3EG0A

Crystal structure of the n114t mutant of abl-sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
b'NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSTYITPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 12
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg0A00
1OOTA 1UG1A 2D1XA 2K2MA 3H0IA 4F14A 4OMNA 1HD3A 5I22A 1T0HA 2O2OA 1JXOA 4J9DA 3H41A 2GTJA 2DX1A 3H0HA 2J7IA 1SEMA 2KT1A 1S1NA 1GBQA 1E6GA 2DVJA 1UFFA 2HCKA 4RTZA 1YNZA 2MIOA 4DEYA 2EYYA 1WXBA 2RQTA 2LCSA 2X3XD 4OMQA 4JJDA 1PHTA 2J05A 2D0NA 3FJ5A 4LNPA 1ABQA 2AKLA 3LH5A 1GRIA 1J3TA 2RNAA 2CUDA 4M4ZA 1IO6A 1Y0MA 2KGTA 1KFZA 1OV3A 1RLQC 5IH2A 1ZSGA 1H8KA 1X6GA 1V1CA 2G6FX 3VS6A 1U06A 4JZ3A 4Z8AA 1W70A 2BZXA 1YN8A 3REAB 1E6HA 1NLOC 3NHNA 4CC4B 2F2VA 1UGVA 4AG2C 1GFDA 1GL5A 4J9HA 2OJ2A 4J9GA 4ZNXA 1PKTA 2LX7A 2JM8A 2C0OA 2LZ6B 2O31A 5IHNA 2CSIA 4D8KA 4OMPA 1SSHA 1BBZA 1UTIA 1MV0B 2AZVA 2EW3A 1X69A 1WLPB 2YUNA 2LJ3A 3QWYA 4JJCA 1SHFA 3EGUA 3NPFA 2LQNA 1H3HA 3VS1A 4HCKA 2BTTA 1X43A 2C0IA 2KE9A 5FWCA 1WFWA 1Z9QA 4IIOA 3PVLA 1HJDA 1H92A 1T3LA 1GCQC 1N5ZA 3CQTA 1HSQA 2D8HA 2L3PA 4HVVA 1T0JA 4CC7A 3M0RA 2KEAA 3I5SA 2EVRA 2DL4A 2QDLA 2M0YA 1NG2A 2VVKA 1YCSB 2DL8A 1GBRA 2DBKA 5EC7A 3SEMA 1RLPC 2BZYA 2HBWA 2LJ0A 2V1RA 1CKBA 1QWEA 2YUQA 2FO0A 1OEBA 2AZSA 2K7AA 2L2PA 3VRYA 4GLMA 2CH4W 2EGEA 2HSPA 4FSSA 5L23A 1PNJA 2RPNA 2AK5A 1NEBA 2DA9A 1G2BA 1YWOA 1ABOA 2JM9A 4RTXA 2CREA 3REBB 1FYNA 1WA7A 2RQVA 3H0FA 4HVWA 3EG1A 2DILA 2VWFA 3VS0A 1AWJA 2RQWA 1T3SA 2L3QA 2ABLA 2LJ1A 2EGCA 2H8HA 1GCQA 1X2QA 2ENMA 3KFVA 2KT8A 2KYMA 4A63B 1PKSA 1AEYA 1WDXA 3M0QA 4QT7A 2J6OA 3EG0A 2JW4A 2CT3A 1AZGB 1EFNA 1U3OA 2CDTA 1GCPA 2PZ1A 3ZL7C 2GTOA 3NMZC 2F2XA 2P4RA 2KRNA 4RTVA 2CSQA 3I35A 1AWOA 2KYBA 4JJBA 1JO8A 1VYVA 2EYXA 1PRLC 4AFUC 1NYFA 2DRMA 2K79A 2DLPA 2KR3A 4OMLA 2DL3A 2YUPA 2W10A 1QKXA 3I5RA 2ED1A 1B3QA 1JU5C 4AG1C 2KROA 2O88A 1QWFA 2MCNA 1I1JA 1WIEA 2FRYA 5FW9A 2DL7A 4CC2A 1W6XA 1QLYA 4F16A 1NYGA 1CSKA 1I07A 2YUOA 1ZUKA 2I0NA 3M0SA 4WCIA 4RTUA 1SRMA 2GBQA 1M3BA 5IXBA 2B86A 2DRKA 2DJQA 2LMJA 3UF4A 2JMCA 2O9SA 4D8DA 1KSWA 1ARKA 1ZUUA 5IHIA 3UA7A 4CC3A 2E5KA 3IQLA 3TSWA 2J06A 2SRCA 4JZ4A 2A36A 2MOXA 4JPBW 1VYUA 2D8JA 1K9AA 3VS5A 4EIKA 1M3CA 1WI7A 2JMAA 1GFCA 1RUWA 1TG0A 5HCKA 2KRMA 1CKAA 3U23A 1TUDA 1M27C 4J9IA 3VS7A 2ECZA 1QKWA 4ORZA 1I0CA 1BU1A 2RQRA 1M3AA 1ZBJA 2DMOA 1UDLA 1PWTA 2K9GA 4OMOA 4F17A 2A28A 2EPDA 1AWXA 1ZLMA 3EG3A 1NM7A 3RNJA 2VKNA 1WYXA 1UE9A 2ED0A 2FG0A 2RQUA 3THKA 1UJ0A 4LN2A 4LE9A 4LUEA 1JXMA 3UA6A 4Z89A 2JS0A 1AOJA 3M0PA 3TVTA 1KIKA 2K6DA 5ECAA 2EKHA 1WXTA 2JXBA 1ZUYA 4RTYA 2DYBA 1X6BA 1UUEA 2KRSA 1K76A 1UJYA 2YDLA 2LQWA 2RF0A 1NLPC 4RUGA 1M30A 1X27A 2ROTA 4DEXA 1AD5A 2BZ8A 2KBTA 4J9EA 3UATA 1SPKA 5GJVB 5IHKA 2KXCA 1Z9ZA 4R0KA 3A98A 2X3WD 3I9QA 2CT4A 1YWPA 3R6NA 3PE0A 2L3SA 3JV3A 3NGPA 2HDAA 2PTKA 1BB9A 2NUZA 2EQIA 2PNIA 4RTTA 2ROLA 1RI9A 1UHFA 1AWWA 2A37A 2W0ZA 2FRWA 3EHRA 1SRLA 1VYTA 1K1ZA 2JS2A 2LP5A 2RMOA 2ESWA 1X2KA 2YT6A 2K3BA 4X1VA 1M8MA 1K0SA 4E6RA 1WXUA 2EYZA 4AFZC 1XOVA 4GBQA 4Y92A 1KJWA 1VA7A 1U5SA 4AFSC 2OI3A 4RTWA 3VS3A 5GJWB 4K11A 2FPDA 3M0UA 2O9VA 2GGRA 1YP5A 5IXFA 1W1FA 2DF6A 2FEIA 3M0TA 4HXJA 1NEGA 1E7OA 2NWMA 3EHQA 4HVUA 2L0AA 2FPFA 1G83A 3GBQA 1FMKA 3VS2A 2J6KA 2GQIA 2AKKA 2JTEA 2SEMA 1Y57A 3VS4A 1JQQA 2FPEA 2J6FA 2RN8A 1MV3A 1LCKA 1OPLA 2DBMA 4AFQC 1WX6A 1A0NB 3PVQA 4J9BA 3ULRB 2V1QA 2DNUA 2EGAA 2C0TA 2KNBB 4ESRA 2DM1A 4IIMA 3O5ZA 5FWBA 2JT4A 1K4US 1UHCA 2EBPA 1TUCA 1SHGA 2DE0X 2YSQA 2CUBA 3QWXX 2KXDA 2GNCA 2DL5A 4J9CA 2F2WA 2XMFA 3RBBB 5I11A 3C0CA 1MUZA 2M51A 4LUDA 1JEGA 2CH4A 1BK2A 3TSZA 1QCFA 1ZX6A 2A08A 1B07A 2EYWA 4OMMA 1OPKA 3SHWA 2IIMA 2HEQA 1PRMC 1K0XA 2OAWA 4KRTA 3VRZA 1UECA 4Z88A 1AZEA 3EG2A 4J9FA 2LNHB 1AVZC
chains in the Genus database with same CATH superfamily
2D1XA 2DK3A 3CD6T 1BCOA 3H0IA 4F14A 1YHQA 1JXOA 4J9DA 4M78F 1W4SA 2GTJA 4JLGA 2JTFA 1GBQA 1E6GA 4RTZA 4JRPA 2DD5A 4KGXB 3MPUB 1HXDA 2LX9A 3CCJQ 2LQKA 4PJJA 2FHDA 2EYYA 1WXBA 2LCSA 1VQ4A 2CZ6B 3CBPA 1KHCA 1M1GA 1ACMB 2J05A 2KI7A 3V7SA 3CPFA 1GRIA 1BI3A 2RNAA 5GANd 1IO6A 1UB4A 4QQDA 3HTRA 1KFZA 2FB7A 5EG2A 3CD6Q 2ZPBB 3X24B 1X6GA 1V1CA 5LJ3e 2K57A 5A0DA 2E5QA 1W70A 1VOMA 2HL5C 4Y91A 5I2SA 3L2ZA 4E7HA 3EG9B 2R58A 1UGVA 3CC2T 3URGA 1OZ2A 1GL5A 1TU0B 2RD1A 1BIAA 4ANJA 3EGXA 2LX7A 2A3LA 4X9DA 4EDUA 2C0OA 3GNGA 4D8KA 4OMPA 1SSHA 3KUFA 3SFMA 2AZVA 3CCVA 5LJ5d 2ZGWA 4M77B 2QQBA 3EG9A 4M77E 3H6ZA 3TREA 3QWYA 1IGUA 2R57A 3NPFA 4DBQA 4M7AB 3VS1A 4HCKA 4M7AE 4IIOA 1HJDA 1MGQA 3OYKA 2QK0A 1T3LA 1GCQC 3KBGA 1K9MC 1Q82U 2I2LA 4HVVA 2LCCA 5L8RE 3M4YA 3X28B 2EVRA 3X20B 3OYDA 2QDLA 2CZ0B 1PD1A 1YBYA 3L2WA 3CMAA 4M77A 2PVDB 1YCSB 1I5LA 4M7AA 1K8AR 3E9GA 2BZYA 1VQMT 2EJFA 3G71Q 1CKBA 1SKUB 2L2PA 5GAMg 1N9RA 2VXEA 2EFIA 5IAYA 2HSPA 2DIGA 3FRNA 4FSSA 1PNJA 3A8LB 4M75F 1Q81C 2DA9A 2MYSA 1G2BA 1Q82R 2JM9A 1U8RA 1BKBA 1SF9A 1Q95G 3FEOA 1QP2A 3CCRA 1WA7A 2COWA 3DKMA 1AWJA 2LRQA 1T3SA 2L3QA 2RI3A 3CCST 2H8HA 1GCQA 3J80E 2KYMA 1Q7YR 3M9QA 5DY9A 4QT7A 4HT9A 3EG0A 2PUKB 3UT1A 3GP8A 1GCPA 4UC4A 1NPPA 2PZ1A 2F2XA 3NTHA 4RTVA 2CSQA 4JS4A 1PRLC 1NYFA 3NTKA 4QKUA 1N8RU 2DLPA 3FDRA 4QVCA 3GIBA 4JRKA 1B3QA 2O88A 1AHJB 5J39A 1VQ9Q 1JJ2A 4A54A 2NUTB 1I07A 2RHZA 1ZUKA 3M0SA 4B9WA 1ZQ1A 2DVEA 5GANj 3M56A 4KT0E 5DLOA 4M7DC 2DTHA 2J06A 3I55T 5KYXB 4FT2A 2EQKA 1KC8U 4EIKA 4XU1A 5GANg 4PJOD 3SWNC 1RUWA 1WHJA 1TG0A 2XDDA 3DLMA 4P5NA 3JCMh 1M27C 4J9IA 3PTAA 2ECZA 4FIBA 4E7IA 2HKQB 4FYVB 4PL6A 4OMOA 1UDLA 1I81A 2HBPA 5KYXA 4E7KA 3E19A 2EPDA 3OS5A 1MMGA 3ZFJA 2EWNA 2RHYA 1NM7A 3RNJA 3P8DA 1UGRB 4M78G 4M7DB 4M7DE 2JN0A 1FX7A 1X6OA 3EH2A 3CMEA 2FG0A 2RQUA 3UA6A 1AOJA 3I55Q 1KC8R 2E3HA 2EKHA 2QEXQ 2OTJA 2RHXA 4C92D 3DLLA 2DYBA 3RERA 3G4SQ 5LJ5g 2PUOB 4J6YA 4M7DA 5CO7A 5FRMA 2RF0A 1NLPC 1VIEA 4OMFB 3AT1B 4DEXA 4J9EA 5FU7C 5GJVB 2CP6A 2KXCA 3GF5A 3OYEA 4R0KA 3WXMB 3M55A 2X3WD 1IZ6A 1YWPA 1IB8A 2CZ1B 3R6NA 9ATCB 3CCLT 4OGEA 2HDAA 5GAOp 2PU9B 2WSEE 2DIQA 1Y96B 4ZTJA 4YTLA 1YIJA 4HCBA 3JCMe 1IXDA 1UHFA 2A0FB 5CKEA 3MP8A 2LP5A 3OYMA 2Z0WA 3HKSA 1K0SA 1LPLA 1WXUA 1Y96A 2DTIA 5HY6A 3M0UA 