4TVAA 3OYBA 4A4KA 1QKXA 4BACA 1WJRA 3PE0A 2BTTA 2VXEA 3HXVA 4ZTFA 2OX7A 3ULRB 2ZPHB 1RAFB 4D8KA 1YGBA 4XTZA 4G85A 2AKLA 2GTOA 1KD1U 2DMOA 3QNEA 1B7YB 3CPWS 3V8KA 4N4GA 1K1ZA 4L5GA 4LVMA 1ZUYA 3E19A 2WSFE 3OBWA 5CKDA 2V8KA 1X27A 12ASA 3HRIA 4Q15A 1OU8A 2KAFA 1MUZA 1JJ2P 3OYJA 2CP6A 1JXMA 5A0GA 2X35A 4C8QF 3CC2Q 3GLXA 3WQZA 5F5WA 1WDXA 1W70A 1R77A 1YJNA 1PCXA 3TVTA 1N5ZA 2G3RA 4L59A 3RKYA 3LH0A 2CGHA 5LJ3g 4O5VA 3EG9B 2C06A 3JCMc 2JZ2A 4RG2A 4M75E 3VU3C 1YJ9A 2KROA 1KHIA 4GY5A 1B34B 2PVDB 4BI3A 4UP9A 1WA7A 1ZUKA 3JB9G 3ASKA 4F17A 4P3OA 2XGTA 5J26A 1QF6A 4E6RA 2C0TA 2Y4YA 1HK9A 3D7SB 1VIEA 2E70A 1WHLA 1X69A 4KUIA 2LVMA 1ZBJA 2CJBA 1JJ2A 2LNHB 3PT9A 1KQSS 1X2GA 3GBQA 4ESRA 2J6FA 2L8DA 4BI8B 1IRXA 4E7KA 2HDAA 5KNNA 3VS1A 4DOWA 3X20B 2DL8A 4IUTA 2CZ7B 3EG9A 2D0QB 4P73C 5CCAA 2HNIA 2E4HA 2ZPEB 3OYFA 3RACA 1BBUA 5HGQA 3LGFA 4CH4A 1FX7A 1M2OA 1MMGA 3RUXA 3L2QA 4M78G 2Q5HA 2XU8A 3FB9A 1BIBA 3CD6A 5ELOA 1E1OA 1WHMA 1H4SA 1D1AA 2RI2A 2QI2A 3PFSA 1NLOC 1D1CA 4RMFA 2QQSA 5GMKi 4D8DA 1OZ3A 5D6WA 1W1FA 1VQOQ 1RIQA 1ZX6A 2RHIA 1WU7A 2ZNJA 3A7AA 4PJOG 4ELYC 2ZZGA 1NM7A 1QCOA 1I5LA 3ER0A 4M75F 3EHRA 3VS4A 3CCJT 3HXXA 4JLIA 5GMKj 1VQMA 3A7RA 1YIJA 4C8QD 1EIYA 1YFRA 2E41A 3L42A 3UA6A 2JTEA 4UPAA 3L2UA 2I2LA 2EQKA 4ORZA 2LX7A 4JRQA 4P73A 2JVVA 2A36A 2QK0A 4PFPA 3L2RA 3HSBA 5FWBA 1YIJT 5FLXE 1CSKA 2KMTA 2Y90A 1I07A 4YRJA 1VQ7Q 3N5BB 2C0IA 1D3BB 2IIMA 2KYBA 4N4HA 4RCCA 2F69A 2RHUA 1NLPC 4KT0E 3KXTA 1Q81C 4RTUA 4ME7A 3G7ZA 1EVKA 3CC7A 4YRPA 5A0DA 4YRMA 4JDSA 2K5LA 4KGZB 4FW1A 4JZ3A 4RDXA 3JB9J 2PMEA 3BJUA 5LJ5g 5IH2A 4TVYA 1VQ9Q 3TCJA 3NENA 4PJMA 4A4EA 3SHWA 3CC7T 2CUBA 2LDMA 2E6NA 2P84A 3HFZB 4EIKA 1HC7A 4M78E 2QA4A 2MCNA 3QG1A 2G6FX 4YRQA 2EBPA 2ZAEA 2JTFA 3F70A 3QDRB 2HSEB 4UP7A 1WFWA 3I55Q 1QCNA 1D3BA 4MZTA 4FYYB 2RJEA 2FL7A 2QASA 2ZZFA 5CQYA 3I5SA 5IAYA 4LD9K 2KVQG 4RTVA 1AWWA 1IGUA 1YITQ 4PJOE 2P0LA 4LDVA 1Q82R 4GLKA 2E3IA 1NE8A 1SG5A 3M4QA 2ZPIB 4KQEA 2CP7A 2DETA 1ZHIA 5GANe 1ZSZC 3QO8A 3NFCA 2KYMA 1W66A 4BD3A 3JB9F 4YRLA 2CSIA 1EIFA 3OYCA 2EGAA 4J15A 2LCCA 4M77G 1LCKA 2VVKA 3OYYA 2HBWA 2FEIA 4E7HA 1X54A 3VQWA 1UEBA 2HMAA 2OTLA 4DBFA 4FYVB 3HFZA 2EQJA 4JPBW 4J83A 2VKNA 4FW2A 4BW9A 3OMGA 2C8MA 3V8LA 1MNEA 3LH5A 2OI3A 4HCZA 3EH1A 4HWSA 1WLPB 4LNPA 1WGSA 2FRYA 1M4ZA 2VGNA 1NZ9A 2LQKA 3QO3A 2P0PA 2QQBA 1KK7A 4HWRA 1BI3A 1SHGA 4C8QC 1AD5A 2GF7A 2LQNA 2F2XA 1NYRA 1R0BG 4M78F 4E7ZA 2XDPA 1VQLA 3OYEA 3OW2P 1ACMB 3HHTB 4LVLA 5KE3A 4F04B 1UECA 8ATCB 4PJOF 4RTZA 5FU6C 2B8AA 2QHUA 1S72Q 3G4SA 1Y0MA 1VQLT 3CCVA 5C51B 1QLYA 2DNUA 5FU6B 1BK2A 2JW4A 1VQKA 2PQWA 4FYWB 1VOMA 4J6XA 3CCVT 2YT6A 4QQGA 4ZTZB 2I0NA 1K73R 5I2SA 4LVKA 2XG8D 4M7AG 5ELNA 1QW1A 4M77E 1JJ2S 2X4JA 3JB9D 1UGQB 2JM9A 1PRMC 4BE0A 1VQ5Q 3R6OA 2X3WD 1UFFA 1MMAA 2YDLA 2JMCA 2DL5A 3OYLA 3MHXA 4LUEA 4LDXA 1N8RR 5GAOn 3WVEB 2LMJA 4XU0A 1G5HA 3LWIA 1KMNA 3LX7A 4LD6A 2K9GA 5GMKe 1UJ0A 1C0AA 1OEBA 3JCMg 2DEUA 2GCXA 3CCLQ 1O9SA 4DOVA 4M75C 3PIOA 3BDLA 3ZL7C 3CC2A 4DEYA 2Q7GA 4A54A 2DBMA 1YJWQ 3HXUA 3CCJQ 4AG2C 2LP5A 1NNHA 3AT1B 4XTVA 1BBZA 3EG1A 3RBBB 4Y28E 1NJIU 1K76A 4IUPA 2KEAA 2X3XD 1AHJB 5CAIA 3VUBA 3CCUT 4M78D 1U8RA 2BKDN 2P0KA 2GFAA 1M27C 3RDVA 3M59A 3MQZA 3MJXA 1B8AA 2QHSA 1Z9QA 1U06A 5HK0A 1TUCA 2ZR2A 3RL6A 3JCMb 2JS0A 3PTAA 4PJOD 1UHFA 5CR2A 4Q5WA 1FXXA 1GCQC 5L23A 1SHFA 5HY6A 4M77F 2LNVA 2DQ3A 1YFNA 1ZLMA 4JRKA 1WQ7A 3OYMA 2O31A 2QHVA 1YNZA 4HWOA 1PRLC 1ZUUA 2G4CA 3MEVA 2D1XA 1LNXA 1GFCA 4M7AE 1ASYA 5GAN3 1TG0A 1C1AA 1N9RA 3M4GA 1OYXA 3ME9A 4K87A 3HFOA 4WJ4A 1AOJA 3LGLA 1WPYA 3E9FA 1SSFA 3UF4A 2HL5C 2KRSA 1G3SA 2XDDA 1P92A 3SWNC 1EZZB 2KT1A 1AZGB 2MMPA 3ZBDA 2CH4A 1UDLA 3TU4K 4ZGDB 4QVDA 3A8GB 3G1ZA 4PHCA 3IKMB 1QCFA 2ED1A 3MEAA 3LSSA 1VQOA 2DYBA 4EDUA 1PD1A 4QW2A 2DRKA 4YPFA 2DTIA 2VUBA 4JUVA 1GCQA 3EGDB 1VQPT 2J6KA 4C92G 4RTXA 1VQZA 1UGRB 4QT7A 1TXQA 4BUGA 2VGMA 4CC7A 4XTWA 2FPEA 2E64A 3BY7A 1N27A 1V1CA 1X6OA 1C6VX 4HCCA 2JS2A 5DLQE 1PM3A 3X25B 1USYC 4F7UG 5GMKh 2RO0A 4NL3A 1VQ7A 2R57A 3H0HA 2ZZEA 5CKFA 4XEMA 3CCEA 5LJ3e 3SWNA 2DA9A 1W2BP 1VQ4Q 4P71C 3QZ5B 1K9MR 2RNAA 4M7DG 2P0QA 2H8HA 4YCVA 4M7AF 1XOVA 2B86A 4EMKB 3G71T 4GLMA 4RG8A 2F5KA 3DB3A 1B70B 1WXTA 4M77D 2RH2A 2F5TX 1S1NA 2A08A 4M78C 4IKFA 1JB0E 1VQ9A 3OYNA 3TQ7P 4CS4A 2A0FB 1M1KC 4OB1B 1WHGA 3CCRT 3UFGA 1BI0A 2E5KA 2J06A 1KC8C 1JXOA 2DL4A 2ROTA 4J9HA 2P4RA 1R0CB 2M51A 4CI0C 2JN0A 3IKLA 2NWMA 1E6GA 2DJQA 4UC4A 3MEYA 2I4LA 1AEYA 4D6WA 4PJOC 2EYWA 2AMCA 4H02A 1WLEA 4XTYA 2KBTA 3HRSA 2E5QA 2CZ0B 2YRDA 4B6MA 2PVOB 2QQ9A 3CCQA 1B3QA 1WJSA 3MP6A 1W2BA 2K2VA 3J81E 3JCMW 2QTVA 3QJYA 1PWTA 3X26B 1YITA 2DBKA 1Q81U 1IHVA 2HKQB 2ABLA 1ARKA 2J05A 2JJ9A 3I55T 5FU7B 1Q86C 4EMKA 2OAUA 2D8HA 3OMCA 4J7FA 3OS1A 1B70A 5L8RE 4FIBA 2E1HA 2A3LA 1M90C 5CKHA 3MP8A 1QKWA 4ZGJB 3ZEHA 2FPFA 4M78A 2O9VA 3KFVA 1XNIA 2EWNA 4J9BA 2E5AA 4Q6GA 2DU7A 2GNCA 1QVGP 1X43A 4OMQA 5HK3A 3VQYA 2K2MA 3QWYA 2YSQA 4J5YA 2EGCA 3OW2S 5GANj 2PNIA 4HXJA 4M7DE 3VQVA 9ATCB 4LXCA 3FJ5A 2QQAA 4Z89A 2DEQA 4E7SA 3QUIA 4N4IA 2DVJA 3CCSQ 4CC2A 4M7AD 3JCMJ 2DXCA 1LOJA 3EFSA 3JCMV 3JB9I 3GIBA 5GAOr 2FO0A 1WHKA 5C6SA 4CC3A 1NYFA 2O4XB 3JCMQ 3CCUQ 2FZCB 5ECAA 2V26A 5GAN7 3CXCP 4TQFA 3EG2A 2BZXA 1X6BA 2EVRA 1RLQC 3M5AA 1QVGA 5KYNA 4BE1A 1AVZC 3HTRA 1H8KA 5FRMA 1QE0A 3LYIA 5LJ5e 5AYFA 2ZPBB 1Q7YR 2FZGB 3CMAT 1TSFA 5KYUB 2RK2A 4HVUA 4PL6A 4RTWA 4E47A 1N8RC 4AH6A 2RQUA 4M77C 3IQLA 3CMQA 1T3SA 1S72T 2PU9B 1E24A 4H2VA 3I9QA 3A1PA 8AT1B 4CS2A 2W10A 3GNGA 1EFWA 4YRRA 3NHNA 2F1LA 4K11A 1PG5B 2R5AA 1Y71A 5GMKl 3HFNA 4ZGEB 4F7UF 4HA8A 1IB8A 1ADYA 2OTJQ 3P8HA 7AT1B 3M55A 4OMPA 1X2KA 3OS5A 5GJWB 2LCLA 5GAMg 3VV0A 2E10A 2O4XA 4WCIA 3CXCA 3A7UA 2RHZA 2W0ZA 2DD5A 4M7DF 3OB9A 4BWAA 3SFMA 1EIYB 1IXDA 1EQRA 5CKEA 1W6XA 1AWJA 1M1FA 1H4VB 2KE9A 2LJ3A 1VQ5T 3LLRA 4YROA 1VQNQ 2VB6A 2HSPA 2QG9B 4FT4A 2XK0A 4ATOA 2ZTGA 3GP8A 1BB9A 1BI2A 2FHDA 4HCKA 3PVLA 3REAB 3DB4A 5KYUA 1EFNA 2LX9A 3MKDA 1YBYA 2WSEE 2L3RA 2RM4A 1G51A 3CCJA 1M3CA 4YCUA 4P3PA 3EHQA 2DKGA 3HL8A 1OPLA 1VQPQ 3CCLT 1NBEB 1YI2T 3JAME 1OI1A 2KSSA 4C5GA 3RERA 1YFTA 1UG1A 1YJWT 5LJ5d 1RAGB 1I1JA 4N0AC 3HTZA 3VRZA 1Q95G 1LPLA 2NYSA 3E9HA 2J6OA 1YHQQ 2P4TA 3S3OA 4CH3A 3M0SA 4K88A 1NJ1A 3C0CA 4TVWA 3RF1A 5FW9A 2ZT6A 4FCYA 3HFVA 2ZT7A 3LC0A 4IIOA 2XICA 4M7AC 4XK8E 4C5EA 4G84A 2YUNA 3G71Q 4C0ZA 2V8JA 3I56T 2ZINA 4BDYA 3E1SA 3MP1A 4R55A 2SEMA 3CCRQ 3HRUA 1C0MA 4FT2A 2CS7A 5LJ5h 2XI9A 4DBHA 2DU5A 1QWFA 1IHWA 4N0AA 2DQ0A 3EFOA 1VUBA 4M7DD 1M9SA 3M9QA 4J9GA 1ATIA 2FG0A 1QVFP 2D6FA 2HD0A 4IUUA 3TSWA 2ZNIA 3P8TA 3VS3A 3VS2A 4XU2A 3M53A 2JOYA 4H2WA 1VYVA 4FSXA 4C5IA 1MMDA 1SSHA 1SRMA 3HKSA 1NJ8A 3A8LB 3TEHA 3L2ZA 1TUDA 1VYTA 4M7AA 3REUA 1K9MC 3M4YA 3VRYA 1W2BS 4CH6A 1E6HA 5LL6S 1WI7A 2EW3A 4NOYA 4YDQA 1JEGA 3JCMe 5C52B 1M1GA 4OMNA 4AT1B 1RI9A 4M75D 1M3AA 5I21A 1G5VA 2YLCA 1RLPC 4ELZC 4YRCA 1YCYA 1ZSZB 4DEXA 1G3YA 1QVFA 3MPUB 3NMZC 2DTHA 1H3ZA 1G8XA 1N9WA 4EX5A 1U1SA 2C7IA 1V29B 2CKKA 2CJAA 3UH0A 5IHNA 2GGRA 2OJ2A 1VQ4T 4J9FA 2VC8A 2LZ6B 4A4HA 3VS0A 1WQWA 4F14A 1PKTA 3OYGA 2BE9B 3MEUA 3UATA 3RGLA 4KRTA 4DQ2A 2K3BA 2X4WA 5LJ3j 3MO8A 4A63B 3CC4T 4H2UA 1GBQA 2DERA 4C8QB 1JRIA 6AT1B 4Y92A 2ZT8A 4E2FB 2O2OA 3P8YA 4ZTUB 1MNDA 2NUTB 1ZSZA 3HP9A 4JS5A 1QMCA 4E51A 4AMCA 2DDZA 3EAEA 1GXIE 3CMAQ 1OX8A 5GAOp 1QVGS 3QBYA 3QJ6A 2E6ZA 1Y7XA 4C0GA 1MGQA 2I4NA 1BKBA 3HRKA 3PMTA 2P5IA 3M4PA 1NJIR 3RR6A 2K5IA 5GANd 1YB3A 4J8OA 1PYSB 4K86A 4C5HA 3L4GB 2KXCA 4P75C 3MF2A 1M1KU 5GAOm 2HBPA 4OVAA 1KC8U 4ZN3A 2LT4A 3PIPA 4M7DC 1Z7MA 2MK5A 2QDYB 1HTTA 4C8QA 2O88A 3TEEA 3URGA 5I11A 2D0NA 1WZOA 3CCMT 1YJ9Q 