3EFSA

Biotin protein ligase from aquifex aeolicus in complex with biotin and atp
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
232
structure length
232
Chain Sequence
FKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKGRGRLGRKWLSQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
total genus 61
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3efsA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3efsA01
2IY5A 1X01A 3JCMd 2DU7A 2RHSB 2DKGA 2RM4A 3LSQA 3HXYA 2CIMA 4YRRA 4C92E 3W3SA 2ALYB 4UP9A 4CS3A 2ZZEA 5LJ5e 1SERA 1KQ2A 3QO3A 3IG2A 1B34B 1MGQA 4BW9A 4M77G 4DPGA 1X2HA 2I2LA 2CGHA 3HSBA 1B8AA 4M7AE 3IKMB 4KR3A 5C51B 2YLBA 5KNNA 5GAN6 1LNXA 3NELA 4M7DB 1EIYB 4NOYA 1YCYA 4EX5A 5LJ5f 1X56A 3QSUA 4HA8A 1E24A 3HFVA 4J15A 3A7UA 4KR2A 1C0AA 5ELOA 3NENA 4M77C 2DJZA 3FB9A 3QO7A 4K87A 4RQFA 2YHTA 4G85A 5C52B 4H2UA 4K86A 3RKYA 5K1XA 2I4LA 3RACA 3RESA 5C53B 1I4K1 2DZ9A 1H641 4M77A 2ODRD 1KMNA 4M75D 5GAOn 3P8TA 4XTUA 3FIFA 4XTXA 3HFZB 3VBBA 2EAYA 2DTHA 1PYSA 5HGQA 4M75E 5F5WA 1KOGA 3LSSA 2E1HA 1USYA 1WNLA 5GMKj 4RMFA 1Y96B 4J6XA 4RDXA 4HT9A 3JCMh 4UPAA 2E41A 1KMMA 3SWNA 5LJ5h 1E22A 5GANe 4M77F 1X54A 2DQ0A 2ZZGA 5DY9A 1HC7A 4X5OA 5K1PA 1B70B 1X2GA 2C7IA 1NJ2A 2CJ9A 2DTOA 1U1SA 2RHQA 3ICAA 1ASYA 5GAMe 1RIQA 3PGGA 3JB9H 4N0AA 3WQZA 1IL2A 4H02A 4EMKA 3OD1A 3PCOB 2ZT6A 5GAOl 4M7DG 4EMHA 1H4QA 3BDUA 2ARUA 2ZR3A 2RA2A 2EWNA 1E1OA 2HNIA 5GMKh 5GANh 2QHVA 1B7YA 3E9HA 1G5IA 3V8JA 1B7YB 4M7DC 4A54A 2IY5B 2FB7A 4TVAB 2DQ3A 1L0WA 4M7AD 3UFGA 4YYEA 4M7DE 1NYQA 3HY0A 4WI1A 3MF2A 1YB3A 1SETA 4H2XB 4P72C 3HXUA 4C8QE 2Q7EA 1WPYA 3QHSA 4PG3A 3UGQA 3HTZA 2ZR2A 4YRMA 4P73C 3JCMQ 2VXEA 4XTWA 3JB9D 2RHSA 4TTVA 4C8QF 1E1TA 4M78E 3JCMJ 1BBWA 1QE0A 2P5IA 2Q7HA 1U1TA 3JCMe 1BIBA 4JUVA 2K57A 4PJOC 3DSQA 4EO4A 2I4NA 4TVWA 4XTVA 4JLIA 4M78C 5GANj 4MMLA 4YREA 4JRIA 2DTIA 4YRTA 3RF1A 4F7UF 2EJ9A 2ZGWA 4M7AB 4PNOA 3P8YA 4M75B 3IKLA 4YDQA 4X9CA 4YRKA 4XTYA 4ZTZB 1WQWA 3VQWA 4PJOD 1JRIA 3RUXA 1WLEA 2QHSA 2ZT8A 3MEYA 5GAMf 5LJ3d 1NJ8A 2QTXA 1Z7MA 5GAMg 4YRFA 4P71C 5GAN2 3BY7A 2CJBA 2E64A 2ZINA 2DEQA 4CH6A 4M78F 4M78B 4HT8A 2Y90A 4HWRA 3KFUA 1WU7A 2C8MA 4PJOB 1N9SA 2DU5A 1TH7A 4C92B 3M4PA 3LC0A 1D3BB 4M7DD 3REXA 4PJOE 4P3OA 11ASA 3INZA 2FYKA 1GGMA 5GAOq 1PYSB 4UP8A 2RHQB 2VXFA 2JN0A 4TQFA 3JCMV 3A32A 3JB9I 4P74C 4H2XA 5LJ3e 4AH6A 4P74A 4WF2A 4RCCA 1KQ1A 1N9WA 1Y96A 4PJOG 5LJ3h 4XU3A 4XU0A 4YRNA 4CS4A 1LYLA 4XEMA 3TEHA 4M78G 2VC8A 3HFZA 3M4QA 4X9DA 3BJUA 5GAOp 1ADJA 2ARTA 3JCMb 1FYFA 4M78D 4C8QB 2ZT5A 1G5HA 4NCXA 1VQZA 3SB2A 4A53A 1H4SA 4XU1A 1Z7NA 4G84A 1QF6A 1LOJA 4M77E 5GAOr 1H4VB 3HY1A 2I4OA 1SESA 2EJGA 2ODRC 3HFOA 4M7AG 4P75C 5GMKi 2I4MA 4E51A 4L87A 2J3MA 4C92F 2ZTGA 2ZT7A 1NNHA 1WQ7A 4M7AC 4H2VA 4M78A 3VQXA 3FJPA 3JCMP 1H4TA 4QVCA 1HXDA 1M5Q1 4YCWA 4YRCA 1YFTA 4NL3A 3ERRA 5E3IA 3A5YA 1BBUA 1I8FA 1NJ5A 3TEGA 4C8QC 4M75C 4NL2A 2Q5IA 4CH3A 1I81A 2RB6A 3BFMA 4QVDA 5GMKe 2ZIOA 3JCMc 3JCMg 2P0LA 2ZXFA 3HRKA 1B76A 2Q5HA 4H2YA 4PJOF 3A74A 3TEHB 2AKWB 3QNEA 4XU2A 4M75G 4M7AA 5GAMd 3M4GA 4M7AF 1EFWA 3HFNA 4WJ3M 4TWAA 1EQRA 4EMGA 3CMQA 3L4GB 3G1ZA 4J5YA 4XTZA 1EVLA 2XTIA 1LJOA 4P75A 3VU3C 5GANg 4XEOA 1EIYA 5GMKm 4C8QA 4OLFA 4F7UG 4F7UB 5CAIA 1EOVA 3RERA 1W66A 4Q6GA 5LJ5g 4YRJA 2QHUA 4C92D 4CH4A 4YRGA 2J3LA 4DQ2A 3HXXA 4O2DA 2E3CA 2DXUA 4C92A 3JB9F 2AMCB 3JB9G 2ARSA 1YFRA 3VQVA 2DZCA 1NYRA 4CH5A 5GANd 4YRSA 3E9IA 3IALA 1NJ1A 4RQEA 5GAMj 4PJOA 1X55A 4Q15A 4F7UE 5ELNA 3QUIA 5GAOm 4M75A 3GIBA 4MMKA 3QTCA 4M77D 2ZNJA 4K88A 4LNSA 4Y91A 2PMFA 4TQDA 12ASA 4JRKA 3SWNC 1B34A 1N9RA 4EMKC 1ATIA 2ZCEA 4P72A 4C8QG 3EFRA 4EMKB 1USYC 2ALYA 4UP7A 2CJAA 2QHTA 1EVKA 1ASZA 2E10A 3NEMA 3A7AA 4OP0A 1NJ6A 2DDZA 1J5WA 3VQYA 2Q7GA 2ZZFA 4HWPA 2YLCA 1HK9A 5GMKl 1YFSA 5LJ3f 3I7FA 3RL6A 1B70A 4ZIBA 5GAMh 2XGTA 3V8LA 3L2ZA 3RKWA 2E65A 5GAN5 1JBMA 1M8VA 4YP0A 4HWOA 3V7SA 4J6WA 5GANf 3TUPA 4KQEA 4P71A 1G51A 3P8VA 4N0AC 3HXVA 3RIRA 5LJ5j 5GAN4 3A31A 4YRIA 5GAN3 3NETA 1JJCB 2EL9A 3UGTA 1D3BA 1YGBA 3R07A 3HXWA 4M77B 4H2SA 5I21A 3MF1A 4V2SA 3PZCA 4YRLA 4YRQA 5GAN8 4YCVA 4P3PA 1ADYA 3A5ZA 3JCMf 3JCMW 1BIAA 2ZIMA 4YPFA 3REUA 4TVAA 4WJ4A 4PHCA 4C92C 1I5LA 4HWSA 4J6YA 4YCUA 3UH0A 4XQ3A 4TVYA 3HRIA 3RGLA 4H2TA 4C8QD 5GAN7 4H2WA 4ZTUB 2RD1A 4HVCA 3V8KA 3JCMX 2DXTA 3L4GA 3L1AA 3PCOA 1SRYA 2ZNIA 1JJCA 4M7DF 4M75F 3A7RA 5LJ3j 2PMEA 4P73A 4F7UA 2E5AA 2AKWA 4RCBA 4BWAA 2DVEA 5LJ3g 3BW1A 3EFSA 2G4CA 3QO8A 4C92G 4HWTA 5LJ5d 1WYDA 2EJFA 3V7RA 4YRPA 3AHUA 3HXZA 4CS2A 4P3NA 3QO5A 3RKXA 1HTTA 4YROA 4M7DA 2AMCA 3SWNB 3V7CA 3JB9J
chains in the Genus database with same CATH superfamily
5HK0A 1IHVA 1X01A 1BYMA 2DU7A 3QDFA 3LSQA 3EGUA 2DMOA 4YRRA 3UT1A 3QIIA 5D6YA 1BCOA 3CMAT 2MI6A 2DF6A 2DPPB 2PUOB 4FW2A 3CPWS 1FYNA 4J9GA 2CGHA 1G5VA 1B8AA 4KR3A 2RHXA 5KNNA 4LVMA 2QGGA 2B8AA 4LXCA 1YCYA 1D1BA 4CC3A 4LVKA 3PFSA 4HA8A 3O5ZA 1E24A 1OPKA 3GP8A 3IQLA 3A7UA 3OB9A 4KR2A 1Q7YR 2QA4Q 2X4XA 3FB9A 4K87A 1GBQA 1NJIC 2DK3A 4LDXA 3RKYA 4AFSC 2YT6A 3ASKA 3CEYA 2KMTA 2WSFE 5C53B 2DZ9A 1PWTA 4OMNA 1Q86R 2ODRD 4M75D 1S72Q 3P8TA 4ELYC 5F5WA 1M9SA 1HYOA 1H3ZA 2HSPA 4RMFA 4RDXA 1UE9A 2RO0A 3VRYA 2KNBB 4UPAA 2EYXA 1E22A 5KYNA 2BE7D 4M77F 4XAXB 1O9SA 5K1PA 2VGNA 2A8EA 2JM9A 1EIFA 4ATOA 2VKNA 2CJ9A 4RTTA 2GFUA 1PM3A 5FW9A 4M4ZA 1RIQA 2D8HA 2YRCA 1QVFS 2W10A 1NG2A 5FU7B 3X26B 2FRYA 5GAOl 1MNEA 2DD4A 1ARKA 1NLPC 1OU9A 3BDUA 1AZEA 2VV5A 1YITT 1OZ2A 1TU0B 1R8OB 2MWOA 2LQKA 2QQSA 3V8JA 2FG0A 4M7DC 1E6GA 2EYWA 3VKIA 1PRMC 4YYEA 1U06A 2ECZA 9ATCB 3H0HA 2RHIA 3M0TA 1Z9QA 3A8GB 4KH0B 4C8QE 5IHKA 2XDDA 1PC0A 3CMEA 1M3AA 2COZA 3EG2A 1FX7A 3FC3A 3E19A 4ZN1A 1QCOA 1BIBA 3EGXB 4L5GA 2E5QA 4CI0C 1PHTA 1I5OB 4JJDA 2QG9B 4RTXA 4EO4A 4IUVA 3CXCA 4MMLA 4YRTA 3MEUA 4M7AB 3LGLA 4E6RA 2BKDN 4M75B 2CP0A 4GLKA 4XTYA 4ZTZB 3TSWA 2QGFB 1MNDA 4MZTA 2VYTA 1YI2T 4MZPA 4C0DB 5GAMf 2RQUA 2P0QA 2E6ZA 2EGEA 2CJBA 2E64A 2HQXA 3MP8A 5IAYA 2ZINA 2DO3A 1WFWA 4QKUA 3NTIA 2Y90A 4R55A 2RHZA 2HKQB 1VQKT 2HBPA 1GL5A 4PJOB 3M4PA 3RR6A 1YP5A 3LC0A 4E7HA 4M7DD 3VUBA 1ZLMA 3REXA 1VQPT 2DBMA 4PFOA 4PJOE 2A3LA 2DL5A 1VQ5A 1GGMA 2QI2A 5GAOq 3NGPA 5HKCA 3MP6A 1K8AU 4TQFA 2RHUA 1G8XA 4C5IA 2OI3A 1AWWA 2JOYA 3M57A 4P74C 2HBWA 4P74A 2LJ0A 3EG1A 4WF2A 2V8IA 2D8JA 1WHHA 4PJOG 5LL6S 5LJ3h 1OQKA 3CQTA 4ZNXA 3CCUQ 4YRNA 4RTWA 4CS4A 1VQ9T 1FMVA 4XEMA 3TEHA 5KE2A 3HFZA 3QWYA 3CCQA 5GAOp 1ADJA 2ARTA 4C8QB 5KYUA 2ZT5A 2JTFA 3QZ9B 1G5HA 1X2QA 3SB2A 4LDUA 3OS2A 1OZ3A 1S1NA 4M77E 5IXFA 4RKUE 1H4VB 1N8RC 1VQNQ 1SESA 3EFOA 1YWPA 4M7AG 2LJ1A 4P75C 4B9XA 2Y4YA 4L87A 1E7OA 2J3MA 1TOVA 4CC7A 5FWBA 1UHFA 1K73U 1WHJA 4FU6A 4RMOA 3FEOA 3EHRA 3JCMP 1WIEA 1M5Q1 5A0DA 1OU8A 1KQSS 3X20B 2DL4A 3NPFA 3GOXA 1BBUA 1GCPA 5A0GA 4CH3A 2RB6A 5IH2A 4AG2C 1BI3A 2ZXFA 1WYXA 1VOMA 2Q5HA 3ME9A 3QNEA 2DNUA 2OTLQ 3JSCA 1PNJA 3M4GA 5GAMd 1EFWA 3HFNA 1JXMA 4TWAA 4EMGA 2DAQA 2O31A 3CMQA 4QQDA 3CC7T 3CCSA 3G1ZA 2H8HA 2L2PA 4LNPA 1LJOA 2XTIA 3LH0A 2NUPA 3VU3C 4DEYA 1EIYA 4VUBA 3OMCA 3ULRB 2KR3A 3VJPA 3I55A 1PD0A 2DJQA 1VQPQ 2YXYA 4B6MA 3WXMB 2OX7A 2MAMA 2P0PA 4PLLA 5J3BA 4O2DA 1HJDA 1C1AA 2MMPA 3LW5E 2AMCB 2ARSA 4J9EA 3VV0A 3H41A 1NYRA 2JUFA 5GANd 2PVDB 3IALA 1DJ7B 4PJOA 3LWHA 1X55A 2AZSA 4Q15A 1I0CA 1RLPC 5ELNA 5GAOm 4KUIA 2ZPHB 4FYYB 4M77D 2ZNJA 4Y91A 1VQOA 2PMFA 3RMSA 4TQDA 2DD5A 12ASA 1VQ6A 1MV3A 1ZUUA 3M0SA 1VQ6T 3G1JA 1QVGA 4EMKC 3I56T 2K5FA 2QK0A 4Z8AA 1FMWA 4C8QG 3EFRA 5KYUB 1GCQC 1SKUB 1RI0A 1S72A 1G3YA 1OEBA 2NUTB 2CJAA 3CC4T 4OP0A 2EQKA 3MKDA 1YWOA 2J6OA 4HWPA 1YFNA 3UF4A 4PFPA 2YLCA 4FM4B 1HK9A 1PD1A 1YFSA 2ZPBB 3NHNA 2J7IA 5LJ3f 4OMLA 1ZBXA 2FVUA 3I9QA 2VVKA 1VQ7Q 4LVIA 2BE9B 4AT1B 2A36A 1QP2A 4B9WA 4HWOA 5CIUA 2D6FA 4YP0A 4N4HA 4P71A 3HXVA 5KYXA 4YRIA 2E5KA 2XD0A 4QQ6A 1PSFA 1K73C 4M77B 4Q5WA 4HCCA 3PVQA 2IVWA 2QYZA 3L2VA 4YRLA 4YRQA 4LVLA 4F04B 1X27A 1ADYA 1N8RR 1U8RA 4TVAA 5CVIA 2ZCFB 2COYA 2H3JA 3FDRA 3MEVA 3E9GA 1I5LA 2DIGA 1YITQ 2X4WA 1N8RU 2XICA 1K4US 2HQHA 1UDLA 3HRIA 4H2TA 5GAN7 4ZTUB 4FL6A 2RD1A 5I11A 3L4GA 2CZ7B 4ZTFA 2LQWA 4IIMA 2FZCB 2GFAA 2MK5A 2WSEE 2EW3A 4P73A 3CMEQ 2AKWA 1UGRB 3NTHA 1NM7A 2QXFA 2NUTA 3QO8A 4HWTA 5LJ5d 1WYDA 3CCLA 4ZGEB 3HXZA 4KGXB 3HP9A 2C0IA 3G6EQ 3RKXA 1JB0E 2JM8A 3PMTA 2IY5A 1UFFA 2DKGA 3BE3A 3PMIA 1SHGA 2KT1A 3OY9A 3W3SA 3A8OB 4CS3A 5CKFA 5FWCA 3PNWC 1GFCA 2ABLA 2KYBA 4KRTA 4LD6A 1CKAA 3CCVT 5L23A 1RI9A 3TU4K 2PVGB 3SD4A 4HT4A 4IURA 1VQ4T 2AZVA 3C0CA 3ZBDA 2FRWA 2C0OA 1X2HA 4M7AE 3OS5A 5C51B 1X6OA 3NELA 1EIYB 1AZGB 1OX9A 2VASA 1X56A 2JNGA 3HRUA 2IG0A 3RNJA 1QVPA 2FPFA 2VGMA 3UPUA 3G4SQ 1VQMA 4J15A 2CP3A 1AHJB 1VQ5Q 1TXQA 5ELOA 2LRQA 1V76A 1RAGB 4RTYA 1VIFA 1WJRA 5IXBA 3WVDB 5C52B 3VS7A 4K86A 1UGSB 1N5ZA 3QJ6A 1B3QA 2DYBA 2RQVA 3DKMA 1I4K1 2AKLA 4E47A 1H641 4M77A 3SEMA 4XTUA 4XTXA 4WTOB 3VBBA 2EAYA 5HGQA 5FU7C 5KYXB 3LSSA 4J9HA 3HTRA 5GMKj 2PUKB 1TTHB 1Y96B 4HT9A 1WJSA 1KMMA 3SWNA 5GANe 1X54A 2DQ0A 