1N6AA 4KBMB 3CC7T 2V8JA 5FROA 1YP5A 2DXCA 3EAEA 1E7OA 4DQ2A 4EMKC 1MMAA 1DJ7B 2FZCB 1M9SA 2BE9B 1VQNA 2XD0A 1WJQA 3VS2A 5KE2A 1NJIR 2SEMA 4QQ6A 1D0YA 4LXCA 2ZPIB 4OF1A 1LCKA 1OPLA 4M75G 1JJ2P 3HRSA 4BY6C 4LD9K 3FB9A 1VQOT 4J7FA 2V1QA 4C8QD 4JRQA 1TWBA 3EGDB 4E7ZA 2DM1A 2L89A 1YJWQ 3BW1A 3VKIA 2LTOA 2E1HA 5CQYA 2QQ9A 2QTVA 2KXDA 4J9CA 1WPYA 2K2VA 2PQWA 3LYIA 3A8MB 4BE2A 1VQ7Q 1M2VB 3L2VA 3ZEHA 3CCET 4QVZA 1VQKQ 1JEGA 4DOWA 1ZX6A 1VQ8T 2EYWA 3CBMA 2MWPA 1Q86C 1K0XA 1VQLT 3VUZA 2DEUA 3OBYA 1AZEA 3EG2A 5GAMh 2QGFB 4PLLA 1M2VA 1UG1A 4B6MA 2EJ9A 5I22A 5GAOr 2O2OA 1YI2A 3M59A 2DX1A 4PJOF 4F7UF 2KT1A 2BKDN 2D6FA 1QCNA 2HCKA 3L42A 4JDSA 4XTWA 1ZBXA 3QZ9B 3EFRA 3E1SA 2X3XD 4KUDK 4OMQA 2D0NA 4E47A 1IREB 3FJ5A 4XQ3A 3MJXA 1VQPQ 3PMTA 1YJ9A 1Y0MA 3CCMQ 4RKUE 1R8OB 1V76A 1RLQC 1ZSGA 4IKFA 1G8XA 1NBEB 2COZA 1JB0E 2WACA 3VS6A 4JZ3A 1RL2A 1EX4A 4KGZB 2KMTA 3REAB 4M78C 2K3YA 4C92F 1VQ4T 3UWNA 4CC4B 1MMNA 1GFDA 1JBMA 4BE1A 2YRVA 2OTLA 5GAMe 4J9GA 5AYFA 2JM8A 2BIVA 3CCUA 1D1BA 2DJZA 1UGSB 2O31A 2YWWA 2QA4A 1LVKA 2VC8A 2MK5A 1MV0B 1YHQQ 3G6ET 2RJCA 1WLPB 4M77D 2YUNA 2LJ3A 1SHFA 4M7AD 1H3HA 2AT1B 4NS5A 2QDYB 4C5IA 1BI0A 4M78E 4C8QB 3JCMX 3C12A 2KE9A 4XU2A 1Z9QA 2QGGA 2H3JA 2XKOC 1N5ZA 3CQTA 2D8HA 2L3PA 1VQPA 4EPCA 1VQ5A 5J3BA 3I56A 1JJ2S 2KEAA 2VYTA 1VQ4Q 1PSFA 3JCMc 3S3OA 3CCVT 1GBRA 2DBKA 4M78A 2MWOA 2QTXA 3JSCA 3SEMA 3DB3A 2DTOA 5LJ3h 4ZGJB 4LDUA 3M53A 1QWEA 2K3XA 4HT8A 4GLMA 4X9CA 1R0BG 4OB2B 5D6XA 3OYAA 3JB9G 2AK5A 2GFAA 2MPXC 3MEWA 3LH0A 4R55A 3RIRA 4XK8E 1GXIE 2FL7A 4RTXA 4J83A 2CREA 3REBB 1ZSZC 1G5VA 1PCXA 2DILA 2VWFA 3TCJA 3M58A 4IUQA 4X34A 2ABLA 1X2QA 2AIRB 5GAMf 3KFVA 3VYGA 3CCVQ 3OB9A 1PKSA 1AEYA 2XDBA 2RH2A 2GFUA 3UPUA 2JW4A 2EQUA 1EFNA 2CDTA 1U3OA 3WVEB 3ZL7C 3P8BB 3NMZC 4AMCA 2KRNA 1M1KU 2YXYA 4C8QF 3I35A 5GANe 2KYBA 3CCRT 1OU9A 2EYXA 2VXFA 4N4HA 4J8OA 2DRMA 2K79A 4M75C 3CMAQ 1N9SA 3EGXB 3OA6A 2DL3A 4OB1B 3T9NA 3OMGA 1JU5C 4AG1C 1P92A 3QIIA 1PSEA 1RAEB 8ATCB 1QWFA 2MCNA 1WIEA 2DL7A 1M90R 3UDCA 3JB9I 2X4JA 3RKWA 3HSBA 1CSKA 4WCIA 2I0NA 3HFOA 1N8RC 1I5OB 1WJSA 3HL8A 1M1KR 2B86A 2LMJA 2DJQA 4KGVB 3CCQQ 1G3YA 5LJ3d 2O9SA 3MEAA 3G71T 4PJLA 1UGQB 1KSWA 1K8AU 5HK0A 2ATCB 3RR6A 2CYZB 4OB0B 5KYNA 3OS1A 1ZUUA 4CC3A 5LJ5e 3CCRQ 3TSWA 1W2BP 2MOXA 4JPBW 2GCXA 1K9AA 1G3SA 2C06A 1WI7A 2JMAA 4PFPA 2KRMA 1CKAA 4GLKA 4F04B 4BE0A 3U23A 5GAN5 1M4ZA 2VV5A 1QKWA 4ORZA 1BU1A 2RQRA 1PWTA 4Y28E 4MDXA 4ZGDB 1M1FA 1ZLMA 3MHXA 3EG3A 3CPWA 1KD1U 4J6XA 5KH6A 4M7DD 2HD0A 3SDZA 4XTYA 4PJOG 4F7UG 2Y4XA 4LN2A 1Q7YU 3MP1A 2D9TA 1JXMA 4Z89A 3OYLA 2K6DA 5ECAA 4E7LA 1SG5A 2JXBA 3CCQA 5LJ3f 1XQHA 2VB6A 1K76A 2RB6A 4LDWA 5KYYB 4JUVA 3C95A 4XTVA 1QVPA 2ROTA 2BZ8A 2KBTA 4MMKA 3FC3A 1KD1R 5IHKA 1ZHIA 2RO0A 3A98A 3QYGB 1G3WA 1KQSP 2M1HA 3DB4A 2G3RA 3PE0A 1VQ9T 2L3SA 2Y4YA 4C92G 3JV3A 4ZN3A 1U1TA 1MNDA 1D0XA 3EFOA 1D0ZA 5KYYA 4FU6A 4M77F 5CIUA 4FT4A 2JVVA 2PNIA 4M7AF 2F5KA 4IUPA 2A37A 2RI2A 2FRWA 3EHRA 1AWWA 3M5AA 2M16A 1YFNA 3VYHB 2ESWA 5GMKh 2HMAA 5CVIA 3LWIA 2X35A 2KQWA 1OX9A 4FYWB 2EYZA 4AFZC 4Y92A 3CMEQ 3CC2A 3ME9A 2PVOB 1OZ3A 3RKYA 1U5SA 1C0MA 3JCMb 3OYJA 2OI3A 4II1A 4RTWA 2P0KA 5KCHA 3VS3A 2DD4A 4K11A 2GGRA 1I4K1 1W1FA 2FEIA 2OTJQ 3M0TA 3SB2A 5A0LA 4HXJA 1K73C 7AT1B 1HYOA 3V7RA 3GOXA 2CP7A 2V8KA 2BUDA 2QEXT 2L8DA 2J6KA 2GQIA 2RHUA 3G4ST 3MP6A 1Y57A 3LLRA 1JQQA 2FPEA 4ME7A 2VGMA 3E2UA 4AFQC 1W2BS 3R6OA 2ZPGB 1YIJQ 1JRIA 1MNEA 3HPWA 5LJ3j 2P0QA 3ULRB 1O75A 2DNUA 1VQMA 1WGSA 5GMKe 4OGCA 3LWHA 2RA2A 2EGAA 2KNBB 4IIMA 1QVGS 2JT4A 4EMHA 2EBPA 3SWNB 4E7JA 1TUCA 2DE0X 2YSQA 3OYHA 4MMLA 4C0DC 4HCCA 1HK9A 3MO8A 3S3MA 1K9MR 1MUZA 2DETA 1MHNA 4LUDA 1VIFA 2CH4A 3C94A 1QCFA 3M54A 4OMMA 3QBYA 2HEQA 3CPWP 3G7ZA 2OAWA 3SWNA 1QP3A 5CQXA 1IRXA 1FWZA 4IURA 1UECA 4Z88A 2LT4A 3L2UA 2LNHB 1AVZC 1WQ7A 1OOTA 2K2MA 3RMSA 1VQNQ 4IUVA 4OMNA 4NL2A 1NPRA 1ZA1B 1UEBA 3CXCP 1T0HA 3H41A 2E6NA 4A53A 5D6YA 5CR2A 1Q81R 2J7IA 2ZPFB 2ZZDA 5M9OA 1SEMA 1S1NA 2QI2A 3KXTA 1YNZA 5FU7B 1KQSS 4LDXA 2MIOA 4DEYA 3QUIA 3A8OB 3H8ZA 3RDVA 1NJIU 1X75C 1LNXA 1KK7A 4WF2A 2AKLA 2NUPA 2HZYA 3ASKA 1J3TA 3JCMd 4M7DF 3TQ7P 5GAN6 3OYGA 2MI6A 1YI2T 2Y90A 2KGTA 1OV3A 5IH2A 4EMGA 2DXUA 3HRTA 3OW2P 3SD4A 2G6FX 4HKEA 5I21A 3Q1JA 4Z8AA 2BZXA 1YJWT 4N4GA 1D3BB 4FYYB 1E6HA 1TH7A 1NLOC 4XU3A 1WZOA 3NHNA 2F2VA 4PJOC 4MZPA 5GAN7 3PFSA 3ER0A 1FXXA 4J9HA 1VQ7T 4N0AC 4ZNXA 1PKTA 3BFMA 2XG8D 1VQKT 1KQ2A 2P84A 1D3BA 2YRDA 1X69A 5DM7R 4IUUA 1BI2A 1YI2Q 3OYBA 1TUGB 1S72A 4M78D 3PGGA 4EMKB 3L2RA 1X43A 2C0IA 1QVFP 1YITA 1H92A 5CAIA 3JCMf 2OTLT 1BCMA 2DO3A 1KHIA 5FLXE 2X4XA 4LD6A 2E6ZA 2QQRA 4C92C 2DL4A 1RAHB 1NG2A 2VVKA 3S6WA 5A2QE 4M77G 1B34B 2DL8A 4PJMA 4BY6B 4EMKA 4J7IA 4M7AG 1FMWA 1YJ9Q 1M2OA 1RLPC 4F7UA 2LJ0A 4J5YA 2FO0A 1OEBA 2LVMA 4B9XA 1WNLA 3VRYA 2KY9A 2CH4W 1UGPB 2EGEA 2X4YA 2E70A 3JCMW 2KVQG 1VQPT 5L23A 2RPNA 1RAFB 3I56T 1B34A 3CCMT 1NEBA 1YWOA 1ABOA 2LQ8A 2ZAEA 4XTUA 2OTLQ 4R56A 1FYNA 3EFSA 2RQVA 3H0FA 4HVWA 4L59A 3PIOA 2DPPB 2RQWA 3CPWS 3CCUQ 2QA4Q 4O5VA 1XTDA 2LJ1A 3JCMP 3VU3C 5CK9A 5GMKl 2KT8A 4A63B 3N5BB 1PC0A 3M0QA 2KDSA 3PT9A 2WSCE 5GMKm 2E12A 2H3EB 3CXCS 1TXQA 2KK4A 2P4TA 1YHQT 2FZGB 4A4HA 4JJBA 3CC7A 1VQ5Q 5GAN2 1V29B 2RHIA 3I56Q 1WJRA 3QO3A 2QYZA 2XHCA 3TU4K 1W2BA 2KR3A 5CKBA 4FSXA 2YUPA 1QKXA 3I5RA 2RK2A 2DXBA 1RABB 2QQSA 1B7TA 3LX7A 1BIBA 1QVGA 3VJPA 1WHHA 4KH1B 1I1JA 2DZ9A 2FRYA 5FW9A 4CC2A 4CRIA 4N4IA 4NL3A 2YUOA 4RTUA 1SRMA 1M3BA 2RJDA 5IXBA 2DRKA 2M02A 3OW2S 3TEEA 2M0OA 3UF4A 2E41A 4DOVA 2JMCA 2F1LA 4M75D 2CP2A 2VGNA 2DYIA 2E3IA 2EQMA 2L3RA 4BDYA 3UA7A 3IQLA 4LDVA 3X26B 2RJEA 2SRCA 4PJNA 4JZ4A 2A36A 4XAXB 2D8JA 4M78B 2HQXA 3V8JA 2XU8A 3VS5A 3GLXA 1VQ6Q 1M3CA 5GAMd 3D7SB 2HQHA 5HCKA 1K8AC 4BI8B 3OS0A 2R5MA 3VS7A 5GANh 1AT1B 1TSFA 1YJNA 1I0CA 1M3AA 2DMOA 4F17A 3CCEA 2L5QA 4ZTFA 2QQAA 4Q5WA 1XJWB 4XTZA 2VKNA 2EYQA 2XK0A 1VQ8A 2EAYA 1RAIB 3E9FA 1QVFS 1UE9A 2ED0A 4DBHA 2LCLA 1VQLA 1QCOA 1UJ0A 4VUBA 1Q82C 4LE9A 1KQSA 4LUEA 2COYA 3HRUA 2JS0A 1Q86U 4E7SA 3TVTA 1OQKA 2WSFE 3A5ZB 2NLUA 3CMAT 3QZ5B 2YDLA 1Q7YC 3MKDA 4RUGA 3HP9A 1Y07A 1X27A 5LJ5h 2K5FA 4C5HA 2YLBA 1Z9ZA 1VQ6A 1MMDA 