3KFUA 3A8OB 2GFUA 2NUTA 4HWTA 2EIFA 3A32A 5IHIA 3EH2A 4R56A 1RAAB 1PNJA 3H8ZA 2A7YA 2MF2A 1VQ8T 4GBQA 5GAN4 3CMET 3IALA 2KT8A 2EJFA 1UGPB 4H2XB 1RAHB 4PJNA 4KR2A 3VYGA 1Q7YC 2LJ1A 1Q86U 4H2SA 1UGVA 3I5RA 2QHTA 4Z88A 5LJ5f 1M2VA 5GANh 1M90U 1HYOA 1PYSA 3NELA 2DJZA 1YI2Q 1FMKA 3L4GA 3CCUA 3VS5A 1T0HA 3CCST 3GNFB 3GOXA 4EMHA 4M75B 2XIDA 2E3HA 3QXEB 4KR3A 1IREB 2LQ8A 1B7TA 4YRNA 1K8AR 3BE3A 1Z9ZA 1SESA 3E9IA 1BCMA 3J80E 5FWCA 4LDUA 2A37A 2GTJA 3EG0A 1VQ6Q 4MMLA 3VBBA 2RHXA 3OY9A 2F2WA 3QYGB 1KQ2A 2KNBB 2EYXA 5D6XA 4QVCA 3DLLA 1HSQA 3CD6Q 4A4GA 3BFMA 2RHSA 1FWZA 2MOXA 1RUWA 3NGPA 3H0IA 4J7IA 1RI0A 4H2XA 4O2DA 5CQXA 2HQXA 1FMVA 3FDRA 1T0JA 3A5YA 1OQKA 4ZIBA 2MAMA 4PG3A 3EFRA 4WJ3M 3QDFA 3I56Q 2BIVA 3I35A 1NPPA 3V8JA 4BDZA 1B07A 1RABB 1G3WA 1XQHA 4OB2B 3OYKA 5LJ5j 2CDTA 1WIEA 1WYXA 1VQMQ 1M8VA 2K57A 1ZQ1A 1LVKA 4M75A 4CC4B 1U3OA 3A8HB 1FMWA 2AKKA 3M0UA 2PZ1A 2OTJT 1JO8A 2COWA 4BI4A 3EGXA 2IY5B 3VUZA 2E65A 2ZZDA 1VQNA 4HWPA 2JTMA 4FU6A 2A8EA 4PLIA 3QHSA 3MCAB 1H92A 1N8RU 4MMKA 5KH6A 4TWAA 2KRMA 2CREA 5HKCA 1VQNT 1HD3A 3SWNB 1NYQA 1VQPA 4WI1A 5D6YA 1UB4A 4KGVB 3MEWA 4J6YA 4HT8A 1SRYA 4KH0B 2L89A 1LJOA 3QIIA 2EYZA 3C94A 1XJWB 2RA2A 3UDCA 1AWXA 4NL2A 3SD4A 1BCOA 2DAQA 2RB6A 4LE9A 5A2QE 1OX9A 2KQWA 4XQ3A 1AT1B 1GL5A 2DXBA 3VQXA 1YHQA 1M3BA 1Y57A 2DM1A 4P3NA 2IY5A 4OMMA 4PFOA 2M9UA 3E9GA
chains in the Genus database with same CATH topology
1X2HA 2AMCB 2Q7EA 4YRTA 1YHQT 1UGSB 3G71A 2ZXFA 3X24B 1QVFS 3QSUA 3QTCA 2LC4A 3CCRA 3JRZA 1JJCB 1R8OB 1GGMA 2QQRA 1BIAA 5GAN2 4OB3B 1WJQA 3BDUA 4MZPA 4M78B 1Q82C 2V8IA 5IN1A 5C53B 1MHNA 4RQFA 3NTIA 2EYQA 4RCBA 1KMMA 4YREA 2RD1A 4J6WA 5GAMe 5GANf 3C12A 3I55A 4CS3A 4PJOB 1USYA 2K3XA 3SDZA 4Y91A 5DM7R 3P8DA 4C0FA 2PUKB 4P71A 2IG0A 1JJCA 5M9OA 4OF1A 4C92E 2IVWA 1NJ5A 3OSSC 2XDBA 3HRTA 4A4FA 3C95A 1TH7A 4YTLA 2ALYB 3OBYA 5LJ3d 2RHQA 1BYMA 3HY0A 4DPGA 2WSCE 4F7UE 3ERRA 2Q5IA 4BE2A 2Q7HA 5KE2A 1WYDA 4PJOA 1Y07A 1K9MU 4LVIA 3Q1JA 3QZ9B 1YFSA 3UPUA 3UWNA 3CPFA 1NJIC 3SB2A 2QEXT 4H2TA 2O01E 4BY6C 2MI6A 3JCMX 2R5MA 4BY6B 1PSEA 1WNLA 5GAMd 2ARSA 3DLMA 1KQ1A 5FRNA 2ALYA 3CMAA 1K73C 1NJ6A 5LJ3h 1N9SA 1S72A 4HT4A 1IL2A 4EO4A 3R07A 2K3YA 4C92F 4YRKA 3I7FA 2DXTA 3PNWC 2NS6A 4M77B 1JBMA 5GAOq 3TUPA 1EVLA 1G5IA 1X56A 3NEMA 1EOVA 4HT9A 2KY9A 1YJNT 1I8FA 2X4XA 2J3MA 5GAMh 1B7YA 1VQ5A 3PCOB 2ARTA 3C4SA 4EPCA 1Y96B 3QO5A 1YJ9T 1K8AC 4JS4A 3OA6A 4EMGA 2PUOB 5GAN8 2RJCA 3JSCA 5J3BA 1J5WA 3FLGA 3CCLA 4PLLA 1QVPA 3PMIA 4RMOA 1YI2A 1OZ2A 3TREA 1U1TA 2I4OA 1ADJA 4DA4A 3RKXA 1YJWA 4M77A 2ZPGB 4YCWA 2AKWB 2CJ9A 5FROA 1B34A 3J7AF 4CH5A 5KCOA 1VQ6A 2DPPB 5K1PA 4OP0A 2ZIOA 3PCOA 4P74C 1Y96A 2KDSA 2RI3A 3H6ZA 3V7SA 2RI5A 2FB7A 1VQ6T 11ASA 4QQDA 3A31A 3PGGA 1Q7YU 3IG2A 3REXA 3I56A 3CD6T 3RIRA 4RQEA 4OGEA 3TEHB 2FYKA 4P72C 4C92D 2J3LA 3OYHA 3DSQA 4M7AB 4ZN1A 3A8MB 4PKCC 4TTVA 4TQDA 4P5NA 1E1TA 2AKWA 2H3JA 1ZBXA 2PVGB 1VQMT 5GAOl 3S3NA 4YRFA 3CBMA 3NTKA 1KHCA 1BBWA 4WF2A 1LYLA 2EQMA 3VKIA 3UGQA 3LWHA 2VXFA 3HY1A 3OYDA 4P74A 5CVIA 3OS0A 4L6V5 1X55A 2MWOA 3LW5E 2HAXA 2DZCA 4QQ6A 3M58A 4YP0A 4IUQA 2K4YA 2WACA 4P72A 2KK4A 5LJ3f 2ZCEA 2D9TA 2EKOA 2LTOA 2DK3A 2DD4A 1O75A 4YRGA 3RMQA 2EJ9A 2M0OA 2MWPA 1W4SA 2QXFA 1KD1C 2RK1A 2DVEA 3CBPA 5GMKm 2CZ1B 4NCXA 1VQ4A 2QA4T 4E7LA 4MZMA 3FC3A 3QO7A 2JUFA 4XU3A 2ZIMA 1ASZA 4OMFB 3QKJA 5CK9A 3CC4A 3OQ5A 4X34A 5GAMf 5DY9A 4OLFA 2DIQA 2JNGA 4II1A 1NJ2A 3GF5A 3RMSA 4XTUA 3AHUA 3S6WA 3OYIA 2EFIA 2OTLT 4JLGA 2CYZB 3NTHA 1BI1A 3CBOA 2M1HA 5K1XA 2EAYA 4C92C 1X01A 5DLOA 4C92B 2RHYA 5CKBA 3M56A 3JCMd 3OS2A 2EL9A 4E7IA 3GPLA 2VV5A 5GAMj 2GQVA 3CCMA 4Z02A 3JCMP 4F7UB 4LNSA 1Q82U 2HQEA 1VQ8A 1I4K1 1NPRA 4TVRA 4XU1A 3CMEA 4M7DB 3V7CA 1B76A 2RJDA 4V2SA 3M54A 4FL6A 3CXCS 3VYHB 3G6EA 3G4ST 2RHSB 2LT1A 4BB7A 4XAXB 4C92A 3M57A 3CCSA 1KG1A 4H2YA 5C0MA 1VQKT 3JCMh 3G6ET 3OW2A 3FIFA 5E3IA 3CPWA 1H4TA 2PMFA 1G3TA 4F7UA 3A74A 2DXUA 3UT1A 4PNOA 2K5FA 4P75A 5I2MA 2DZ9A 3FEOA 3TEGA 2XTIA 1N6AA 4M7DA 3X28B 3RKWA 2FVUA 2CZ6B 4MDWA 5GANg 2ODRD 2QTXA 3T9NA 2BUDA 3P8BB 3FJPA 2ZGWA 3HXZA 2E3CA 1FYFA 4KUDK 2RJFA 3CC2T 2I4MA 2OTJA 4KULA 5IT9E 2AHJB 4B9WA 1SETA 1QP3A 1QP2A 3RESA 1H641 1H4QA 2DTOA 1K73U 4VUBA 5KCHA 3HXYA 2DO3A 1VIFA 3QYHB 1KQSA 2YRVA 4HCBA 2M16A 3A5ZB 3L2WA 5GAN5 3NETA 3O8VA 5GAN6 2E12A 4LVJA 2X4YA 3BW1A 5EG2A 4XEOA 1SERA 4X9DA 3LSQA 4JRIA 2DIGA 1L0WA 4HKEA 3HPWA 2ZR3A 2CIMA 4C8QG 4LDYA 1K8AU 2L5QA 3ICAA 1PSFA 4OB0B 5J39A 3CEYA 1DJ7B 3DKMA 3ZFJA 4FM4B 1I81A 3A5ZA 3JB9H 2XD0A 4X5OA 4NS5A 4JJNK 4LDWA 1M5Q1 3P8VA 1VQOT 1Z7NA 3KBGA 3QPHA 4O6JA 2ZPFB 4A53A 2ZT5A 1KOGA 4YYEA 2ODRC 4YRIA 4RKUE 4EMKC 2YHTA 1RL2A 2RHQB 2XKOC 3FRNA 1VQ7T 4B9XA 3INZA 3JCMf 4E7JA 2LRQA 3CCET 3PZCA 3OSVA 1XTDA 3OYAA 2NLUA 3S3MA 4IURA 4YRSA 2ZCFB 2EQUA 5CIUA 4L87A 3L1AA 4QVZA 3KUFA 3VJPA 3UGTA 3WVDB 4TVAB 1VQ9T 4ZTJA 3OD1A 3WXMB 3V7RA 3HXWA 1HXDA 4M75G 4HVCA 4C8QE 3MF1A 1IZ6A 5FU7C 2VYTA 4IUVA 4XTXA 3CCQT 4OGCA 4KBMB 3W3SA 4C0DC 4JRPA 2R58A 5A0LA 2QEXA 1YITT 4MDXA 5CO7A 2YLBA 4C0DB 1E22A 4UP8A 2XHCA 2Y4XA 3L2VA 4X9CA 2EJGA 2ARUA 3META 1X75C 4CRIA 4TVAA 3OYBA 4A4KA 4BACA 1WJRA 2VXEA 3HXVA 4ZTFA 2ZPHB 1YGBA 4XTZA 4G85A 1KD1U 3QNEA 1B7YB 3CPWS 3V8KA 4N4GA 4L5GA 4LVMA 3E19A 2WSFE 3OBWA 5CKDA 2V8KA 12ASA 3HRIA 4Q15A 2KAFA 3OYJA 5A0GA 2X35A 4C8QF 3GLXA 3WQZA 5F5WA 1YJNA 2G3RA 4L59A 3RKYA 3LH0A 2CGHA 5LJ3g 4O5VA 2C06A 3JCMc 2JZ2A 4RG2A 4M75E 3VU3C 1YJ9A 1KHIA 4GY5A 1B34B 2PVDB 4BI3A 4UP9A 3JB9G 3ASKA 4P3OA 2XGTA 3E9GA 5J26A 1QF6A 2Y4YA 1HK9A 1VIEA 2E70A 4KUIA 2LVMA 2CJBA 1JJ2A 3PT9A 1KQSS 1X2GA 4BI8B 2L8DA 4E7KA 5KNNA 4DOWA 3X20B 4IUTA 2CZ7B 2D0QB 4P73C 5CCAA 2HNIA 2ZPEB 3OYFA 3RACA 1BBUA 5HGQA 3LGFA 4CH4A 1FX7A 3RUXA 3L2QA 4M78G 2Q5HA 2XU8A 3FB9A 1BIBA 3CD6A 5ELOA 1E1OA 1H4SA 2RI2A 2QI2A 3PFSA 4RMFA 2QQSA 5GMKi 1OZ3A 5D6WA 1RIQA 2RHIA 1WU7A 2ZNJA 3A7AA 4PJOG 4ELYC 2ZZGA 1I5LA 3ER0A 4M75F 3CCJT 3HXXA 4JLIA 5GMKj 1VQMA 3A7RA 1YIJA 4C8QD 1EIYA 1YFRA 2E41A 3L42A 4UPAA 3L2UA 2I2LA 2EQKA 4JRQA 4P73A 2JVVA 3L2RA 3HSBA 1YIJT 5FLXE 2KMTA 2Y90A 4YRJA 3N5BB 1D3BB 4N4HA 4RCCA 2F69A 2RHUA 4KT0E 3KXTA 1Q81C 4ME7A 3G7ZA 1EVKA 3CC7A 4YRPA 5A0DA 4YRMA 4JDSA 2K5LA 4RDXA 3JB9J 2PMEA 3BJUA 5LJ5g 4TVYA 3TCJA 3NENA 4A4EA 3CC7T 2LDMA 2E6NA 3HFZB 1HC7A 4M78E 2QA4A 3QG1A 4YRQA 2JTFA 3F70A 3QDRB 4UP7A 1D3BA 4MZTA 2RJEA 2FL7A 2ZZFA 5CQYA 5IAYA 4LD9K 2KVQG 4PJOE 2P0LA 4LDVA 4GLKA 1NE8A 3M4QA 2ZPIB 4KQEA 1ZHIA 5GANe 3QO8A 3NFCA 1W66A 4BD3A 3JB9F 4YRLA 1EIFA 3OYCA 4J15A 2LCCA 4M77G 3OYYA 4E7HA 1X54A 3VQWA 1UEBA 2OTLA 3HFZA 2EQJA 4J83A 4BW9A 3OMGA 2C8MA 3V8LA 4HCZA 4HWSA 1WGSA 1M4ZA 2VGNA 1NZ9A 2LQKA 3QO3A 2P0PA 2QQBA 4HWRA 1BI3A 4C8QC 2GF7A 1NYRA 4M78F 2XDPA 1VQLA 3OYEA 3HHTB 4LVLA 5KE3A 4PJOF 5FU6C 2B8AA 2QHUA 3G4SA 1VQLT 3CCVA 5C51B 5FU6B 1VQKA 2PQWA 4J6XA 3CCVT 4QQGA 4ZTZB 5I2SA 4LVKA 2XG8D 4M7AG 5ELNA 1QW1A 4M77E 1JJ2S 2X4JA 3JB9D 1UGQB 4BE0A 3R6OA 3OYLA 3MHXA 4LDXA 5GAOn 3WVEB 4XU0A 1G5HA 3LWIA 1KMNA 3LX7A 4LD6A 5GMKe 1C0AA 3JCMg 2GCXA 1O9SA 4DOVA 4M75C 3PIOA 3BDLA 3CC2A 2Q7GA 4A54A 3HXUA 1NNHA 4XTVA 4Y28E 1NJIU 4IUPA 1AHJB 5CAIA 3VUBA 3CCUT 4M78D 1U8RA 2BKDN 2P0KA 2GFAA 3M59A 3MQZA 1B8AA 2QHSA 5HK0A 2ZR2A 3RL6A 3JCMb 4PJOD 5CR2A 4Q5WA 1FXXA 5HY6A 4M77F 2LNVA 2DQ3A 4JRKA 1WQ7A 3OYMA 2QHVA 4HWOA 2G4CA 3MEVA 1LNXA 1ASYA 4M7AE 5GAN3 1N9RA 3M4GA 1OYXA 3ME9A 4K87A 3HFOA 4WJ4A 3LGLA 1WPYA 3E9FA 1SSFA 2XDDA 1G3SA 1P92A 3SWNC 2MMPA 3ZBDA 3TU4K 4ZGDB 4QVDA 3A8GB 3G1ZA 4PHCA 3IKMB 3MEAA 3LSSA 1VQOA 4EDUA 4QW2A 4YPFA 2DTIA 2VUBA 4JUVA 1VQPT 4C92G 1VQZA 1UGRB 4BUGA 2VGMA 4XTWA 2E64A 3BY7A 1N27A 1X6OA 4HCCA 5DLQE 