1RAHB 2JTEA 2K5LA 2JJ9A 3E1SA 4JRPA 2CH4A 1NJ2A 3CPWA 4FYVB 3CCMT 1UGVA 3ICAA 1ASYA 3VYHB 4C0FA 1VQNT 1IL2A 1PCXA 3EG9A 1SSHA 4H02A 3OD1A 1D09B 3CXCS 1TG0A 5L8RE 1X6BA 1YN8A 2L5QA 1WGSA 1H4QA 3BDLA 2PTKA 2RI5A 2D1XA 4OMQA 2ZR3A 2RA2A 2EWNA 2HNIA 1M30A 2DL8A 3U23A 2IY5B 3MQZA 3P8DA 8ATCB 2DQ3A 5FRNA 4M7AD 2Z0WA 4LN2A 1NYQA 2CSQA 1YB3A 6AT1B 2ROLA 2E3HA 2V26A 2Q7EA 3QHSA 3CC4A 2JT4A 3QWXX 4R0KA 2AIRB 1KC8U 2YUQA 5CKDA 2ZPIB 3JB9D 2COWA 2KDSA 4M78E 1BBWA 3TSZA 1J3TA 1T3LA 2Q7HA 2F2XA 2GQVA 2NUPB 3L2QA 4PJOC 2K6DA 1RAIB 2RF0A 3PIOA 3QBYA 4TVWA 4XTVA 2ROTA 1NJIU 2ED1A 1FXXA 2LZ6B 5GANj 3C4SA 2V8KA 2OJ2A 2M0OA 1K76A 4AMCA 5AT1B 2EJ9A 1M90C 4PNOA 1VYVA 2SEMA 4QVZA 1K9MC 4YRKA 3CCMA 1WDXA 1QKXA 4GBQA 1WQWA 1FMKA 1T0HA 3GF5A 4C0DC 3VQWA 1QLYA 2LVMA 3KBGA 2J05A 1G3WA 2K7AA 4E7ZA 1KFZA 2ZT8A 1VQOT 1MV0B 5IHNA 2FZGB 1BBZA 1TS9A 1Z7MA 2DEUA 3CCET 1YHQA 2L8DA 2DIQA 4PLIA 2DEQA 4CH6A 2O4XA 4M78F 4HT8A 2O9SA 1QWFA 2RK1A 4BDYA 2MIOA 4L59A 2L0AA 3FRNA 1BI0A 2G6FX 1KD1R 1YNZA 4Z88A 3ZFJA 4LUDA 2KRNA 4RUGA 3INZA 4II1A 2GBQA 2RHQB 2CZ1B 4H2XA 1U5SA 4AH6A 1VQ8T 5DM7R 3NTKA 4CRIA 1NPPA 1Y96A 1KQSP 2PNIA 4FW1A 3M53A 2VC8A 2A0FB 3M4QA 4X9DA 5KYYB 1UTIA 2EQMA 4UC4A 4OMMA 3JCMb 1FYFA 4M78D 1Y07A 3EG3A 2QA4A 2CYZB 4LDYA 5CKBA 4D8KA 1VQZA 2RJEA 2CS7A 1H4SA 4E7KA 2LNVA 1UGPB 2NUZA 1VA7A 5GAOr 8AT1B 4JJNK 1K0SA 2BIVA 3HFOA 3CCEQ 2KY9A 5DLOA 1D1CA 3L2RA 1NNHA 1H8KA 1HSQA 2HL5C 3VUZA 2RQWA 3EFOB 4H2VA 4M78A 4IUUA 3VQXA 3FJPA 2GTJA 2MOXA 3CCRT 1AWXA 1YFTA 2YSQA 4KUDK 4ELZC 2RJFA 5E3IA 3A5YA 1YJNA 3A5ZB 1NJ5A 1NPRA 1M3BA 1TUDA 4M75C 2QQAA 2C0TA 1VQKQ 5GMKe 2ZIOA 2PVOB 2LX9A 3JCMc 4J7IA 3JCMg 5KYWA 1AEYA 3G71A 1YIJT 3HRKA 3LYIA 4H2YA 3TEHB 3CCVA 2AKWB 2M16A 2QA4T 3GBQA 1Y57A 4M7AF 4WJ3M 3G7ZA 1EQRA 2EGCA 3I5RA 1X2KA 5J26A 3UDCA 2X4YA 4XTZA 1UHCA 1M8MA 2A08A 2YDLA 2DL3A 3MCAB 2FEIA 4XEOA 3O8VA 2DYIA 4C8QA 1Q7YU 1KG1A 5A0LA 5GJVB 2OTLT 4F7UG 4F7UB 5CAIA 3UA7A 4FYXB 1EOVA 1W66A 5LJ5g 4YRJA 5IN1A 1QVFP 2EQUA 3OBWA 2J3LA 4DQ2A 4DOWA 3CMET 2E3CA 3JB9F 4HVUA 4AG1C 2CZ6B 3R6NA 1QCNA 3H6ZA 2CH4W 2F2WA 4RQEA 5GAMj 2O88A 1ZUKA 5CCAA 3DLLA 1UJ0A 4MMKA 4LNSA 3M0RA 1K1ZA 1TWBA 1X75C 2DVJA 1IREB 3S3OA 1UECA 2YUOA 2HKNA 2JVVA 3MEAA 1RUWA 1WJQA 2ALYA 3CBOA 1Y71A 4A63B 2RHYA 1EZZB 4O6JA 1JJ2A 1ZQ1A 1W6XA 3MP1A 1NJ6A 2EFIA 1ABQA 2R57A 2NS6A 3OYNA 1YHQT 3NFCA 4FYWB 1YJWQ 3CCUT 1JO8A 2XGTA 4PJNA 3L2ZA 3THKA 1ZSZC 2E65A 5GAN5 4ME7A 3OYKA 2V1QA 1IO6A 2SRCA 1NYFA 5FLXE 3DB4A 3TUPA 4MZMA 2CP7A 1ABOA 3QZ5B 2QAZA 3TCJA 2V8JA 3NETA 3X24B 1JJCB 2EL9A 3UGTA 4JS4A 3PTAA 2QEXT 3VS5A 1YGBA 1D0ZA 3HXWA 2JS2A 1YCSB 4V2SA 2CP2A 5GAN8 4P3PA 3M56A 5GJWB 3H0IA 3A5ZA 4IUPA 3JCMW 5FRMA 4DOVA 3G4ST 4YPFA 4KT0E 2RMOA 2OAWA 3G71Q 4YCUA 3PT9A 4OMFB 2WSCE 4LDWA 2EQJA 4D6WA 3OYGA 1EX4A 3KFVA 4H2WA 4OB1B 2DXTA 4X34A 3L1AA 3PCOA 1SRYA 3DB3A 2VB6A 2CDTA 2ZNIA 4TVRA 3A7RA 5D7UA 2PMEA 3X28B 1KD1U 1B7TA 1WZOA 3H0FA 3NMZC 2E5AA 1VQNA 4BWAA 5M9OA 1RL2A 5C6SA 2EJFA 2AKKA 3AHUA 4YRPA 4P3NA 3QO5A 1Q82R 2AMCA 3VS2A 3SWNB 4JZ3A 1AWOA 3CMAA 4OB0B 3HRSA 3V7CA 1BU1A 3HPWA 5CKEA 3JCMd 2RJDA 4ZN3A 1RACB 2RQRA 2RM4A 2CIMA 2BTTA 1BB9A 4C92E 3CC2T 4PL6A 2ALYB 3CCLQ 3VS4A 1ZX6A 3CPWP 1R77A 2ZZEA 2ZZDA 1QVGS 3OW2S 3QO3A 1SG5A 1XQHA 3PIPA 1ZUYA 1MGQA 4BW9A 4M77G 1GFDA 1BI1A 5CQYA 4DPGA 1NLOC 1Q82C 1YHQQ 2I2LA 3HSBA 3J81E 2A7YA 1GBRA 2YLBA 1LNXA 4M7DB 1NBEB 4NOYA 3TVTA 4EX5A 2DETA 1V29B 4L6V5 5D6XA 1K9MR 3A8MB 4BE2A 1GXIE 4JJBA 3N5BB 3CC7A 3QSUA 4OVAA 3CBPA 3QKJA 2A28A 1UB4A 1KC8R 1UGQB 4ZTJA 2D0QB 3H8ZA 4M77C 1ZSZB 2DJZA 1VQ5T 2YHTA 1AWJA 2RK2A 4H2UA 5K1XA 2CP5A 4BDZA 2P4RA 3RACA 5HY6A 3RESA 3CCQT 2K2MA 1PKTA 2XKOC 4KULA 2HZYA 1QP3A 3S3NA 2ZAEA 1VQKA 1MMGA 1N6AA 4RG8A 1EFNA 1VQMQ 2KRMA 3HFZB 1M27C 2DTHA 4P5NA 2E1HA 1USYA 3E9FA 4LE9A 1M1KC 3JCMh 5HK3A 2E41A 3X25B 5LJ5h 2OTJA 5DY9A 4X5OA 5D6WA 1B70B 4D8DA 1IHWA 1X2GA 3CC4Q 1BK2A 1D0YA 2DXCA 3META 3MEWA 4AFZC 4BI8B 1M4ZA 5GAMe 3PGGA 2ZPFB 3VS0A 2KK4A 4DBFA 2FZKB 5CO7A 2XDPA 2LMJA 3VYGA 2LT4A 2L3SA 4IIOA 1AT1B 1M2VA 3TREA 2ARUA 1WHLA 1K8AR 1AOJA 4OB3B 4E7JA 3A8HB 4O5VA 2QHVA 4A4FA 2J06A 1B7YB 1WX6A 4A54A 3G71T 3RDVA 1R0CB 4TVAB 1L0WA 3UFGA 1YJNQ 2CREA 3G6ET 4CC2A 3HY0A 1M3CA 3EGXA 4WI1A 3MF2A 1SETA 1TUGB 4H2XB 1YI2Q 3SFMA 1JJ2P 4HXJA 4P73C 1RAFB 2LT1A 2VXEA 2RHSA 3EAEA 2EGAA 4C8QF 1E1TA 2F5TX 1QE0A 2P5IA 2O2OA 1OYXA 3C95A 1U1TA 5CQXA 2QEXQ 3M9QA 2M1HA 2E12A 1IXDA 3VRZA 2YUNA 4JLIA 2CP6A 3RMQA 4JRIA 2DTIA 2JZ2A 3RF1A 1B07A 2ZGWA 3P8YA 3ZL7C 3CCJA 4BE0A 4X9CA 1WLPB 1KHCA 4FSXA 1UEBA 3CD6T 5HCKA 4PJOD 3QG1A 3RUXA 1ZA2B 3F70A 3MEYA 2C06A 2RI3A 1IRXA 4A4KA 5LJ3d 1NJ8A 2QTXA 4C0ZA 1PSEA 3A1PA 3KUFA 4P71C 4YRFA 3BY7A 2JMAA 3CCMQ 1M1KR 4M78B 2GTOA 2BZYA 4KH1B 3KFUA 3URGA 1N9SA 4C92B 3CCST 1YJ9T 2MCNA 3I35A 1D3BB 2EBPA 2EKHA 1Y0MA 5EG2A 3E2UA 2FYKA 4X1VA 1GCQA 2AHJB 3SDZA 3JCMV 3A8LB 3JB9I 4NS5A 1BCMA 2HEQA 2R5MA 3VS6A 3S6WA 4RCCA 1KQ1A 1Z9ZA 2KXCA 1JQQA 4XU3A 3CD6A 4XU0A 2R58A 1LYLA 1S72T 3EG0A 4M78G 2KROA 1VYUA 3BJUA 2YWWA 3G4SA 3L2WA 1AD5A 1RLQC 2EPDA 3I56A 2LDMA 4NCXA 1V1CA 2XIDA 4OMOA 4A53A 5FU6C 1VQ4Q 1Z7NA 4G84A 1LOJA 1U3OA 2EYQA 2NYSA 1ZSZA 2HCKA 1W2BA 2M9UA 3GLXA 5IHIA 4BB7A 3CCVQ 3HY1A 4J9IA 3D7SB 4QW2A 5FROA 2ODRC 3FLGA 2RNAA 1RABB 5KYWB 1Q86U 5GMKi 1SRLA 3OYLA 2B86A 4C5EA 2GQIA 2XU8A 4EDUA 1QVFA 1H92A 1KSWA 4A4HA 3OYFA 4C92F 2ZT7A 5I2SA 3CC7Q 1SF9A 2XG8D 2KRSA 2CT3A 2A37A 2PU9B 1H4TA 2IIMA 1UUEA 1OI1A 4YCWA 2VWFA 2K79A 2KT8A 4YRCA 2E70A 4BACA 2LCLA 2AK5A 2RN8A 3ERRA 4HKEA 3TEGA 2E4HA 1I81A 2GF7A 3BFMA 2JW4A 4QVDA 3CMAQ 1B76A 4PJOF 3A74A 2EVRA 4M75G 2GNCA 4J9DA 1IZ6A 3I55Q 1M2OA 2O01E 1R0BG 1VQLT 2E3IA 3OYYA 4P75A 2QQRA 4DA4A 1VQMT 2OTJT 5GMKm 3P8BB 2KQWA 1TSFA 2XMFA 3M0QA 4Z02A 3RERA 2QHUA 2P84A 2OTLA 4CH4A 4KGZB 1C0MA 4YRGA 2DRKA 2P4TA 4JJCA 3HXXA 4FCYA 2JMCA 3CCSQ 4PKCC 1YFRA 2LJ3A 3EGDB 4OGEA 4YRSA 3E9IA 1VQ8Q 2L89A 1QW1A 3OW2P 1VIEA 5CR2A 3QYGB 4M75A 2XHCA 3QTCA 4KBMB 4JRKA 5KH6A 2HAXA 3CCRA 1B34A 2BUDA 4J9FA 1N9RA 7AT1B 3OYDA 2ZCEA 3A98A 2K3XA 2X9HA 3EH2A 4P72A 5AYFA 4EMKB 1USYC 1VQ4A 2DILA 5ECAA 1ZHIA 1H3HA 4RTUA 1ZA1B 1EVKA 2GGRA 2KGTA 1J5WA 1VQOQ 1CKBA 1K73R 3VQYA 2Q7GA 5CK9A 3LGFA 1VQ6Q 3CCLT 2AT1B 2DE0X 4E2FB 2BZ8A 2LQ8A 3GNFB 3RL6A 4DEXA 2QQBA 3OYIA 4ZIBA 3RKWA 4AFUC 4EIKA 1M8VA 2PZ1A 2KSSA 1IGQA 4MDWA 3V7SA 4J6WA 5KCOA 3OYCA 1MHNA 4KQEA 2QASA 1G51A 3P8VA 4N0AC 4J8OA 1OPLA 5LJ5j 5GAN4 3A31A 1YITA 5GAN3 2CKKA 2DM1A 1D3BA 2HDAA 2K5IA 2KVQG 4H2SA 4OF1A 2DFUA 4YCVA 3MPUB 2PQWA 4E7SA 1Q86C 1RAEB 3REUA 1KJWA 1FWZA 4WJ4A 4LVJA 4C0GA 2RH2A 4ZGDB 4PHCA 1QVGP 1XOVA 1SRMA 3UH0A 3M59A 4XQ3A 4JLGA 2M0YA 2DERA 3RGLA 3T9NA 1KK7A 1UJYA 1WXTA 4Y28E 3CC2A 4HVCA 3V8KA 2KBTA 2QDLA 1WA7A 3DLMA 4M7DF 4M75F 1NZ9A 2NLUA 2XDBA 4ESRA 4F7UA 1KHIA 1IGUA 5A2QE 4PJJA 4RCBA 2DVEA 3PVLA 1MMDA 2DBKA 4C5HA 1WXBA 3M4YA 2G4CA 1X69A 2KXDA 1PRLC 2E6NA 3UATA 3OYBA 2VUBA 2CUBA 3V7RA 5I22A 4K11A 2EYYA 1VYTA 1HTTA 4HVVA 4M7DA 3OA6A 1QWEA 4JUVA 3S3MA 3JB9J 4PK4A 3C94A 4QQGA 2RHSB 4PFZA 3HXYA 3P8HA 4LUEA 1SHFA 3LX7A 2D9TA 2W0ZA 4GLMA 4UP9A 5LJ5e 1SERA 1KQ2A 1VQ7A 1A0NB 5I2MA 1Q82U 2DXBA 3IG2A 1B34B 2LP5A 3M0PA 2KI7A 4DBRA 4ZGJB 3OS0A 3OYMA 3GNGA 3R6OA 1XTDA 1MMAA 1PKSA 2HL3A 3REBB 3IKMB 3C12A 3OYJA 1VQ7T 5GAN6 4YTLA 3OMGA 1WHMA 2K2VA 5KCHA 2X3WD 2OTJQ 5LJ5f 2XK0A 3CCUA 1GRIA 2KYMA 3LWIA 2GCXA 2K4YA 1YJ9A 3HFVA 1CSKA 3TQ7P 1G83A 4BE1A 1C0AA 4FIBA 3NENA 3L2UA 3JAME 3QO7A 4RQFA 2LCCA 4G85A 2I4LA 3CPFA 3SHWA 4BI3A 1KD1C 4E7IA 1KMNA 5GAOn 3CXCP 3FIFA 1MMNA 1PYSA 4M75E 1KOGA 5EC7A 1W4SA 1WNLA 2EQIA 2EYZA 2CZ0B 2ATCB 2QTVA 4J6XA 4OGCA 2CT4A 1JJ2S 1M1GA 3ZEHA 3FJ5A 2ZZGA 2ZPGB 1HC7A 2BZXA 3MJXA 2C7IA 4N4GA 5J39A 5IT9E 2DTOA 2KAFA 2L3RA 1U1SA 1BI2A 2HSEB 2RHQA 4J9BA 4QT7A 1RAAB 3JB9H 4N0AA 3WQZA 2J6KA 1KIKA 4EMKA 2DLPA 3PCOB 2ZT6A 2JS0A 1OX8A 4M7DG 4EMHA 3GPLA 1LVKA 1QQJA 3QJYA 1E1OA 5GMKh 5GANh 4JZ4A 3CCJQ 1B7YA 3E9HA 1G5IA 3UA6A 1W1FA 3M55A 1QKWA 2YUPA 2DL7A 2FB7A 3OS1A 4HCZA 4FSSA 4JDSA 4M7DE 4P72C 2K9GA 3HXUA 3KXTA 1WPYA 1M1KU 4PG3A 3UGQA 3HTZA 2ZR2A 1I07A 4YRMA 1JU5C 2MF2A 3PE0A 3JCMQ 5C0MA 4XTWA 2F2VA 4XK8E 4E7LA 4TTVA 1I1JA 3JCMJ 2R5AA 3JCMe 2I0NA 3MO8A 2K57A 1WI7A 3DSQA 2F69A 1VQ9A 1YI2A 2I4NA 4OB2B 1SEMA 4M78C 4YREA 4F7UF 1WXUA 3QXEB 3IKLA 1T3SA 2CSIA 4AFQC 2X51A 1MUZA 2FL7A 1JRIA 2FHDA 1PG5B 1X43A 2HQEA 4EPCA 4Z89A 1WLEA 2MYSA 2QHSA 5CKHA 3CD6Q 1VQ8A 4A4EA 4A4GA 5GAMg 1K8AC 2WACA 4OMPA 1Q95G 2KE9A 4BY6C 5GAN2 1Y7XA 2YRDA 3L42A 4F14A 1Q81R 3I56Q 4RTZA 2M02A 4ANJA 2X3XD 4HWRA 3REAB 3EGDA 1BKBA 1WU7A 2C8MA 1VQLA 4CC4B 2DU5A 1TH7A 2MWPA 4F17A 1SPKA 3CC2Q 2F1LA 4P3OA 11ASA 1T0JA 4JRQA 1PYSB 4UP8A 2VXFA 2JN0A 3A32A 2ZPEB 1OV3A 4FT4A 3HL8A 1M90R 3HHTB 5LJ3e 1VUBA 4IKFA 4WCIA 2O9VA 1NEGA 1N9WA 1RADB 3M58A 1JXOA 1ACMB 1YIJQ 2QQ9A 4C5GA 3M0UA 3CCEA 1OOTA 2X35A 1G3SA 1M2VB 2K3BA 1QF6A 2FPEA 4XU1A 2JTMA 2OAUA 1G3TA 4IUQA 3OW2A 4BY6B 2HD0A 