4C0ZA 5GAN3 4Z02A 2K5IA 3CEYA 3NGPA 1Q86R 2PTKA 2QAZA 3CCQT 1M90U 2NUZA 2EQJA 3QDFA 3A1PA 2QXFA 1X01A 1RI9A 3OYFA 1OU8A 2W0ZA 1VYTA 2FZKB 1ZSZB 4A4KA 1K1ZA 2RI5A 4PLIA 2YT6A 2DAQA 5GMKi 2K3BA 1H3ZA 3FLGA 1M8MA 3RMQA 4E6RA 1IHVA 2DZCA 2MAMA 2HL3A 3CC4Q 1R0CB 4FW2A 2FYKA 1ZSZA 5KYUB 4OP0A 1FMVA 5GJWB 3LGFA 2FPDA 4RG8A 1WHMA 1VUBA 4ELZC 4O6JA 1KQ1A 3G6EA 2CZ7B 4M77C 4M75B 4M75E 1OYXA 2AHJB 1M5Q1 4M7AC 2LNVA 3A8GB 4HVUA 3EH1A 1N27A 1G83A 4JLIA 5KYUA 3GBQA 3L1AA 2JUFA 2AKKA 3FJPA 3BE3A 3GNFB 4FL6A 2F69A 1QVGP 4BD3A 4M75A 2YHTA 4FW1A 4ZGEB 3META 2RK1A 3OQ5A 3CCJA 2GQVA 1A0NB 2PVGB 3PVQA 4BI4A 1IHWA 3RKXA 1WHLA 1XNIA 1KC8C 2C0TA 2HNIA 3CC4A 4L6V5 3O5ZA 5GAOl 5FWBA 1K4US 1UHCA 5GANf 3OMCA 5CCAA 2LC4A 4XU0A 3QYHB 3JB9D 5GAMj 2CUBA 5GAOm 3CC2Q 2DL5A 3CD6A 3CXCA 3A8HB 3OSVA 3C0CA 3GPLA 2M51A 3QJ6A 1BK2A 2P0PA 3EFOB 3TSZA 4WTOB 2A08A 4LDYA 4BUGA 1OPKA 3SHWA 4IUTA 5A0GA 3CMET 1RAAB 3V8KA 2FVUA 3QDRB 4FYXB 2XDPA 4HA8A 4BB7A 4MDWA 3HFNA 1O9SA 4J9FA 2DERA 2OTJT 1HD3A 4L5GA 4QQGA 1LJOA 5LJ5f 3F70A 4A4GA 4C0FA 3LW5E 3OW2A 3H0HA 3RUXA 3RESA 1D1CA 2DVJA 2A7YA 1UFFA 2IPOB 1ZA2B 3PMIA 3QHSA 1VQMQ 2RQTA 4JJDA 1PHTA 2X9HA 4LNPA 1ABQA 3QKJA 3LH5A 2CUDA 1YIJT 4M4ZA 3ZBDA 1PD0A 3G71A 1H8KA 5IT9E 1TS9A 1U06A 1NJIC 1YN8A 2B8AA 1OULA 3JCMQ 1QVFA 3OY9A 3CCSQ 5IN1A 2EIFA 3QXEB 4AG2C 8AT1B 2RM4A 4J6WA 2CP5A 2OJ2A 2XIDA 4PFZA 3J7AF 5GAOq 1QW1A 2LZ6B 1K9MU 5IHNA 2CSIA 1OI1A 1BBZA 3L2QA 1UTIA 4A4FA 2EW3A 2V8IA 1N8RR 4JJCA 3EGUA 2LQNA 3P8HA 1EZZB 2JJ9A 2BTTA 2NUTA 2CP3A 5FWCA 1WFWA 4V2SA 3PVLA 1VQNT 1IGQA 2KSSA 4PFOA 1HSQA 1T0JA 2XICA 4CC7A 3M0RA 3I5SA 5CKDA 2OAUA 5LJ3g 2M0YA 3V8LA 2IVWA 5EC7A 1Q81U 2JOYA 4C8QG 2E10A 4MZTA 1OX8A 2HBWA 1S72T 5LJ5j 1QMCA 2V1RA 2ZCFB 1M8VA 3CCSA 2YUQA 2K7AA 2AZSA 2E65A 1YITT 1EIFA 1VQ9A 5HK3A 2O4XB 1D09B 3QSUA 2MF2A 2OX7A 2D0QB 4C0DB 3OYYA 3JCMJ 3EG1A 2NUPB 2GF7A 4AT1B 3VS0A 4E2FB 1SSFA 3HHTB 2YRCA 4OB3B 2EGCA 2O4XA 2ENMA 4ELYC 3JB9J 2JZ2A 3WVDB 2ZPHB 1WDXA 4BDZA 5FRNA 3OYCA 1S72Q 2J6OA 3JRZA 2XI9A 4KULA 2CT3A 4NOYA 4KUIA 1AZGB 1C6VX 1H641 3JAME 4QVDA 1PM3A 2GTOA 1YITQ 3NFCA 2P4RA 3LGLA 1RACB 1NZ9A 1AWOA 1QQJA 1JO8A 1VYVA 2EJGA 3M4GA 1WHGA 1RADB 2M9UA 3BDLA 4AFUC 4GY5A 2K4YA 1KG1A 5C0MA 4JRIA 4OMLA 3CBOA 2W10A 3JB9F 3MEUA 1K73U 2ED1A 2CS7A 2E4HA 3I55A 2JNGA 5GAN8 4FCYA 4C0GA 2KROA 4ZN1A 2QG9B 2QEXA 3G4SA 1W6XA 3BDUA 1QLYA 4F16A 3CCLQ 2ZPEB 1NYGA 5I2MA 4BACA 3QG1A 2CKKA 4RG2A 2GBQA 1YJ9T 1TTHB 3VV0A 6AT1B 4D8DA 4CI0C 1ARKA 1BYMA 1BI1A 5IHIA 3J81E 3G1JA 2E5KA 3O8VA 3X25B 4PKCC 2DFUA 2LDMA 1VYUA 1K73R 3OYNA 3JB9H 2QASA 4PJOB 4F7UB 4JJNK 4PJOE 4F7UE 5C6SA 1GFCA 3BY7A 2V26A 4QW2A 1TUDA 2HAXA 2E64A 4PK4A 3CCUT 2QA4T 1F1BB 1ZBJA 2K9GA 2O01E 2A28A 4HCZA 1AWXA 5AT1B 2NYSA 3CC7Q 1WYXA 4XTXA 4PJOA 5DLQE 4RCCA 3THKA 2X4WA 4C5EA 5KYWB 5HKCA 3PIPA 4N0AA 3M0PA 4PNOA 3CCLA 1KIKA 1U1SA 4OVAA 1VQ5T 5GAN4 1WXTA 1YJNT 2VUBA 1ZUYA 1D1AA 4RTYA 5CKFA 4C92B 4C92E 1X6BA 1UUEA 2KRSA 1UJYA 3EGDA 2LQWA 5GAOn 2CP0A 1Y71A 1M30A 5KYWA 1AD5A 3UATA 1SPKA 5GMKj 3H9NA 2KAFA 1VQOQ 3I9QA 2CT4A 1RI0A 4TVRA 2HKNA 4C92A 2HQEA 1BB9A 5FU6C 2DKGA 2EQIA 1C1AA 4RTTA 2ROLA 1WHKA 3OSSC 1SRLA 5KCOA 1LOJA 2JS2A 3S3NA 1YJNQ 2RMOA 3INZA 1X2KA 1RAGB 2DXTA 4DBFA 3CCEQ 1YJWA 4X1VA 4ATOA 1VQ6T 1M90C 1VQ8Q 1XOVA 4GBQA 3QPHA 1KJWA 1M1KC 1VA7A 1VQLQ 4AFSC 1VQ7A 1WQWA 4MZMA 4BI3A 3M57A 1YCYA 2RJFA 5FU6B 3MEVA 1VQKA 4D6WA 2O9VA 5IXFA 2IG0A 3QJYA 2DF6A 1G3TA 3C4SA 1I8FA 1NEGA 2X51A 3AHUA 3VUBA 1VQOA 5J26A 3OS2A 2NWMA 3V7CA 4C8QC 3OYIA 3EHQA 2YLCA 2L0AA 2FPFA 2HSEB 2LT1A 1FMKA 3JCMg 2MMPA 2JTEA 3OBWA 4DBRA 3VS4A 3NTIA 5KE3A 2BE7D 2J6FA 2RN8A 1MV3A 5D6WA 4FM4B 1PG5B 2DBMA 2EKOA 1WX6A 2CGHA 5D7UA 5LL6S 4J9BA 2F5TX 2JTMA 4C8QE 4ESRA 4JS5A 4DA4A 3MCAB 3CCMA 2R5AA 2VASA 3FIFA 1SHGA 3QWXX 5CKHA 2GNCA 3JCMV 2F2WA 2XMFA 3RBBB 1Y7XA 5I11A 1KD1C 1NE8A 4C8QA 3CCJT 3PNWC 4M7DG 2DEQA 1R77A 1B07A 4RCBA 2IIMA 1PRMC 1TOVA 3G6EQ 3CC4T 4C5GA 4KRTA 3VRZA 4RMOA 4KH0B 4A4EA 2K5LA
chains in the Genus database with same CATH topology
1OOTA 1UG1A 2D1XA 2K2MA 3H0IA 4F14A 4OMNA 1HD3A 5I22A 1T0HA 2O2OA 1JXOA 4J9DA 3H41A 2GTJA 2DX1A 3H0HA 2J7IA 1SEMA 2KT1A 1S1NA 1GBQA 1E6GA 2DVJA 1UFFA 2HCKA 4RTZA 1YNZA 2MIOA 4DEYA 2EYYA 1WXBA 2RQTA 2LCSA 2X3XD 4OMQA 4JJDA 1PHTA 2J05A 2D0NA 3FJ5A 4LNPA 1ABQA 2AKLA 3LH5A 1GRIA 1J3TA 2RNAA 2CUDA 4M4ZA 1IO6A 1Y0MA 2KGTA 1KFZA 1OV3A 1RLQC 5IH2A 1ZSGA 1H8KA 1X6GA 1V1CA 2G6FX 3VS6A 1U06A 4JZ3A 4Z8AA 1W70A 2BZXA 1YN8A 3REAB 1E6HA 1NLOC 3NHNA 4CC4B 2F2VA 1UGVA 4AG2C 1GFDA 1GL5A 4J9HA 2OJ2A 4J9GA 4ZNXA 1PKTA 2LX7A 2JM8A 2C0OA 2LZ6B 2O31A 5IHNA 2CSIA 4D8KA 4OMPA 1SSHA 1BBZA 1UTIA 1MV0B 2AZVA 2EW3A 1X69A 1WLPB 2YUNA 2LJ3A 3QWYA 4JJCA 1SHFA 3EGUA 3NPFA 2LQNA 1H3HA 3VS1A 4HCKA 2BTTA 1X43A 2C0IA 2KE9A 5FWCA 1WFWA 1Z9QA 4IIOA 3PVLA 1HJDA 1H92A 1T3LA 1GCQC 1N5ZA 3CQTA 1HSQA 2D8HA 2L3PA 4HVVA 1T0JA 4CC7A 3M0RA 2KEAA 3I5SA 2EVRA 2DL4A 2QDLA 2M0YA 1NG2A 2VVKA 1YCSB 2DL8A 1GBRA 2DBKA 5EC7A 3SEMA 1RLPC 2BZYA 2HBWA 2LJ0A 2V1RA 1CKBA 1QWEA 2YUQA 2FO0A 1OEBA 2AZSA 2K7AA 2L2PA 3VRYA 4GLMA 2CH4W 2EGEA 2HSPA 4FSSA 5L23A 1PNJA 2RPNA 2AK5A 1NEBA 2DA9A 1G2BA 1YWOA 1ABOA 2JM9A 4RTXA 2CREA 3REBB 1FYNA 1WA7A 2RQVA 3H0FA 4HVWA 3EG1A 2DILA 2VWFA 3VS0A 1AWJA 2RQWA 1T3SA 2L3QA 2ABLA 2LJ1A 2EGCA 2H8HA 1GCQA 1X2QA 2ENMA 3KFVA 2KT8A 2KYMA 4A63B 1PKSA 1AEYA 1WDXA 3M0QA 4QT7A 2J6OA 3EG0A 2JW4A 2CT3A 1AZGB 1EFNA 1U3OA 2CDTA 1GCPA 2PZ1A 3ZL7C 2GTOA 3NMZC 2F2XA 2P4RA 2KRNA 4RTVA 2CSQA 3I35A 1AWOA 2KYBA 4JJBA 1JO8A 1VYVA 2EYXA 1PRLC 4AFUC 1NYFA 2DRMA 2K79A 2DLPA 2KR3A 4OMLA 2DL3A 2YUPA 2W10A 1QKXA 3I5RA 2ED1A 1B3QA 1JU5C 4AG1C 2KROA 2O88A 1QWFA 2MCNA 1I1JA 1WIEA 2FRYA 5FW9A 2DL7A 4CC2A 1W6XA 1QLYA 4F16A 1NYGA 1CSKA 1I07A 2YUOA 1ZUKA 2I0NA 3M0SA 4WCIA 4RTUA 1SRMA 2GBQA 1M3BA 5IXBA 2B86A 2DRKA 2DJQA 2LMJA 3UF4A 2JMCA 2O9SA 4D8DA 1KSWA 1ARKA 1ZUUA 5IHIA 3UA7A 4CC3A 2E5KA 3IQLA 3TSWA 2J06A 2SRCA 4JZ4A 2A36A 2MOXA 4JPBW 1VYUA 2D8JA 1K9AA 3VS5A 4EIKA 1M3CA 1WI7A 2JMAA 1GFCA 1RUWA 1TG0A 5HCKA 2KRMA 1CKAA 3U23A 1TUDA 1M27C 4J9IA 3VS7A 2ECZA 1QKWA 4ORZA 1I0CA 1BU1A 2RQRA 1M3AA 1ZBJA 2DMOA 1UDLA 