3X25B 1USYC 4F7UG 5GMKh 2RO0A 4NL3A 1VQ7A 2R57A 2ZZEA 5CKFA 4XEMA 3CCEA 5LJ3e 3SWNA 4P71C 3QZ5B 4M7DG 2P0QA 4YCVA 4M7AF 1XOVA 4EMKB 3G71T 4RG8A 2F5KA 3DB3A 1B70B 4M77D 2RH2A 2F5TX 4M78C 4IKFA 1JB0E 1VQ9A 3OYNA 4CS4A 1M1KC 4OB1B 3CCRT 3UFGA 1BI0A 1KC8C 4CI0C 3IKLA 2JN0A 4UC4A 3MEYA 2I4LA 4D6WA 4PJOC 4H02A 2AMCA 1WLEA 4XTYA 3HRSA 2E5QA 2CZ0B 3CCQA 2PVOB 2QQ9A 1WJSA 3MP6A 1W2BA 2K2VA 3J81E 3JCMW 3QJYA 3X26B 1YITA 1Q81U 3I55T 5FU7B 1Q86C 4EMKA 2OAUA 3OMCA 4J7FA 3OS1A 1B70A 5L8RE 4FIBA 2E1HA 2A3LA 1M90C 5CKHA 3MP8A 4ZGJB 3ZEHA 4M78A 1XNIA 2EWNA 2E5AA 4Q6GA 2DU7A 5HK3A 3VQYA 4J5YA 3OW2S 5GANj 4M7DE 3VQVA 2QQAA 2DEQA 3QUIA 4N4IA 4M7AD 3JCMJ 2DXCA 1LOJA 3EFSA 3JCMV 3JB9I 3GIBA 5GAOr 5C6SA 2O4XB 3JCMQ 5GAN7 4TQFA 1QVGA 3M5AA 4BE1A 5FRMA 1QE0A 3LYIA 5LJ5e 5AYFA 2ZPBB 3CMAT 2RK2A 4PL6A 4E47A 1N8RC 4AH6A 4M77C 3CMQA 1S72T 2PU9B 1E24A 4H2VA 4CS2A 3GNGA 1EFWA 4YRRA 2R5AA 1Y71A 5GMKl 3HFNA 4ZGEB 4F7UF 4HA8A 1ADYA 3P8HA 3M55A 3OS5A 2LCLA 5GAMg 3VV0A 2E10A 2O4XA 3CXCA 3A7UA 2RHZA 2DD5A 4M7DF 3OB9A 4BWAA 3SFMA 1EIYB 1EQRA 5CKEA 1M1FA 1H4VB 1VQ5T 3LLRA 4YROA 4FT4A 2XK0A 4ATOA 2ZTGA 3GP8A 1BI2A 2FHDA 3DB4A 2LX9A 1YBYA 2WSEE 2L3RA 2RM4A 1G51A 3CCJA 4YCUA 4P3PA 3HL8A 2DKGA 3CCLT 1YI2T 3JAME 1OI1A 2KSSA 4C5GA 3RERA 1YFTA 1YJWT 5LJ5d 4N0AC 3HTZA 3E9HA 2P4TA 3S3OA 4CH3A 4K88A 1NJ1A 4TVWA 3RF1A 2ZT6A 3HFVA 2ZT7A 3LC0A 2XICA 4M7AC 4XK8E 4C5EA 4G84A 4C0ZA 2V8JA 3I56T 2ZINA 4BDYA 3E1SA 3MP1A 4R55A 3HRUA 4FT2A 2CS7A 5LJ5h 2XI9A 2DU5A 4N0AA 2DQ0A 1VUBA 4M7DD 1M9SA 3M9QA 1ATIA 2D6FA 2HD0A 4IUUA 2ZNIA 3P8TA 4XU2A 3M53A 2JOYA 4H2WA 4FSXA 4C5IA 3HKSA 1NJ8A 3A8LB 3TEHA 3L2ZA 4M7AA 3REUA 1K9MC 3M4YA 1W2BS 4CH6A 5LL6S 4NOYA 4YDQA 3JCMe 5C52B 1M1GA 4M75D 5I21A 1G5VA 2YLCA 4ELZC 4YRCA 1YCYA 1G3YA 1QVFA 2DTHA 1H3ZA 1N9WA 4EX5A 1U1SA 2C7IA 1V29B 2CKKA 2CJAA 3UH0A 1VQ4T 2VC8A 4A4HA 1WQWA 3OYGA 3MEUA 3RGLA 4DQ2A 2X4WA 5LJ3j 3MO8A 3CC4T 4H2UA 4C8QB 1JRIA 2ZT8A 3P8YA 4ZTUB 3HP9A 4JS5A 4E51A 2DDZA 3EAEA 1GXIE 5GAOp 1QVGS 3QBYA 3QJ6A 2E6ZA 1Y7XA 4C0GA 1MGQA 2I4NA 1BKBA 3HRKA 3PMTA 2P5IA 3M4PA 2K5IA 5GANd 1YB3A 4J8OA 1PYSB 4K86A 4C5HA 3L4GB 4P75C 3MF2A 1M1KU 5GAOm 2HBPA 4OVAA 1KC8U 4ZN3A 2LT4A 3PIPA 4M7DC 1Z7MA 2QDYB 1HTTA 4C8QA 3TEEA 3URGA 3CCMT 3KFUA 3A8OB 2GFUA 4HWTA 2EIFA 3A32A 4R56A 3H8ZA 2A7YA 2MF2A 1VQ8T 5GAN4 3CMET 3IALA 2EJFA 1UGPB 4H2XB 4KR2A 3VYGA 1Q7YC 1Q86U 4H2SA 2QHTA 5LJ5f 5GANh 1M90U 1PYSA 3NELA 2DJZA 3L4GA 3CCUA 3CCST 3GNFB 3GOXA 4EMHA 4M75B 2XIDA 3QXEB 4KR3A 1IREB 2LQ8A 4YRNA 1SESA 3E9IA 3J80E 4LDUA 4MMLA 3VBBA 2RHXA 3OY9A 3QYGB 1KQ2A 5D6XA 4QVCA 3DLLA 4A4GA 3BFMA 2RHSA 1FWZA 4J7IA 1RI0A 4H2XA 4O2DA 5CQXA 2HQXA 3FDRA 3A5YA 4ZIBA 2MAMA 4PG3A 3EFRA 4WJ3M 2BIVA 1NPPA 3V8JA 4BDZA 1XQHA 1G3WA 4OB2B 3OYKA 5LJ5j 1M8VA 2K57A 1ZQ1A 4M75A 3A8HB 2OTJT 4BI4A 2IY5B 3VUZA 2E65A 2ZZDA 1VQNA 4HWPA 2JTMA 4FU6A 2A8EA 4PLIA 3QHSA 3MCAB 1N8RU 4MMKA 5KH6A 4TWAA 1VQNT 5HKCA 3SWNB 1NYQA 1VQPA 4WI1A 5D6YA 1UB4A 3MEWA 4J6YA 4HT8A 1SRYA 2L89A 1LJOA 3QIIA 3C94A 2RA2A 3UDCA 4NL2A 3SD4A 2DAQA 2RB6A 5A2QE 2KQWA 4XQ3A 3VQXA 2DXBA 1YHQA 4P3NA 2IY5A 2M9UA 3PTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RDX A;  3JB9 J;  1X2H A;  2AMC B;  4C92 A;  2PME A;  3BJU A;  4YRT A;  5LJ5 g;  2Q7E A;  2ZXF A;  4TVY A;  1QE0 A;  3NEN A;  3QSU A;  4H2Y A;  5LJ5 e;  3JCM h;  3FIF A;  3QTC A;  5E3I A;  3HFZ B;  1H4T A;  1HC7 A;  4AH6 A;  2PMF A;  4M78 E;  4M77 C;  4F7U A;  1JJC B;  3A74 A;  2DXU A;  3CMQ A;  1E24 A;  4PNO A;  1GGM A;  4H2V A;  4YRQ A;  4P75 A;  4CS2 A;  1BIA A;  4UP7 A;  5GAN 2;  2DZ9 A;  3TEG A;  1EFW A;  1D3B A;  4YRR A;  2XTI A;  2ZZF A;  4M7D A;  3BDU A;  5GMK l;  3HFN A;  4F7U F;  4HA8 A;  4M78 B;  1ADY A;  3RKW A;  5C53 B;  4RQF A;  4PJO E;  5GAN g;  2ODR D;  2P0L A;  5GAM g;  2E10 A;  4RCB A;  2QTX A;  1KMM A;  3M4Q A;  3A7U A;  4KQE A;  4YRE A;  2RD1 A;  4M7D F;  5GAN e;  4J6W A;  4BWA A;  1EIY B;  5GAM e;  5GAN f;  3QO8 A;  1EQR A;  1W66 A;  3JB9 F;  4YRL A;  4CS3 A;  1H4V B;  4PJO B;  1USY A;  4M77 G;  4J15 A;  3FJP A;  2ZGW A;  3HXZ A;  4YRO A;  2E3C A;  1X54 A;  1FYF A;  3VQW A;  4Y91 A;  2I4M A;  2ZTG A;  3HFZ A;  4P71 A;  4BW9 A;  2C8M A;  1JJC A;  2RM4 A;  3V8L A;  1G51 A;  1SET A;  4YCU A;  3RES A;  1H64 1;  4P3P A;  1H4Q A;  4HWS A;  2DTO A;  2DKG A;  4C92 E;  3HXY A;  1NJ5 A;  1TH7 A;  3QO3 A;  3RER A;  4HWR A;  1YFT A;  2ALY B;  5LJ3 d;  4C8Q C;  5LJ5 d;  2RHQ A;  4N0A C;  3HTZ A;  3HY0 A;  4TQF A;  4DPG A;  5GAN 5;  3NET A;  5GAN 6;  3ERR A;  4F7U E;  2Q5I A;  1NYR A;  4M78 F;  3E9H A;  2Q7H A;  4CH3 A;  1WYD A;  4PJO A;  4K88 A;  1NJ1 A;  3BW1 A;  4TVW A;  3RF1 A;  2ZT6 A;  3HFV A;  2ZT7 A;  3LC0 A;  4XEO A;  1SER A;  4X9D A;  1YFS A;  4M7A C;  3LSQ A;  4JRI A;  1L0W A;  4PJO F;  3SB2 A;  4G84 A;  4H2T A;  2QHU A;  2ZR3 A;  3JCM X;  2CIM A;  5C51 B;  4C8Q G;  3ICA A;  1WNL A;  5GAM d;  2ARS A;  2ZIN A;  1KQ1 A;  4J6X A;  2ALY A;  1NJ6 A;  1I81 A;  5LJ3 h;  5LJ5 h;  3A5Z A;  3JB9 H;  4ZTZ B;  2DU5 A;  4X5O A;  1N9S A;  1M5Q 1;  4N0A A;  3P8V A;  1IL2 A;  2DQ0 A;  4EO4 A;  4M7D D;  1ATI A;  4M7A G;  5ELN A;  1Z7N A;  4M77 E;  3R07 A;  3JB9 D;  2ZNI A;  3P8T A;  4XU2 A;  4C92 F;  4YRK A;  4H2W A;  1NJ8 A;  3I7F A;  2DXT A;  4A53 A;  3TEH A;  2ZT5 A;  3L2Z A;  5GAO n;  4M77 B;  1KOG A;  1JBM A;  5GAO q;  4M7A A;  4XU0 A;  1EVL A;  1G5H A;  3REU A;  3TUP A;  1KMN A;  1G5I A;  4YYE A;  1X56 A;  3NEM A;  4CH6 A;  2ODR C;  4YRI A;  5GMK e;  1EOV A;  1C0A A;  4NOY A;  3JCM g;  4HT9 A;  4YDQ A;  4EMK C;  2YHT A;  1I8F A;  2J3M A;  5GAM h;  1B7Y A;  2RHQ B;  2ART A;  3PCO B;  4M75 C;  3JCM e;  3INZ A;  5C52 B;  2Q7G A;  1Y96 B;  4A54 A;  3JCM f;  3QO5 A;  3HXU A;  3PZC A;  4M75 D;  1NNH A;  5I21 A;  4EMG A;  2YLC A;  4XTV A;  4YRC A;  1YCY A;  4YRS A;  5GAN 8;  5CAI A;  4M78 D;  2DTH A;  4L87 A;  3L1A A;  1J5W A;  1N9W A;  4EX5 A;  1U1S A;  2C7I A;  1U1T A;  3UGT A;  2I4O A;  1ADJ A;  2CJA A;  3UH0 A;  3RKX A;  4TVA B;  1B8A A;  2QHS A;  3OD1 A;  3V7R A;  4M77 A;  2ZR2 A;  3RL6 A;  3JCM b;  2VC8 A;  3HXW A;  4M75 G;  1HXD A;  4HVC A;  4PJO D;  4C8Q E;  1WQW A;  3MF1 A;  4YCW A;  2AKW B;  2CJ9 A;  1B34 A;  4CH5 A;  3RGL A;  4DQ2 A;  5K1P A;  4M77 F;  4OP0 A;  5LJ3 j;  2ZIO A;  3PCO A;  2DQ3 A;  4H2U A;  4XTX A;  4P74 C;  4JRK A;  1Y96 A;  1WQ7 A;  1JRI A;  4C8Q B;  2QHV A;  4HWO A;  3W3S A;  2ZT8 A;  2G4C A;  3V7S A;  3P8Y A;  4ZTU B;  1LNX A;  2FB7 A;  4M7A E;  1ASY A;  2YLB A;  5GAN 3;  1E22 A;  1N9R A;  4UP8 A;  11AS A;  3A31 A;  3M4G A;  3PGG A;  4E51 A;  4K87 A;  3HFO A;  3IG2 A;  4WJ4 A;  2DDZ A;  3REX A;  1WPY A;  3RIR A;  4RQE A;  4X9C A;  2EJG A;  2ARU A;  3TEH B;  2FYK A;  5GAO p;  4P72 C;  4C92 D;  2J3L A;  1MGQ A;  3SWN C;  2I4N A;  3DSQ A;  4M7A B;  4TVA A;  3HRK A;  2P5I A;  2VXE A;  4TTV A;  3HXV A;  3M4P A;  4TQD A;  4QVD A;  5GAN d;  1YB3 A;  3G1Z A;  1E1T A;  1YGB A;  4XTZ A;  4G85 A;  4PHC A;  3IKM B;  1PYS B;  2AKW A;  3LSS A;  3QNE A;  1B7Y B;  4K86 A;  3V8K A;  3L4G B;  4P75 C;  3MF2 A;  5GAO l;  5GAO m;  4YPF A;  4YRF A;  2DTI A;  4JUV A;  4M7D C;  1BBW A;  1Z7M A;  4WF2 A;  1LYL A;  1HTT A;  12AS A;  3HRI A;  3UGQ A;  4C8Q A;  4C92 G;  4Q15 A;  2VXF A;  3HY1 A;  1VQZ A;  3KFU A;  4P74 A;  4XTW A;  2E64 A;  3BY7 A;  4HWT A;  1X55 A;  3A32 A;  4C8Q F;  2DZC A;  3WQZ A;  5F5W A;  5GAN 4;  3IAL A;  1USY C;  2EJF A;  4H2X B;  3RKY A;  4F7U G;  5GMK h;  4YP0 A;  5LJ3 g;  2CGH A;  4NL3 A;  4KR2 A;  3JCM c;  2ZZE A;  4XEM A;  4H2S A;  4P72 A;  4M75 E;  3VU3 C;  5LJ3 