2EKOA 5KYYA 2I4OA 3ER0A 1QMCA 2KEAA 4JS5A 2M51A 1NJIR 2EJGA 3HKSA 2L3QA 2LC4A 3OYEA 2I4MA 4E51A 2P0KA 4J83A 2ZTGA 1P92A 1WQ7A 2EIFA 1YJWT 4M7AC 2NWMA 1YJ9Q 3H9NA 1NYGA 4QVCA 1HXDA 4PJLA 2LQNA 3CCQQ 4NL3A 3QDRB 3CBMA 3EH1A 3AT1B 3J7AF 3LLRA 1I8FA 2RJCA 2X4JA 4C8QC 4LDVA 2ESWA 4NL2A 2Q5IA 1E6HA 1YJWA 2DA9A 2J6FA 1LCKA 1D1AA 2P0LA 3OYAA 2CUDA 4XU2A 1NE8A 1M1FA 1W2BS 1YBYA 4M7AA 1WHKA 4HCBA 3L4GB 4J5YA 1EVLA 3OQ5A 1VQLQ 1K9AA 5GANg 2ENMA 2RQTA 4OLFA 4HCKA 3I55T 4GY5A 4Q6GA 4C92D 2IPOB 1O75A 1NEBA 4BI4A 3OBYA 4KGVB 2DXUA 4C92A 1K9MU 3JB9G 2FPDA 4PJMA 3VQVA 2DZCA 4CH5A 1M90U 1KQSA 4N4IA 2QEXA 4MDXA 1NJ1A 3CCJT 1W2BP 3UWNA 4F7UE 1C6VX 2JXBA 3QUIA 1IB8A 3GIBA 1ZSGA 4K88A 2YRVA 4BUGA 3HRTA 4FT2A 1YIJA 2RPNA 1Q7YC 1TUCA 3SWNC 4DBQA 1ATIA 4R56A 4BD3A 2D0NA 3OSVA 1KC8C 1YJNT 1G2BA 4UP7A 1W70A 4RG2A 2QHTA 1ZBJA 1HD3A 2G3RA 1ASZA 3M5AA 2MPXC 2DX1A 2E10A 3J80E 3A7AA 3NEMA 1XJWB 2DDZA 2ZZFA 2FO0A 3JRZA 1F1BB 2K3YA 1VQPA 3CCRQ 2L3PA 5GMKl 3I7FA 2LTOA 1B70A 2HMAA 5GAMh 1LPLA 3V8LA 1JBMA 1AVZC 3EG9B 3VS1A 5FU6B 3WVEB 4F16A 5KE3A 1OULA 5GANf 2DRMA 3QPHA 3RIRA 2Y4XA 4HVWA 2LCSA 5DLQE 3R07A 4JPBW 1JEGA 1Q81C 5I21A 3RBBB 3MF1A 3PZCA 3MHXA 1UG1A 3TEEA 3JCMf 1BIAA 2ZIMA 2O4XB 3VS3A 3JV3A 4DBHA 4IUTA 1D0XA 4J9CA 3Q1JA 4ORZA 1N27A 4C92C 4HWSA 4J6YA 1K0XA 2LX7A 4TVYA 1XNIA 4J7FA 4C8QD 1X6GA 3JCMX 3G6EA 1JJCA 1SSFA 4RTVA 3OYHA 5LJ3j 3LH5A 3I5SA 1QCFA 2H3EB 4Y92A 2XI9A 2V1RA 5LJ3g 3BW1A 3QYHB 3EFSA 2F5KA 4C92G 2ED0A 3EHQA 3OSSC 1WHGA 4CS2A 3M54A 1Q81U 4YROA 1VQ9Q 2RI2A 2QDYB 4LD9K 4YDQA 2LNHB
chains in the Genus database with same CATH topology
5HK0A 1X01A 1BYMA 2DU7A 3LSQA 4YRRA 3UT1A 3QIIA 5D6YA 3CMAT 2MI6A 2PUOB 2DPPB 3CPWS 2CGHA 1G5VA 1B8AA 4KR3A 2RHXA 5KNNA 4LVMA 2B8AA 1YCYA 4LVKA 3PFSA 4HA8A 1E24A 3GP8A 3A7UA 3OB9A 4KR2A 2X4XA 3FB9A 4K87A 4LDXA 1NJIC 2DK3A 3RKYA 3ASKA 3CEYA 2KMTA 2WSFE 5C53B 2DZ9A 2ODRD 4M75D 3P8TA 4ELYC 5F5WA 1M9SA 1H3ZA 4RMFA 4RDXA 2RO0A 4UPAA 1E22A 4M77F 4XAXB 1O9SA 5K1PA 2VGNA 2A8EA 1EIFA 4ATOA 2CJ9A 2GFUA 1RIQA 1QVFS 5FU7B 3X26B 5GAOl 2DD4A 3BDUA 2VV5A 1YITT 1OZ2A 1R8OB 2MWOA 2LQKA 2QQSA 3V8JA 4M7DC 3VKIA 4YYEA 2RHIA 3A8GB 4C8QE 2XDDA 3CMEA 1FX7A 3FC3A 3E19A 4ZN1A 1BIBA 4L5GA 2E5QA 4CI0C 4EO4A 4IUVA 3CXCA 4MMLA 4YRTA 3MEUA 4M7AB 3LGLA 2BKDN 4M75B 4GLKA 4XTYA 4ZTZB 4MZTA 2VYTA 1YI2T 4MZPA 4C0DB 5GAMf 2P0QA 2E6ZA 2CJBA 2E64A 2HQXA 3MP8A 5IAYA 2ZINA 2DO3A 3NTIA 2Y90A 4R55A 2RHZA 1VQKT 2HBPA 4PJOB 3M4PA 3LC0A 4E7HA 4M7DD 3VUBA 3REXA 1VQPT 4PJOE 2A3LA 1GGMA 1VQ5A 2QI2A 5GAOq 5HKCA 3MP6A 1K8AU 4TQFA 2RHUA 4C5IA 4P74C 2JOYA 3M57A 4P74A 4WF2A 2V8IA 4PJOG 5LL6S 5LJ3h 4YRNA 4CS4A 1VQ9T 4XEMA 3TEHA 5KE2A 3HFZA 3CCQA 5GAOp 1ADJA 2ARTA 4C8QB 2ZT5A 2JTFA 3QZ9B 1G5HA 3SB2A 4LDUA 3OS2A 1OZ3A 4M77E 4RKUE 1H4VB 1N8RC 1SESA 4M7AG 4P75C 4B9XA 2Y4YA 4L87A 2J3MA 1K73U 4FU6A 4RMOA 3FEOA 3JCMP 1M5Q1 5A0DA 1KQSS 3X20B 3GOXA 1BBUA 5A0GA 4CH3A 2RB6A 1BI3A 2ZXFA 2Q5HA 3ME9A 3QNEA 3JSCA 5GAMd 3M4GA 1EFWA 3HFNA 4TWAA 4EMGA 2DAQA 3CMQA 4QQDA 3CC7T 3CCSA 3G1ZA 2XTIA 1LJOA 3LH0A 3VU3C 1EIYA 4VUBA 3OMCA 3VJPA 3I55A 3WXMB 2MAMA 2P0PA 4PLLA 5J3BA 4O2DA 3LW5E 2MMPA 2AMCB 2ARSA 3VV0A 1NYRA 2JUFA 5GANd 2PVDB 3IALA 1DJ7B 4PJOA 3LWHA 1X55A 4Q15A 5ELNA 5GAOm 4KUIA 2ZPHB 4M77D 2ZNJA 4Y91A 1VQOA 2PMFA 3RMSA 4TQDA 2DD5A 12ASA 1VQ6A 1VQ6T 1QVGA 4EMKC 3I56T 2K5FA 4C8QG 3EFRA 1RI0A 1S72A 1G3YA 2CJAA 3CC4T 4OP0A 2EQKA 4HWPA 2YLCA 4FM4B 1HK9A 1YFSA 2ZPBB 5LJ3f 1ZBXA 2FVUA 4LVIA 1QP2A 4B9WA 4HWOA 5CIUA 2D6FA 4YP0A 4N4HA 4P71A 3HXVA 4YRIA 2XD0A 4QQ6A 1PSFA 1K73C 4M77B 4Q5WA 4HCCA 2IVWA 3L2VA 4YRLA 4YRQA 4LVLA 1ADYA 1U8RA 4TVAA 2ZCFB 5CVIA 2H3JA 3FDRA 3MEVA 3E9GA 1I5LA 2DIGA 2X4WA 1N8RU 2XICA 3HRIA 4H2TA 5GAN7 4ZTUB 4FL6A 2RD1A 3L4GA 2CZ7B 4ZTFA 2GFAA 2WSEE 4P73A 2AKWA 1UGRB 3NTHA 2QXFA 3QO8A 4HWTA 5LJ5d 1WYDA 3CCLA 4ZGEB 3HXZA 3HP9A 3RKXA 1JB0E 3PMTA 2IY5A 2DKGA 3PMIA 3OY9A 3W3SA 3A8OB 4CS3A 5CKFA 3PNWC 4LD6A 3CCVT 3TU4K 2PVGB 3SD4A 4HT4A 4IURA 1VQ4T 3ZBDA 1X2HA 4M7AE 3OS5A 5C51B 1X6OA 3NELA 1EIYB 1X56A 2JNGA 3HRUA 2IG0A 1QVPA 3UPUA 2VGMA 1VQMA 4J15A 1AHJB 5ELOA 2LRQA 1VIFA 1WJRA 3WVDB 5C52B 4K86A 1UGSB 3DKMA 3QJ6A 1I4K1 4E47A 1H641 4M77A 4XTUA 4XTXA 3VBBA 2EAYA 5HGQA 5FU7C 3LSSA 5GMKj 2PUKB 1Y96B 4HT9A 1WJSA 1KMMA 3SWNA 5GANe 1X54A 2DQ0A 2K5LA 3E1SA 4JRPA 1NJ2A 3CPWA 3CCMT 3ICAA 1ASYA 3VYHB 4C0FA 1VQNT 1IL2A 4H02A 3OD1A 3CXCS 5L8RE 2L5QA 1WGSA 1H4QA 3BDLA 2RI5A 2ZR3A 2RA2A 2EWNA 2HNIA 2IY5B 3MQZA 3P8DA 2DQ3A 5FRNA 4M7AD 1NYQA 1YB3A 2Q7EA 3QHSA 3CC4A 1KC8U 3JB9D 2ZPIB 5CKDA 2KDSA 4M78E 1BBWA 2Q7HA 2GQVA 3L2QA 4PJOC 3PIOA 3QBYA 4TVWA 4XTVA 1NJIU 1FXXA 5GANj 3C4SA 2V8KA 2M0OA 2EJ9A 1M90C 4PNOA 4QVZA 4YRKA 1K9MC 3CCMA 1WQWA 3GF5A 4C0DC 3VQWA 2LVMA 3KBGA 1G3WA 2ZT8A 1VQOT 1Z7MA 3CCET 1YHQA 2L8DA 2DIQA 4PLIA 2DEQA 4CH6A 2O4XA 4M78F 4HT8A 2RK1A 4BDYA 4L59A 3FRNA 1BI0A 3ZFJA 3INZA 4II1A 2RHQB 2CZ1B 4H2XA 4AH6A 1VQ8T 5DM7R 3NTKA 4CRIA 1NPPA 1Y96A 3M53A 2VC8A 3M4QA 4X9DA 2EQMA 4UC4A 3JCMb 1FYFA 4M78D 1Y07A 2QA4A 2CYZB 4LDYA 5CKBA 1VQZA 2RJEA 2CS7A 1H4SA 4E7KA 2LNVA 1UGPB 5GAOr 4JJNK 2BIVA 3HFOA 2KY9A 5DLOA 3L2RA 1NNHA 3VUZA 4H2VA 4IUUA 4M78A 3VQXA 3FJPA 3CCRT 1YFTA 4KUDK 4ELZC 2RJFA 5E3IA 3A5YA 1YJNA 3A5ZB 1NJ5A 1NPRA 4M75C 2QQAA 5GMKe 2ZIOA 2PVOB 2LX9A 3JCMc 4J7IA 3JCMg 3G71A 1YIJT 3HRKA 3LYIA 4H2YA 3TEHB 3CCVA 2AKWB 2M16A 2QA4T 4M7AF 4WJ3M 3G7ZA 1EQRA 5J26A 3UDCA 2X4YA 4XTZA 3MCAB 4XEOA 3O8VA 4C8QA 1Q7YU 1KG1A 5A0LA 2OTLT 4F7UG 4F7UB 5CAIA 1EOVA 4YRJA 1W66A 5LJ5g 5IN1A 2EQUA 3OBWA 2J3LA 4DQ2A 4DOWA 3CMET 2E3CA 3JB9F 2CZ6B 3H6ZA 4RQEA 5GAMj 5CCAA 3DLLA 4MMKA 4LNSA 1X75C 1IREB 3S3OA 2JVVA 3MEAA 1WJQA 2ALYA 3CBOA 1Y71A 2RHYA 4O6JA 1JJ2A 1ZQ1A 3MP1A 1NJ6A 2EFIA 2R57A 2NS6A 3OYNA 1YHQT 3NFCA 3CCUT 2XGTA 3L2ZA 2E65A 5GAN5 4ME7A 3OYKA 5FLXE 3DB4A 3TUPA 4MZMA 3QZ5B 3TCJA 2V8JA 3NETA 3X24B 1JJCB 2EL9A 3UGTA 4JS4A 3PTAA 2QEXT 1YGBA 3HXWA 4V2SA 5GAN8 4P3PA 3M56A 3A5ZA 4IUPA 3JCMW 5FRMA 4DOVA 3G4ST 4YPFA 4KT0E 4YCUA 3PT9A 4OMFB 2WSCE 4LDWA 2EQJA 4D6WA 3OYGA 4H2WA 4OB1B 2DXTA 4X34A 3L1AA 3PCOA 1SRYA 3DB3A 2ZNIA 4TVRA 3A7RA 2PMEA 3X28B 1KD1U 2E5AA 1VQNA 4BWAA 5M9OA 1RL2A 5C6SA 2EJFA 4YRPA 3AHUA 4P3NA 3QO5A 2AMCA 3SWNB 3CMAA 4OB0B 3V7CA 3HRSA 3HPWA 5CKEA 3JCMd 2RJDA 4ZN3A 2RM4A 2CIMA 4C92E 3CC2T 4PL6A 2ALYB 2ZZEA 2ZZDA 1QVGS 3OW2S 3QO3A 1XQHA 3PIPA 1MGQA 4BW9A 4M77G 1BI1A 5CQYA 4DPGA 1Q82C 2I2LA 3HSBA 3J81E 2A7YA 2YLBA 1LNXA 4M7DB 4NOYA 4EX5A 1V29B 4L6V5 5D6XA 3A8MB 4BE2A 1GXIE 3CC7A 3N5BB 3QSUA 4OVAA 3CBPA 3QKJA 1UB4A 1UGQB 4ZTJA 2D0QB 3H8ZA 4M77C 2DJZA 2YHTA 2RK2A 4H2UA 5K1XA 4BDZA 3RACA 5HY6A 3RESA 3CCQT 2XKOC 4KULA 1QP3A 3S3NA 1VQKA 1N6AA 4RG8A 3HFZB 2DTHA 4P5NA 2E1HA 1USYA 3E9FA 1M1KC 3JCMh 5HK3A 2E41A 3X25B 5LJ5h 2OTJA 5DY9A 4X5OA 5D6WA 1B70B 1X2GA 2DXCA 3META 3MEWA 4BI8B 1M4ZA 5GAMe 3PGGA 2ZPFB 2KK4A 5CO7A 2XDPA 3VYGA 2LT4A 3TREA 2ARUA 4OB3B 4E7JA 3A8HB 4O5VA 2QHVA 4A4FA 1B7YB 4A54A 3G71T 4TVAB 1L0WA 3UFGA 3G6ET 3HY0A 4WI1A 3MF2A 1SETA 4H2XB 3SFMA 4P73C 2LT1A 2VXEA 2RHSA 3EAEA 4C8QF 1E1TA 2F5TX 1QE0A 2P5IA 1OYXA 3C95A 1U1TA 5CQXA 3M9QA 2M1HA 2E12A 4JLIA 3RMQA 4JRIA 2DTIA 2JZ2A 3RF1A 2ZGWA 3P8YA 3CCJA 4BE0A 4X9CA 1KHCA 4FSXA 1UEBA 3CD6T 4PJOD 3QG1A 3RUXA 3F70A 3MEYA 2C06A 2RI3A 4A4KA 5LJ3d 1NJ8A 2QTXA 4C0ZA 1PSEA 3KUFA 4YRFA 4P71C 3BY7A 4M78B 3KFUA 3URGA 1N9SA 4C92B 3CCST 1YJ9T 1D3BB 5EG2A 2FYKA 2AHJB 3SDZA 3JCMV 3A8LB 3JB9I 4NS5A 2R5MA 3S6WA 4RCCA 1KQ1A 4XU3A 3CD6A 4XU0A 2R58A 1LYLA 1S72T 4M78G 3BJUA 3G4SA 3L2WA 3I56A 2LDMA 4NCXA 2XIDA 4A53A 5FU6C 1Z7NA 4G84A 1LOJA 2EYQA 1W2BA 2M9UA 3GLXA 4BB7A 3HY1A 4QW2A 5FROA 2ODRC 3FLGA 1Q86U 5GMKi 3OYLA 4C5EA 2XU8A 4EDUA 1QVFA 4A4HA 3OYFA 4C92F 2ZT7A 5I2SA 2XG8D 2PU9B 1H4TA 1OI1A 4YCWA 4YRCA 2E70A 4BACA 2LCLA 3ERRA 4HKEA 3TEGA 1I81A 2GF7A 3BFMA 4QVDA 1B76A 4PJOF 3A74A 4M75G 1IZ6A 2O01E 1VQLT 3OYYA 4P75A 2QQRA 4DA4A 1VQMT 2OTJT 5GMKm 3P8BB 2KQWA 3RERA 4Z02A 2QHUA 2OTLA 4CH4A 4YRGA 2P4TA 3HXXA 4PKCC 1YFRA 4OGEA 4YRSA 3E9IA 2L89A 1QW1A 1VIEA 5CR2A 3QYGB 4M75A 2XHCA 3QTCA 4KBMB 4JRKA 5KH6A 2HAXA 3CCRA 1B34A 2BUDA 1N9RA 3OYDA 2ZCEA 2K3XA 4P72A 5AYFA 4EMKB 1USYC 1VQ4A 1ZHIA 1EVKA 1J5WA 3VQYA 2Q7GA 5CK9A 3LGFA 3CCLT 2LQ8A 3GNFB 3RL6A 2QQBA 3OYIA 4ZIBA 3RKWA 1M8VA 2KSSA 4MDWA 3V7SA 4J6WA 5KCOA 3OYCA 1MHNA 4KQEA 1G51A 3P8VA 4N0AC 4J8OA 5GAN4 5LJ5j 3A31A 1YITA 5GAN3 2CKKA 1D3BA 2K5IA 2KVQG 4H2SA 4OF1A 4YCVA 2PQWA 1Q86C 3REUA 1FWZA 4WJ4A 4LVJA 4C0GA 4PHCA 2RH2A 4ZGDB 1XOVA 3UH0A 3M59A 4XQ3A 4JLGA 3RGLA 3T9NA 3CC2A 4Y28E 4HVCA 3V8KA 3DLMA 4M7DF 4M75F 1NZ9A 2NLUA 2XDBA 4F7UA 1KHIA 5A2QE 4RCBA 2DVEA 4C5HA 3M4YA 2G4CA 2E6NA 3OYBA 2VUBA 3V7RA 1HTTA 4M7DA 3OA6A 4JUVA 3S3MA 3JB9J 3C94A 4QQGA 2RHSB 3HXYA 3P8HA 3LX7A 2D9TA 4UP9A 5LJ5e 1SERA 1KQ2A 1VQ7A 5I2MA 1Q82U 2DXBA 3IG2A 1B34B 3OS0A 4ZGJB 3OYMA 3GNGA 3R6OA 1XTDA 3IKMB 3C12A 3OYJA 1VQ7T 5GAN6 4YTLA 3OMGA 2K2VA 5KCHA 5LJ5f 2XK0A 3CCUA 