1PWTA 2K9GA 4OMOA 4F17A 2A28A 2EPDA 1AWXA 1ZLMA 3EG3A 1NM7A 3RNJA 2VKNA 1WYXA 1UE9A 2ED0A 2FG0A 2RQUA 3THKA 1UJ0A 4LN2A 4LE9A 4LUEA 1JXMA 3UA6A 4Z89A 2JS0A 1AOJA 3M0PA 3TVTA 1KIKA 2K6DA 5ECAA 2EKHA 1WXTA 2JXBA 1ZUYA 4RTYA 2DYBA 1X6BA 1UUEA 2KRSA 1K76A 1UJYA 2YDLA 2LQWA 2RF0A 1NLPC 4RUGA 1M30A 1X27A 2ROTA 4DEXA 1AD5A 2BZ8A 2KBTA 4J9EA 3UATA 1SPKA 5GJVB 5IHKA 2KXCA 1Z9ZA 4R0KA 3A98A 2X3WD 3I9QA 2CT4A 1YWPA 3R6NA 3PE0A 2L3SA 3JV3A 3NGPA 2HDAA 2PTKA 1BB9A 2NUZA 2EQIA 2PNIA 4RTTA 2ROLA 1RI9A 1UHFA 1AWWA 2A37A 2W0ZA 2FRWA 3EHRA 1SRLA 1VYTA 1K1ZA 2JS2A 2LP5A 2RMOA 2ESWA 1X2KA 2YT6A 2K3BA 4X1VA 1M8MA 1K0SA 4E6RA 1WXUA 2EYZA 4AFZC 1XOVA 4GBQA 4Y92A 1KJWA 1VA7A 1U5SA 4AFSC 2OI3A 4RTWA 3VS3A 5GJWB 4K11A 2FPDA 3M0UA 2O9VA 2GGRA 1YP5A 5IXFA 1W1FA 2DF6A 2FEIA 3M0TA 4HXJA 1NEGA 1E7OA 2NWMA 3EHQA 4HVUA 2L0AA 2FPFA 1G83A 3GBQA 1FMKA 3VS2A 2J6KA 2GQIA 2AKKA 2JTEA 2SEMA 1Y57A 3VS4A 1JQQA 2FPEA 2J6FA 2RN8A 1MV3A 1LCKA 1OPLA 2DBMA 4AFQC 1WX6A 1A0NB 3PVQA 4J9BA 3ULRB 2V1QA 2DNUA 2EGAA 2C0TA 2KNBB 4ESRA 2DM1A 4IIMA 3O5ZA 5FWBA 2JT4A 1K4US 1UHCA 2EBPA 1TUCA 1SHGA 2DE0X 2YSQA 2CUBA 3QWXX 2KXDA 2GNCA 2DL5A 4J9CA 2F2WA 2XMFA 3RBBB 5I11A 3C0CA 1MUZA 2M51A 4LUDA 1JEGA 2CH4A 1BK2A 3TSZA 1QCFA 1ZX6A 2A08A 1B07A 2EYWA 4OMMA 1OPKA 3SHWA 2IIMA 2HEQA 1PRMC 1K0XA 2OAWA 4KRTA 3VRZA 1UECA 4Z88A 1AZEA 3EG2A 4J9FA 2LNHB 1AVZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOT A;  1UG1 A;  2D1X A;  2K2M A;  3H0I A;  4F14 A;  4OMN A;  1HD3 A;  5I22 A;  1T0H A;  2O2O A;  1JXO A;  4J9D A;  3H41 A;  2GTJ A;  2DX1 A;  3H0H A;  2J7I A;  1SEM A;  2KT1 A;  1S1N A;  1GBQ A;  1E6G A;  2DVJ A;  1UFF A;  2HCK A;  4RTZ A;  1YNZ A;  2MIO A;  4DEY A;  2EYY A;  1WXB A;  2RQT A;  2LCS A;  2X3X D;  4OMQ A;  4JJD A;  1PHT A;  2J05 A;  2D0N A;  3FJ5 A;  4LNP A;  1ABQ A;  2AKL A;  3LH5 A;  1GRI A;  1J3T A;  2RNA A;  2CUD A;  4M4Z A;  1IO6 A;  1Y0M A;  2KGT A;  1KFZ A;  1OV3 A;  1RLQ C;  5IH2 A;  1ZSG A;  1H8K A;  1X6G A;  1V1C A;  2G6F X;  3VS6 A;  1U06 A;  4JZ3 A;  4Z8A A;  1W70 A;  2BZX A;  1YN8 A;  3REA B;  1E6H A;  1NLO C;  3NHN A;  4CC4 B;  2F2V A;  1UGV A;  4AG2 C;  1GFD A;  1GL5 A;  4J9H A;  2OJ2 A;  4J9G A;  4ZNX A;  1PKT A;  2LX7 A;  2JM8 A;  2C0O A;  2LZ6 B;  2O31 A;  5IHN A;  2CSI A;  4D8K A;  4OMP A;  1SSH A;  1BBZ A;  1UTI A;  1MV0 B;  2AZV A;  2EW3 A;  1X69 A;  1WLP B;  2YUN A;  2LJ3 A;  3QWY A;  4JJC A;  1SHF A;  3EGU A;  3NPF A;  2LQN A;  1H3H A;  3VS1 A;  4HCK A;  2BTT A;  1X43 A;  2C0I A;  2KE9 A;  5FWC A;  1WFW A;  1Z9Q A;  4IIO A;  3PVL A;  1HJD A;  1H92 A;  1T3L A;  1GCQ C;  1N5Z A;  3CQT A;  1HSQ A;  2D8H A;  2L3P A;  4HVV A;  1T0J A;  4CC7 A;  3M0R A;  2KEA A;  3I5S A;  2EVR A;  2DL4 A;  2QDL A;  2M0Y A;  1NG2 A;  2VVK A;  1YCS B;  2DL8 A;  1GBR A;  2DBK A;  5EC7 A;  3SEM A;  1RLP C;  2BZY A;  2HBW A;  2LJ0 A;  2V1R A;  1CKB A;  1QWE A;  2YUQ A;  2FO0 A;  1OEB A;  2AZS A;  2K7A A;  2L2P A;  3VRY A;  4GLM A;  2CH4 W;  2EGE A;  2HSP A;  4FSS A;  5L23 A;  1PNJ A;  2RPN A;  2AK5 A;  1NEB A;  2DA9 A;  1G2B A;  1YWO A;  1ABO A;  2JM9 A;  4RTX A;  2CRE A;  3REB B;  1FYN A;  1WA7 A;  2RQV A;  3H0F A;  4HVW A;  3EG1 A;  2DIL A;  2VWF A;  3VS0 A;  1AWJ A;  2RQW A;  1T3S A;  2L3Q A;  2ABL A;  2LJ1 A;  2EGC A;  2H8H A;  1GCQ A;  1X2Q A;  2ENM A;  3KFV A;  2KT8 A;  2KYM A;  4A63 B;  1PKS A;  1AEY A;  1WDX A;  3M0Q A;  4QT7 A;  2J6O A;  3EG0 A;  2JW4 A;  2CT3 A;  1AZG B;  1EFN A;  1U3O A;  2CDT A;  1GCP A;  2PZ1 A;  3ZL7 C;  2GTO A;  3NMZ C;  2F2X A;  2P4R A;  2KRN A;  4RTV A;  2CSQ A;  3I35 A;  1AWO A;  2KYB A;  4JJB A;  1JO8 A;  1VYV A;  2EYX A;  1PRL C;  4AFU C;  1NYF A;  2DRM A;  2K79 A;  2DLP A;  2KR3 A;  4OML A;  2DL3 A;  2YUP A;  2W10 A;  1QKX A;  3I5R A;  2ED1 A;  1B3Q A;  1JU5 C;  4AG1 C;  2KRO A;  2O88 A;  1QWF A;  2MCN A;  1I1J A;  1WIE A;  2FRY A;  5FW9 A;  2DL7 A;  4CC2 A;  1W6X A;  1QLY A;  4F16 A;  1NYG A;  1CSK A;  1I07 A;  2YUO A;  1ZUK A;  2I0N A;  3M0S A;  4WCI A;  4RTU A;  1SRM A;  2GBQ A;  1M3B A;  5IXB A;  2B86 A;  2DRK A;  2DJQ A;  2LMJ A;  3UF4 A;  2JMC A;  2O9S A;  4D8D A;  1KSW A;  1ARK A;  1ZUU A;  5IHI A;  3UA7 A;  4CC3 A;  2E5K A;  3IQL A;  3TSW A;  2J06 A;  2SRC A;  4JZ4 A;  2A36 A;  2MOX A;  4JPB W;  1VYU A;  2D8J A;  1K9A A;  3VS5 A;  4EIK A;  1M3C A;  1WI7 A;  2JMA A;  1GFC A;  1RUW A;  1TG0 A;  5HCK A;  2KRM A;  1CKA A;  3U23 A;  1TUD A;  1M27 C;  4J9I A;  3VS7 A;  2ECZ A;  1QKW A;  4ORZ A;  1I0C A;  1BU1 A;  2RQR A;  1M3A A;  1ZBJ A;  2DMO A;  1UDL A;  1PWT A;  2K9G A;  4OMO A;  4F17 A;  2A28 A;  2EPD A;  1AWX A;  1ZLM A;  3EG3 A;  1NM7 A;  3RNJ A;  2VKN A;  1WYX A;  1UE9 A;  2ED0 A;  2FG0 A;  2RQU A;  3THK A;  1UJ0 A;  4LN2 A;  4LE9 A;  4LUE A;  1JXM A;  3UA6 A;  4Z89 A;  2JS0 A;  1AOJ A;  3M0P A;  3TVT A;  1KIK A;  2K6D A;  5ECA A;  2EKH A;  1WXT A;  2JXB A;  1ZUY A;  4RTY A;  2DYB A;  1X6B A;  1UUE A;  2KRS A;  1K76 A;  1UJY A;  2YDL A;  2LQW A;  2RF0 A;  1NLP C;  4RUG A;  1M30 A;  1X27 A;  2ROT A;  4DEX A;  1AD5 A;  2BZ8 A;  2KBT A;  4J9E A;  3UAT A;  1SPK A;  5GJV B;  5IHK A;  2KXC A;  1Z9Z A;  4R0K A;  3A98 A;  2X3W D;  3I9Q A;  2CT4 A;  1YWP A;  3R6N A;  3PE0 A;  2L3S A;  3JV3 A;  3NGP A;  2HDA A;  2PTK A;  1BB9 A;  2NUZ A;  2EQI A;  2PNI A;  4RTT A;  2ROL A;  1RI9 A;  1UHF A;  1AWW A;  2A37 A;  2W0Z A;  2FRW A;  3EHR A;  1SRL A;  1VYT A;  1K1Z A;  2JS2 A;  2LP5 A;  2RMO A;  2ESW A;  1X2K A;  2YT6 A;  2K3B A;  4X1V A;  1M8M A;  1K0S A;  4E6R A;  1WXU A;  2EYZ A;  4AFZ C;  1XOV A;  4GBQ A;  4Y92 A;  1KJW A;  1VA7 A;  1U5S A;  4AFS C;  2OI3 A;  4RTW A;  3VS3 A;  5GJW B;  4K11 A;  2FPD A;  3M0U A;  2O9V A;  2GGR A;  1YP5 A;  5IXF A;  1W1F A;  2DF6 A;  2FEI A;  3M0T A;  4HXJ A;  1NEG A;  1E7O A;  2NWM A;  3EHQ A;  4HVU A;  2L0A A;  2FPF A;  1G83 A;  3GBQ A;  1FMK A;  3VS2 A;  2J6K A;  2GQI A;  2AKK A;  2JTE A;  2SEM A;  1Y57 A;  3VS4 A;  1JQQ A;  2FPE A;  2J6F A;  2RN8 A;  1MV3 A;  1LCK A;  1OPL A;  2DBM A;  4AFQ C;  1WX6 A;  1A0N B;  3PVQ A;  4J9B A;  3ULR B;  2V1Q A;  2DNU A;  2EGA A;  2C0T A;  2KNB B;  4ESR A;  2DM1 A;  4IIM A;  3O5Z A;  5FWB A;  2JT4 A;  1K4U S;  1UHC A;  2EBP A;  1TUC A;  1SHG A;  2DE0 X;  2YSQ A;  2CUB A;  3QWX X;  2KXD A;  2GNC A;  2DL5 A;  4J9C A;  2F2W A;  2XMF A;  3RBB B;  5I11 A;  3C0C A;  1MUZ A;  2M51 A;  4LUD A;  1JEG A;  2CH4 A;  1BK2 A;  3TSZ A;  1QCF A;  1ZX6 A;  2A08 A;  1B07 A;  2EYW A;  4OMM A;  1OPK A;  3SHW A;  2IIM A;  2HEQ A;  1PRM C;  1K0X A;  2OAW A;  4KRT A;  3VRZ A;  1UEC A;  4Z88 A;  1AZE A;  3EG2 A;  4J9F A;  2LNH B;  1AVZ C; 