e;  3SWN A;  2QHT A;  4P71 C;  1B34 B;  5LJ3 f;  5LJ5 f;  4M7D G;  5GAN h;  2ZCE A;  1PYS A;  3NEL A;  2DJZ A;  4UP9 A;  3L4G A;  4YCV A;  3JB9 G;  4M7A F;  4YRG A;  2EJ9 A;  4EMK B;  4EMH A;  4P3O A;  1B70 B;  2XGT A;  4M75 B;  1QF6 A;  4M77 D;  4KR3 A;  4M78 C;  4YRN A;  1HK9 A;  2DVE A;  4CS4 A;  5GMK m;  1SES A;  3E9I A;  4NCX A;  2CJB A;  3UFG A;  3IKL A;  3QO7 A;  2JN0 A;  1X2G A;  4MML A;  3VBB A;  4XU3 A;  2ZIM A;  1ASZ A;  1KQ2 A;  4QVC A;  3BFM A;  2RHS A;  3MEY A;  2I4L A;  5KNN A;  4PJO C;  4H02 A;  2AMC A;  4H2X A;  1WLE A;  4XTY A;  5GAM f;  4O2D A;  4P73 C;  5DY9 A;  4OLF A;  2HNI A;  3A5Y A;  4ZIB A;  3RAC A;  3JCM W;  3EFR A;  1BBU A;  4PG3 A;  5HGQ A;  4WJ3 M;  4CH4 A;  1NJ2 A;  3V8J A;  3RUX A;  4M78 G;  2Q5H A;  5LJ5 j;  4XTU A;  3FB9 A;  3AHU A;  1BIB A;  4EMK A;  1M8V A;  5ELO A;  1E1O A;  2K57 A;  1B70 A;  1H4S A;  4M75 A;  2E1H A;  4RMF A;  2IY5 B;  2E65 A;  5GMK i;  1RIQ A;  1WU7 A;  4HWP A;  4M78 A;  2ZNJ A;  5K1X A;  3A7A A;  2EAY A;  4PJO G;  2ZZG A;  1I5L A;  4C92 C;  4M75 F;  3HXX A;  1X01 A;  2E5A A;  2EWN A;  4JLI A;  5GMK j;  3QHS A;  4Q6G A;  4C92 B;  2DU7 A;  3A7R A;  3VQY A;  4MMK A;  4C8Q D;  1EIY A;  1YFR A;  2E41 A;  4TWA A;  3JCM d;  2EL9 A;  3SWN B;  1NYQ A;  4UPA A;  4J5Y A;  5GAN j;  2I2L A;  5GAM j;  4WI1 A;  4M7D E;  3VQV A;  4P73 A;  3HSB A;  3JCM P;  4F7U B;  4J6Y A;  4HT8 A;  4LNS A;  1SRY A;  2DEQ A;  1LJO A;  2Y90 A;  2RA2 A;  3QUI A;  4YRJ A;  4NL2 A;  4M7A D;  1D3B B;  2RB6 A;  1I4K 1;  3JCM J;  4XU1 A;  4M7D B;  4RCC A;  4XQ3 A;  3V7C A;  3VQX A;  1LOJ A;  3EFS A;  1B76 A;  3JCM V;  3JB9 I;  4P3N A;  2IY5 A;  3GIB A;  5GAO r;  1EVK A;  4V2S A;  3JCM Q;  4YRP A;  4YRM A;  5GAN 7;  2RHS B; 
#chains in the Genus database with same CATH topology
 1X2H A;  3NPF A;  1IGQ A;  2AMC B;  2Q7E A;  4YRT A;  1YHQ T;  1UGS B;  3G71 A;  2ZXF A;  4X1V A;  3X24 B;  4RTT A;  1QVF S;  3QSU A;  2BZY A;  3H0F A;  3QTC A;  2LC4 A;  3CCR A;  3JRZ A;  1JJC B;  1R8O B;  1D0Z A;  1GGM A;  2QQR A;  3JV3 A;  3CC4 Q;  1BIA A;  2ESW A;  5GAN 2;  1KSW A;  4OB3 B;  2FZK B;  2L3P A;  1WJQ A;  2L3S A;  3BDU A;  4MZP A;  1KD1 R;  4M78 B;  1Q82 C;  2V8I A;  2A28 A;  2KGT A;  5IN1 A;  2YUQ A;  5C53 B;  1MHN A;  4RQF A;  2FPD A;  2CP5 A;  3NTI A;  5KYY B;  2EYQ A;  4RCB A;  3H9N A;  1KMM A;  4YRE A;  2RD1 A;  4J6W A;  5GAM e;  5GAN f;  2DL7 A;  3C12 A;  3M0Q A;  3I55 A;  4CS3 A;  1WXU A;  4PJO B;  1USY A;  2K3X A;  3SDZ A;  4Y91 A;  5DM7 R;  3P8D A;  2RN8 A;  4C0F A;  3VS6 A;  2PUK B;  2ED0 A;  1RAI B;  2AZS A;  4P71 A;  2IG0 A;  3M0P A;  2QGG A;  1JJC A;  5M9O A;  4J9D A;  2L3Q A;  4AFS C;  2RQT A;  1SKU B;  4OF1 A;  4C92 E;  2IVW A;  2JXB A;  1NJ5 A;  3OSS C;  2XDB A;  3HRT A;  4A4F A;  2LQW A;  3C95 A;  1K4U S;  3CCM Q;  1TH7 A;  4YTL A;  2BE7 D;  2KXD A;  1RAE B;  4PFZ A;  3OBY A;  2ALY B;  5LJ3 d;  4IIM A;  2RHQ A;  1BYM A;  5KYY A;  3HY0 A;  4DPG A;  2WSC E;  4F7U E;  3ERR A;  2K79 A;  3G4S Q;  1VQ8 Q;  2Q5I A;  3CME Q;  4BE2 A;  2Q7H A;  5AT1 B;  5KE2 A;  1WYD A;  4PJO A;  1F1B B;  1Y07 A;  1K9M U;  4LVI A;  3Q1J A;  1VQK Q;  3G6E Q;  3QZ9 B;  1YFS A;  2MYS A;  1UHC A;  3UPU A;  3UWN A;  3CPF A;  1NJI C;  3SB2 A;  2QEX T;  4H2T A;  2MPX C;  2O01 E;  4BY6 C;  2MI6 A;  3JCM X;  1YCS B;  1I5O B;  2R5M A;  2QGF B;  4BY6 B;  1PSE A;  1BU1 A;  1WNL A;  5GAM d;  2ARS A;  3DLM A;  1KQ1 A;  1YWO A;  3R6N A;  5FRN A;  2ALY A;  3CMA A;  1QWE A;  1K73 C;  1NJ6 A;  5LJ3 h;  2FRW A;  1X6G A;  2DFU A;  4JZ4 A;  1N9S A;  5KYX B;  1S72 A;  4HT4 A;  1IL2 A;  4EO4 A;  2HCK A;  2L0A A;  3R07 A;  2H3E B;  2CT4 A;  1T3L A;  2K3Y A;  4JJD A;  4C92 F;  2HZY A;  4YRK A;  2MIO A;  2F2V A;  1G83 A;  3I7F A;  2DXT A;  5IXF A;  3EGU A;  2CH4 W;  3PNW C;  1OOT A;  2NS6 A;  4M77 B;  1JBM A;  5GAO q;  3TUP A;  1EVL A;  1G5I A;  4AG1 C;  1YN8 A;  1X56 A;  3NEM A;  1OPK A;  1EOV A;  4HT9 A;  2KY9 A;  1YJN T;  1I8F A;  2X4X A;  2J3M A;  2VAS A;  5GAM h;  1B7Y A;  1VQ5 A;  3PCO B;  2ART A;  5I22 A;  3C4S A;  4EPC A;  4PJJ A;  1E7O A;  1Y96 B;  3QO5 A;  1YJ9 T;  1K8A C;  4JS4 A;  3OA6 A;  4KGX B;  4EMG A;  1D0X A;  1ZA2 B;  1D1B A;  5KYX A;  2PUO B;  5GAN 8;  2RJC A;  2EGE A;  1MV0 B;  3JSC A;  5J3B A;  1J5W A;  1WX6 A;  3FLG A;  2PTK A;  4PLL A;  1QVP A;  3PMI A;  3CCL A;  4RMO A;  1YI2 A;  1OZ2 A;  3TRE A;  1U1T A;  1GFD A;  2I4O A;  1ADJ A;  4DA4 A;  3RKX A;  1YJW A;  1VA7 A;  4M77 A;  2X9H A;  2HQH A;  2ZPG B;  4YCW A;  2EPD A;  2AKW B;  2CJ9 A;  5FRO A;  4M4Z A;  2C0O A;  1B34 A;  3J7A F;  4CH5 A;  1GCP A;  5KCO A;  1VQ6 A;  2DPP B;  5K1P A;  4OP0 A;  2ZIO A;  3PCO A;  4P74 C;  1Y96 A;  2KDS A;  2RI3 A;  3H6Z A;  3EFO B;  3VS7 A;  3V7S A;  2RI5 A;  2AK5 A;  2FB7 A;  1VQ6 T;  11AS A;  4QQD A;  3A31 A;  1YP5 A;  3PGG A;  1Q7Y U;  3IG2 A;  2QYZ A;  3REX A;  3I56 A;  3CD6 T;  3RIR A;  4RQE A;  4OGE A;  1PC0 A;  3TEH B;  2FYK A;  4P72 C;  1JU5 C;  2RMO A;  4C92 D;  2J3L A;  1ZA1 B;  3OYH A;  3DSQ A;  1TS9 A;  2AIR B;  4M7A B;  4ZN1 A;  3A8M B;  4PKC C;  2ECZ A;  4TTV A;  1GRI A;  2XMF A;  4TQD A;  1FYN A;  2DIL A;  4P5N A;  1E1T A;  1NYG A;  2AKW A;  2H3J A;  1ZBX A;  2PVG B;  2CSQ A;  1G2B A;  1VQM T;  1EX4 A;  5GAO l;  3S3N A;  4YRF A;  3CBM A;  3NTK A;  1KHC A;  4ANJ A;  1BBW A;  1K9A A;  4WF2 A;  1J3T A;  2EQM A;  3VKI A;  1LYL A;  3UGQ A;  4OMO A;  3LWH A;  1JQQ A;  2VXF A;  3HY1 A;  3CCE Q;  3OYD A;  2EKH A;  4P74 A;  5CVI A;  2YXY A;  3OS0 A;  1KFZ A;  4L6V 5;  1X55 A;  2MWO A;  3LW5 E;  2HAX A;  1TUG B;  2DZC A;  2KRN A;  4QQ6 A;  2JM8 A;  2RQV A;  2AZV A;  3M58 A;  1KJW A;  4AFQ C;  4YP0 A;  2YWW A;  4IUQ A;  3SEM A;  4DBQ A;  2K4Y A;  2WAC A;  2K6D A;  4P72 A;  1SPK A;  2K7A A;  2KK4 A;  2DX1 A;  1TOV A;  1SEM A;  5LJ3 f;  2ZCE A;  2D9T A;  2EKO A;  2LTO A;  2DK3 A;  2DD4 A;  4KH1 B;  1O75 A;  1M8M A;  4YRG A;  3RMQ A;  2EJ9 A;  4JJC A;  2M0O A;  2MWP A;  1W4S A;  2RF0 A;  2QXF A;  1KD1 C;  2RK1 A;  3CCQ Q;  2J7I A;  2DVE A;  1KIK A;  3CBP A;  2V1Q A;  5GMK m;  2CZ1 B;  4RTY A;  4NCX A;  1VQ4 A;  2QA4 T;  4E7L A;  4MZM A;  3FC3 A;  3QO7 A;  1M1K R;  2JUF A;  4XU3 A;  2ZIM A;  1KC8 R;  1ASZ A;  4OMF B;  3QKJ A;  5CK9 A;  2ROL A;  2VWF A;  3OQ5 A;  3CC4 A;  2SRC A;  4X34 A;  5GAM f;  2LCS A;  1PKS A;  5DY9 A;  2QEX Q;  4OLF A;  2DIQ A;  2HEQ A;  2JNG A;  2V1R A;  4II1 A;  2IPO B;  3GF5 A;  4LUD A;  1NJ2 A;  3RMS A;  1H3H A;  4XTU A;  3AHU A;  1VYU A;  1UUE A;  1AWO A;  4FSS A;  4J9E A;  2RPN A;  3S6W A;  3OYI A;  2EFI A;  2OTL T;  1Q86 R;  4JLG A;  2CYZ B;  4AFZ C;  2COZ A;  2CP3 A;  3NTH A;  1BI1 A;  3CBO A;  1CKA A;  1ZSG A;  2DRM A;  1M90 R;  2M1H A;  5K1X A;  2EAY A;  4C92 C;  1PHT A;  1X01 A;  2QDL A;  5DLO A;  3E2U A;  2HL3 A;  4C92 B;  2RHY A;  5CKB A;  3M56 A;  4J9C A;  4Z8A A;  4DBR A;  2YRC A;  1YWP A;  3JCM d;  3OS2 A;  2EL9 A;  4E7I A;  4AFU C;  3GPL A;  2VV5 A;  1M2V B;  2CP0 A;  5GAM j;  2GQV A;  5KYW B;  1K0S A;  3CCM A;  5HCK A;  4Z02 A;  2CUD A;  2NUP B;  3CPW P;  4LN2 A;  4F7U B;  1IO6 A;  3RNJ A;  3JCM P;  4LNS A;  2CT3 A;  3REB B;  1Q82 U;  1YJN Q;  3CQT A;  2HQE A;  1V76 A;  1VQ8 A;  1I4K 1;  1NPR A;  4TVR A;  4XU1 A;  3CME A;  4M7D B;  3V7C A;  2OAW A;  1B76 A;  1GBR A;  2RJD A;  4V2S A;  3M54 A;  4FL6 A;  3CXC S;  3VYH B;  3G6E A;  4J9I A;  3G4S T;  2RHS B;  2LT1 A;  1RAC B;  2YUO A;  4BB7 A;  4XAX B;  4C92 A;  3M57 A;  4HVW A;  3CCS A;  1KG1 A;  4H2Y A;  5C0M A;  1VQK T;  3JCM h;  3G6E T;  3OW2 A;  3FIF A;  5E3I A;  