3LWIA 2GCXA 2K4YA 1YJ9A 3HFVA 4BE1A 1C0AA 4FIBA 3NENA 3L2UA 3JAME 3QO7A 4RQFA 2LCCA 4G85A 2I4LA 3CPFA 4BI3A 1KD1C 4E7IA 1KMNA 5GAOn 3FIFA 1PYSA 4M75E 1KOGA 1W4SA 1WNLA 2CZ0B 4J6XA 4OGCA 1JJ2S 1M1GA 3ZEHA 2ZZGA 2ZPGB 1HC7A 2C7IA 4N4GA 5J39A 5IT9E 2DTOA 2KAFA 2L3RA 1U1SA 1BI2A 2RHQA 3JB9H 4N0AA 3WQZA 4EMKA 3PCOB 2ZT6A 4M7DG 4EMHA 3GPLA 3QJYA 1E1OA 5GMKh 5GANh 3E9HA 1B7YA 1G5IA 3M55A 2FB7A 3OS1A 4HCZA 4JDSA 4M7DE 4P72C 3HXUA 3KXTA 1WPYA 1M1KU 4PG3A 3UGQA 3HTZA 2ZR2A 4YRMA 2MF2A 3JCMQ 5C0MA 4XTWA 4TTVA 4XK8E 4E7LA 3JCMJ 2R5AA 3JCMe 3MO8A 2K57A 3DSQA 2F69A 1VQ9A 1YI2A 2I4NA 4OB2B 4M78C 4YREA 4F7UF 3QXEB 3IKLA 2FL7A 1JRIA 2FHDA 2HQEA 4EPCA 1WLEA 2QHSA 5CKHA 1VQ8A 4A4EA 4A4GA 5GAMg 1K8AC 2WACA 5GAN2 4BY6C 1Y7XA 3L42A 4HWRA 1BKBA 1WU7A 2C8MA 1VQLA 2DU5A 1TH7A 2MWPA 4P3OA 11ASA 4JRQA 1PYSB 4UP8A 2VXFA 2JN0A 3A32A 2ZPEB 4FT4A 3HL8A 3HHTB 5LJ3e 1VUBA 4IKFA 1N9WA 3M58A 2QQ9A 4C5GA 3CCEA 2X35A 1G3SA 1QF6A 4XU1A 2JTMA 2OAUA 1G3TA 4IUQA 3OW2A 4BY6B 2HD0A 2EKOA 2I4OA 3ER0A 4JS5A 2EJGA 3HKSA 2LC4A 3OYEA 2I4MA 4E51A 2P0KA 4J83A 2ZTGA 1P92A 1WQ7A 2EIFA 1YJWT 4M7AC 4QVCA 1HXDA 4NL3A 3QDRB 3CBMA 3J7AF 3LLRA 1I8FA 2RJCA 2X4JA 4C8QC 4LDVA 4NL2A 2Q5IA 1YJWA 2P0LA 3OYAA 4XU2A 1NE8A 1M1FA 1W2BS 1YBYA 4M7AA 4HCBA 3L4GB 4J5YA 1EVLA 3OQ5A 5GANg 4OLFA 3I55T 4GY5A 4Q6GA 4C92D 1O75A 4BI4A 3OBYA 2DXUA 4C92A 1K9MU 3JB9G 3VQVA 2DZCA 4CH5A 1M90U 1KQSA 4N4IA 2QEXA 4MDXA 1NJ1A 3CCJT 3UWNA 4F7UE 3QUIA 3GIBA 4K88A 2YRVA 4BUGA 3HRTA 4FT2A 1YIJA 1Q7YC 3SWNC 1ATIA 4R56A 4BD3A 3OSVA 1KC8C 1YJNT 4UP7A 4RG2A 2QHTA 2G3RA 1ASZA 3M5AA 3J80E 3NEMA 2E10A 3A7AA 2DDZA 2ZZFA 3JRZA 2K3YA 1VQPA 5GMKl 3I7FA 2LTOA 1B70A 5GAMh 3V8LA 1JBMA 5KE3A 3WVEB 5FU6B 5GANf 3QPHA 3RIRA 2Y4XA 5DLQE 3R07A 1Q81C 5I21A 3MF1A 3PZCA 3MHXA 3TEEA 3JCMf 1BIAA 2ZIMA 2O4XB 4IUTA 3Q1JA 4C92C 1N27A 4HWSA 4J6YA 4TVYA 1XNIA 4J7FA 4C8QD 3JCMX 3G6EA 1JJCA 1SSFA 3OYHA 5LJ3j 2XI9A 5LJ3g 3BW1A 3QYHB 3EFSA 2F5KA 4C92G 3OSSC 4CS2A 3M54A 1Q81U 4YROA 2RI2A 2QDYB 4LD9K 4YDQA 1VQ5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY5 A;  1X01 A;  3JCM d;  2DU7 A;  2RHS B;  2DKG A;  2RM4 A;  3LSQ A;  3HXY A;  2CIM A;  4YRR A;  4C92 E;  3W3S A;  2ALY B;  4UP9 A;  4CS3 A;  2ZZE A;  5LJ5 e;  1SER A;  1KQ2 A;  3QO3 A;  3IG2 A;  1B34 B;  1MGQ A;  4BW9 A;  4M77 G;  4DPG A;  1X2H A;  2I2L A;  2CGH A;  3HSB A;  1B8A A;  4M7A E;  3IKM B;  4KR3 A;  5C51 B;  2YLB A;  5KNN A;  5GAN 6;  1LNX A;  3NEL A;  4M7D B;  1EIY B;  4NOY A;  1YCY A;  4EX5 A;  5LJ5 f;  1X56 A;  3QSU A;  4HA8 A;  1E24 A;  3HFV A;  4J15 A;  3A7U A;  4KR2 A;  1C0A A;  5ELO A;  3NEN A;  4M77 C;  2DJZ A;  3FB9 A;  3QO7 A;  4K87 A;  4RQF A;  2YHT A;  4G85 A;  5C52 B;  4H2U A;  4K86 A;  3RKY A;  5K1X A;  2I4L A;  3RAC A;  3RES A;  5C53 B;  1I4K 1;  2DZ9 A;  1H64 1;  4M77 A;  2ODR D;  1KMN A;  4M75 D;  5GAO n;  3P8T A;  4XTU A;  3FIF A;  4XTX A;  3HFZ B;  3VBB A;  2EAY A;  2DTH A;  1PYS A;  5HGQ A;  4M75 E;  5F5W A;  1KOG A;  3LSS A;  2E1H A;  1USY A;  1WNL A;  5GMK j;  4RMF A;  1Y96 B;  4J6X A;  4RDX A;  4HT9 A;  3JCM h;  4UPA A;  2E41 A;  1KMM A;  3SWN A;  5LJ5 h;  1E22 A;  5GAN e;  4M77 F;  1X54 A;  2DQ0 A;  2ZZG A;  5DY9 A;  1HC7 A;  4X5O A;  5K1P A;  1B70 B;  1X2G A;  2C7I A;  1NJ2 A;  2CJ9 A;  2DTO A;  1U1S A;  2RHQ A;  3ICA A;  1ASY A;  5GAM e;  1RIQ A;  3PGG A;  3JB9 H;  4N0A A;  3WQZ A;  1IL2 A;  4H02 A;  4EMK A;  3OD1 A;  3PCO B;  2ZT6 A;  5GAO l;  4M7D G;  4EMH A;  1H4Q A;  3BDU A;  2ARU A;  2ZR3 A;  2RA2 A;  2EWN A;  1E1O A;  2HNI A;  5GMK h;  5GAN h;  2QHV A;  1B7Y A;  3E9H A;  1G5I A;  3V8J A;  1B7Y B;  4M7D C;  4A54 A;  2IY5 B;  2FB7 A;  4TVA B;  2DQ3 A;  1L0W A;  4M7A D;  3UFG A;  4YYE A;  4M7D E;  1NYQ A;  3HY0 A;  4WI1 A;  3MF2 A;  1YB3 A;  1SET A;  4H2X B;  4P72 C;  3HXU A;  4C8Q E;  2Q7E A;  1WPY A;  3QHS A;  4PG3 A;  3UGQ A;  3HTZ A;  2ZR2 A;  4YRM A;  4P73 C;  3JCM Q;  2VXE A;  4XTW A;  3JB9 D;  2RHS A;  4TTV A;  4C8Q F;  1E1T A;  4M78 E;  3JCM J;  1BBW A;  1QE0 A;  2P5I A;  2Q7H A;  1U1T A;  3JCM e;  1BIB A;  4JUV A;  2K57 A;  4PJO C;  3DSQ A;  4EO4 A;  2I4N A;  4TVW A;  4XTV A;  4JLI A;  4M78 C;  5GAN j;  4MML A;  4YRE A;  4JRI A;  2DTI A;  4YRT A;  3RF1 A;  4F7U F;  2EJ9 A;  2ZGW A;  4M7A B;  4PNO A;  3P8Y A;  4M75 B;  3IKL A;  4YDQ A;  4X9C A;  4YRK A;  4XTY A;  4ZTZ B;  1WQW A;  3VQW A;  4PJO D;  1JRI A;  3RUX A;  1WLE A;  2QHS A;  2ZT8 A;  3MEY A;  5GAM f;  5LJ3 d;  1NJ8 A;  2QTX A;  1Z7M A;  5GAM g;  4YRF A;  4P71 C;  5GAN 2;  3BY7 A;  2CJB A;  2E64 A;  2ZIN A;  2DEQ A;  4CH6 A;  4M78 F;  4M78 B;  4HT8 A;  2Y90 A;  4HWR A;  3KFU A;  1WU7 A;  2C8M A;  4PJO B;  1N9S A;  2DU5 A;  1TH7 A;  4C92 B;  3M4P A;  3LC0 A;  1D3B B;  4M7D D;  3REX A;  4PJO E;  4P3O A;  11AS A;  3INZ A;  2FYK A;  1GGM A;  5GAO q;  1PYS B;  4UP8 A;  2RHQ B;  2VXF A;  2JN0 A;  4TQF A;  3JCM V;  3A32 A;  3JB9 I;  4P74 C;  4H2X A;  5LJ3 e;  4AH6 A;  4P74 A;  4WF2 A;  4RCC A;  1KQ1 A;  1N9W A;  1Y96 A;  4PJO G;  5LJ3 h;  4XU3 A;  4XU0 A;  4YRN A;  4CS4 A;  1LYL A;  4XEM A;  3TEH A;  4M78 G;  2VC8 A;  3HFZ A;  3M4Q A;  4X9D A;  3BJU A;  5GAO p;  1ADJ A;  2ART A;  3JCM b;  1FYF A;  4M78 D;  4C8Q B;  2ZT5 A;  1G5H A;  4NCX A;  1VQZ A;  3SB2 A;  4A53 A;  1H4S A;  4XU1 A;  1Z7N A;  4G84 A;  1QF6 A;  1LOJ A;  4M77 E;  5GAO r;  1H4V B;  3HY1 A;  2I4O A;  1SES A;  2EJG A;  2ODR C;  3HFO A;  4M7A G;  4P75 C;  5GMK i;  2I4M A;  4E51 A;  4L87 A;  2J3M A;  4C92 F;  2ZTG A;  2ZT7 A;  1NNH A;  1WQ7 A;  4M7A C;  4H2V A;  4M78 A;  3VQX A;  3FJP A;  3JCM P;  1H4T A;  4QVC A;  1HXD A;  1M5Q 1;  4YCW A;  4YRC A;  1YFT A;  4NL3 A;  3ERR A;  5E3I A;  3A5Y A;  1BBU A;  1I8F A;  1NJ5 A;  3TEG A;  4C8Q C;  4M75 C;  4NL2 A;  2Q5I A;  4CH3 A;  1I81 A;  2RB6 A;  3BFM A;  4QVD A;  5GMK e;  2ZIO A;  3JCM c;  3JCM g;  2P0L A;  2ZXF A;  3HRK A;  1B76 A;  2Q5H A;  4H2Y A;  4PJO F;  3A74 A;  3TEH B;  2AKW B;  3QNE A;  4XU2 A;  4M75 G;  4M7A A;  5GAM d;  3M4G A;  4M7A F;  1EFW A;  3HFN A;  4WJ3 M;  4TWA A;  1EQR A;  4EMG A;  3CMQ A;  3L4G B;  3G1Z A;  4J5Y A;  4XTZ A;  1EVL A;  2XTI A;  1LJO A;  4P75 A;  3VU3 C;  5GAN g;  4XEO A;  1EIY A;  5GMK m;  4C8Q A;  4OLF A;  4F7U G;  4F7U B;  5CAI A;  1EOV A;  3RER A;  1W66 A;  4Q6G A;  5LJ5 g;  4YRJ A;  2QHU A;  4C92 D;  4CH4 A;  4YRG A;  2J3L A;  4DQ2 A;  3HXX A;  4O2D A;  2E3C A;  2DXU A;  4C92 A;  3JB9 F;  2AMC B;  3JB9 G;  2ARS A;  1YFR A;  3VQV A;  2DZC A;  1NYR A;  4CH5 A;  5GAN d;  4YRS A;  3E9I A;  3IAL A;  1NJ1 A;  4RQE A;  5GAM j;  4PJO A;  1X55 A;  4Q15 A;  4F7U E;  5ELN A;  3QUI A;  5GAO m;  4M75 A;  3GIB A;  4MMK A;  3QTC A;  4M77 D;  2ZNJ A;  4K88 A;  4LNS A;  4Y91 A;  2PMF A;  4TQD A;  12AS A;  4JRK A;  3SWN C;  1B34 A;  1N9R A;  4EMK C;  1ATI A;  2ZCE A;  4P72 A;  4C8Q G;  3EFR A;  4EMK B;  1USY C;  2ALY A;  4UP7 A;  2CJA A;  2QHT A;  1EVK A;  1ASZ A;  2E10 A;  3NEM A;  3A7A A;  4OP0 A;  1NJ6 A;  2DDZ A;  1J5W A;  3VQY A;  2Q7G A;  2ZZF A;  4HWP A;  2YLC A;  1HK9 A;  5GMK l;  1YFS A;  5LJ3 f;  3I7F A;  3RL6 A;  1B70 A;  4ZIB A;  5GAM h;  2XGT A;  3V8L A;  3L2Z A;  3RKW A;  2E65 A;  5GAN 5;  1JBM A;  1M8V A;  4YP0 A;  4HWO A;  3V7S A;  4J6W A;  5GAN f;  3TUP A;  4KQE A;  4P71 A;  1G51 A;  3P8V A;  4N0A C;  3HXV A;  3RIR A;  5LJ5 j;  5GAN 4;  3A31 A;  4YRI A;  5GAN 3;  3NET A;  1JJC B;  2EL9 A;  3UGT A;  1D3B A;  1YGB A;  3R07 A;  3HXW A;  4M77 B;  4H2S A;  5I21 A;  3MF1 A;  4V2S A;  3PZC A;  4YRL A;  4YRQ A;  5GAN 8;  4YCV A;  4P3P A;  1ADY A;  3A5Z A;  3JCM f;  3JCM W;  1BIA A;  2ZIM A;  4YPF A;  3REU A;  4TVA A;  4WJ4 A;  4PHC A;  4C92 C;  1I5L A;  4HWS A;  4J6Y A;  4YCU A;  3UH0 A;  4XQ3 A;  4TVY A;  3HRI A;  3RGL A;  4H2T A;  4C8Q D;  5GAN 7;  4H2W A;  4ZTU B;  2RD1 A;  4HVC A;  3V8K A;  3JCM X;  2DXT A;  3L4G A;  3L1A A;  3PCO A;  1SRY A;  2ZNI A;  1JJC A;  4M7D F;  4M75 F;  3A7R A;  5LJ3 j;  2PME A;  4P73 A;  4F7U A;  2E5A A;  2AKW A;  4RCB A;  4BWA A;  2DVE A;  5LJ3 g;  3BW1 A;  3EFS A;  2G4C A;  3QO8 A;  4C92 G;  4HWT A;  5LJ5 d;  1WYD A;  2EJF A;  3V7R A;  4YRP A;  3AHU A;  3HXZ A;  4CS2 A;  4P3N A;  3QO5 A;  3RKX A;  1HTT A;  4YRO A;  4M7D A;  2AMC A;  3SWN B;  3V7C A;  3JB9 J; 
#chains in the Genus database with same CATH topology