#chains in the Genus database with same CATH topology
 2D1X A;  2DK3 A;  3CD6 T;  1BCO A;  3H0I A;  4F14 A;  1YHQ A;  1JXO A;  4J9D A;  4M78 F;  1W4S A;  2GTJ A;  4JLG A;  2JTF A;  1GBQ A;  1E6G A;  4RTZ A;  4JRP A;  2DD5 A;  4KGX B;  3MPU B;  1HXD A;  2LX9 A;  3CCJ Q;  2LQK A;  4PJJ A;  2FHD A;  2EYY A;  1WXB A;  2LCS A;  1VQ4 A;  2CZ6 B;  3CBP A;  1KHC A;  1M1G A;  1ACM B;  2J05 A;  2KI7 A;  3V7S A;  3CPF A;  1GRI A;  1BI3 A;  2RNA A;  5GAN d;  1IO6 A;  1UB4 A;  4QQD A;  3HTR A;  1KFZ A;  2FB7 A;  5EG2 A;  3CD6 Q;  2ZPB B;  3X24 B;  1X6G A;  1V1C A;  5LJ3 e;  2K57 A;  5A0D A;  2E5Q A;  1W70 A;  1VOM A;  2HL5 C;  4Y91 A;  5I2S A;  3L2Z A;  4E7H A;  3EG9 B;  2R58 A;  1UGV A;  3CC2 T;  3URG A;  1OZ2 A;  1GL5 A;  1TU0 B;  2RD1 A;  1BIA A;  4ANJ A;  3EGX A;  2LX7 A;  2A3L A;  4X9D A;  4EDU A;  2C0O A;  3GNG A;  4D8K A;  4OMP A;  1SSH A;  3KUF A;  3SFM A;  2AZV A;  3CCV A;  5LJ5 d;  2ZGW A;  4M77 B;  2QQB A;  3EG9 A;  4M77 E;  3H6Z A;  3TRE A;  3QWY A;  1IGU A;  2R57 A;  3NPF A;  4DBQ A;  4M7A B;  3VS1 A;  4HCK A;  4M7A E;  4IIO A;  1HJD A;  1MGQ A;  3OYK A;  2QK0 A;  1T3L A;  1GCQ C;  3KBG A;  1K9M C;  1Q82 U;  2I2L A;  4HVV A;  2LCC A;  5L8R E;  3M4Y A;  3X28 B;  2EVR A;  3X20 B;  3OYD A;  2QDL A;  2CZ0 B;  1PD1 A;  1YBY A;  3L2W A;  3CMA A;  4M77 A;  2PVD B;  1YCS B;  1I5L A;  4M7A A;  1K8A R;  3E9G A;  2BZY A;  1VQM T;  2EJF A;  3G71 Q;  1CKB A;  1SKU B;  2L2P A;  5GAM g;  1N9R A;  2VXE A;  2EFI A;  5IAY A;  2HSP A;  2DIG A;  3FRN A;  4FSS A;  1PNJ A;  3A8L B;  4M75 F;  1Q81 C;  2DA9 A;  2MYS A;  1G2B A;  1Q82 R;  2JM9 A;  1U8R A;  1BKB A;  1SF9 A;  1Q95 G;  3FEO A;  1QP2 A;  3CCR A;  1WA7 A;  2COW A;  3DKM A;  1AWJ A;  2LRQ A;  1T3S A;  2L3Q A;  2RI3 A;  3CCS T;  2H8H A;  1GCQ A;  3J80 E;  2KYM A;  1Q7Y R;  3M9Q A;  5DY9 A;  4QT7 A;  4HT9 A;  3EG0 A;  2PUK B;  3UT1 A;  3GP8 A;  1GCP A;  4UC4 A;  1NPP A;  2PZ1 A;  2F2X A;  3NTH A;  4RTV A;  2CSQ A;  4JS4 A;  1PRL C;  1NYF A;  3NTK A;  4QKU A;  1N8R U;  2DLP A;  3FDR A;  4QVC A;  3GIB A;  4JRK A;  1B3Q A;  2O88 A;  1AHJ B;  5J39 A;  1VQ9 Q;  1JJ2 A;  4A54 A;  2NUT B;  1I07 A;  2RHZ A;  1ZUK A;  3M0S A;  4B9W A;  1ZQ1 A;  2DVE A;  5GAN j;  3M56 A;  4KT0 E;  5DLO A;  4M7D C;  2DTH A;  2J06 A;  3I55 T;  5KYX B;  4FT2 A;  2EQK A;  1KC8 U;  4EIK A;  4XU1 A;  5GAN g;  4PJO D;  3SWN C;  1RUW A;  1WHJ A;  1TG0 A;  2XDD A;  3DLM A;  4P5N A;  3JCM h;  1M27 C;  4J9I A;  3PTA A;  2ECZ A;  4FIB A;  4E7I A;  2HKQ B;  4FYV B;  4PL6 A;  4OMO A;  1UDL A;  1I81 A;  2HBP A;  5KYX A;  4E7K A;  3E19 A;  2EPD A;  3OS5 A;  1MMG A;  3ZFJ A;  2EWN A;  2RHY A;  1NM7 A;  3RNJ A;  3P8D A;  1UGR B;  4M78 G;  4M7D B;  4M7D E;  2JN0 A;  1FX7 A;  1X6O A;  3EH2 A;  3CME A;  2FG0 A;  2RQU A;  3UA6 A;  1AOJ A;  3I55 Q;  1KC8 R;  2E3H A;  2EKH A;  2QEX Q;  2OTJ A;  2RHX A;  4C92 D;  3DLL A;  2DYB A;  3RER A;  3G4S Q;  5LJ5 g;  2PUO B;  4J6Y A;  4M7D A;  5CO7 A;  5FRM A;  2RF0 A;  1NLP C;  1VIE A;  4OMF B;  3AT1 B;  4DEX A;  4J9E A;  5FU7 C;  5GJV B;  2CP6 A;  2KXC A;  3GF5 A;  3OYE A;  4R0K A;  3WXM B;  3M55 A;  2X3W D;  1IZ6 A;  1YWP A;  1IB8 A;  2CZ1 B;  3R6N A;  9ATC B;  3CCL T;  4OGE A;  2HDA A;  5GAO p;  2PU9 B;  2WSE E;  2DIQ A;  1Y96 B;  4ZTJ A;  4YTL A;  1YIJ A;  4HCB A;  3JCM e;  1IXD A;  1UHF A;  2A0F B;  5CKE A;  3MP8 A;  2LP5 A;  3OYM A;  2Z0W A;  3HKS A;  1K0S A;  1LPL A;  1WXU A;  1Y96 A;  2DTI A;  5HY6 A;  3M0U A;  1N6A A;  4KBM B;  3CC7 T;  2V8J A;  5FRO A;  1YP5 A;  2DXC A;  3EAE A;  1E7O A;  4DQ2 A;  4EMK C;  1MMA A;  1DJ7 B;  2FZC B;  1M9S A;  2BE9 B;  1VQN A;  2XD0 A;  1WJQ A;  3VS2 A;  5KE2 A;  1NJI R;  2SEM A;  4QQ6 A;  1D0Y A;  4LXC A;  2ZPI B;  4OF1 A;  1LCK A;  1OPL A;  4M75 G;  1JJ2 P;  3HRS A;  4BY6 C;  4LD9 K;  3FB9 A;  1VQO T;  4J7F A;  2V1Q A;  4C8Q D;  4JRQ A;  1TWB A;  3EGD B;  4E7Z A;  2DM1 A;  2L89 A;  1YJW Q;  3BW1 A;  3VKI A;  2LTO A;  2E1H A;  5CQY A;  2QQ9 A;  2QTV A;  2KXD A;  4J9C A;  1WPY A;  2K2V A;  2PQW A;  3LYI A;  3A8M B;  4BE2 A;  1VQ7 Q;  1M2V B;  3L2V A;  3ZEH A;  3CCE T;  4QVZ A;  1VQK Q;  1JEG A;  4DOW A;  1ZX6 A;  1VQ8 T;  2EYW A;  3CBM A;  2MWP A;  1Q86 C;  1K0X A;  1VQL T;  3VUZ A;  2DEU A;  3OBY A;  1AZE A;  3EG2 A;  5GAM h;  2QGF B;  4PLL A;  1M2V A;  1UG1 A;  4B6M A;  2EJ9 A;  5I22 A;  5GAO r;  2O2O A;  1YI2 A;  3M59 A;  2DX1 A;  4PJO F;  4F7U F;  2KT1 A;  2BKD N;  2D6F A;  1QCN A;  2HCK A;  3L42 A;  4JDS A;  4XTW A;  1ZBX A;  3QZ9 B;  3EFR A;  3E1S A;  2X3X D;  4KUD K;  4OMQ A;  2D0N A;  4E47 A;  1IRE B;  3FJ5 A;  4XQ3 A;  3MJX A;  1VQP Q;  3PMT A;  1YJ9 A;  1Y0M A;  3CCM Q;  4RKU E;  1R8O B;  1V76 A;  1RLQ C;  1ZSG A;  4IKF A;  1G8X A;  1NBE B;  2COZ A;  1JB0 E;  2WAC A;  3VS6 A;  4JZ3 A;  1RL2 A;  1EX4 A;  4KGZ B;  2KMT A;  3REA B;  4M78 C;  2K3Y A;  4C92 F;  1VQ4 T;  3UWN A;  4CC4 B;  1MMN A;  1GFD A;  1JBM A;  4BE1 A;  2YRV A;  2OTL A;  5GAM e;  4J9G A;  5AYF A;  2JM8 A;  2BIV A;  3CCU A;  1D1B A;  2DJZ A;  1UGS B;  2O31 A;  2YWW A;  2QA4 A;  1LVK A;  2VC8 A;  2MK5 A;  1MV0 B;  1YHQ Q;  3G6E T;  2RJC A;  1WLP B;  4M77 D;  2YUN A;  2LJ3 A;  1SHF A;  4M7A D;  1H3H A;  2AT1 B;  4NS5 A;  2QDY B;  4C5I A;  1BI0 A;  4M78 E;  4C8Q B;  3JCM X;  3C12 A;  2KE9 A;  4XU2 A;  1Z9Q A;  2QGG A;  2H3J A;  2XKO C;  1N5Z A;  3CQT A;  2D8H A;  2L3P A;  1VQP A;  4EPC A;  1VQ5 A;  5J3B A;  3I56 A;  1JJ2 S;  2KEA A;  2VYT A;  1VQ4 Q;  1PSF A;  3JCM c;  3S3O A;  3CCV T;  1GBR A;  2DBK A;  4M78 A;  2MWO A;  2QTX A;  3JSC A;  3SEM A;  3DB3 A;  