5KYW A;  3TSZ A;  3CPW A;  1H4T A;  2NUP A;  2PMF A;  1G3T A;  4F7U A;  3A74 A;  2DXU A;  1CKB A;  3UT1 A;  5IXB A;  4PNO A;  2DLP A;  2K5F A;  4P75 A;  1ABQ A;  5I2M A;  2ENM A;  2DZ9 A;  3FEO A;  3TEG A;  3EGX B;  2LJ0 A;  1N6A A;  2XTI A;  4M7D A;  3X28 B;  1K0X A;  3RKW A;  2FVU A;  2CZ6 B;  2GBQ A;  1OU9 A;  4MDW A;  5GAN g;  2ODR D;  1KQS P;  2QTX A;  3UA7 A;  1WXB A;  1TU0 B;  3T9N A;  1TTH B;  2BUD A;  3P8B B;  5D7U A;  1TWB A;  2O9S A;  3FJP A;  2ZGW A;  3HXZ A;  2E3C A;  1FYF A;  4KUD K;  2RJF A;  1RAD B;  1UE9 A;  3CC2 T;  2I4M A;  2OTJ A;  2RQR A;  3G1J A;  4KUL A;  2KR3 A;  5IT9 E;  2AHJ B;  4B9W A;  1NEG A;  1YIJ Q;  1SET A;  1QP3 A;  1QP2 A;  3RES A;  1H64 1;  4ZNX A;  1H4Q A;  2DTO A;  1K73 U;  4VUB A;  5KCH A;  2NUZ A;  1AZE A;  3HXY A;  2DYI A;  1I0C A;  2DO3 A;  4RUG A;  2JMA A;  1VIF A;  3QYH B;  1HJD A;  1KQS A;  2YRV A;  4HCB A;  2M16 A;  3A5Z B;  1NG2 A;  5GJV B;  3L2W A;  5GAN 5;  3NET A;  3O8V A;  5GAN 6;  2E12 A;  4LVJ A;  2AT1 B;  2X4Y A;  2YUP A;  4PK4 A;  1SF9 A;  3O5Z A;  1D0Y A;  3QWX X;  1UJY A;  4F16 A;  3BW1 A;  1MV3 A;  3CC7 Q;  1UTI A;  5EG2 A;  1OUL A;  4XEO A;  1SER A;  4X9D A;  3LSQ A;  2CP2 A;  4JRI A;  2DIG A;  1L0W A;  4HKE A;  4JJB A;  3HPW A;  2ZR3 A;  4PJL A;  1SRL A;  2DF6 A;  2CIM A;  3THK A;  4C8Q G;  4LDY A;  1K8A U;  2L5Q A;  3ICA A;  1PSF A;  4OB0 B;  5IHK A;  5J39 A;  5EC7 A;  4WTO B;  1QQJ A;  1Q81 R;  3CEY A;  1PD0 A;  2GQI A;  1DJ7 B;  3DKM A;  3ZFJ A;  2QA4 Q;  4FM4 B;  2JT4 A;  1I81 A;  3A5Z A;  3JB9 H;  1U5S A;  2XD0 A;  4X5O A;  4NS5 A;  4JJN K;  4LDW A;  1M5Q 1;  3P8V A;  2X51 A;  1VQO T;  4R0K A;  1MMN A;  1Z7N A;  3KBG A;  3PVQ A;  2L2P A;  3QPH A;  4OML A;  1WHJ A;  2KI7 A;  2DL3 A;  4O6J A;  2BZ8 A;  2ZPF B;  4A53 A;  2ZT5 A;  2ATC B;  1KOG A;  3A98 A;  1M30 A;  1ABO A;  2COY A;  4YYE A;  1WHH A;  2D8J A;  2M0Y A;  2ODR C;  4YRI A;  1NEB A;  3U23 A;  2OTL Q;  4RKU E;  2M02 A;  4EMK C;  2YHT A;  1RL2 A;  2RHQ B;  2XKO C;  3FRN A;  1VQ7 T;  4B9X A;  3INZ A;  3M0R A;  1OV3 A;  3JCM f;  4E7J A;  2LRQ A;  2HKN A;  3CCE T;  3PZC A;  2Z0W A;  2EQI A;  3OSV A;  1XTD A;  3EGD A;  3OYA A;  2NLU A;  3S3M A;  3M0T A;  4HVV A;  4IUR A;  4YRS A;  2ZCF B;  2EQU A;  2QAZ A;  5CIU A;  2RQW A;  2EYY A;  3H41 A;  4L87 A;  3L1A A;  4QVZ A;  3KUF A;  3VJP A;  3UGT A;  3WVD B;  4TVA B;  1VQ9 T;  4ZTJ A;  3OD1 A;  3WXM B;  3V7R A;  1A0N B;  3HXW A;  1HXD A;  4M75 G;  4HVC A;  4C8Q E;  3MF1 A;  1VQL Q;  3EG3 A;  1IZ6 A;  5FU7 C;  4QKU A;  2VYT A;  4IUV A;  4XTX A;  3CCQ T;  4OGC A;  4KBM B;  3CCV Q;  3W3S A;  4C0D C;  4JRP A;  2R58 A;  5A0L A;  2QEX A;  1YIT T;  4MDX A;  5CO7 A;  2YLB A;  4C0D B;  1E22 A;  4UP8 A;  1X2Q A;  2XHC A;  2Y4X A;  3L2V A;  1D09 B;  4FYX B;  4X9C A;  2EJG A;  2ARU A;  3MET A;  1X75 C;  2DE0 X;  4CRI A;  4TVA A;  3OYB A;  4A4K A;  1QKX A;  4BAC A;  1WJR A;  3PE0 A;  2BTT A;  2VXE A;  3HXV A;  4ZTF A;  2OX7 A;  3ULR B;  2ZPH B;  1RAF B;  4D8K A;  1YGB A;  4XTZ A;  4G85 A;  2AKL A;  2GTO A;  1KD1 U;  2DMO A;  3QNE A;  1B7Y B;  3CPW S;  3V8K A;  4N4G A;  1K1Z A;  4L5G A;  4LVM A;  1ZUY A;  3E19 A;  2WSF E;  3OBW A;  5CKD A;  2V8K A;  1X27 A;  12AS A;  3HRI A;  4Q15 A;  1OU8 A;  2KAF A;  1MUZ A;  1JJ2 P;  3OYJ A;  2CP6 A;  1JXM A;  5A0G A;  2X35 A;  4C8Q F;  3CC2 Q;  3GLX A;  3WQZ A;  5F5W A;  1WDX A;  1W70 A;  1R77 A;  1YJN A;  1PCX A;  3TVT A;  1N5Z A;  2G3R A;  4L59 A;  3RKY A;  3LH0 A;  2CGH A;  5LJ3 g;  4O5V A;  3EG9 B;  2C06 A;  3JCM c;  2JZ2 A;  4RG2 A;  4M75 E;  3VU3 C;  1YJ9 A;  2KRO A;  1KHI A;  4GY5 A;  1B34 B;  2PVD B;  4BI3 A;  4UP9 A;  1WA7 A;  1ZUK A;  3JB9 G;  3ASK A;  4F17 A;  4P3O A;  2XGT A;  5J26 A;  1QF6 A;  4E6R A;  2C0T A;  2Y4Y A;  1HK9 A;  3D7S B;  1VIE A;  2E70 A;  1WHL A;  1X69 A;  4KUI A;  2LVM A;  1ZBJ A;  2CJB A;  1JJ2 A;  2LNH B;  3PT9 A;  1KQS S;  1X2G A;  3GBQ A;  4ESR A;  2J6F A;  2L8D A;  4BI8 B;  1IRX A;  4E7K A;  2HDA A;  5KNN A;  3VS1 A;  4DOW A;  3X20 B;  2DL8 A;  4IUT A;  2CZ7 B;  3EG9 A;  2D0Q B;  4P73 C;  5CCA A;  2HNI A;  2E4H A;  2ZPE B;  3OYF A;  3RAC A;  1BBU A;  5HGQ A;  3LGF A;  4CH4 A;  1FX7 A;  1M2O A;  1MMG A;  3RUX A;  3L2Q A;  4M78 G;  2Q5H A;  2XU8 A;  3FB9 A;  1BIB A;  3CD6 A;  5ELO A;  1E1O A;  1WHM A;  1H4S A;  1D1A A;  2RI2 A;  2QI2 A;  3PFS A;  1NLO C;  1D1C A;  4RMF A;  2QQS A;  5GMK i;  4D8D A;  1OZ3 A;  5D6W A;  1W1F A;  1VQO Q;  1RIQ A;  1ZX6 A;  2RHI A;  1WU7 A;  2ZNJ A;  3A7A A;  4PJO G;  4ELY C;  2ZZG A;  1NM7 A;  1QCO A;  1I5L A;  3ER0 A;  4M75 F;  3EHR A;  3VS4 A;  3CCJ T;  3HXX A;  4JLI A;  5GMK j;  1VQM A;  3A7R A;  1YIJ A;  4C8Q D;  1EIY A;  1YFR A;  2E41 A;  3L42 A;  3UA6 A;  2JTE A;  4UPA A;  3L2U A;  2I2L A;  2EQK A;  4ORZ A;  2LX7 A;  4JRQ A;  4P73 A;  2JVV A;  2A36 A;  2QK0 A;  4PFP A;  3L2R A;  3HSB A;  5FWB A;  1YIJ T;  5FLX E;  1CSK A;  2KMT A;  2Y90 A;  1I07 A;  4YRJ A;  1VQ7 Q;  3N5B B;  2C0I A;  1D3B B;  2IIM A;  2KYB A;  4N4H A;  4RCC A;  2F69 A;  2RHU A;  1NLP C;  4KT0 E;  3KXT A;  1Q81 C;  4RTU A;  4ME7 A;  3G7Z A;  1EVK A;  3CC7 A;  4YRP A;  5A0D A;  4YRM A;  4JDS A;  2K5L A;  4KGZ B;  4FW1 A;  4JZ3 A;  4RDX A;  3JB9 J;  2PME A;  3BJU A;  5LJ5 g;  5IH2 A;  4TVY A;  1VQ9 Q;  3TCJ A;  3NEN A;  4PJM A;  4A4E A;  3SHW A;  3CC7 T;  2CUB A;  2LDM A;  2E6N A;  2P84 A;  3HFZ B;  4EIK A;  1HC7 A;  4M78 E;  2QA4 A;  2MCN A;  3QG1 A;  2G6F X;  4YRQ A;  2EBP A;  2ZAE A;  2JTF A;  3F70 A;  3QDR B;  2HSE B;  4UP7 A;  1WFW A;  3I55 Q;  1QCN A;  1D3B A;  4MZT A;  4FYY B;  2RJE A;  2FL7 A;  2QAS A;  2ZZF A;  5CQY A;  3I5S A;  5IAY A;  4LD9 K;  2KVQ G;  4RTV A;  1AWW A;  1IGU A;  1YIT Q;  4PJO E;  2P0L A;  4LDV A;  1Q82 R;  4GLK A;  2E3I A;  1NE8 A;  1SG5 A;  3M4Q A;  2ZPI B;  4KQE A;  2CP7 A;  2DET A;  1ZHI A;  5GAN e;  1ZSZ C;  3QO8 A;  3NFC A;  2KYM A;  1W66 A;  4BD3 A;  3JB9 F;  4YRL A;  2CSI A;  1EIF A;  3OYC A;  2EGA A;  4J15 A;  2LCC A;  4M77 G;  1LCK A;  2VVK A;  3OYY A;  2HBW A;  2FEI A;  4E7H A;  1X54 A;  3VQW A;  1UEB A;  2HMA A;  2OTL A;  4DBF A;  4FYV B;  3HFZ A;  2EQJ A;  4JPB W;  4J83 A;  2VKN A;  4FW2 A;  4BW9 A;  3OMG A;  2C8M A;  3V8L A;  1MNE A;  3LH5 A;  2OI3 A;  4HCZ A;  3EH1 A;  4HWS A;  1WLP B;  4LNP A;  1WGS A;  2FRY A;  1M4Z A;  2VGN A;  1NZ9 A;  2LQK A;  3QO3 A;  2P0P A;  2QQB A;  1KK7 A;  4HWR A;  1BI3 A;  1SHG A;  4C8Q C;  1AD5 A;  2GF7 A;  2LQN A;  2F2X A;  1NYR A;  1R0B G;  4M78 F;  4E7Z A;  2XDP A;  1VQL A;  3OYE A;  3OW2 P;  1ACM B;  3HHT B;  4LVL A;  5KE3 A;  4F04 B;  1UEC A;  8ATC B;  4PJO F;  4RTZ A;  5FU6 C;  2B8A A;  2QHU A;  1S72 Q;  3G4S A;  1Y0M A;  1VQL T;  3CCV A;  5C51 B;  1QLY A;  2DNU A;  5FU6 B;  1BK2 A;  2JW4 A;  1VQK A;  2PQW A;  4FYW B;  1VOM A;  4J6X A;  3CCV T;  2YT6 A;  4QQG A;  4ZTZ B;  2I0N A;  1K73 R;  5I2S A;  4LVK A;  2XG8 D;  4M7A G;  5ELN A;  1QW1 A;  4M77 E;  1JJ2 S;  2X4J A;  3JB9 D;  1UGQ B;  2JM9 A;  1PRM C;  4BE0 A;  1VQ5 Q;  3R6O A;  2X3W D;  1UFF A;  1MMA A;  2YDL A;  2JMC A;  2DL5 A;  3OYL A;  3MHX A;  4LUE A;  4LDX A;  1N8R R;  5GAO n;  3WVE B;  2LMJ A;  4XU0 A;  1G5H A;  3LWI A;  1KMN A;  3LX7 A;  4LD6 A;  2K9G A;  5GMK e;  1UJ0 A;  1C0A A;  1OEB A;  3JCM g;  2DEU A;  2GCX A;  3CCL Q;  1O9S A;  4DOV A;  4M75 C;  3PIO A;  3BDL A;  3ZL7 C;  3CC2 A;  4DEY A;  2Q7G A;  4A54 A;  2DBM A;  1YJW Q;  3HXU A;  3CCJ Q;  4AG2 C;  2LP5 A;  1NNH A;  3AT1 B;  4XTV A;  1BBZ A;  3EG1 A;  3RBB B;  4Y28 E;  1NJI U;  1K76 A;  4IUP A;  2KEA A;  2X3X D;  1AHJ B;  