 5HK0 A;  1IHV A;  1X01 A;  1BYM A;  2DU7 A;  3QDF A;  3LSQ A;  3EGU A;  2DMO A;  4YRR A;  3UT1 A;  3QII A;  5D6Y A;  1BCO A;  3CMA T;  2MI6 A;  2DF6 A;  2DPP B;  2PUO B;  4FW2 A;  3CPW S;  1FYN A;  4J9G A;  2CGH A;  1G5V A;  1B8A A;  4KR3 A;  2RHX A;  5KNN A;  4LVM A;  2QGG A;  2B8A A;  4LXC A;  1YCY A;  1D1B A;  4CC3 A;  4LVK A;  3PFS A;  4HA8 A;  3O5Z A;  1E24 A;  1OPK A;  3GP8 A;  3IQL A;  3A7U A;  3OB9 A;  4KR2 A;  1Q7Y R;  2QA4 Q;  2X4X A;  3FB9 A;  4K87 A;  1GBQ A;  1NJI C;  2DK3 A;  4LDX A;  3RKY A;  4AFS C;  2YT6 A;  3ASK A;  3CEY A;  2KMT A;  2WSF E;  5C53 B;  2DZ9 A;  1PWT A;  4OMN A;  1Q86 R;  2ODR D;  4M75 D;  1S72 Q;  3P8T A;  4ELY C;  5F5W A;  1M9S A;  1HYO A;  1H3Z A;  2HSP A;  4RMF A;  4RDX A;  1UE9 A;  2RO0 A;  3VRY A;  2KNB B;  4UPA A;  2EYX A;  1E22 A;  5KYN A;  2BE7 D;  4M77 F;  4XAX B;  1O9S A;  5K1P A;  2VGN A;  2A8E A;  2JM9 A;  1EIF A;  4ATO A;  2VKN A;  2CJ9 A;  4RTT A;  2GFU A;  1PM3 A;  5FW9 A;  4M4Z A;  1RIQ A;  2D8H A;  2YRC A;  1QVF S;  2W10 A;  1NG2 A;  5FU7 B;  3X26 B;  2FRY A;  5GAO l;  1MNE A;  2DD4 A;  1ARK A;  1NLP C;  1OU9 A;  3BDU A;  1AZE A;  2VV5 A;  1YIT T;  1OZ2 A;  1TU0 B;  1R8O B;  2MWO A;  2LQK A;  2QQS A;  3V8J A;  2FG0 A;  4M7D C;  1E6G A;  2EYW A;  3VKI A;  1PRM C;  4YYE A;  1U06 A;  2ECZ A;  9ATC B;  3H0H A;  2RHI A;  3M0T A;  1Z9Q A;  3A8G B;  4KH0 B;  4C8Q E;  5IHK A;  2XDD A;  1PC0 A;  3CME A;  1M3A A;  2COZ A;  3EG2 A;  1FX7 A;  3FC3 A;  3E19 A;  4ZN1 A;  1QCO A;  1BIB A;  3EGX B;  4L5G A;  2E5Q A;  4CI0 C;  1PHT A;  1I5O B;  4JJD A;  2QG9 B;  4RTX A;  4EO4 A;  4IUV A;  3CXC A;  4MML A;  4YRT A;  3MEU A;  4M7A B;  3LGL A;  4E6R A;  2BKD N;  4M75 B;  2CP0 A;  4GLK A;  4XTY A;  4ZTZ B;  3TSW A;  2QGF B;  1MND A;  4MZT A;  2VYT A;  1YI2 T;  4MZP A;  4C0D B;  5GAM f;  2RQU A;  2P0Q A;  2E6Z A;  2EGE A;  2CJB A;  2E64 A;  2HQX A;  3MP8 A;  5IAY A;  2ZIN A;  2DO3 A;  1WFW A;  4QKU A;  3NTI A;  2Y90 A;  4R55 A;  2RHZ A;  2HKQ B;  1VQK T;  2HBP A;  1GL5 A;  4PJO B;  3M4P A;  3RR6 A;  1YP5 A;  3LC0 A;  4E7H A;  4M7D D;  3VUB A;  1ZLM A;  3REX A;  1VQP T;  2DBM A;  4PFO A;  4PJO E;  2A3L A;  2DL5 A;  1VQ5 A;  1GGM A;  2QI2 A;  5GAO q;  3NGP A;  5HKC A;  3MP6 A;  1K8A U;  4TQF A;  2RHU A;  1G8X A;  4C5I A;  2OI3 A;  1AWW A;  2JOY A;  3M57 A;  4P74 C;  2HBW A;  4P74 A;  2LJ0 A;  3EG1 A;  4WF2 A;  2V8I A;  2D8J A;  1WHH A;  4PJO G;  5LL6 S;  5LJ3 h;  1OQK A;  3CQT A;  4ZNX A;  3CCU Q;  4YRN A;  4RTW A;  4CS4 A;  1VQ9 T;  1FMV A;  4XEM A;  3TEH A;  5KE2 A;  3HFZ A;  3QWY A;  3CCQ A;  5GAO p;  1ADJ A;  2ART A;  4C8Q B;  5KYU A;  2ZT5 A;  2JTF A;  3QZ9 B;  1G5H A;  1X2Q A;  3SB2 A;  4LDU A;  3OS2 A;  1OZ3 A;  1S1N A;  4M77 E;  5IXF A;  4RKU E;  1H4V B;  1N8R C;  1VQN Q;  1SES A;  3EFO A;  1YWP A;  4M7A G;  2LJ1 A;  4P75 C;  4B9X A;  2Y4Y A;  4L87 A;  1E7O A;  2J3M A;  1TOV A;  4CC7 A;  5FWB A;  1UHF A;  1K73 U;  1WHJ A;  4FU6 A;  4RMO A;  3FEO A;  3EHR A;  3JCM P;  1WIE A;  1M5Q 1;  5A0D A;  1OU8 A;  1KQS S;  3X20 B;  2DL4 A;  3NPF A;  3GOX A;  1BBU A;  1GCP A;  5A0G A;  4CH3 A;  2RB6 A;  5IH2 A;  4AG2 C;  1BI3 A;  2ZXF A;  1WYX A;  1VOM A;  2Q5H A;  3ME9 A;  3QNE A;  2DNU A;  2OTL Q;  3JSC A;  1PNJ A;  3M4G A;  5GAM d;  1EFW A;  3HFN A;  1JXM A;  4TWA A;  4EMG A;  2DAQ A;  2O31 A;  3CMQ A;  4QQD A;  3CC7 T;  3CCS A;  3G1Z A;  2H8H A;  2L2P A;  4LNP A;  1LJO A;  2XTI A;  3LH0 A;  2NUP A;  3VU3 C;  4DEY A;  1EIY A;  4VUB A;  3OMC A;  3ULR B;  2KR3 A;  3VJP A;  3I55 A;  1PD0 A;  2DJQ A;  1VQP Q;  2YXY A;  4B6M A;  3WXM B;  2OX7 A;  2MAM A;  2P0P A;  4PLL A;  5J3B A;  4O2D A;  1HJD A;  1C1A A;  2MMP A;  3LW5 E;  2AMC B;  2ARS A;  4J9E A;  3VV0 A;  3H41 A;  1NYR A;  2JUF A;  5GAN d;  2PVD B;  3IAL A;  1DJ7 B;  4PJO A;  3LWH A;  1X55 A;  2AZS A;  4Q15 A;  1I0C A;  1RLP C;  5ELN A;  5GAO m;  4KUI A;  2ZPH B;  4FYY B;  4M77 D;  2ZNJ A;  4Y91 A;  1VQO A;  2PMF A;  3RMS A;  4TQD A;  2DD5 A;  12AS A;  1VQ6 A;  1MV3 A;  1ZUU A;  3M0S A;  1VQ6 T;  3G1J A;  1QVG A;  4EMK C;  3I56 T;  2K5F A;  2QK0 A;  4Z8A A;  1FMW A;  4C8Q G;  3EFR A;  5KYU B;  1GCQ C;  1SKU B;  1RI0 A;  1S72 A;  1G3Y A;  1OEB A;  2NUT B;  2CJA A;  3CC4 T;  4OP0 A;  2EQK A;  3MKD A;  1YWO A;  2J6O A;  4HWP A;  1YFN A;  3UF4 A;  4PFP A;  2YLC A;  4FM4 B;  1HK9 A;  1PD1 A;  1YFS A;  2ZPB B;  3NHN A;  2J7I A;  5LJ3 f;  4OML A;  1ZBX A;  2FVU A;  3I9Q A;  2VVK A;  1VQ7 Q;  4LVI A;  2BE9 B;  4AT1 B;  2A36 A;  1QP2 A;  4B9W A;  4HWO A;  5CIU A;  2D6F A;  4YP0 A;  4N4H A;  4P71 A;  3HXV A;  5KYX A;  4YRI A;  2E5K A;  2XD0 A;  4QQ6 A;  1PSF A;  1K73 C;  4M77 B;  4Q5W A;  4HCC A;  3PVQ A;  2IVW A;  2QYZ A;  3L2V A;  4YRL A;  4YRQ A;  4LVL A;  4F04 B;  1X27 A;  1ADY A;  1N8R R;  1U8R A;  4TVA A;  5CVI A;  2ZCF B;  2COY A;  2H3J A;  3FDR A;  3MEV A;  3E9G A;  1I5L A;  2DIG A;  1YIT Q;  2X4W A;  1N8R U;  2XIC A;  1K4U S;  2HQH A;  1UDL A;  3HRI A;  4H2T A;  5GAN 7;  4ZTU B;  4FL6 A;  2RD1 A;  5I11 A;  3L4G A;  2CZ7 B;  4ZTF A;  2LQW A;  4IIM A;  2FZC B;  2GFA A;  2MK5 A;  2WSE E;  2EW3 A;  4P73 A;  3CME Q;  2AKW A;  1UGR B;  3NTH A;  1NM7 A;  2QXF A;  2NUT A;  3QO8 A;  4HWT A;  5LJ5 d;  1WYD A;  3CCL A;  4ZGE B;  3HXZ A;  4KGX B;  3HP9 A;  2C0I A;  3G6E Q;  3RKX A;  1JB0 E;  2JM8 A;  3PMT A;  2IY5 A;  1UFF A;  2DKG A;  3BE3 A;  3PMI A;  1SHG A;  2KT1 A;  3OY9 A;  3W3S A;  3A8O B;  4CS3 A;  5CKF A;  5FWC A;  3PNW C;  1GFC A;  2ABL A;  2KYB A;  4KRT A;  4LD6 A;  1CKA A;  3CCV T;  5L23 A;  1RI9 A;  3TU4 K;  2PVG B;  3SD4 A;  4HT4 A;  4IUR A;  1VQ4 T;  2AZV A;  3C0C A;  3ZBD A;  2FRW A;  2C0O A;  1X2H A;  4M7A E;  3OS5 A;  5C51 B;  1X6O A;  3NEL A;  1EIY B;  1AZG B;  1OX9 A;  2VAS A;  1X56 A;  2JNG A;  3HRU A;  2IG0 A;  3RNJ A;  1QVP A;  2FPF A;  2VGM A;  3UPU A;  3G4S Q;  1VQM A;  4J15 A;  2CP3 A;  1AHJ B;  1VQ5 Q;  1TXQ A;  5ELO A;  2LRQ A;  1V76 A;  1RAG B;  4RTY A;  1VIF A;  1WJR A;  5IXB A;  3WVD B;  5C52 B;  3VS7 A;  4K86 A;  1UGS B;  1N5Z A;  3QJ6 A;  1B3Q A;  2DYB A;  2RQV A;  3DKM A;  1I4K 1;  2AKL A;  4E47 A;  1H64 1;  4M77 A;  3SEM A;  4XTU A;  4XTX A;  4WTO B;  3VBB A;  2EAY A;  5HGQ A;  5FU7 C;  5KYX B;  3LSS A;  4J9H A;  3HTR A;  5GMK j;  2PUK B;  1TTH B;  1Y96 B;  4HT9 A;  1WJS A;  1KMM A;  3SWN A;  5GAN e;  1X54 A;  2DQ0 A;  1RAH B;  2JTE A;  2K5L A;  2JJ9 A;  3E1S A;  4JRP A;  2CH4 A;  1NJ2 A;  3CPW A;  4FYV B;  3CCM T;  1UGV A;  3ICA A;  1ASY A;  3VYH B;  4C0F A;  1VQN T;  1IL2 A;  1PCX A;  3EG9 A;  1SSH A;  4H02 A;  3OD1 A;  1D09 B;  3CXC S;  1TG0 A;  5L8R E;  1X6B A;  1YN8 A;  2L5Q A;  1WGS A;  1H4Q A;  3BDL A;  2PTK A;  2RI5 A;  2D1X A;  4OMQ A;  2ZR3 A;  2RA2 A;  2EWN A;  2HNI A;  1M30 A;  2DL8 A;  3U23 A;  2IY5 B;  3MQZ A;  3P8D A;  8ATC B;  2DQ3 A;  5FRN A;  4M7A D;  2Z0W A;  4LN2 A;  1NYQ A;  2CSQ A;  1YB3 A;  6AT1 B;  2ROL A;  2E3H A;  2V26 A;  2Q7E A;  3QHS A;  3CC4 A;  2JT4 A;  3QWX X;  4R0K A;  2AIR B;  1KC8 U;  2YUQ A;  5CKD A;  2ZPI B;  3JB9 D;  2COW A;  2KDS A;  4M78 E;  1BBW A;  3TSZ A;  1J3T A;  1T3L A;  2Q7H A;  2F2X A;  2GQV A;  2NUP B;  3L2Q A;  4PJO C;  2K6D A;  1RAI B;  2RF0 A;  3PIO A;  3QBY A;  4TVW A;  4XTV A;  2ROT A;  1NJI U;  2ED1 A;  1FXX A;  2LZ6 B;  5GAN j;  3C4S A;  2V8K A;  2OJ2 A;  2M0O A;  1K76 A;  4AMC A;  5AT1 B;  2EJ9 A;  1M90 C;  4PNO A;  1VYV A;  2SEM A;  4QVZ A;  1K9M C;  4YRK A;  3CCM A;  1WDX A;  1QKX A;  4GBQ A;  1WQW A;  1FMK A;  1T0H A;  3GF5 A;  4C0D C;  3VQW A;  1QLY A;  2LVM A;  3KBG A;  2J05 A;  1G3W A;  2K7A A;  4E7Z A;  1KFZ A;  2ZT8 A;  1VQO T;  1MV0 B;  5IHN A;  2FZG B;  1BBZ A;  1TS9 A;  1Z7M A;  2DEU A;  3CCE T;  1YHQ A;  2L8D A;  2DIQ A;  4PLI A;  2DEQ A;  4CH6 A;  2O4X A;  4M78 F;  4HT8 A;  2O9S A;  1QWF A;  2RK1 A;  4BDY A;  2MIO A;  4L59 A;  2L0A A;  3FRN A;  1BI0 A;  2G6F X;  1KD1 R;  1YNZ A;  4Z88 A;  3ZFJ A;  4LUD A;  2KRN A;  4RUG A;  3INZ A;  4II1 A;  2GBQ A;  2RHQ B;  2CZ1 B;  4H2X A;  1U5S A;  4AH6 A;  1VQ8 T;  5DM7 R;  3NTK A;  4CRI A;  1NPP A;  1Y96 A;  1KQS P;  2PNI A;  4FW1 A;  3M53 A;  2VC8 A;  2A0F B;  3M4Q A;  4X9D A;  5KYY B;  1UTI A;  2EQM A;  4UC4 A;  4OMM A;  3JCM b;  1FYF A;  4M78 D;  1Y07 A;  3EG3 A;  2QA4 A;  2CYZ B;  4LDY A;  5CKB A;  4D8K A;  1VQZ A;  2RJE A;  2CS7 A;  1H4S A;  4E7K A;  2LNV A;  1UGP B;  2NUZ A;  1VA7 A;  5GAO r;  8AT1 B;  4JJN K;  1K0S A;  2BIV A;  3HFO A;  3CCE Q;  2KY9 A;  5DLO A;  1D1C A;  3L2R A;  1NNH A;  1H8K A;  1HSQ A;  2HL5 C;  3VUZ A;  2RQW A;  3EFO B;  4H2V A;  4M78 A;  4IUU A;  3VQX A;  3FJP A;  2GTJ A;  2MOX A;  3CCR T;  1AWX A;  1YFT A;  2YSQ A;  4KUD K;  4ELZ C;  2RJF A;  5E3I A;  3A5Y A;  1YJN A;  3A5Z B;  1NJ5 A;  1NPR A;  1M3B A;  1TUD A;  4M75 C;  2QQA A;  2C0T A;  1VQK Q;  5GMK e;  2ZIO A;  2PVO B;  2LX9 A;  3JCM c;  4J7I A;  3JCM g;  5KYW A;  1AEY A;  3G71 A;  1YIJ T;  3HRK A;  3LYI A;  4H2Y A;  3TEH B;  3CCV A;  2AKW B;  2M16 A;  2QA4 T;  3GBQ A;  1Y57 A;  4M7A F;  4WJ3 M;  3G7Z A;  1EQR A;  2EGC A;  3I5R A;  1X2K A;  5J26 A;  3UDC A;  2X4Y A;  4XTZ A;  1UHC A;  1M8M A;  2A08 A;  2YDL A;  2DL3 A;  3MCA B;  2FEI A;  4XEO A;  3O8V A;  2DYI A;  4C8Q A;  1Q7Y U;  1KG1 A;  5A0L A;  5GJV B;  2OTL T;  4F7U G;  4F7U B;  5CAI A;  3UA7 A;  4FYX B;  1EOV A;  1W66 A;  5LJ5 g;  4YRJ A;  5IN1 A;  1QVF P;  2EQU A;  3OBW A;  2J3L A;  4DQ2 A;  4DOW A;  3CME T;  2E3C