2DTO A;  5LJ3 h;  4ZGJ B;  4LDU A;  3M53 A;  1QWE A;  2K3X A;  4HT8 A;  4GLM A;  4X9C A;  1R0B G;  4OB2 B;  5D6X A;  3OYA A;  3JB9 G;  2AK5 A;  2GFA A;  2MPX C;  3MEW A;  3LH0 A;  4R55 A;  3RIR A;  4XK8 E;  1GXI E;  2FL7 A;  4RTX A;  4J83 A;  2CRE A;  3REB B;  1ZSZ C;  1G5V A;  1PCX A;  2DIL A;  2VWF A;  3TCJ A;  3M58 A;  4IUQ A;  4X34 A;  2ABL A;  1X2Q A;  2AIR B;  5GAM f;  3KFV A;  3VYG A;  3CCV Q;  3OB9 A;  1PKS A;  1AEY A;  2XDB A;  2RH2 A;  2GFU A;  3UPU A;  2JW4 A;  2EQU A;  1EFN A;  2CDT A;  1U3O A;  3WVE B;  3ZL7 C;  3P8B B;  3NMZ C;  4AMC A;  2KRN A;  1M1K U;  2YXY A;  4C8Q F;  3I35 A;  5GAN e;  2KYB A;  3CCR T;  1OU9 A;  2EYX A;  2VXF A;  4N4H A;  4J8O A;  2DRM A;  2K79 A;  4M75 C;  3CMA Q;  1N9S A;  3EGX B;  3OA6 A;  2DL3 A;  4OB1 B;  3T9N A;  3OMG A;  1JU5 C;  4AG1 C;  1P92 A;  3QII A;  1PSE A;  1RAE B;  8ATC B;  1QWF A;  2MCN A;  1WIE A;  2DL7 A;  1M90 R;  3UDC A;  3JB9 I;  2X4J A;  3RKW A;  3HSB A;  1CSK A;  4WCI A;  2I0N A;  3HFO A;  1N8R C;  1I5O B;  1WJS A;  3HL8 A;  1M1K R;  2B86 A;  2LMJ A;  2DJQ A;  4KGV B;  3CCQ Q;  1G3Y A;  5LJ3 d;  2O9S A;  3MEA A;  3G71 T;  4PJL A;  1UGQ B;  1KSW A;  1K8A U;  5HK0 A;  2ATC B;  3RR6 A;  2CYZ B;  4OB0 B;  5KYN A;  3OS1 A;  1ZUU A;  4CC3 A;  5LJ5 e;  3CCR Q;  3TSW A;  1W2B P;  2MOX A;  4JPB W;  2GCX A;  1K9A A;  1G3S A;  2C06 A;  1WI7 A;  2JMA A;  4PFP A;  2KRM A;  1CKA A;  4GLK A;  4F04 B;  4BE0 A;  3U23 A;  5GAN 5;  1M4Z A;  2VV5 A;  1QKW A;  4ORZ A;  1BU1 A;  2RQR A;  1PWT A;  4Y28 E;  4MDX A;  4ZGD B;  1M1F A;  1ZLM A;  3MHX A;  3EG3 A;  3CPW A;  1KD1 U;  4J6X A;  5KH6 A;  4M7D D;  2HD0 A;  3SDZ A;  4XTY A;  4PJO G;  4F7U G;  2Y4X A;  4LN2 A;  1Q7Y U;  3MP1 A;  2D9T A;  1JXM A;  4Z89 A;  3OYL A;  2K6D A;  5ECA A;  4E7L A;  1SG5 A;  2JXB A;  3CCQ A;  5LJ3 f;  1XQH A;  2VB6 A;  1K76 A;  2RB6 A;  4LDW A;  5KYY B;  4JUV A;  3C95 A;  4XTV A;  1QVP A;  2ROT A;  2BZ8 A;  2KBT A;  4MMK A;  3FC3 A;  1KD1 R;  5IHK A;  1ZHI A;  2RO0 A;  3A98 A;  3QYG B;  1G3W A;  1KQS P;  2M1H A;  3DB4 A;  2G3R A;  3PE0 A;  1VQ9 T;  2L3S A;  2Y4Y A;  4C92 G;  3JV3 A;  4ZN3 A;  1U1T A;  1MND A;  1D0X A;  3EFO A;  1D0Z A;  5KYY A;  4FU6 A;  4M77 F;  5CIU A;  4FT4 A;  2JVV A;  2PNI A;  4M7A F;  2F5K A;  4IUP A;  2A37 A;  2RI2 A;  2FRW A;  3EHR A;  1AWW A;  3M5A A;  2M16 A;  1YFN A;  3VYH B;  2ESW A;  5GMK h;  2HMA A;  5CVI A;  3LWI A;  2X35 A;  2KQW A;  1OX9 A;  4FYW B;  2EYZ A;  4AFZ C;  4Y92 A;  3CME Q;  3CC2 A;  3ME9 A;  2PVO B;  1OZ3 A;  3RKY A;  1U5S A;  1C0M A;  3JCM b;  3OYJ A;  2OI3 A;  4II1 A;  4RTW A;  2P0K A;  5KCH A;  3VS3 A;  2DD4 A;  4K11 A;  2GGR A;  1I4K 1;  1W1F A;  2FEI A;  2OTJ Q;  3M0T A;  3SB2 A;  5A0L A;  4HXJ A;  1K73 C;  7AT1 B;  1HYO A;  3V7R A;  3GOX A;  2CP7 A;  2V8K A;  2BUD A;  2QEX T;  2L8D A;  2J6K A;  2GQI A;  2RHU A;  3G4S T;  3MP6 A;  1Y57 A;  3LLR A;  1JQQ A;  2FPE A;  4ME7 A;  2VGM A;  3E2U A;  4AFQ C;  1W2B S;  3R6O A;  2ZPG B;  1YIJ Q;  1JRI A;  1MNE A;  3HPW A;  5LJ3 j;  2P0Q A;  3ULR B;  1O75 A;  2DNU A;  1VQM A;  1WGS A;  5GMK e;  4OGC A;  3LWH A;  2RA2 A;  2EGA A;  2KNB B;  4IIM A;  1QVG S;  2JT4 A;  4EMH A;  2EBP A;  3SWN B;  4E7J A;  1TUC A;  2DE0 X;  2YSQ A;  3OYH A;  4MML A;  4C0D C;  4HCC A;  1HK9 A;  3MO8 A;  3S3M A;  1K9M R;  1MUZ A;  2DET A;  1MHN A;  4LUD A;  1VIF A;  2CH4 A;  3C94 A;  1QCF A;  3M54 A;  4OMM A;  3QBY A;  2HEQ A;  3CPW P;  3G7Z A;  2OAW A;  3SWN A;  1QP3 A;  5CQX A;  1IRX A;  1FWZ A;  4IUR A;  1UEC A;  4Z88 A;  2LT4 A;  3L2U A;  2LNH B;  1AVZ C;  1WQ7 A;  1OOT A;  2K2M A;  3RMS A;  1VQN Q;  4IUV A;  4OMN A;  4NL2 A;  1NPR A;  1ZA1 B;  1UEB A;  3CXC P;  1T0H A;  3H41 A;  2E6N A;  4A53 A;  5D6Y A;  5CR2 A;  1Q81 R;  2J7I A;  2ZPF B;  2ZZD A;  5M9O A;  1SEM A;  1S1N A;  2QI2 A;  3KXT A;  1YNZ A;  5FU7 B;  1KQS S;  4LDX A;  2MIO A;  4DEY A;  3QUI A;  3A8O B;  3H8Z A;  3RDV A;  1NJI U;  1X75 C;  1LNX A;  1KK7 A;  4WF2 A;  2AKL A;  2NUP A;  2HZY A;  3ASK A;  1J3T A;  3JCM d;  4M7D F;  3TQ7 P;  5GAN 6;  3OYG A;  2MI6 A;  1YI2 T;  2Y90 A;  2KGT A;  1OV3 A;  5IH2 A;  4EMG A;  2DXU A;  3HRT A;  3OW2 P;  3SD4 A;  2G6F X;  4HKE A;  5I21 A;  3Q1J A;  4Z8A A;  2BZX A;  1YJW T;  4N4G A;  1D3B B;  4FYY B;  1E6H A;  1TH7 A;  1NLO C;  4XU3 A;  1WZO A;  3NHN A;  2F2V A;  4PJO C;  4MZP A;  5GAN 7;  3PFS A;  3ER0 A;  1FXX A;  4J9H A;  1VQ7 T;  4N0A C;  4ZNX A;  1PKT A;  3BFM A;  2XG8 D;  1VQK T;  1KQ2 A;  2P84 A;  1D3B A;  2YRD A;  1X69 A;  5DM7 R;  4IUU A;  1BI2 A;  1YI2 Q;  3OYB A;  1TUG B;  1S72 A;  4M78 D;  3PGG A;  4EMK B;  3L2R A;  1X43 A;  2C0I A;  1QVF P;  1YIT A;  1H92 A;  5CAI A;  3JCM f;  2OTL T;  1BCM A;  2DO3 A;  1KHI A;  5FLX E;  2X4X A;  4LD6 A;  2E6Z A;  2QQR A;  4C92 C;  2DL4 A;  1RAH B;  1NG2 A;  2VVK A;  3S6W A;  5A2Q E;  4M77 G;  1B34 B;  2DL8 A;  4PJM A;  4BY6 B;  4EMK A;  4J7I A;  4M7A G;  1FMW A;  1YJ9 Q;  1M2O A;  1RLP C;  4F7U A;  2LJ0 A;  4J5Y A;  2FO0 A;  1OEB A;  2LVM A;  4B9X A;  1WNL A;  3VRY A;  2KY9 A;  2CH4 W;  1UGP B;  2EGE A;  2X4Y A;  2E70 A;  3JCM W;  2KVQ G;  1VQP T;  5L23 A;  2RPN A;  1RAF B;  3I56 T;  1B34 A;  3CCM T;  1NEB A;  1YWO A;  1ABO A;  2LQ8 A;  2ZAE A;  4XTU A;  2OTL Q;  4R56 A;  1FYN A;  3EFS A;  2RQV A;  3H0F A;  4HVW A;  4L59 A;  3PIO A;  2DPP B;  2RQW A;  3CPW S;  3CCU Q;  2QA4 Q;  4O5V A;  1XTD A;  2LJ1 A;  3JCM P;  3VU3 C;  5CK9 A;  5GMK l;  2KT8 A;  4A63 B;  3N5B B;  1PC0 A;  3M0Q A;  2KDS A;  3PT9 A;  2WSC E;  5GMK m;  2E12 A;  2H3E B;  3CXC S;  1TXQ A;  2KK4 A;  2P4T A;  1YHQ T;  2FZG B;  4A4H A;  4JJB A;  3CC7 A;  1VQ5 Q;  5GAN 2;  1V29 B;  2RHI A;  3I56 Q;  1WJR A;  3QO3 A;  2QYZ A;  2XHC A;  3TU4 K;  1W2B A;  2KR3 A;  5CKB A;  4FSX A;  2YUP A;  1QKX A;  3I5R A;  2RK2 A;  2DXB A;  1RAB B;  2QQS A;  1B7T A;  3LX7 A;  1BIB A;  1QVG A;  3VJP A;  1WHH A;  4KH1 B;  1I1J A;  2DZ9 A;  2FRY A;  5FW9 A;  4CC2 A;  4CRI A;  4N4I A;  4NL3 A;  2YUO A;  4RTU A;  1SRM A;  1M3B A;  2RJD A;  5IXB A;  2DRK A;  2M02 A;  3OW2 S;  3TEE A;  2M0O A;  3UF4 A;  2E41 A;  