5CAI A;  3VUB A;  3CCU T;  4M78 D;  1U8R A;  2BKD N;  2P0K A;  2GFA A;  1M27 C;  3RDV A;  3M59 A;  3MQZ A;  3MJX A;  1B8A A;  2QHS A;  1Z9Q A;  1U06 A;  5HK0 A;  1TUC A;  2ZR2 A;  3RL6 A;  3JCM b;  2JS0 A;  3PTA A;  4PJO D;  1UHF A;  5CR2 A;  4Q5W A;  1FXX A;  1GCQ C;  5L23 A;  1SHF A;  5HY6 A;  4M77 F;  2LNV A;  2DQ3 A;  1YFN A;  1ZLM A;  4JRK A;  1WQ7 A;  3OYM A;  2O31 A;  2QHV A;  1YNZ A;  4HWO A;  1PRL C;  1ZUU A;  2G4C A;  3MEV A;  2D1X A;  1LNX A;  1GFC A;  4M7A E;  1ASY A;  5GAN 3;  1TG0 A;  1C1A A;  1N9R A;  3M4G A;  1OYX A;  3ME9 A;  4K87 A;  3HFO A;  4WJ4 A;  1AOJ A;  3LGL A;  1WPY A;  3E9F A;  1SSF A;  3UF4 A;  2HL5 C;  2KRS A;  1G3S A;  2XDD A;  1P92 A;  3SWN C;  1EZZ B;  2KT1 A;  1AZG B;  2MMP A;  3ZBD A;  2CH4 A;  1UDL A;  3TU4 K;  4ZGD B;  4QVD A;  3A8G B;  3G1Z A;  4PHC A;  3IKM B;  1QCF A;  2ED1 A;  3MEA A;  3LSS A;  1VQO A;  2DYB A;  4EDU A;  1PD1 A;  4QW2 A;  2DRK A;  4YPF A;  2DTI A;  2VUB A;  4JUV A;  1GCQ A;  3EGD B;  1VQP T;  2J6K A;  4C92 G;  4RTX A;  1VQZ A;  1UGR B;  4QT7 A;  1TXQ A;  4BUG A;  2VGM A;  4CC7 A;  4XTW A;  2FPE A;  2E64 A;  3BY7 A;  1N27 A;  1V1C A;  1X6O A;  1C6V X;  4HCC A;  2JS2 A;  5DLQ E;  1PM3 A;  3X25 B;  1USY C;  4F7U G;  5GMK h;  2RO0 A;  4NL3 A;  1VQ7 A;  2R57 A;  3H0H A;  2ZZE A;  5CKF A;  4XEM A;  3CCE A;  5LJ3 e;  3SWN A;  2DA9 A;  1W2B P;  1VQ4 Q;  4P71 C;  3QZ5 B;  1K9M R;  2RNA A;  4M7D G;  2P0Q A;  2H8H A;  4YCV A;  4M7A F;  1XOV A;  2B86 A;  4EMK B;  3G71 T;  4GLM A;  4RG8 A;  2F5K A;  3DB3 A;  1B70 B;  1WXT A;  4M77 D;  2RH2 A;  2F5T X;  1S1N A;  2A08 A;  4M78 C;  4IKF A;  1JB0 E;  1VQ9 A;  3OYN A;  3TQ7 P;  4CS4 A;  2A0F B;  1M1K C;  4OB1 B;  1WHG A;  3CCR T;  3UFG A;  1BI0 A;  2E5K A;  2J06 A;  1KC8 C;  1JXO A;  2DL4 A;  2ROT A;  4J9H A;  2P4R A;  1R0C B;  2M51 A;  4CI0 C;  2JN0 A;  3IKL A;  2NWM A;  1E6G A;  2DJQ A;  4UC4 A;  3MEY A;  2I4L A;  1AEY A;  4D6W A;  4PJO C;  2EYW A;  2AMC A;  4H02 A;  1WLE A;  4XTY A;  2KBT A;  3HRS A;  2E5Q A;  2CZ0 B;  2YRD A;  4B6M A;  2PVO B;  2QQ9 A;  3CCQ A;  1B3Q A;  1WJS A;  3MP6 A;  1W2B A;  2K2V A;  3J81 E;  3JCM W;  2QTV A;  3QJY A;  1PWT A;  3X26 B;  1YIT A;  2DBK A;  1Q81 U;  1IHV A;  2HKQ B;  2ABL A;  1ARK A;  2J05 A;  2JJ9 A;  3I55 T;  5FU7 B;  1Q86 C;  4EMK A;  2OAU A;  2D8H A;  3OMC A;  4J7F A;  3OS1 A;  1B70 A;  5L8R E;  4FIB A;  2E1H A;  2A3L A;  1M90 C;  5CKH A;  3MP8 A;  1QKW A;  4ZGJ B;  3ZEH A;  2FPF A;  4M78 A;  2O9V A;  3KFV A;  1XNI A;  2EWN A;  4J9B A;  2E5A A;  4Q6G A;  2DU7 A;  2GNC A;  1QVG P;  1X43 A;  4OMQ A;  5HK3 A;  3VQY A;  2K2M A;  3QWY A;  2YSQ A;  4J5Y A;  2EGC A;  3OW2 S;  5GAN j;  2PNI A;  4HXJ A;  4M7D E;  3VQV A;  9ATC B;  4LXC A;  3FJ5 A;  2QQA A;  4Z89 A;  2DEQ A;  4E7S A;  3QUI A;  4N4I A;  2DVJ A;  3CCS Q;  4CC2 A;  4M7A D;  3JCM J;  2DXC A;  1LOJ A;  3EFS A;  3JCM V;  3JB9 I;  3GIB A;  5GAO r;  2FO0 A;  1WHK A;  5C6S A;  4CC3 A;  1NYF A;  2O4X B;  3JCM Q;  3CCU Q;  2FZC B;  5ECA A;  2V26 A;  5GAN 7;  3CXC P;  4TQF A;  3EG2 A;  2BZX A;  1X6B A;  2EVR A;  1RLQ C;  3M5A A;  1QVG A;  5KYN A;  4BE1 A;  1AVZ C;  3HTR A;  1H8K A;  5FRM A;  1QE0 A;  3LYI A;  5LJ5 e;  5AYF A;  2ZPB B;  1Q7Y R;  2FZG B;  3CMA T;  1TSF A;  5KYU B;  2RK2 A;  4HVU A;  4PL6 A;  4RTW A;  4E47 A;  1N8R C;  4AH6 A;  2RQU A;  4M77 C;  3IQL A;  3CMQ A;  1T3S A;  1S72 T;  2PU9 B;  1E24 A;  4H2V A;  3I9Q A;  3A1P A;  8AT1 B;  4CS2 A;  2W10 A;  3GNG A;  1EFW A;  4YRR A;  3NHN A;  2F1L A;  4K11 A;  1PG5 B;  2R5A A;  1Y71 A;  5GMK l;  3HFN A;  4ZGE B;  4F7U F;  4HA8 A;  1IB8 A;  1ADY A;  2OTJ Q;  3P8H A;  7AT1 B;  3M55 A;  4OMP A;  1X2K A;  3OS5 A;  5GJW B;  2LCL A;  5GAM g;  3VV0 A;  2E10 A;  2O4X A;  4WCI A;  3CXC A;  3A7U A;  2RHZ A;  2W0Z A;  2DD5 A;  4M7D F;  3OB9 A;  4BWA A;  3SFM A;  1EIY B;  1IXD A;  1EQR A;  5CKE A;  1W6X A;  1AWJ A;  1M1F A;  1H4V B;  2KE9 A;  2LJ3 A;  1VQ5 T;  3LLR A;  4YRO A;  1VQN Q;  2VB6 A;  2HSP A;  2QG9 B;  4FT4 A;  2XK0 A;  4ATO A;  2ZTG A;  3GP8 A;  1BB9 A;  1BI2 A;  2FHD A;  4HCK A;  3PVL A;  3REA B;  3DB4 A;  5KYU A;  1EFN A;  2LX9 A;  3MKD A;  1YBY A;  2WSE E;  2L3R A;  2RM4 A;  1G51 A;  3CCJ A;  1M3C A;  4YCU A;  4P3P A;  3EHQ A;  2DKG A;  3HL8 A;  1OPL A;  1VQP Q;  3CCL T;  1NBE B;  1YI2 T;  3JAM E;  1OI1 A;  2KSS A;  4C5G A;  3RER A;  1YFT A;  1UG1 A;  1YJW T;  5LJ5 d;  1RAG B;  1I1J A;  4N0A C;  3HTZ A;  3VRZ A;  1Q95 G;  1LPL A;  2NYS A;  3E9H A;  2J6O A;  1YHQ Q;  2P4T A;  3S3O A;  4CH3 A;  3M0S A;  4K88 A;  1NJ1 A;  3C0C A;  4TVW A;  3RF1 A;  5FW9 A;  2ZT6 A;  4FCY A;  3HFV A;  2ZT7 A;  3LC0 A;  4IIO A;  2XIC A;  4M7A C;  4XK8 E;  4C5E A;  4G84 A;  2YUN A;  3G71 Q;  4C0Z A;  2V8J A;  3I56 T;  2ZIN A;  4BDY A;  3E1S A;  3MP1 A;  4R55 A;  2SEM A;  3CCR Q;  3HRU A;  1C0M A;  4FT2 A;  2CS7 A;  5LJ5 h;  2XI9 A;  4DBH A;  2DU5 A;  1QWF A;  1IHW A;  4N0A A;  2DQ0 A;  3EFO A;  1VUB A;  4M7D D;  1M9S A;  3M9Q A;  4J9G A;  1ATI A;  2FG0 A;  1QVF P;  2D6F A;  2HD0 A;  4IUU A;  3TSW A;  2ZNI A;  3P8T A;  3VS3 A;  3VS2 A;  4XU2 A;  3M53 A;  2JOY A;  4H2W A;  1VYV A;  4FSX A;  4C5I A;  1MMD A;  1SSH A;  1SRM A;  3HKS A;  1NJ8 A;  3A8L B;  3TEH A;  3L2Z A;  1TUD A;  1VYT A;  4M7A A;  3REU A;  1K9M C;  3M4Y A;  3VRY A;  1W2B S;  4CH6 A;  1E6H A;  5LL6 S;  1WI7 A;  2EW3 A;  4NOY A;  4YDQ A;  1JEG A;  3JCM e;  5C52 B;  1M1G A;  4OMN A;  4AT1 B;  1RI9 A;  4M75 D;  1M3A A;  5I21 A;  1G5V A;  2YLC A;  1RLP C;  4ELZ C;  4YRC A;  1YCY A;  1ZSZ B;  4DEX A;  1G3Y A;  1QVF A;  3MPU B;  3NMZ C;  2DTH A;  1H3Z A;  1G8X A;  1N9W A;  4EX5 A;  1U1S A;  2C7I A;  1V29 B;  2CKK A;  2CJA A;  3UH0 A;  5IHN A;  2GGR A;  2OJ2 A;  1VQ4 T;  4J9F A;  2VC8 A;  2LZ6 B;  4A4H A;  3VS0 A;  1WQW A;  4F14 A;  1PKT A;  3OYG A;  2BE9 B;  3MEU A;  3UAT A;  3RGL A;  4KRT A;  4DQ2 A;  2K3B A;  2X4W A;  5LJ3 j;  3MO8 A;  4A63 B;  3CC4 T;  4H2U A;  1GBQ A;  2DER A;  4C8Q B;  1JRI A;  6AT1 B;  4Y92 A;  2ZT8 A;  4E2F B;  2O2O A;  3P8Y A;  4ZTU B;  1MND A;  2NUT B;  1ZSZ A;  3HP9 A;  4JS5 A;  1QMC A;  4E51 A;  4AMC A;  2DDZ A;  3EAE A;  1GXI E;  3CMA Q;  1OX8 A;  5GAO p;  1QVG S;  3QBY A;  3QJ6 A;  2E6Z A;  1Y7X A;  4C0G A;  1MGQ A;  2I4N A;  1BKB A;  3HRK A;  3PMT A;  2P5I A;  3M4P A;  1NJI R;  3RR6 A;  2K5I A;  5GAN d;  1YB3 A;  4J8O A;  1PYS B;  4K86 A;  4C5H A;  3L4G B;  2KXC A;  4P75 C;  3MF2 A;  1M1K U;  5GAO m;  2HBP A;  4OVA A;  1KC8 U;  4ZN3 A;  2LT4 A;  3PIP A;  4M7D C;  1Z7M A;  2MK5 A;  2QDY B;  1HTT A;  4C8Q A;  2O88 A;  3TEE A;  3URG A;  5I11 A;  2D0N A;  1WZO A;  3CCM T;  1YJ9 Q;  3KFU A;  3A8O B;  2GFU A;  2NUT A;  4HWT A;  2EIF A;  3A32 A;  5IHI A;  3EH2 A;  4R56 A;  1RAA B;  1PNJ A;  3H8Z A;  2A7Y A;  2MF2 A;  1VQ8 T;  4GBQ A;  5GAN 4;  3CME T;  3IAL A;  2KT8 A;  2EJF A;  1UGP B;  4H2X B;  1RAH B;  4PJN A;  4KR2 A;  3VYG A;  1Q7Y C;  2LJ1 A;  1Q86 U;  4H2S A;  1UGV A;  3I5R A;  2QHT A;  4Z88 A;  5LJ5 f;  1M2V A;  5GAN h;  1M90 U;  1HYO A;  1PYS A;  3NEL A;  2DJZ A;  1YI2 Q;  1FMK A;  3L4G A;  3CCU A;  3VS5 A;  1T0H A;  3CCS T;  3GNF B;  3GOX A;  4EMH A;  4M75 B;  2XID A;  2E3H A;  3QXE B;  4KR3 A;  1IRE B;  2LQ8 A;  1B7T A;  4YRN A;  1K8A R;  3BE3 A;  1Z9Z A;  1SES A;  3E9I A;  1BCM A;  3J80 E;  5FWC A;  4LDU A;  2A37 A;  2GTJ A;  3EG0 A;  1VQ6 Q;  4MML A;  3VBB A;  2RHX A;  3OY9 A;  2F2W A;  3QYG B;  1KQ2 A;  2KNB B;  2EYX A;  5D6X A;  4QVC A;  3DLL A;  1HSQ A;  3CD6 Q;  4A4G A;  3BFM A;  2RHS A;  1FWZ A;  2MOX A;  1RUW A;  3NGP A;  3H0I A;  4J7I A;  1RI0 A;  4H2X A;  4O2D A;  5CQX A;  2HQX A;  1FMV A;  3FDR A;  1T0J A;  3A5Y A;  1OQK A;  4ZIB A;  2MAM A;  4PG3 A;  3EFR A;  4WJ3 M;  3QDF A;  3I56 Q;  2BIV A;  3I35 A;  1NPP A;  3V8J A;  4BDZ A;  1B07 A;  1RAB B;  1G3W A;  1XQH A;  4OB2 B;  3OYK A;  5LJ5 j;  2CDT A;  1WIE A;  1WYX A;  1VQM Q;  1M8V A;  2K57 A;  1ZQ1 A;  1LVK A;  4M75 A;  4CC4 B;  1U3O A;  3A8H B;  1FMW A;  2AKK A;  3M0U A;  2PZ1 A;  2OTJ T;  1JO8 A;  2COW A;  4BI4 A;  3EGX A;  2IY5 B;  3VUZ A;  2E65 A;  2ZZD A;  1VQN A;  4HWP A;  2JTM A;  4FU6 A;  2A8E A;  4PLI A;  3QHS A;  3MCA B;  1H92 A;  1N8R U;  4MMK A;  5KH6 A;  4TWA A;  2KRM A;  2CRE A;  5HKC A;  1VQN T;  1HD3 A;  3SWN B;  1NYQ A;  1VQP A;  4WI1 A;  5D6Y A;  1UB4 A;  4KGV B;  3MEW A;  4J6Y A;  4HT8 A;  1SRY A;  4KH0 B;  2L89 A;  1LJO A;  3QII A;  2EYZ A;  3C94 A;  1XJW B;  2RA2 A;  3UDC A;  1AWX A;  4NL2 A;  3SD4 A;  1BCO A;  2DAQ A;  2RB6 A;  4LE9 A;  5A2Q E;  1OX9 A;  2KQW A;  4XQ3 A;  1AT1 B;  1GL5 A;  2DXB A;  3VQX A;  1YHQ A;  1M3B A;  1Y57 A;  2DM1 A;  4P3N A;  2IY5 A;  4OMM A;  4PFO A;  2M9U A;  3E9G A; 