A;  3JB9 F;  4HVU A;  4AG1 C;  2CZ6 B;  3R6N A;  1QCN A;  3H6Z A;  2CH4 W;  2F2W A;  4RQE A;  5GAM j;  2O88 A;  1ZUK A;  5CCA A;  3DLL A;  1UJ0 A;  4MMK A;  4LNS A;  3M0R A;  1K1Z A;  1TWB A;  1X75 C;  2DVJ A;  1IRE B;  3S3O A;  1UEC A;  2YUO A;  2HKN A;  2JVV A;  3MEA A;  1RUW A;  1WJQ A;  2ALY A;  3CBO A;  1Y71 A;  4A63 B;  2RHY A;  1EZZ B;  4O6J A;  1JJ2 A;  1ZQ1 A;  1W6X A;  3MP1 A;  1NJ6 A;  2EFI A;  1ABQ A;  2R57 A;  2NS6 A;  3OYN A;  1YHQ T;  3NFC A;  4FYW B;  1YJW Q;  3CCU T;  1JO8 A;  2XGT A;  4PJN A;  3L2Z A;  3THK A;  1ZSZ C;  2E65 A;  5GAN 5;  4ME7 A;  3OYK A;  2V1Q A;  1IO6 A;  2SRC A;  1NYF A;  5FLX E;  3DB4 A;  3TUP A;  4MZM A;  2CP7 A;  1ABO A;  3QZ5 B;  2QAZ A;  3TCJ A;  2V8J A;  3NET A;  3X24 B;  1JJC B;  2EL9 A;  3UGT A;  4JS4 A;  3PTA A;  2QEX T;  3VS5 A;  1YGB A;  1D0Z A;  3HXW A;  2JS2 A;  1YCS B;  4V2S A;  2CP2 A;  5GAN 8;  4P3P A;  3M56 A;  5GJW B;  3H0I A;  3A5Z A;  4IUP A;  3JCM W;  5FRM A;  4DOV A;  3G4S T;  4YPF A;  4KT0 E;  2RMO A;  2OAW A;  3G71 Q;  4YCU A;  3PT9 A;  4OMF B;  2WSC E;  4LDW A;  2EQJ A;  4D6W A;  3OYG A;  1EX4 A;  3KFV A;  4H2W A;  4OB1 B;  2DXT A;  4X34 A;  3L1A A;  3PCO A;  1SRY A;  3DB3 A;  2VB6 A;  2CDT A;  2ZNI A;  4TVR A;  3A7R A;  5D7U A;  2PME A;  3X28 B;  1KD1 U;  1B7T A;  1WZO A;  3H0F A;  3NMZ C;  2E5A A;  1VQN A;  4BWA A;  5M9O A;  1RL2 A;  5C6S A;  2EJF A;  2AKK A;  3AHU A;  4YRP A;  4P3N A;  3QO5 A;  1Q82 R;  2AMC A;  3VS2 A;  3SWN B;  4JZ3 A;  1AWO A;  3CMA A;  4OB0 B;  3HRS A;  3V7C A;  1BU1 A;  3HPW A;  5CKE A;  3JCM d;  2RJD A;  4ZN3 A;  1RAC B;  2RQR A;  2RM4 A;  2CIM A;  2BTT A;  1BB9 A;  4C92 E;  3CC2 T;  4PL6 A;  2ALY B;  3CCL Q;  3VS4 A;  1ZX6 A;  3CPW P;  1R77 A;  2ZZE A;  2ZZD A;  1QVG S;  3OW2 S;  3QO3 A;  1SG5 A;  1XQH A;  3PIP A;  1ZUY A;  1MGQ A;  4BW9 A;  4M77 G;  1GFD A;  1BI1 A;  5CQY A;  4DPG A;  1NLO C;  1Q82 C;  1YHQ Q;  2I2L A;  3HSB A;  3J81 E;  2A7Y A;  1GBR A;  2YLB A;  1LNX A;  4M7D B;  1NBE B;  4NOY A;  3TVT A;  4EX5 A;  2DET A;  1V29 B;  4L6V 5;  5D6X A;  1K9M R;  3A8M B;  4BE2 A;  1GXI E;  4JJB A;  3N5B B;  3CC7 A;  3QSU A;  4OVA A;  3CBP A;  3QKJ A;  2A28 A;  1UB4 A;  1KC8 R;  1UGQ B;  4ZTJ A;  2D0Q B;  3H8Z A;  4M77 C;  1ZSZ B;  2DJZ A;  1VQ5 T;  2YHT A;  1AWJ A;  2RK2 A;  4H2U A;  5K1X A;  2CP5 A;  4BDZ A;  2P4R A;  3RAC A;  5HY6 A;  3RES A;  3CCQ T;  2K2M A;  1PKT A;  2XKO C;  4KUL A;  2HZY A;  1QP3 A;  3S3N A;  2ZAE A;  1VQK A;  1MMG A;  1N6A A;  4RG8 A;  1EFN A;  1VQM Q;  2KRM A;  3HFZ B;  1M27 C;  2DTH A;  4P5N A;  2E1H A;  1USY A;  3E9F A;  4LE9 A;  1M1K C;  3JCM h;  5HK3 A;  2E41 A;  3X25 B;  5LJ5 h;  2OTJ A;  5DY9 A;  4X5O A;  5D6W A;  1B70 B;  4D8D A;  1IHW A;  1X2G A;  3CC4 Q;  1BK2 A;  1D0Y A;  2DXC A;  3MET A;  3MEW A;  4AFZ C;  4BI8 B;  1M4Z A;  5GAM e;  3PGG A;  2ZPF B;  3VS0 A;  2KK4 A;  4DBF A;  2FZK B;  5CO7 A;  2XDP A;  2LMJ A;  3VYG A;  2LT4 A;  2L3S A;  4IIO A;  1AT1 B;  1M2V A;  3TRE A;  2ARU A;  1WHL A;  1K8A R;  1AOJ A;  4OB3 B;  4E7J A;  3A8H B;  4O5V A;  2QHV A;  4A4F A;  2J06 A;  1B7Y B;  1WX6 A;  4A54 A;  3G71 T;  3RDV A;  1R0C B;  4TVA B;  1L0W A;  3UFG A;  1YJN Q;  2CRE A;  3G6E T;  4CC2 A;  3HY0 A;  1M3C A;  3EGX A;  4WI1 A;  3MF2 A;  1SET A;  1TUG B;  4H2X B;  1YI2 Q;  3SFM A;  1JJ2 P;  4HXJ A;  4P73 C;  1RAF B;  2LT1 A;  2VXE A;  2RHS A;  3EAE A;  2EGA A;  4C8Q F;  1E1T A;  2F5T X;  1QE0 A;  2P5I A;  2O2O A;  1OYX A;  3C95 A;  1U1T A;  5CQX A;  2QEX Q;  3M9Q A;  2M1H A;  2E12 A;  1IXD A;  3VRZ A;  2YUN A;  4JLI A;  2CP6 A;  3RMQ A;  4JRI A;  2DTI A;  2JZ2 A;  3RF1 A;  1B07 A;  2ZGW A;  3P8Y A;  3ZL7 C;  3CCJ A;  4BE0 A;  4X9C A;  1WLP B;  1KHC A;  4FSX A;  1UEB A;  3CD6 T;  5HCK A;  4PJO D;  3QG1 A;  3RUX A;  1ZA2 B;  3F70 A;  3MEY A;  2C06 A;  2RI3 A;  1IRX A;  4A4K A;  5LJ3 d;  1NJ8 A;  2QTX A;  4C0Z A;  1PSE A;  3A1P A;  3KUF A;  4P71 C;  4YRF A;  3BY7 A;  2JMA A;  3CCM Q;  1M1K R;  4M78 B;  2GTO A;  2BZY A;  4KH1 B;  3KFU A;  3URG A;  1N9S A;  4C92 B;  3CCS T;  1YJ9 T;  2MCN A;  3I35 A;  1D3B B;  2EBP A;  2EKH A;  1Y0M A;  5EG2 A;  3E2U A;  2FYK A;  4X1V A;  1GCQ A;  2AHJ B;  3SDZ A;  3JCM V;  3A8L B;  3JB9 I;  4NS5 A;  1BCM A;  2HEQ A;  2R5M A;  3VS6 A;  3S6W A;  4RCC A;  1KQ1 A;  1Z9Z A;  2KXC A;  1JQQ A;  4XU3 A;  3CD6 A;  4XU0 A;  2R58 A;  1LYL A;  1S72 T;  3EG0 A;  4M78 G;  2KRO A;  1VYU A;  3BJU A;  2YWW A;  3G4S A;  3L2W A;  1AD5 A;  1RLQ C;  2EPD A;  3I56 A;  2LDM A;  4NCX A;  1V1C A;  2XID A;  4OMO A;  4A53 A;  5FU6 C;  1VQ4 Q;  1Z7N A;  4G84 A;  1LOJ A;  1U3O A;  2EYQ A;  2NYS A;  1ZSZ A;  2HCK A;  1W2B A;  2M9U A;  3GLX A;  5IHI A;  4BB7 A;  3CCV Q;  3HY1 A;  4J9I A;  3D7S B;  4QW2 A;  5FRO A;  2ODR C;  3FLG A;  2RNA A;  1RAB B;  5KYW B;  1Q86 U;  5GMK i;  1SRL A;  3OYL A;  2B86 A;  4C5E A;  2GQI A;  2XU8 A;  4EDU A;  1QVF A;  1H92 A;  1KSW A;  4A4H A;  3OYF A;  4C92 F;  2ZT7 A;  5I2S A;  3CC7 Q;  1SF9 A;  2XG8 D;  2KRS A;  2CT3 A;  2A37 A;  2PU9 B;  1H4T A;  2IIM A;  1UUE A;  1OI1 A;  4YCW A;  2VWF A;  2K79 A;  2KT8 A;  4YRC A;  2E70 A;  4BAC A;  2LCL A;  2AK5 A;  2RN8 A;  3ERR A;  4HKE A;  3TEG A;  2E4H A;  1I81 A;  2GF7 A;  3BFM A;  2JW4 A;  4QVD A;  3CMA Q;  1B76 A;  4PJO F;  3A74 A;  2EVR A;  4M75 G;  2GNC A;  4J9D A;  1IZ6 A;  3I55 Q;  1M2O A;  2O01 E;  1R0B G;  1VQL T;  2E3I A;  3OYY A;  4P75 A;  2QQR A;  4DA4 A;  1VQM T;  2OTJ T;  5GMK m;  3P8B B;  2KQW A;  1TSF A;  2XMF A;  3M0Q A;  4Z02 A;  3RER A;  2QHU A;  2P84 A;  2OTL A;  4CH4 A;  4KGZ B;  1C0M A;  4YRG A;  2DRK A;  2P4T A;  4JJC A;  3HXX A;  4FCY A;  2JMC A;  3CCS Q;  4PKC C;  1YFR A;  2LJ3 A;  3EGD B;  4OGE A;  4YRS A;  3E9I A;  1VQ8 Q;  2L89 A;  1QW1 A;  3OW2 P;  1VIE A;  5CR2 A;  3QYG B;  4M75 A;  2XHC A;  3QTC A;  4KBM B;  4JRK A;  5KH6 A;  2HAX A;  3CCR A;  1B34 A;  2BUD A;  4J9F A;  1N9R A;  7AT1 B;  3OYD A;  2ZCE A;  3A98 A;  2K3X A;  2X9H A;  3EH2 A;  4P72 A;  5AYF A;  4EMK B;  1USY C;  1VQ4 A;  2DIL A;  5ECA A;  1ZHI A;  1H3H A;  4RTU A;  1ZA1 B;  1EVK A;  2GGR A;  2KGT A;  1J5W A;  1VQO Q;  1CKB A;  1K73 R;  3VQY A;  2Q7G A;  5CK9 A;  3LGF A;  1VQ6 Q;  3CCL T;  2AT1 B;  2DE0 X;  4E2F B;  2BZ8 A;  2LQ8 A;  3GNF B;  3RL6 A;  4DEX A;  2QQB A;  3OYI A;  4ZIB A;  3RKW A;  4AFU C;  4EIK A;  1M8V A;  2PZ1 A;  2KSS A;  1IGQ A;  4MDW A;  3V7S A;  4J6W A;  5KCO A;  3OYC A;  1MHN A;  4KQE A;  2QAS A;  1G51 A;  3P8V A;  4N0A C;  4J8O A;  1OPL A;  5LJ5 j;  5GAN 4;  3A31 A;  1YIT A;  5GAN 3;  2CKK A;  2DM1 A;  1D3B A;  2HDA A;  2K5I A;  2KVQ G;  4H2S A;  4OF1 A;  2DFU A;  4YCV A;  3MPU B;  2PQW A;  4E7S A;  1Q86 C;  1RAE B;  3REU A;  1KJW A;  1FWZ A;  4WJ4 A;  4LVJ A;  4C0G A;  2RH2 A;  4ZGD B;  4PHC A;  1QVG P;  1XOV A;  1SRM A;  3UH0 A;  3M59 A;  4XQ3 A;  4JLG A;  2M0Y A;  2DER A;  3RGL A;  3T9N A;  1KK7 A;  1UJY A;  1WXT A;  4Y28 E;  3CC2 A;  4HVC A;  3V8K A;  2KBT A;  2QDL A;  1WA7 A;  3DLM A;  4M7D F;  4M75 F;  1NZ9 A;  2NLU A;  2XDB A;  4ESR A;  4F7U A;  1KHI A;  1IGU A;  5A2Q E;  4PJJ A;  4RCB A;  2DVE A;  3PVL A;  1MMD A;  2DBK A;  4C5H A;  1WXB A;  3M4Y A;  2G4C A;  1X69 A;  2KXD A;  1PRL C;  2E6N A;  3UAT A;  3OYB A;  2VUB A;  2CUB A;  3V7R A;  5I22 A;  4K11 A;  2EYY A;  1VYT A;  1HTT A;  4HVV A;  4M7D A;  3OA6 A;  1QWE A;  4JUV A;  3S3M A;  3JB9 J;  4PK4 A;  3C94 A;  4QQG A;  2RHS B;  4PFZ A;  3HXY A;  3P8H A;  4LUE A;  1SHF A;  3LX7 A;  2D9T A;  2W0Z A;  4GLM A;  4UP9 A;  5LJ5 e;  1SER A;  1KQ2 A;  1VQ7 A;  1A0N B;  5I2M A;  1Q82 U;  2DXB A;  3IG2 A;  1B34 B;  2LP5 A;  3M0P A;  2KI7 A;  4DBR A;  4ZGJ B;  3OS0 A;  3OYM A;  3GNG A;  3R6O A;  1XTD A;  1MMA A;  1PKS A;  2HL3 A;  3REB B;  3IKM B;  3C12 A;  3OYJ A;  1VQ7 T;  5GAN 6;  4YTL A;  3OMG A;  1WHM A;  2K2V A;  5KCH A;  2X3W D;  2OTJ Q;  5LJ5 f;  2XK0 A;  3CCU A;  1GRI A;  2KYM A;  3LWI A;  2GCX A;  2K4Y A;  1YJ9 A;  3HFV A;  1CSK A;  3TQ7 P;  1G83 A;  4BE1 A;  1C0A A;  4FIB A;  3NEN A;  3L2U A;  3JAM E;  3QO7 A;  4RQF A;  2LCC A;  4G85 A;  2I4L A;  3CPF A;  3SHW A;  4BI3 A;  1KD1 C;  4E7I A;  1KMN A;  5GAO n;  3CXC P;  3FIF A;  1MMN A;  1PYS A;  4M75 E;  1KOG A;  5EC7 A;  1W4S A;  1WNL A;  2EQI A;  2EYZ A;  2CZ0 B;  2ATC B;  2QTV A;  4J6X A;  4OGC A;  2CT4 A;  1JJ2 S;  1M1G A;  3ZEH A;  3FJ5 A;  2ZZG A;  2ZPG B;  1HC7 A;  2BZX A;  3MJX A;  2C7I A;  4N4G A;  5J39 A;  5IT9 E;  2DTO A;  2KAF A;  2L3R A;  1U1S A;  1BI2 A;  2HSE B;  2RHQ A;  4J9B A;  4QT7 A;  1RAA B;  3JB9 H;  4N0A A;  3WQZ A;  2J6K A;  1KIK A;  4EMK A;  2DLP A;  3PCO B;  2ZT6 A;  2JS0 A;  1OX8 A;  4M7D G;  4EMH A;  3GPL A;  1LVK A;  1QQJ A;  3QJY A;  1E1O A;  5GMK h;  5GAN h;  4JZ4 A;  3CCJ Q;  1B7Y A;  3E9H A;  1G5I A;  3UA6 A;  1W1F A;  3M55 A;  1QKW A;  2YUP A;  2DL7 A;  2FB7 A;  3OS1 A;  4HCZ A;  4FSS A;  4JDS A;  