4DOV A;  2JMC A;  2F1L A;  4M75 D;  2CP2 A;  2VGN A;  2DYI A;  2E3I A;  2EQM A;  2L3R A;  4BDY A;  3UA7 A;  3IQL A;  4LDV A;  3X26 B;  2RJE A;  2SRC A;  4PJN A;  4JZ4 A;  2A36 A;  4XAX B;  2D8J A;  4M78 B;  2HQX A;  3V8J A;  2XU8 A;  3VS5 A;  3GLX A;  1VQ6 Q;  1M3C A;  5GAM d;  3D7S B;  2HQH A;  5HCK A;  1K8A C;  4BI8 B;  3OS0 A;  2R5M A;  3VS7 A;  5GAN h;  1AT1 B;  1TSF A;  1YJN A;  1I0C A;  1M3A A;  2DMO A;  4F17 A;  3CCE A;  2L5Q A;  4ZTF A;  2QQA A;  4Q5W A;  1XJW B;  4XTZ A;  2VKN A;  2EYQ A;  2XK0 A;  1VQ8 A;  2EAY A;  1RAI B;  3E9F A;  1QVF S;  1UE9 A;  2ED0 A;  4DBH A;  2LCL A;  1VQL A;  1QCO A;  1UJ0 A;  4VUB A;  1Q82 C;  4LE9 A;  1KQS A;  4LUE A;  2COY A;  3HRU A;  2JS0 A;  1Q86 U;  4E7S A;  3TVT A;  1OQK A;  2WSF E;  3A5Z B;  2NLU A;  3CMA T;  3QZ5 B;  2YDL A;  1Q7Y C;  3MKD A;  4RUG A;  3HP9 A;  1Y07 A;  1X27 A;  5LJ5 h;  2K5F A;  4C5H A;  2YLB A;  1Z9Z A;  1VQ6 A;  1MMD A;  4C0Z A;  5GAN 3;  4Z02 A;  2K5I A;  3CEY A;  3NGP A;  1Q86 R;  2PTK A;  2QAZ A;  3CCQ T;  1M90 U;  2NUZ A;  2EQJ A;  3QDF A;  3A1P A;  2QXF A;  1X01 A;  1RI9 A;  3OYF A;  1OU8 A;  2W0Z A;  1VYT A;  2FZK B;  1ZSZ B;  4A4K A;  1K1Z A;  2RI5 A;  4PLI A;  2YT6 A;  2DAQ A;  5GMK i;  2K3B A;  1H3Z A;  3FLG A;  1M8M A;  3RMQ A;  4E6R A;  1IHV A;  2DZC A;  2MAM A;  2HL3 A;  3CC4 Q;  1R0C B;  4FW2 A;  2FYK A;  1ZSZ A;  5KYU B;  4OP0 A;  1FMV A;  5GJW B;  3LGF A;  2FPD A;  4RG8 A;  1WHM A;  1VUB A;  4ELZ C;  4O6J A;  1KQ1 A;  3G6E A;  2CZ7 B;  4M77 C;  4M75 B;  4M75 E;  1OYX A;  2AHJ B;  1M5Q 1;  4M7A C;  2LNV A;  3A8G B;  4HVU A;  3EH1 A;  1N27 A;  1G83 A;  4JLI A;  5KYU A;  3GBQ A;  3L1A A;  2JUF A;  2AKK A;  3FJP A;  3BE3 A;  3GNF B;  4FL6 A;  2F69 A;  1QVG P;  4BD3 A;  4M75 A;  2YHT A;  4FW1 A;  4ZGE B;  3MET A;  2RK1 A;  3OQ5 A;  3CCJ A;  2GQV A;  1A0N B;  2PVG B;  3PVQ A;  4BI4 A;  1IHW A;  3RKX A;  1WHL A;  1XNI A;  1KC8 C;  2C0T A;  2HNI A;  3CC4 A;  4L6V 5;  3O5Z A;  5GAO l;  5FWB A;  1K4U S;  1UHC A;  5GAN f;  3OMC A;  5CCA A;  2LC4 A;  4XU0 A;  3QYH B;  3JB9 D;  5GAM j;  2CUB A;  5GAO m;  3CC2 Q;  2DL5 A;  3CD6 A;  3CXC A;  3A8H B;  3OSV A;  3C0C A;  3GPL A;  2M51 A;  3QJ6 A;  1BK2 A;  2P0P A;  3EFO B;  3TSZ A;  4WTO B;  2A08 A;  4LDY A;  4BUG A;  1OPK A;  3SHW A;  4IUT A;  5A0G A;  3CME T;  1RAA B;  3V8K A;  2FVU A;  3QDR B;  4FYX B;  2XDP A;  4HA8 A;  4BB7 A;  4MDW A;  3HFN A;  1O9S A;  4J9F A;  2DER A;  2OTJ T;  1HD3 A;  4L5G A;  4QQG A;  1LJO A;  5LJ5 f;  3F70 A;  4A4G A;  4C0F A;  3LW5 E;  3OW2 A;  3H0H A;  3RUX A;  3RES A;  1D1C A;  2DVJ A;  2A7Y A;  1UFF A;  2IPO B;  1ZA2 B;  3PMI A;  3QHS A;  1VQM Q;  2RQT A;  4JJD A;  1PHT A;  2X9H A;  4LNP A;  1ABQ A;  3QKJ A;  3LH5 A;  2CUD A;  1YIJ T;  4M4Z A;  3ZBD A;  1PD0 A;  3G71 A;  1H8K A;  5IT9 E;  1TS9 A;  1U06 A;  1NJI C;  1YN8 A;  2B8A A;  1OUL A;  3JCM Q;  1QVF A;  3OY9 A;  3CCS Q;  5IN1 A;  2EIF A;  3QXE B;  4AG2 C;  8AT1 B;  2RM4 A;  4J6W A;  2CP5 A;  2OJ2 A;  2XID A;  4PFZ A;  3J7A F;  5GAO q;  1QW1 A;  2LZ6 B;  1K9M U;  5IHN A;  2CSI A;  1OI1 A;  1BBZ A;  3L2Q A;  1UTI A;  4A4F A;  2EW3 A;  2V8I A;  1N8R R;  4JJC A;  3EGU A;  2LQN A;  3P8H A;  1EZZ B;  2JJ9 A;  2BTT A;  2NUT A;  2CP3 A;  5FWC A;  1WFW A;  4V2S A;  3PVL A;  1VQN T;  1IGQ A;  2KSS A;  4PFO A;  1HSQ A;  1T0J A;  2XIC A;  4CC7 A;  3M0R A;  3I5S A;  5CKD A;  2OAU A;  5LJ3 g;  2M0Y A;  3V8L A;  2IVW A;  5EC7 A;  1Q81 U;  2JOY A;  4C8Q G;  2E10 A;  4MZT A;  1OX8 A;  2HBW A;  1S72 T;  5LJ5 j;  1QMC A;  2V1R A;  2ZCF B;  1M8V A;  3CCS A;  2YUQ A;  2K7A A;  2AZS A;  2E65 A;  1YIT T;  1EIF A;  1VQ9 A;  5HK3 A;  2O4X B;  1D09 B;  3QSU A;  2MF2 A;  2OX7 A;  2D0Q B;  4C0D B;  3OYY A;  3JCM J;  3EG1 A;  2NUP B;  2GF7 A;  4AT1 B;  3VS0 A;  4E2F B;  1SSF A;  3HHT B;  2YRC A;  4OB3 B;  2EGC A;  2O4X A;  2ENM A;  4ELY C;  3JB9 J;  2JZ2 A;  3WVD B;  2ZPH B;  1WDX A;  4BDZ A;  5FRN A;  3OYC A;  1S72 Q;  2J6O A;  3JRZ A;  2XI9 A;  4KUL A;  2CT3 A;  4NOY A;  4KUI A;  1AZG B;  1C6V X;  1H64 1;  3JAM E;  4QVD A;  1PM3 A;  2GTO A;  1YIT Q;  3NFC A;  2P4R A;  3LGL A;  1RAC B;  1NZ9 A;  1AWO A;  1QQJ A;  1JO8 A;  1VYV A;  2EJG A;  3M4G A;  1WHG A;  1RAD B;  2M9U A;  3BDL A;  4AFU C;  4GY5 A;  2K4Y A;  1KG1 A;  5C0M A;  4JRI A;  4OML A;  3CBO A;  2W10 A;  3JB9 F;  3MEU A;  1K73 U;  2ED1 A;  2CS7 A;  2E4H A;  3I55 A;  2JNG A;  5GAN 8;  4FCY A;  4C0G A;  2KRO A;  4ZN1 A;  2QG9 B;  2QEX A;  3G4S A;  1W6X A;  3BDU A;  1QLY A;  4F16 A;  3CCL Q;  2ZPE B;  1NYG A;  5I2M A;  4BAC A;  3QG1 A;  2CKK A;  4RG2 A;  2GBQ A;  1YJ9 T;  1TTH B;  3VV0 A;  6AT1 B;  4D8D A;  4CI0 C;  1ARK A;  1BYM A;  1BI1 A;  5IHI A;  3J81 E;  3G1J A;  2E5K A;  3O8V A;  3X25 B;  4PKC C;  2DFU A;  2LDM A;  1VYU A;  1K73 R;  3OYN A;  3JB9 H;  2QAS A;  4PJO B;  4F7U B;  4JJN K;  4PJO E;  4F7U E;  5C6S A;  1GFC A;  3BY7 A;  2V26 A;  4QW2 A;  1TUD A;  2HAX A;  2E64 A;  4PK4 A;  3CCU T;  2QA4 T;  1F1B B;  1ZBJ A;  2K9G A;  2O01 E;  2A28 A;  4HCZ A;  1AWX A;  5AT1 B;  2NYS A;  3CC7 Q;  1WYX A;  4XTX A;  4PJO A;  5DLQ E;  4RCC A;  3THK A;  2X4W A;  4C5E A;  5KYW B;  5HKC A;  3PIP A;  4N0A A;  3M0P A;  4PNO A;  3CCL A;  1KIK A;  1U1S A;  4OVA A;  1VQ5 T;  5GAN 4;  1WXT A;  1YJN T;  2VUB A;  1ZUY A;  1D1A A;  4RTY A;  5CKF A;  4C92 B;  4C92 E;  1X6B A;  1UUE A;  2KRS A;  1UJY A;  3EGD A;  2LQW A;  5GAO n;  2CP0 A;  1Y71 A;  1M30 A;  5KYW A;  1AD5 A;  3UAT A;  1SPK A;  5GMK j;  3H9N A;  2KAF A;  1VQO Q;  3I9Q A;  2CT4 A;  1RI0 A;  4TVR A;  2HKN A;  4C92 A;  2HQE A;  1BB9 A;  5FU6 C;  2DKG A;  2EQI A;  1C1A A;  4RTT A;  2ROL A;  1WHK A;  3OSS C;  1SRL A;  5KCO A;  1LOJ A;  2JS2 A;  3S3N A;  1YJN Q;  2RMO A;  3INZ A;  1X2K A;  1RAG B;  2DXT A;  4DBF A;  3CCE Q;  1YJW A;  4X1V A;  4ATO A;  1VQ6 T;  1M90 C;  1VQ8 Q;  1XOV A;  4GBQ A;  3QPH A;  1KJW A;  1M1K C;  1VA7 A;  1VQL Q;  4AFS C;  1VQ7 A;  1WQW A;  4MZM A;  4BI3 A;  3M57 A;  1YCY A;  2RJF A;  5FU6 B;  3MEV A;  1VQK A;  4D6W A;  2O9V A;  5IXF A;  2IG0 A;  3QJY A;  2DF6 A;  1G3T A;  3C4S A;  1I8F A;  1NEG A;  2X51 A;  3AHU A;  3VUB A;  1VQO A;  5J26 A;  3OS2 A;  2NWM A;  3V7C A;  4C8Q C;  3OYI A;  3EHQ A;  2YLC A;  2L0A A;  2FPF A;  2HSE B;  2LT1 A;  1FMK A;  3JCM g;  2MMP A;  2JTE A;  3OBW A;  4DBR A;  3VS4 A;  3NTI A;  5KE3 A;  2BE7 D;  2J6F A;  2RN8 A;  1MV3 A;  5D6W A;  4FM4 B;  1PG5 B;  2DBM A;  2EKO A;  1WX6 A;  2CGH A;  5D7U A;  5LL6 S;  4J9B A;  2F5T X;  2JTM A;  4C8Q E;  4ESR A;  4JS5 A;  4DA4 A;  3MCA B;  3CCM A;  2R5A A;  2VAS A;  3FIF A;  1SHG A;  3QWX X;  5CKH A;  2GNC A;  3JCM V;  2F2W A;  2XMF A;  3RBB B;  1Y7X A;  5I11 A;  1KD1 C;  1NE8 A;  4C8Q A;  3CCJ T;  3PNW C;  4M7D G;  2DEQ A;  1R77 A;  1B07 A;  4RCB A;  2IIM A;  1PRM C;  1TOV A;  3G6E Q;  3CC4 T;  4C5G A;  4KRT A;  3VRZ A;  4RMO A;  4KH0 B;  4A4E A;  2K5L A; 