#chains in the Genus database with same CATH homology
 1X2H A;  2AMC B;  2Q7E A;  4YRT A;  1YHQ T;  1UGS B;  3G71 A;  2ZXF A;  3X24 B;  1QVF S;  3QSU A;  3QTC A;  2LC4 A;  3CCR A;  3JRZ A;  1JJC B;  1R8O B;  1GGM A;  2QQR A;  1BIA A;  5GAN 2;  4OB3 B;  1WJQ A;  3BDU A;  4MZP A;  4M78 B;  1Q82 C;  2V8I A;  5IN1 A;  5C53 B;  1MHN A;  4RQF A;  3NTI A;  2EYQ A;  4RCB A;  1KMM A;  4YRE A;  2RD1 A;  4J6W A;  5GAM e;  5GAN f;  3C12 A;  3I55 A;  4CS3 A;  4PJO B;  1USY A;  2K3X A;  3SDZ A;  4Y91 A;  5DM7 R;  3P8D A;  4C0F A;  2PUK B;  4P71 A;  2IG0 A;  1JJC A;  5M9O A;  4OF1 A;  4C92 E;  2IVW A;  1NJ5 A;  3OSS C;  2XDB A;  3HRT A;  4A4F A;  3C95 A;  1TH7 A;  4YTL A;  2ALY B;  3OBY A;  5LJ3 d;  2RHQ A;  1BYM A;  3HY0 A;  4DPG A;  2WSC E;  4F7U E;  3ERR A;  2Q5I A;  4BE2 A;  2Q7H A;  5KE2 A;  1WYD A;  4PJO A;  1Y07 A;  1K9M U;  4LVI A;  3Q1J A;  3QZ9 B;  1YFS A;  3UPU A;  3UWN A;  3CPF A;  1NJI C;  3SB2 A;  2QEX T;  4H2T A;  2O01 E;  4BY6 C;  2MI6 A;  3JCM X;  2R5M A;  4BY6 B;  1PSE A;  1WNL A;  5GAM d;  2ARS A;  3DLM A;  1KQ1 A;  5FRN A;  2ALY A;  3CMA A;  1K73 C;  1NJ6 A;  5LJ3 h;  1N9S A;  1S72 A;  4HT4 A;  1IL2 A;  4EO4 A;  3R07 A;  2K3Y A;  4C92 F;  4YRK A;  3I7F A;  2DXT A;  3PNW C;  2NS6 A;  4M77 B;  1JBM A;  5GAO q;  3TUP A;  1EVL A;  1G5I A;  1X56 A;  3NEM A;  1EOV A;  4HT9 A;  2KY9 A;  1YJN T;  1I8F A;  2X4X A;  2J3M A;  5GAM h;  1B7Y A;  1VQ5 A;  3PCO B;  2ART A;  3C4S A;  4EPC A;  1Y96 B;  3QO5 A;  1YJ9 T;  1K8A C;  4JS4 A;  3OA6 A;  4EMG A;  2PUO B;  5GAN 8;  2RJC A;  3JSC A;  5J3B A;  1J5W A;  3FLG A;  3CCL A;  4PLL A;  1QVP A;  3PMI A;  4RMO A;  1YI2 A;  1OZ2 A;  3TRE A;  1U1T A;  2I4O A;  1ADJ A;  4DA4 A;  3RKX A;  1YJW A;  4M77 A;  2ZPG B;  4YCW A;  2AKW B;  2CJ9 A;  5FRO A;  1B34 A;  3J7A F;  4CH5 A;  5KCO A;  1VQ6 A;  2DPP B;  5K1P A;  4OP0 A;  2ZIO A;  3PCO A;  4P74 C;  1Y96 A;  2KDS A;  2RI3 A;  3H6Z A;  3V7S A;  2RI5 A;  2FB7 A;  1VQ6 T;  11AS A;  4QQD A;  3A31 A;  3PGG A;  1Q7Y U;  3IG2 A;  3REX A;  3I56 A;  3CD6 T;  3RIR A;  4RQE A;  4OGE A;  3TEH B;  2FYK A;  4P72 C;  4C92 D;  2J3L A;  3OYH A;  3DSQ A;  4M7A B;  4ZN1 A;  3A8M B;  4PKC C;  4TTV A;  4TQD A;  4P5N A;  1E1T A;  2AKW A;  2H3J A;  1ZBX A;  2PVG B;  1VQM T;  5GAO l;  3S3N A;  4YRF A;  3CBM A;  3NTK A;  1KHC A;  1BBW A;  4WF2 A;  1LYL A;  2EQM A;  3VKI A;  3UGQ A;  3LWH A;  2VXF A;  3HY1 A;  3OYD A;  4P74 A;  5CVI A;  3OS0 A;  4L6V 5;  1X55 A;  2MWO A;  3LW5 E;  2HAX A;  2DZC A;  4QQ6 A;  3M58 A;  4YP0 A;  4IUQ A;  2K4Y A;  2WAC A;  4P72 A;  2KK4 A;  5LJ3 f;  2ZCE A;  2D9T A;  2EKO A;  2LTO A;  2DK3 A;  2DD4 A;  1O75 A;  4YRG A;  3RMQ A;  2EJ9 A;  2M0O A;  2MWP A;  1W4S A;  2QXF A;  1KD1 C;  2RK1 A;  2DVE A;  3CBP A;  5GMK m;  2CZ1 B;  4NCX A;  1VQ4 A;  2QA4 T;  4E7L A;  4MZM A;  3FC3 A;  3QO7 A;  2JUF A;  4XU3 A;  2ZIM A;  1ASZ A;  4OMF B;  3QKJ A;  5CK9 A;  3CC4 A;  3OQ5 A;  4X34 A;  5GAM f;  5DY9 A;  4OLF A;  2DIQ A;  2JNG A;  4II1 A;  1NJ2 A;  3GF5 A;  3RMS A;  4XTU A;  3AHU A;  3S6W A;  3OYI A;  2EFI A;  2OTL T;  4JLG A;  2CYZ B;  3NTH A;  1BI1 A;  3CBO A;  2M1H A;  5K1X A;  2EAY A;  4C92 C;  1X01 A;  5DLO A;  4C92 B;  2RHY A;  5CKB A;  3M56 A;  3JCM d;  3OS2 A;  2EL9 A;  4E7I A;  3GPL A;  2VV5 A;  5GAM j;  2GQV A;  3CCM A;  4Z02 A;  3JCM P;  4F7U B;  4LNS A;  1Q82 U;  2HQE A;  1VQ8 A;  1I4K 1;  1NPR A;  4TVR A;  4XU1 A;  3CME A;  4M7D B;  3V7C A;  1B76 A;  2RJD A;  4V2S A;  3M54 A;  4FL6 A;  3CXC S;  3VYH B;  3G6E A;  3G4S T;  2RHS B;  2LT1 A;  4BB7 A;  4XAX B;  4C92 A;  3M57 A;  3CCS A;  1KG1 A;  4H2Y A;  5C0M A;  1VQK T;  3JCM h;  3G6E T;  3OW2 A;  3FIF A;  5E3I A;  3CPW A;  1H4T A;  2PMF A;  1G3T A;  4F7U A;  3A74 A;  2DXU A;  3UT1 A;  4PNO A;  2K5F A;  4P75 A;  5I2M A;  2DZ9 A;  3FEO A;  3TEG A;  2XTI A;  1N6A A;  4M7D A;  3X28 B;  3RKW A;  2FVU A;  2CZ6 B;  4MDW A;  5GAN g;  2ODR D;  2QTX A;  3T9N A;  2BUD A;  3P8B B;  3FJP A;  2ZGW A;  3HXZ A;  2E3C A;  1FYF A;  4KUD K;  2RJF A;  3CC2 T;  2I4M A;  2OTJ A;  4KUL A;  5IT9 E;  2AHJ B;  4B9W A;  1SET A;  1QP3 A;  1QP2 A;  3RES A;  1H64 1;  1H4Q A;  2DTO A;  1K73 U;  4VUB A;  5KCH A;  3HXY A;  2DO3 A;  1VIF A;  3QYH B;  1KQS A;  2YRV A;  4HCB A;  2M16 A;  3A5Z B;  3L2W A;  5GAN 5;  3NET A;  3O8V A;  5GAN 6;  2E12 A;  4LVJ A;  2X4Y A;  3BW1 A;  5EG2 A;  4XEO A;  1SER A;  4X9D A;  3LSQ A;  4JRI A;  2DIG A;  1L0W A;  4HKE A;  3HPW A;  2ZR3 A;  2CIM A;  4C8Q G;  4LDY A;  1K8A U;  2L5Q A;  3ICA A;  1PSF A;  4OB0 B;  5J39 A;  3CEY A;  1DJ7 B;  3DKM A;  3ZFJ A;  4FM4 B;  1I81 A;  3A5Z A;  3JB9 H;  2XD0 A;  4X5O A;  4NS5 A;  4JJN K;  4LDW A;  1M5Q 1;  3P8V A;  1VQO T;  1Z7N A;  3KBG A;  3QPH A;  4O6J A;  2ZPF B;  4A53 A;  2ZT5 A;  1KOG A;  4YYE A;  2ODR C;  4YRI A;  4RKU E;  4EMK C;  2YHT A;  1RL2 A;  2RHQ B;  2XKO C;  3FRN A;  1VQ7 T;  4B9X A;  3INZ A;  3JCM f;  4E7J A;  2LRQ A;  3CCE T;  3PZC A;  3OSV A;  1XTD A;  3OYA A;  2NLU A;  3S3M A;  4IUR A;  4YRS A;  2ZCF B;  2EQU A;  5CIU A;  4L87 A;  3L1A A;  4QVZ A;  3KUF A;  3VJP A;  3UGT A;  3WVD B;  4TVA B;  1VQ9 T;  4ZTJ A;  3OD1 A;  3WXM B;  3V7R A;  3HXW A;  1HXD A;  4M75 G;  4HVC A;  4C8Q E;  3MF1 A;  1IZ6 A;  5FU7 C;  2VYT A;  4IUV A;  4XTX A;  3CCQ T;  4OGC A;  4KBM B;  3W3S A;  4C0D C;  4JRP A;  2R58 A;  5A0L A;  2QEX A;  1YIT T;  4MDX A;  5CO7 A;  2YLB A;  4C0D B;  1E22 A;  4UP8 A;  2XHC A;  2Y4X A;  3L2V A;  4X9C A;  2EJG A;  2ARU A;  3MET A;  1X75 C;  4CRI A;  4TVA A;  3OYB A;  4A4K A;  4BAC A;  1WJR A;  2VXE A;  3HXV A;  4ZTF A;  2ZPH B;  1YGB A;  4XTZ A;  4G85 A;  1KD1 U;  3QNE A;  1B7Y B;  3CPW S;  3V8K A;  4N4G A;  4L5G A;  4LVM A;  3E19 A;  2WSF E;  3OBW A;  5CKD A;  2V8K A;  12AS A;  3HRI A;  4Q15 A;  2KAF A;  3OYJ A;  5A0G A;  2X35 A;  4C8Q F;  3GLX A;  3WQZ A;  5F5W A;  1YJN A;  2G3R A;  4L59 A;  3RKY A;  3LH0 A;  2CGH A;  5LJ3 g;  4O5V A;  2C06 A;  3JCM c;  2JZ2 A;  4RG2 A;  4M75 E;  3VU3 C;  1YJ9 A;  1KHI A;  4GY5 A;  1B34 B;  2PVD B;  4BI3 A;  4UP9 A;  3JB9 G;  3ASK A;  4P3O A;  2XGT A;  3E9G A;  5J26 A;  1QF6 A;  2Y4Y A;  1HK9 A;  1VIE A;  2E70 A;  4KUI A;  2LVM A;  2CJB A;  1JJ2 A;  3PT9 A;  1KQS S;  1X2G A;  4BI8 B;  2L8D A;  4E7K A;  5KNN A;  4DOW A;  3X20 B;  4IUT A;  2CZ7 B;  2D0Q B;  4P73 C;  5CCA A;  2HNI A;  2ZPE B;  3OYF A;  3RAC A;  1BBU A;  5HGQ A;  3LGF A;  4CH4 A;  1FX7 A;  3RUX