4M7D E;  4P72 C;  2K9G A;  3HXU A;  3KXT A;  1WPY A;  1M1K U;  4PG3 A;  3UGQ A;  3HTZ A;  2ZR2 A;  1I07 A;  4YRM A;  1JU5 C;  2MF2 A;  3PE0 A;  3JCM Q;  5C0M A;  4XTW A;  2F2V A;  4XK8 E;  4E7L A;  4TTV A;  1I1J A;  3JCM J;  2R5A A;  3JCM e;  2I0N A;  3MO8 A;  2K57 A;  1WI7 A;  3DSQ A;  2F69 A;  1VQ9 A;  1YI2 A;  2I4N A;  4OB2 B;  1SEM A;  4M78 C;  4YRE A;  4F7U F;  1WXU A;  3QXE B;  3IKL A;  1T3S A;  2CSI A;  4AFQ C;  2X51 A;  1MUZ A;  2FL7 A;  1JRI A;  2FHD A;  1PG5 B;  1X43 A;  2HQE A;  4EPC A;  4Z89 A;  1WLE A;  2MYS A;  2QHS A;  5CKH A;  3CD6 Q;  1VQ8 A;  4A4E A;  4A4G A;  5GAM g;  1K8A C;  2WAC A;  4OMP A;  1Q95 G;  2KE9 A;  4BY6 C;  5GAN 2;  1Y7X A;  2YRD A;  3L42 A;  4F14 A;  1Q81 R;  3I56 Q;  4RTZ A;  2M02 A;  4ANJ A;  2X3X D;  4HWR A;  3REA B;  3EGD A;  1BKB A;  1WU7 A;  2C8M A;  1VQL A;  4CC4 B;  2DU5 A;  1TH7 A;  2MWP A;  4F17 A;  1SPK A;  3CC2 Q;  2F1L A;  4P3O A;  11AS A;  1T0J A;  4JRQ A;  1PYS B;  4UP8 A;  2VXF A;  2JN0 A;  3A32 A;  2ZPE B;  1OV3 A;  4FT4 A;  3HL8 A;  1M90 R;  3HHT B;  5LJ3 e;  1VUB A;  4IKF A;  4WCI A;  2O9V A;  1NEG A;  1N9W A;  1RAD B;  3M58 A;  1JXO A;  1ACM B;  1YIJ Q;  2QQ9 A;  4C5G A;  3M0U A;  3CCE A;  1OOT A;  2X35 A;  1G3S A;  1M2V B;  2K3B A;  1QF6 A;  2FPE A;  4XU1 A;  2JTM A;  2OAU A;  1G3T A;  4IUQ A;  3OW2 A;  4BY6 B;  2HD0 A;  2EKO A;  5KYY A;  2I4O A;  3ER0 A;  1QMC A;  2KEA A;  4JS5 A;  2M51 A;  1NJI R;  2EJG A;  3HKS A;  2L3Q A;  2LC4 A;  3OYE A;  2I4M A;  4E51 A;  2P0K A;  4J83 A;  2ZTG A;  1P92 A;  1WQ7 A;  2EIF A;  1YJW T;  4M7A C;  2NWM A;  1YJ9 Q;  3H9N A;  1NYG A;  4QVC A;  1HXD A;  4PJL A;  2LQN A;  3CCQ Q;  4NL3 A;  3QDR B;  3CBM A;  3EH1 A;  3AT1 B;  3J7A F;  3LLR A;  1I8F A;  2RJC A;  2X4J A;  4C8Q C;  4LDV A;  2ESW A;  4NL2 A;  2Q5I A;  1E6H A;  1YJW A;  2DA9 A;  2J6F A;  1LCK A;  1D1A A;  2P0L A;  3OYA A;  2CUD A;  4XU2 A;  1NE8 A;  1M1F A;  1W2B S;  1YBY A;  4M7A A;  1WHK A;  4HCB A;  3L4G B;  4J5Y A;  1EVL A;  3OQ5 A;  1VQL Q;  1K9A A;  5GAN g;  2ENM A;  2RQT A;  4OLF A;  4HCK A;  3I55 T;  4GY5 A;  4Q6G A;  4C92 D;  2IPO B;  1O75 A;  1NEB A;  4BI4 A;  3OBY A;  4KGV B;  2DXU A;  4C92 A;  1K9M U;  3JB9 G;  2FPD A;  4PJM A;  3VQV A;  2DZC A;  4CH5 A;  1M90 U;  1KQS A;  4N4I A;  2QEX A;  4MDX A;  1NJ1 A;  3CCJ T;  1W2B P;  3UWN A;  4F7U E;  1C6V X;  2JXB A;  3QUI A;  1IB8 A;  3GIB A;  1ZSG A;  4K88 A;  2YRV A;  4BUG A;  3HRT A;  4FT2 A;  1YIJ A;  2RPN A;  1Q7Y C;  1TUC A;  3SWN C;  4DBQ A;  1ATI A;  4R56 A;  4BD3 A;  2D0N A;  3OSV A;  1KC8 C;  1YJN T;  1G2B A;  4UP7 A;  1W70 A;  4RG2 A;  2QHT A;  1ZBJ A;  1HD3 A;  2G3R A;  1ASZ A;  3M5A A;  2MPX C;  2DX1 A;  2E10 A;  3J80 E;  3A7A A;  3NEM A;  1XJW B;  2DDZ A;  2ZZF A;  2FO0 A;  3JRZ A;  1F1B B;  2K3Y A;  1VQP A;  3CCR Q;  2L3P A;  5GMK l;  3I7F A;  2LTO A;  1B70 A;  2HMA A;  5GAM h;  1LPL A;  3V8L A;  1JBM A;  1AVZ C;  3EG9 B;  3VS1 A;  5FU6 B;  3WVE B;  4F16 A;  5KE3 A;  1OUL A;  5GAN f;  2DRM A;  3QPH A;  3RIR A;  2Y4X A;  4HVW A;  2LCS A;  5DLQ E;  3R07 A;  4JPB W;  1JEG A;  1Q81 C;  5I21 A;  3RBB B;  3MF1 A;  3PZC A;  3MHX A;  1UG1 A;  3TEE A;  3JCM f;  1BIA A;  2ZIM A;  2O4X B;  3VS3 A;  3JV3 A;  4DBH A;  4IUT A;  1D0X A;  4J9C A;  3Q1J A;  4ORZ A;  1N27 A;  4C92 C;  4HWS A;  4J6Y A;  1K0X A;  2LX7 A;  4TVY A;  1XNI A;  4J7F A;  4C8Q D;  1X6G A;  3JCM X;  3G6E A;  1JJC A;  1SSF A;  4RTV A;  3OYH A;  5LJ3 j;  3LH5 A;  3I5S A;  1QCF A;  2H3E B;  4Y92 A;  2XI9 A;  2V1R A;  5LJ3 g;  3BW1 A;  3QYH B;  3EFS A;  2F5K A;  4C92 G;  2ED0 A;  3EHQ A;  3OSS C;  1WHG A;  4CS2 A;  3M54 A;  1Q81 U;  4YRO A;  1VQ9 Q;  2RI2 A;  2QDY B;  4LD9 K;  4YDQ A;  2LNH B; 
#chains in the Genus database with same CATH homology
 5HK0 A;  1X01 A;  1BYM A;  2DU7 A;  3LSQ A;  4YRR A;  3UT1 A;  3QII A;  5D6Y A;  3CMA T;  2MI6 A;  2PUO B;  2DPP B;  3CPW S;  2CGH A;  1G5V A;  1B8A A;  4KR3 A;  2RHX A;  5KNN A;  4LVM A;  2B8A A;  1YCY A;  4LVK A;  3PFS A;  4HA8 A;  1E24 A;  3GP8 A;  3A7U A;  3OB9 A;  4KR2 A;  2X4X A;  3FB9 A;  4K87 A;  4LDX A;  1NJI C;  2DK3 A;  3RKY A;  3ASK A;  3CEY A;  2KMT A;  2WSF E;  5C53 B;  2DZ9 A;  2ODR D;  4M75 D;  3P8T A;  4ELY C;  5F5W A;  1M9S A;  1H3Z A;  4RMF A;  4RDX A;  2RO0 A;  4UPA A;  1E22 A;  4M77 F;  4XAX B;  1O9S A;  5K1P A;  2VGN A;  2A8E A;  1EIF A;  4ATO A;  2CJ9 A;  2GFU A;  1RIQ A;  1QVF S;  5FU7 B;  3X26 B;  5GAO l;  2DD4 A;  3BDU A;  2VV5 A;  1YIT T;  1OZ2 A;  1R8O B;  2MWO A;  2LQK A;  2QQS A;  3V8J A;  4M7D C;  3VKI A;  4YYE A;  2RHI A;  3A8G B;  4C8Q E;  2XDD A;  3CME A;  1FX7 A;  3FC3 A;  3E19 A;  4ZN1 A;  1BIB A;  4L5G A;  2E5Q A;  4CI0 C;  4EO4 A;  4IUV A;  3CXC A;  4MML A;  4YRT A;  3MEU A;  4M7A B;  3LGL A;  2BKD N;  4M75 B;  4GLK A;  4XTY A;  4ZTZ B;  4MZT A;  2VYT A;  1YI2 T;  4MZP A;  4C0D B;  5GAM f;  2P0Q A;  2E6Z A;  2CJB A;  2E64 A;  2HQX A;  3MP8 A;  5IAY A;  2ZIN A;  2DO3 A;  3NTI A;  2Y90 A;  4R55 A;  2RHZ A;  1VQK T;  2HBP A;  4PJO B;  3M4P A;  3LC0 A;  4E7H A;  4M7D D;  3VUB A;  3REX A;  1VQP T;  4PJO E;  2A3L A;  1GGM A;  1VQ5 A;  2QI2 A;  5GAO q;  5HKC A;  3MP6 A;  1K8A U;  4TQF A;  2RHU A;  4C5I A;  4P74 C;  2JOY A;  3M57 A;  4P74 A;  4WF2 A;  2V8I A;  4PJO G;  5LL6 S;  5LJ3 h;  4YRN A;  4CS4 A;  1VQ9 T;  4XEM A;  3TEH A;  5KE2 A;  3HFZ A;  3CCQ A;  5GAO p;  1ADJ A;  2ART A;  4C8Q B;  2ZT5 A;  2JTF A;  3QZ9 B;  1G5H A;  3SB2 A;  4LDU A;  3OS2 A;  1OZ3 A;  4M77 E;  4RKU E;  1H4V B;  1N8R C;  1SES A;  4M7A G;  4P75 C;  4B9X A;  2Y4Y A;  4L87 A;  2J3M A;  1K73 U;  4FU6 A;  4RMO A;  3FEO A;  3JCM P;  1M5Q 1;  5A0D A;  1KQS S;  3X20 B;  3GOX A;  1BBU A;  5A0G A;  4CH3 A;  2RB6 A;  1BI3 A;  2ZXF A;  2Q5H A;  3ME9 A;  3QNE A;  3JSC A;  5GAM d;  3M4G A;  1EFW A;  3HFN A;  4TWA A;  4EMG A;  2DAQ A;  3CMQ A;  4QQD A;  3CC7 T;  3CCS A;  3G1Z A;  2XTI A;  1LJO A;  3LH0 A;  3VU3 C;  1EIY A;  4VUB A;  3OMC A;  3VJP A;  3I55 A;  3WXM B;  2MAM A;  2P0P A;  4PLL A;  5J3B A;  4O2D A;  3LW5 E;  2MMP A;  2AMC B;  2ARS A;  3VV0 A;  1NYR A;  2JUF A;  5GAN d;  2PVD B;  3IAL A;  1DJ7 B;  4PJO A;  3LWH A;  1X55 A;  4Q15 A;  5ELN A;  5GAO m;  4KUI A;  2ZPH B;  4M77 D;  2ZNJ A;  4Y91 A;  1VQO A;  2PMF A;  3RMS A;  4TQD A;  2DD5 A;  12AS A;  1VQ6 A;  1VQ6 T;  1QVG A;  4EMK C;  3I56 T;  2K5F A;  4C8Q G;  3EFR A;  1RI0 A;  1S72 A;  1G3Y A;  2CJA A;  3CC4 T;  4OP0 A;  2EQK A;  4HWP A;  2YLC A;  4FM4 B;  1HK9 A;  1YFS A;  2ZPB B;  5LJ3 f;  1ZBX A;  2FVU A;  4LVI A;  1QP2 A;  4B9W A;  4HWO A;  5CIU A;  2D6F A;  4YP0 A;  4N4H A;  4P71 A;  3HXV A;  4YRI A;  2XD0 A;  4QQ6 A;  1PSF A;  1K73 C;  4M77 B;  4Q5W A;  4HCC A;  2IVW A;  3L2V A;  4YRL A;  4YRQ A;  4LVL A;  1ADY A;  1U8R A;  4TVA A;  2ZCF B;  5CVI A;  2H3J A;  3FDR A;  3MEV A;  3E9G A;  1I5L A;  2DIG A;  2X4W A;  1N8R U;  2XIC A;  3HRI A;  4H2T A;  5GAN 7;  4ZTU B;  4FL6 A;  2RD1 A;  3L4G A;  2CZ7 B;  4ZTF A;  2GFA A;  2WSE E;  4P73 A;  2AKW A;  1UGR B;  3NTH A;  2QXF A;  3QO8 A;  4HWT A;  5LJ5 d;  1WYD A;  3CCL A;  4ZGE B;  3HXZ A;  3HP9 A;  3RKX A;  1JB0 E;  3PMT A;  2IY5 A;  2DKG A;  3PMI A;  3OY9 A;  3W3S A;  3A8O B;  4CS3 A;  5CKF A;  3PNW C;  4LD6 A;  3CCV T;  3TU4 K;  2PVG B;  3SD4 A;  4HT4 A;  4IUR A;  1VQ4 T;  3ZBD A;  1X2H A;  4M7A E;  3OS5 A;  5C51 B;  1X6O A;  3NEL A;  1EIY B;  1X56 A;  2JNG A;  3HRU A;  2IG0 A;  1QVP A;  3UPU A;  2VGM A;  1VQM A;  4J15 A;  1AHJ B;  5ELO A;  2LRQ A;  1VIF A;  1WJR A;  3WVD B;  5C52 B;  4K86 A;  1UGS B;  3DKM A;  3QJ6 A;  1I4K 1;  4E47 A;  1H64 1;  4M77 A;  4XTU A;  4XTX A;  3VBB A;  2EAY A;  5HGQ A;  5FU7 C;  3LSS A;  5GMK j;  2PUK B;  1Y96 B;  4HT9 A;  1WJS A;  1KMM A;  3SWN A;  5GAN e;  1X54 A;  2DQ0 A;  2K5L A;  3E1S A;  4JRP A;  1NJ2 A;  3CPW A;  3CCM T;  3ICA A;  1ASY A;  3VYH B;  4C0F A;  1VQN T;  1IL2 A;  4H02 A;  3OD1 A;  3CXC S;  5L8R E;  2L5Q A;  1WGS A;  1H4Q A;  3BDL A;  2RI5 A;  2ZR3 A;  2RA2 A;  2EWN A;  2HNI A;  2IY5 B;  3MQZ A;  3P8D A;  2DQ3 A;  5FRN A;  4M7A D;  1NYQ A;  1YB3 A;  2Q7E A;  3QHS A;  3CC4 A;  1KC8 U;  3JB9 D;  2ZPI B;  5CKD A;  2KDS A;  4M78 E;  1BBW A;  2Q7H A;  2GQV A;  3L2Q A;  4PJO C;  3PIO A;  3QBY A;  4TVW A;  4XTV A;  1NJI U;  1FXX A;  5GAN j;  3C4S A;  2V8K A;  2M0O A;  2EJ9 A;  1M90 C;  4PNO A;  4QVZ A;  4YRK A;  1K9M C;  3CCM A;  1WQW A;  3GF5 A;  4C0D C;  3VQW A;  2LVM A;  3KBG A;  1G3W A;  2ZT8 A;  1VQO T;  1Z7M A;  3CCE T;  1YHQ A;  2L8D A;  2DIQ A;  4PLI A;  2DEQ A;  4CH6 A;  2O4X A;  4M78 F;  4HT8 A;  2RK1 A;  4BDY A;  4L59 A;  3FRN A;  1BI0 A;  3ZFJ A;  3INZ A;  4II1 A;  2RHQ B;  2CZ1 B;  4H2X A;  4AH6 A;  1VQ8 T;  5DM7 R;  3NTK A;  4CRI A;  1NPP A;  1Y96 A;  3M53 A;  2VC8 A;  3M4Q A;  4X9D A;  2EQM A;  4UC4 A;  3JCM b;  1FYF A;  4M78 D;  1Y07 A;  2QA4 A;  2CYZ B;  4LDY A;  5CKB