#chains in the Genus database with same CATH homology
 1OOT A;  1UG1 A;  2D1X A;  2K2M A;  3H0I A;  4F14 A;  4OMN A;  1HD3 A;  5I22 A;  1T0H A;  2O2O A;  1JXO A;  4J9D A;  3H41 A;  2GTJ A;  2DX1 A;  3H0H A;  2J7I A;  1SEM A;  2KT1 A;  1S1N A;  1GBQ A;  1E6G A;  2DVJ A;  1UFF A;  2HCK A;  4RTZ A;  1YNZ A;  2MIO A;  4DEY A;  2EYY A;  1WXB A;  2RQT A;  2LCS A;  2X3X D;  4OMQ A;  4JJD A;  1PHT A;  2J05 A;  2D0N A;  3FJ5 A;  4LNP A;  1ABQ A;  2AKL A;  3LH5 A;  1GRI A;  1J3T A;  2RNA A;  2CUD A;  4M4Z A;  1IO6 A;  1Y0M A;  2KGT A;  1KFZ A;  1OV3 A;  1RLQ C;  5IH2 A;  1ZSG A;  1H8K A;  1X6G A;  1V1C A;  2G6F X;  3VS6 A;  1U06 A;  4JZ3 A;  4Z8A A;  1W70 A;  2BZX A;  1YN8 A;  3REA B;  1E6H A;  1NLO C;  3NHN A;  4CC4 B;  2F2V A;  1UGV A;  4AG2 C;  1GFD A;  1GL5 A;  4J9H A;  2OJ2 A;  4J9G A;  4ZNX A;  1PKT A;  2LX7 A;  2JM8 A;  2C0O A;  2LZ6 B;  2O31 A;  5IHN A;  2CSI A;  4D8K A;  4OMP A;  1SSH A;  1BBZ A;  1UTI A;  1MV0 B;  2AZV A;  2EW3 A;  1X69 A;  1WLP B;  2YUN A;  2LJ3 A;  3QWY A;  4JJC A;  1SHF A;  3EGU A;  3NPF A;  2LQN A;  1H3H A;  3VS1 A;  4HCK A;  2BTT A;  1X43 A;  2C0I A;  2KE9 A;  5FWC A;  1WFW A;  1Z9Q A;  4IIO A;  3PVL A;  1HJD A;  1H92 A;  1T3L A;  1GCQ C;  1N5Z A;  3CQT A;  1HSQ A;  2D8H A;  2L3P A;  4HVV A;  1T0J A;  4CC7 A;  3M0R A;  2KEA A;  3I5S A;  2EVR A;  2DL4 A;  2QDL A;  2M0Y A;  1NG2 A;  2VVK A;  1YCS B;  2DL8 A;  1GBR A;  2DBK A;  5EC7 A;  3SEM A;  1RLP C;  2BZY A;  2HBW A;  2LJ0 A;  2V1R A;  1CKB A;  1QWE A;  2YUQ A;  2FO0 A;  1OEB A;  2AZS A;  2K7A A;  2L2P A;  3VRY A;  4GLM A;  2CH4 W;  2EGE A;  2HSP A;  4FSS A;  5L23 A;  1PNJ A;  2RPN A;  2AK5 A;  1NEB A;  2DA9 A;  1G2B A;  1YWO A;  1ABO A;  2JM9 A;  4RTX A;  2CRE A;  3REB B;  1FYN A;  1WA7 A;  2RQV A;  3H0F A;  4HVW A;  3EG1 A;  2DIL A;  2VWF A;  3VS0 A;  1AWJ A;  2RQW A;  1T3S A;  2L3Q A;  2ABL A;  2LJ1 A;  2EGC A;  2H8H A;  1GCQ A;  1X2Q A;  2ENM A;  3KFV A;  2KT8 A;  2KYM A;  4A63 B;  1PKS A;  1AEY A;  1WDX A;  3M0Q A;  4QT7 A;  2J6O A;  3EG0 A;  2JW4 A;  2CT3 A;  1AZG B;  1EFN A;  1U3O A;  2CDT A;  1GCP A;  2PZ1 A;  3ZL7 C;  2GTO A;  3NMZ C;  2F2X A;  2P4R A;  2KRN A;  4RTV A;  2CSQ A;  3I35 A;  1AWO A;  2KYB A;  4JJB A;  1JO8 A;  1VYV A;  2EYX A;  1PRL C;  4AFU C;  1NYF A;  2DRM A;  2K79 A;  2DLP A;  2KR3 A;  4OML A;  2DL3 A;  2YUP A;  2W10 A;  1QKX A;  3I5R A;  2ED1 A;  1B3Q A;  1JU5 C;  4AG1 C;  2KRO A;  2O88 A;  1QWF A;  2MCN A;  1I1J A;  1WIE A;  2FRY A;  5FW9 A;  2DL7 A;  4CC2 A;  1W6X A;  1QLY A;  4F16 A;  1NYG A;  1CSK A;  1I07 A;  2YUO A;  1ZUK A;  2I0N A;  3M0S A;  4WCI A;  4RTU A;  1SRM A;  2GBQ A;  1M3B A;  5IXB A;  2B86 A;  2DRK A;  2DJQ A;  2LMJ A;  3UF4 A;  2JMC A;  2O9S A;  4D8D A;  1KSW A;  1ARK A;  1ZUU A;  5IHI A;  3UA7 A;  4CC3 A;  2E5K A;  3IQL A;  3TSW A;  2J06 A;  2SRC A;  4JZ4 A;  2A36 A;  2MOX A;  4JPB W;  1VYU A;  2D8J A;  1K9A A;  3VS5 A;  4EIK A;  1M3C A;  1WI7 A;  2JMA A;  1GFC A;  1RUW A;  1TG0 A;  5HCK A;  2KRM A;  1CKA A;  3U23 A;  1TUD A;  1M27 C;  4J9I A;  3VS7 A;  2ECZ A;  1QKW A;  4ORZ A;  1I0C A;  1BU1 A;  2RQR A;  1M3A A;  1ZBJ A;  2DMO A;  1UDL A;  1PWT A;  2K9G A;  4OMO A;  4F17 A;  2A28 A;  2EPD A;  1AWX A;  1ZLM A;  3EG3 A;  1NM7 A;  3RNJ A;  2VKN A;  1WYX A;  1UE9 A;  2ED0 A;  2FG0 A;  2RQU A;  3THK A;  1UJ0 A;  4LN2 A;  4LE9 A;  4LUE A;  1JXM A;  3UA6 A;  4Z89 A;  2JS0 A;  1AOJ A;  3M0P A;  3TVT A;  1KIK A;  2K6D A;  5ECA A;  2EKH A;  1WXT A;  2JXB A;  1ZUY A;  4RTY A;  2DYB A;  1X6B A;  1UUE A;  2KRS A;  1K76 A;  1UJY A;  2YDL A;  2LQW A;  2RF0 A;  1NLP C;  4RUG A;  1M30 A;  1X27 A;  2ROT A;  4DEX A;  1AD5 A;  2BZ8 A;  2KBT A;  4J9E A;  3UAT A;  1SPK A;  5GJV B;  5IHK A;  2KXC A;  1Z9Z A;  4R0K A;  3A98 A;  2X3W D;  3I9Q A;  2CT4 A;  1YWP A;  3R6N A;  3PE0 A;  2L3S A;  3JV3 A;  3NGP A;  2HDA A;  2PTK A;  1BB9 A;  2NUZ A;  2EQI A;  2PNI A;  4RTT A;  2ROL A;  1RI9 A;  1UHF A;  1AWW A;  2A37 A;  2W0Z A;  2FRW A;  3EHR A;  1SRL A;  1VYT A;  1K1Z A;  2JS2 A;  2LP5 A;  2RMO A;  2ESW A;  1X2K A;  2YT6 A;  2K3B A;  4X1V A;  1M8M A;  1K0S A;  4E6R A;  1WXU A;  2EYZ A;  4AFZ C;  1XOV A;  4GBQ A;  4Y92 A;  1KJW A;  1VA7 A;  1U5S A;  4AFS C;  2OI3 A;  4RTW A;  3VS3 A;  5GJW B;  4K11 A;  2FPD A;  3M0U A;  2O9V A;  2GGR A;  1YP5 A;  5IXF A;  1W1F A;  2DF6 A;  2FEI A;  3M0T A;  4HXJ A;  1NEG A;  1E7O A;  2NWM A;  3EHQ A;  4HVU A;  2L0A A;  2FPF A;  1G83 A;  3GBQ A;  1FMK A;  3VS2 A;  2J6K A;  2GQI A;  2AKK A;  2JTE A;  2SEM A;  1Y57 A;  3VS4 A;  1JQQ A;  2FPE A;  2J6F A;  2RN8 A;  1MV3 A;  1LCK A;  1OPL A;  2DBM A;  4AFQ C;  1WX6 A;  1A0N B;  3PVQ A;  4J9B A;  3ULR B;  2V1Q A;  2DNU A;  2EGA A;  2C0T A;  2KNB B;  4ESR A;  2DM1 A;  4IIM A;  3O5Z A;  5FWB A;  2JT4 A;  1K4U S;  1UHC A;  2EBP A;  1TUC A;  1SHG A;  2DE0 X;  2YSQ A;  2CUB A;  3QWX X;  2KXD A;  2GNC A;  2DL5 A;  4J9C A;  2F2W A;  2XMF A;  3RBB B;  5I11 A;  3C0C A;  1MUZ A;  2M51 A;  4LUD A;  1JEG A;  2CH4 A;  1BK2 A;  3TSZ A;  1QCF A;  1ZX6 A;  2A08 A;  1B07 A;  2EYW A;  4OMM A;  1OPK A;  3SHW A;  2IIM A;  2HEQ A;  1PRM C;  1K0X A;  2OAW A;  4KRT A;  3VRZ A;  1UEC A;  4Z88 A;  1AZE A;  3EG2 A;  4J9F A;  2LNH B;  1AVZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...