A;  3L2Q A;  4M78 G;  2Q5H A;  2XU8 A;  3FB9 A;  1BIB A;  3CD6 A;  5ELO A;  1E1O A;  1H4S A;  2RI2 A;  2QI2 A;  3PFS A;  4RMF A;  2QQS A;  5GMK i;  1OZ3 A;  5D6W A;  1RIQ A;  2RHI A;  1WU7 A;  2ZNJ A;  3A7A A;  4PJO G;  4ELY C;  2ZZG A;  1I5L A;  3ER0 A;  4M75 F;  3CCJ T;  3HXX A;  4JLI A;  5GMK j;  1VQM A;  3A7R A;  1YIJ A;  4C8Q D;  1EIY A;  1YFR A;  2E41 A;  3L42 A;  4UPA A;  3L2U A;  2I2L A;  2EQK A;  4JRQ A;  4P73 A;  2JVV A;  3L2R A;  3HSB A;  1YIJ T;  5FLX E;  2KMT A;  2Y90 A;  4YRJ A;  3N5B B;  1D3B B;  4N4H A;  4RCC A;  2F69 A;  2RHU A;  4KT0 E;  3KXT A;  1Q81 C;  4ME7 A;  3G7Z A;  1EVK A;  3CC7 A;  4YRP A;  5A0D A;  4YRM A;  4JDS A;  2K5L A;  4RDX A;  3JB9 J;  2PME A;  3BJU A;  5LJ5 g;  4TVY A;  3TCJ A;  3NEN A;  4A4E A;  3CC7 T;  2LDM A;  2E6N A;  3HFZ B;  1HC7 A;  4M78 E;  2QA4 A;  3QG1 A;  4YRQ A;  2JTF A;  3F70 A;  3QDR B;  4UP7 A;  1D3B A;  4MZT A;  2RJE A;  2FL7 A;  2ZZF A;  5CQY A;  5IAY A;  4LD9 K;  2KVQ G;  4PJO E;  2P0L A;  4LDV A;  4GLK A;  1NE8 A;  3M4Q A;  2ZPI B;  4KQE A;  1ZHI A;  5GAN e;  3QO8 A;  3NFC A;  1W66 A;  4BD3 A;  3JB9 F;  4YRL A;  1EIF A;  3OYC A;  4J15 A;  2LCC A;  4M77 G;  3OYY A;  4E7H A;  1X54 A;  3VQW A;  1UEB A;  2OTL A;  3HFZ A;  2EQJ A;  4J83 A;  4BW9 A;  3OMG A;  2C8M A;  3V8L A;  4HCZ A;  4HWS A;  1WGS A;  1M4Z A;  2VGN A;  1NZ9 A;  2LQK A;  3QO3 A;  2P0P A;  2QQB A;  4HWR A;  1BI3 A;  4C8Q C;  2GF7 A;  1NYR A;  4M78 F;  2XDP A;  1VQL A;  3OYE A;  3HHT B;  4LVL A;  5KE3 A;  4PJO F;  5FU6 C;  2B8A A;  2QHU A;  3G4S A;  1VQL T;  3CCV A;  5C51 B;  5FU6 B;  1VQK A;  2PQW A;  4J6X A;  3CCV T;  4QQG A;  4ZTZ B;  5I2S A;  4LVK A;  2XG8 D;  4M7A G;  5ELN A;  1QW1 A;  4M77 E;  1JJ2 S;  2X4J A;  3JB9 D;  1UGQ B;  4BE0 A;  3R6O A;  3OYL A;  3MHX A;  4LDX A;  5GAO n;  3WVE B;  4XU0 A;  1G5H A;  3LWI A;  1KMN A;  3LX7 A;  4LD6 A;  5GMK e;  1C0A A;  3JCM g;  2GCX A;  1O9S A;  4DOV A;  4M75 C;  3PIO A;  3BDL A;  3CC2 A;  2Q7G A;  4A54 A;  3HXU A;  1NNH A;  4XTV A;  4Y28 E;  1NJI U;  4IUP A;  1AHJ B;  5CAI A;  3VUB A;  3CCU T;  4M78 D;  1U8R A;  2BKD N;  2P0K A;  2GFA A;  3M59 A;  3MQZ A;  1B8A A;  2QHS A;  5HK0 A;  2ZR2 A;  3RL6 A;  3JCM b;  4PJO D;  5CR2 A;  4Q5W A;  1FXX A;  5HY6 A;  4M77 F;  2LNV A;  2DQ3 A;  4JRK A;  1WQ7 A;  3OYM A;  2QHV A;  4HWO A;  2G4C A;  3MEV A;  1LNX A;  1ASY A;  4M7A E;  5GAN 3;  1N9R A;  3M4G A;  1OYX A;  3ME9 A;  4K87 A;  3HFO A;  4WJ4 A;  3LGL A;  1WPY A;  3E9F A;  1SSF A;  2XDD A;  1G3S A;  1P92 A;  3SWN C;  2MMP A;  3ZBD A;  3TU4 K;  4ZGD B;  4QVD A;  3A8G B;  3G1Z A;  4PHC A;  3IKM B;  3MEA A;  3LSS A;  1VQO A;  4EDU A;  4QW2 A;  4YPF A;  2DTI A;  2VUB A;  4JUV A;  1VQP T;  4C92 G;  1VQZ A;  1UGR B;  4BUG A;  2VGM A;  4XTW A;  2E64 A;  3BY7 A;  1N27 A;  1X6O A;  4HCC A;  5DLQ E;  3X25 B;  1USY C;  4F7U G;  5GMK h;  2RO0 A;  4NL3 A;  1VQ7 A;  2R57 A;  2ZZE A;  5CKF A;  4XEM A;  3CCE A;  5LJ3 e;  3SWN A;  4P71 C;  3QZ5 B;  4M7D G;  2P0Q A;  4YCV A;  4M7A F;  1XOV A;  4EMK B;  3G71 T;  4RG8 A;  2F5K A;  3DB3 A;  1B70 B;  4M77 D;  2RH2 A;  2F5T X;  4M78 C;  4IKF A;  1JB0 E;  1VQ9 A;  3OYN A;  4CS4 A;  1M1K C;  4OB1 B;  3CCR T;  3UFG A;  1BI0 A;  1KC8 C;  4CI0 C;  3IKL A;  2JN0 A;  4UC4 A;  3MEY A;  2I4L A;  4D6W A;  4PJO C;  4H02 A;  2AMC A;  1WLE A;  4XTY A;  3HRS A;  2E5Q A;  2CZ0 B;  3CCQ A;  2PVO B;  2QQ9 A;  1WJS A;  3MP6 A;  1W2B A;  2K2V A;  3J81 E;  3JCM W;  3QJY A;  3X26 B;  1YIT A;  1Q81 U;  3I55 T;  5FU7 B;  1Q86 C;  4EMK A;  2OAU A;  3OMC A;  4J7F A;  3OS1 A;  1B70 A;  5L8R E;  4FIB A;  2E1H A;  2A3L A;  1M90 C;  5CKH A;  3MP8 A;  4ZGJ B;  3ZEH A;  4M78 A;  1XNI A;  2EWN A;  2E5A A;  4Q6G A;  2DU7 A;  5HK3 A;  3VQY A;  4J5Y A;  3OW2 S;  5GAN j;  4M7D E;  3VQV A;  2QQA A;  2DEQ A;  3QUI A;  4N4I A;  4M7A D;  3JCM J;  2DXC A;  1LOJ A;  3EFS A;  3JCM V;  3JB9 I;  3GIB A;  5GAO r;  5C6S A;  2O4X B;  3JCM Q;  5GAN 7;  4TQF A;  1QVG A;  3M5A A;  4BE1 A;  5FRM A;  1QE0 A;  3LYI A;  5LJ5 e;  5AYF A;  2ZPB B;  3CMA T;  2RK2 A;  4PL6 A;  4E47 A;  1N8R C;  4AH6 A;  4M77 C;  3CMQ A;  1S72 T;  2PU9 B;  1E24 A;  4H2V A;  4CS2 A;  3GNG A;  1EFW A;  4YRR A;  2R5A A;  1Y71 A;  5GMK l;  3HFN A;  4ZGE B;  4F7U F;  4HA8 A;  1ADY A;  3P8H A;  3M55 A;  3OS5 A;  2LCL A;  5GAM g;  3VV0 A;  2E10 A;  2O4X A;  3CXC A;  3A7U A;  2RHZ A;  2DD5 A;  4M7D F;  3OB9 A;  4BWA A;  3SFM A;  1EIY B;  1EQR A;  5CKE A;  1M1F A;  1H4V B;  1VQ5 T;  3LLR A;  4YRO A;  4FT4 A;  2XK0 A;  4ATO A;  2ZTG A;  3GP8 A;  1BI2 A;  2FHD A;  3DB4 A;  2LX9 A;  1YBY A;  2WSE E;  2L3R A;  2RM4 A;  1G51 A;  3CCJ A;  4YCU A;  4P3P A;  3HL8 A;  2DKG A;  3CCL T;  1YI2 T;  3JAM E;  1OI1 A;  2KSS A;  4C5G A;  3RER A;  1YFT A;  1YJW T;  5LJ5 d;  4N0A C;  3HTZ A;  3E9H A;  2P4T A;  3S3O A;  4CH3 A;  4K88 A;  1NJ1 A;  4TVW A;  3RF1 A;  2ZT6 A;  3HFV A;  2ZT7 A;  3LC0 A;  2XIC A;  4M7A C;  4XK8 E;  4C5E A;  4G84 A;  4C0Z A;  2V8J A;  3I56 T;  2ZIN A;  4BDY A;  3E1S A;  3MP1 A;  4R55 A;  3HRU A;  4FT2 A;  2CS7 A;  5LJ5 h;  2XI9 A;  2DU5 A;  4N0A A;  2DQ0 A;  1VUB A;  4M7D D;  1M9S A;  3M9Q A;  1ATI A;  2D6F A;  2HD0 A;  4IUU A;  2ZNI A;  3P8T A;  4XU2 A;  3M53 A;  2JOY A;  4H2W A;  4FSX A;  4C5I A;  3HKS A;  1NJ8 A;  3A8L B;  3TEH A;  3L2Z A;  4M7A A;  3REU A;  1K9M C;  3M4Y A;  1W2B S;  4CH6 A;  5LL6 S;  4NOY A;  4YDQ A;  3JCM e;  5C52 B;  1M1G A;  4M75 D;  5I21 A;  1G5V A;  2YLC A;  4ELZ C;  4YRC A;  1YCY A;  1G3Y A;  1QVF A;  2DTH A;  1H3Z A;  1N9W A;  4EX5 A;  1U1S A;  2C7I A;  1V29 B;  2CKK A;  2CJA A;  3UH0 A;  1VQ4 T;  2VC8 A;  4A4H A;  1WQW A;  3OYG A;  3MEU A;  3RGL A;  4DQ2 A;  2X4W A;  5LJ3 j;  3MO8 A;  3CC4 T;  4H2U A;  4C8Q B;  1JRI A;  2ZT8 A;  3P8Y A;  4ZTU B;  3HP9 A;  4JS5 A;  4E51 A;  2DDZ A;  3EAE A;  1GXI E;  5GAO p;  1QVG S;  3QBY A;  3QJ6 A;  2E6Z A;  1Y7X A;  4C0G A;  1MGQ A;  2I4N A;  1BKB A;  3HRK A;  3PMT A;  2P5I A;  3M4P A;  2K5I A;  5GAN d;  1YB3 A;  4J8O A;  1PYS B;  4K86 A;  4C5H A;  3L4G B;  4P75 C;  3MF2 A;  1M1K U;  5GAO m;  2HBP A;  4OVA A;  1KC8 U;  4ZN3 A;  2LT4 A;  3PIP A;  4M7D C;  1Z7M A;  2QDY B;  1HTT A;  4C8Q A;  3TEE A;  3URG A;  3CCM T;  3KFU A;  3A8O B;  2GFU A;  4HWT A;  2EIF A;  3A32 A;  4R56 A;  3H8Z A;  2A7Y A;  2MF2 A;  1VQ8 T;  5GAN 4;  3CME T;  3IAL A;  2EJF A;  1UGP B;  4H2X B;  4KR2 A;  3VYG A;  1Q7Y C;  1Q86 U;  4H2S A;  2QHT A;  5LJ5 f;  5GAN h;  1M90 U;  1PYS A;  3NEL A;  2DJZ A;  3L4G A;  3CCU A;  3CCS T;  3GNF B;  3GOX A;  4EMH A;  4M75 B;  2XID A;  3QXE B;  4KR3 A;  1IRE B;  2LQ8 A;  4YRN A;  1SES A;  3E9I A;  3J80 E;  4LDU A;  4MML A;  3VBB A;  2RHX A;  3OY9 A;  3QYG B;  1KQ2 A;  5D6X A;  4QVC A;  3DLL A;  4A4G A;  3BFM A;  2RHS A;  1FWZ A;  4J7I A;  1RI0 A;  4H2X A;  4O2D A;  5CQX A;  2HQX A;  3FDR A;  3A5Y A;  4ZIB A;  2MAM A;  4PG3 A;  3EFR A;  4WJ3 M;  2BIV A;  1NPP A;  3V8J A;  4BDZ A;  1XQH A;  1G3W A;  4OB2 B;  3OYK A;  5LJ5 j;  1M8V A;  2K57 A;  1ZQ1 A;  4M75 A;  3A8H B;  2OTJ T;  4BI4 A;  2IY5 B;  3VUZ A;  2E65 A;  2ZZD A;  1VQN A;  4HWP A;  2JTM A;  4FU6 A;  2A8E A;  4PLI A;  3QHS A;  3MCA B;  1N8R U;  4MMK A;  5KH6 A;  4TWA A;  1VQN T;  5HKC A;  3SWN B;  1NYQ A;  1VQP A;  4WI1 A;  5D6Y A;  1UB4 A;  3MEW A;  4J6Y A;  4HT8 A;  1SRY A;  2L89 A;  1LJO A;  3QII A;  3C94 A;  2RA2 A;  3UDC A;  4NL2 A;  3SD4 A;  2DAQ A;  2RB6 A;  5A2Q E;  2KQW A;  4XQ3 A;  3VQX A;  2DXB A;  1YHQ A;  4P3N A;  2IY5 A;  2M9U A;  3PTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...