A;  1VQZ A;  2RJE A;  2CS7 A;  1H4S A;  4E7K A;  2LNV A;  1UGP B;  5GAO r;  4JJN K;  2BIV A;  3HFO A;  2KY9 A;  5DLO A;  3L2R A;  1NNH A;  3VUZ A;  4H2V A;  4IUU A;  4M78 A;  3VQX A;  3FJP A;  3CCR T;  1YFT A;  4KUD K;  4ELZ C;  2RJF A;  5E3I A;  3A5Y A;  1YJN A;  3A5Z B;  1NJ5 A;  1NPR A;  4M75 C;  2QQA A;  5GMK e;  2ZIO A;  2PVO B;  2LX9 A;  3JCM c;  4J7I A;  3JCM g;  3G71 A;  1YIJ T;  3HRK A;  3LYI A;  4H2Y A;  3TEH B;  3CCV A;  2AKW B;  2M16 A;  2QA4 T;  4M7A F;  4WJ3 M;  3G7Z A;  1EQR A;  5J26 A;  3UDC A;  2X4Y A;  4XTZ A;  3MCA B;  4XEO A;  3O8V A;  4C8Q A;  1Q7Y U;  1KG1 A;  5A0L A;  2OTL T;  4F7U G;  4F7U B;  5CAI A;  1EOV A;  4YRJ A;  1W66 A;  5LJ5 g;  5IN1 A;  2EQU A;  3OBW A;  2J3L A;  4DQ2 A;  4DOW A;  3CME T;  2E3C A;  3JB9 F;  2CZ6 B;  3H6Z A;  4RQE A;  5GAM j;  5CCA A;  3DLL A;  4MMK A;  4LNS A;  1X75 C;  1IRE B;  3S3O A;  2JVV A;  3MEA A;  1WJQ A;  2ALY A;  3CBO A;  1Y71 A;  2RHY A;  4O6J A;  1JJ2 A;  1ZQ1 A;  3MP1 A;  1NJ6 A;  2EFI A;  2R57 A;  2NS6 A;  3OYN A;  1YHQ T;  3NFC A;  3CCU T;  2XGT A;  3L2Z A;  2E65 A;  5GAN 5;  4ME7 A;  3OYK A;  5FLX E;  3DB4 A;  3TUP A;  4MZM A;  3QZ5 B;  3TCJ A;  2V8J A;  3NET A;  3X24 B;  1JJC B;  2EL9 A;  3UGT A;  4JS4 A;  3PTA A;  2QEX T;  1YGB A;  3HXW A;  4V2S A;  5GAN 8;  4P3P A;  3M56 A;  3A5Z A;  4IUP A;  3JCM W;  5FRM A;  4DOV A;  3G4S T;  4YPF A;  4KT0 E;  4YCU A;  3PT9 A;  4OMF B;  2WSC E;  4LDW A;  2EQJ A;  4D6W A;  3OYG A;  4H2W A;  4OB1 B;  2DXT A;  4X34 A;  3L1A A;  3PCO A;  1SRY A;  3DB3 A;  2ZNI A;  4TVR A;  3A7R A;  2PME A;  3X28 B;  1KD1 U;  2E5A A;  1VQN A;  4BWA A;  5M9O A;  1RL2 A;  5C6S A;  2EJF A;  4YRP A;  3AHU A;  4P3N A;  3QO5 A;  2AMC A;  3SWN B;  3CMA A;  4OB0 B;  3V7C A;  3HRS A;  3HPW A;  5CKE A;  3JCM d;  2RJD A;  4ZN3 A;  2RM4 A;  2CIM A;  4C92 E;  3CC2 T;  4PL6 A;  2ALY B;  2ZZE A;  2ZZD A;  1QVG S;  3OW2 S;  3QO3 A;  1XQH A;  3PIP A;  1MGQ A;  4BW9 A;  4M77 G;  1BI1 A;  5CQY A;  4DPG A;  1Q82 C;  2I2L A;  3HSB A;  3J81 E;  2A7Y A;  2YLB A;  1LNX A;  4M7D B;  4NOY A;  4EX5 A;  1V29 B;  4L6V 5;  5D6X A;  3A8M B;  4BE2 A;  1GXI E;  3CC7 A;  3N5B B;  3QSU A;  4OVA A;  3CBP A;  3QKJ A;  1UB4 A;  1UGQ B;  4ZTJ A;  2D0Q B;  3H8Z A;  4M77 C;  2DJZ A;  2YHT A;  2RK2 A;  4H2U A;  5K1X A;  4BDZ A;  3RAC A;  5HY6 A;  3RES A;  3CCQ T;  2XKO C;  4KUL A;  1QP3 A;  3S3N A;  1VQK A;  1N6A A;  4RG8 A;  3HFZ B;  2DTH A;  4P5N A;  2E1H A;  1USY A;  3E9F A;  1M1K C;  3JCM h;  5HK3 A;  2E41 A;  3X25 B;  5LJ5 h;  2OTJ A;  5DY9 A;  4X5O A;  5D6W A;  1B70 B;  1X2G A;  2DXC A;  3MET A;  3MEW A;  4BI8 B;  1M4Z A;  5GAM e;  3PGG A;  2ZPF B;  2KK4 A;  5CO7 A;  2XDP A;  3VYG A;  2LT4 A;  3TRE A;  2ARU A;  4OB3 B;  4E7J A;  3A8H B;  4O5V A;  2QHV A;  4A4F A;  1B7Y B;  4A54 A;  3G71 T;  4TVA B;  1L0W A;  3UFG A;  3G6E T;  3HY0 A;  4WI1 A;  3MF2 A;  1SET A;  4H2X B;  3SFM A;  4P73 C;  2LT1 A;  2VXE A;  2RHS A;  3EAE A;  4C8Q F;  1E1T A;  2F5T X;  1QE0 A;  2P5I A;  1OYX A;  3C95 A;  1U1T A;  5CQX A;  3M9Q A;  2M1H A;  2E12 A;  4JLI A;  3RMQ A;  4JRI A;  2DTI A;  2JZ2 A;  3RF1 A;  2ZGW A;  3P8Y A;  3CCJ A;  4BE0 A;  4X9C A;  1KHC A;  4FSX A;  1UEB A;  3CD6 T;  4PJO D;  3QG1 A;  3RUX A;  3F70 A;  3MEY A;  2C06 A;  2RI3 A;  4A4K A;  5LJ3 d;  1NJ8 A;  2QTX A;  4C0Z A;  1PSE A;  3KUF A;  4YRF A;  4P71 C;  3BY7 A;  4M78 B;  3KFU A;  3URG A;  1N9S A;  4C92 B;  3CCS T;  1YJ9 T;  1D3B B;  5EG2 A;  2FYK A;  2AHJ B;  3SDZ A;  3JCM V;  3A8L B;  3JB9 I;  4NS5 A;  2R5M A;  3S6W A;  4RCC A;  1KQ1 A;  4XU3 A;  3CD6 A;  4XU0 A;  2R58 A;  1LYL A;  1S72 T;  4M78 G;  3BJU A;  3G4S A;  3L2W A;  3I56 A;  2LDM A;  4NCX A;  2XID A;  4A53 A;  5FU6 C;  1Z7N A;  4G84 A;  1LOJ A;  2EYQ A;  1W2B A;  2M9U A;  3GLX A;  4BB7 A;  3HY1 A;  4QW2 A;  5FRO A;  2ODR C;  3FLG A;  1Q86 U;  5GMK i;  3OYL A;  4C5E A;  2XU8 A;  4EDU A;  1QVF A;  4A4H A;  3OYF A;  4C92 F;  2ZT7 A;  5I2S A;  2XG8 D;  2PU9 B;  1H4T A;  1OI1 A;  4YCW A;  4YRC A;  2E70 A;  4BAC A;  2LCL A;  3ERR A;  4HKE A;  3TEG A;  1I81 A;  2GF7 A;  3BFM A;  4QVD A;  1B76 A;  4PJO F;  3A74 A;  4M75 G;  1IZ6 A;  2O01 E;  1VQL T;  3OYY A;  4P75 A;  2QQR A;  4DA4 A;  1VQM T;  2OTJ T;  5GMK m;  3P8B B;  2KQW A;  3RER A;  4Z02 A;  2QHU A;  2OTL A;  4CH4 A;  4YRG A;  2P4T A;  3HXX A;  4PKC C;  1YFR A;  4OGE A;  4YRS A;  3E9I A;  2L89 A;  1QW1 A;  1VIE A;  5CR2 A;  3QYG B;  4M75 A;  2XHC A;  3QTC A;  4KBM B;  4JRK A;  5KH6 A;  2HAX A;  3CCR A;  1B34 A;  2BUD A;  1N9R A;  3OYD A;  2ZCE A;  2K3X A;  4P72 A;  5AYF A;  4EMK B;  1USY C;  1VQ4 A;  1ZHI A;  1EVK A;  1J5W A;  3VQY A;  2Q7G A;  5CK9 A;  3LGF A;  3CCL T;  2LQ8 A;  3GNF B;  3RL6 A;  2QQB A;  3OYI A;  4ZIB A;  3RKW A;  1M8V A;  2KSS A;  4MDW A;  3V7S A;  4J6W A;  5KCO A;  3OYC A;  1MHN A;  4KQE A;  1G51 A;  3P8V A;  4N0A C;  4J8O A;  5GAN 4;  5LJ5 j;  3A31 A;  1YIT A;  5GAN 3;  2CKK A;  1D3B A;  2K5I A;  2KVQ G;  4H2S A;  4OF1 A;  4YCV A;  2PQW A;  1Q86 C;  3REU A;  1FWZ A;  4WJ4 A;  4LVJ A;  4C0G A;  4PHC A;  2RH2 A;  4ZGD B;  1XOV A;  3UH0 A;  3M59 A;  4XQ3 A;  4JLG A;  3RGL A;  3T9N A;  3CC2 A;  4Y28 E;  4HVC A;  3V8K A;  3DLM A;  4M7D F;  4M75 F;  1NZ9 A;  2NLU A;  2XDB A;  4F7U A;  1KHI A;  5A2Q E;  4RCB A;  2DVE A;  4C5H A;  3M4Y A;  2G4C A;  2E6N A;  3OYB A;  2VUB A;  3V7R A;  1HTT A;  4M7D A;  3OA6 A;  4JUV A;  3S3M A;  3JB9 J;  3C94 A;  4QQG A;  2RHS B;  3HXY A;  3P8H A;  3LX7 A;  2D9T A;  4UP9 A;  5LJ5 e;  1SER A;  1KQ2 A;  1VQ7 A;  5I2M A;  1Q82 U;  2DXB A;  3IG2 A;  1B34 B;  3OS0 A;  4ZGJ B;  3OYM A;  3GNG A;  3R6O A;  1XTD A;  3IKM B;  3C12 A;  3OYJ A;  1VQ7 T;  5GAN 6;  4YTL A;  3OMG A;  2K2V A;  5KCH A;  5LJ5 f;  2XK0 A;  3CCU A;  3LWI A;  2GCX A;  2K4Y A;  1YJ9 A;  3HFV A;  4BE1 A;  1C0A A;  4FIB A;  3NEN A;  3L2U A;  3JAM E;  3QO7 A;  4RQF A;  2LCC A;  4G85 A;  2I4L A;  3CPF A;  4BI3 A;  1KD1 C;  4E7I A;  1KMN A;  5GAO n;  3FIF A;  1PYS A;  4M75 E;  1KOG A;  1W4S A;  1WNL A;  2CZ0 B;  4J6X A;  4OGC A;  1JJ2 S;  1M1G A;  3ZEH A;  2ZZG A;  2ZPG B;  1HC7 A;  2C7I A;  4N4G A;  5J39 A;  5IT9 E;  2DTO A;  2KAF A;  2L3R A;  1U1S A;  1BI2 A;  2RHQ A;  3JB9 H;  4N0A A;  3WQZ A;  4EMK A;  3PCO B;  2ZT6 A;  4M7D G;  4EMH A;  3GPL A;  3QJY A;  1E1O A;  5GMK h;  5GAN h;  3E9H A;  1B7Y A;  1G5I A;  3M55 A;  2FB7 A;  3OS1 A;  4HCZ A;  4JDS A;  4M7D E;  4P72 C;  3HXU A;  3KXT A;  1WPY A;  1M1K U;  4PG3 A;  3UGQ A;  3HTZ A;  2ZR2 A;  4YRM A;  2MF2 A;  3JCM Q;  5C0M A;  4XTW A;  4TTV A;  4XK8 E;  4E7L A;  3JCM J;  2R5A A;  3JCM e;  3MO8 A;  2K57 A;  3DSQ A;  2F69 A;  1VQ9 A;  1YI2 A;  2I4N A;  4OB2 B;  4M78 C;  4YRE A;  4F7U F;  3QXE B;  3IKL A;  2FL7 A;  1JRI A;  2FHD A;  2HQE A;  4EPC A;  1WLE A;  2QHS A;  5CKH A;  1VQ8 A;  4A4E A;  4A4G A;  5GAM g;  1K8A C;  2WAC A;  5GAN 2;  4BY6 C;  1Y7X A;  3L42 A;  4HWR A;  1BKB A;  1WU7 A;  2C8M A;  1VQL A;  2DU5 A;  1TH7 A;  2MWP A;  4P3O A;  11AS A;  4JRQ A;  1PYS B;  4UP8 A;  2VXF A;  2JN0 A;  3A32 A;  2ZPE B;  4FT4 A;  3HL8 A;  3HHT B;  5LJ3 e;  1VUB A;  4IKF A;  1N9W A;  3M58 A;  2QQ9 A;  4C5G A;  3CCE A;  2X35 A;  1G3S A;  1QF6 A;  4XU1 A;  2JTM A;  2OAU A;  1G3T A;  4IUQ A;  3OW2 A;  4BY6 B;  2HD0 A;  2EKO A;  2I4O A;  3ER0 A;  4JS5 A;  2EJG A;  3HKS A;  2LC4 A;  3OYE A;  2I4M A;  4E51 A;  2P0K A;  4J83 A;  2ZTG A;  1P92 A;  1WQ7 A;  2EIF A;  1YJW T;  4M7A C;  4QVC A;  1HXD A;  4NL3 A;  3QDR B;  3CBM A;  3J7A F;  3LLR A;  1I8F A;  2RJC A;  2X4J A;  4C8Q C;  4LDV A;  4NL2 A;  2Q5I A;  1YJW A;  2P0L A;  3OYA A;  4XU2 A;  1NE8 A;  1M1F A;  1W2B S;  1YBY A;  4M7A A;  4HCB A;  3L4G B;  4J5Y A;  1EVL A;  3OQ5 A;  5GAN g;  4OLF A;  3I55 T;  4GY5 A;  4Q6G A;  4C92 D;  1O75 A;  4BI4 A;  3OBY A;  2DXU A;  4C92 A;  1K9M U;  3JB9 G;  3VQV A;  2DZC A;  4CH5 A;  1M90 U;  1KQS A;  4N4I A;  2QEX A;  4MDX A;  1NJ1 A;  3CCJ T;  3UWN A;  4F7U E;  3QUI A;  3GIB A;  4K88 A;  2YRV A;  4BUG A;  3HRT A;  4FT2 A;  1YIJ A;  1Q7Y C;  3SWN C;  1ATI A;  4R56 A;  4BD3 A;  3OSV A;  1KC8 C;  1YJN T;  4UP7 A;  4RG2 A;  2QHT A;  2G3R A;  1ASZ A;  3M5A A;  3J80 E;  3NEM A;  2E10 A;  3A7A A;  2DDZ A;  2ZZF A;  3JRZ A;  2K3Y A;  1VQP A;  5GMK l;  3I7F A;  2LTO A;  1B70 A;  5GAM h;  3V8L A;  1JBM A;  5KE3 A;  3WVE B;  5FU6 B;  5GAN f;  3QPH A;  3RIR A;  2Y4X A;  5DLQ E;  3R07 A;  1Q81 C;  5I21 A;  3MF1 A;  3PZC A;  3MHX A;  3TEE A;  3JCM f;  1BIA A;  2ZIM A;  2O4X B;  4IUT A;  3Q1J A;  4C92 C;  1N27 A;  4HWS A;  4J6Y A;  4TVY A;  1XNI A;  4J7F A;  4C8Q D;  3JCM X;  3G6E A;  1JJC A;  1SSF A;  3OYH A;  5LJ3 j;  2XI9 A;  5LJ3 g;  3BW1 A;  3QYH B;  3EFS A;  2F5K A;  4C92 G;  3OSS C;  4CS2 A;  3M54 A;  1Q81 U;  4YRO A;  2RI2 A;  2QDY B;  4LD9 K;  4YDQ A;  1VQ5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...