3EG0A

Crystal structure of the n114t mutant of abl-sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSTYITPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 12
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg0A00
1HJDA 2QDLA 1BBZA 2K2MA 3RBBB 1QLYA 2KXDA 2LJ0A 1U3OA 2A36A 4J9IA 1Y0MA 2W0ZA 2LZ6B 5IHKA 2DNUA 4GBQA 2ROLA 1KSWA 2AZVA 4OMMA 2KE9A 2B86A 2K3BA 2JMAA 4J9HA 3SHWA 2LJ3A 5I11A 1X2QA 2O9VA 1S1NA 2EYXA 1UTIA 4JJCA 1OPLA 2DBMA 4LN2A 1M3CA 2KEAA 4JZ4A 4RTVA 2EKHA 4RTWA 3VS1A 3UA6A 1SRLA 1SHFA 3H0HA 1WXTA 2E5KA 3REBB 4E6RA 2X3XD 2EQIA 1PKSA 4JPBW 2AKKA 3JV3A 3M0QA 4RTTA 3KFVA 1M30A 1T0JA 2C0IA 1ABQA 2J06A 2ECZA 4M4ZA 2BZXA 2JW4A 3QWYA 2CH4A 1YP5A 1SPKA 1TUCA 3VS4A 3I5SA 4JJBA 1YCSB 2DMOA 2LNHB 2DBKA 1MV3A 2DRKA 2PNIA 2DL7A 1FMKA 3EGUA 3NGPA 2ROTA 1JQQA 2DRMA 3VS5A 2GQIA 2M0YA 1GCQC 1UJYA 3VS0A 2LJ1A 4J9DA 5EC7A 1VYVA 1WIEA 1YNZA 3EG1A 1I0CA 2YDLA 4OMNA 1BU1A 2LQWA 2MCNA 3VRYA 2HDAA 1SHGA 1H8KA 1BB9A 1Z9ZA 2VWFA 4AFZC 1FYNA 4LUEA 2W10A 4OMLA 2RMOA 2EGCA 2NUZA 1W70A 2PTKA 2HEQA 1JU5C 1LCKA 4DEYA 4QT7A 1HD3A 2CT4A 2ENMA 3ULRB 1WXBA 3M0RA 3TVTA 2MIOA 2JS2A 1PKTA 1QKWA 4ORZA 1ARKA 1VYUA 5FW9A 1AOJA 1AZGB 3PVQA 4ZNXA 1KIKA 4F16A 2DA9A 4OMQA 2CUDA 1N5ZA 1I07A 1VYTA 1AWOA 1RUWA 2G6FX 1K0XA 2YT6A 3M0PA 2K7AA 2FRWA 2DL3A 1UHFA 2A08A 3QWXX 1OOTA 3FJ5A 2KNBB 1U5SA 3I5RA 1SSHA 1B07A 2EBPA 2VKNA 2PZ1A 3VS2A 4AFSC 1QWFA 5FWBA 4IIOA 2L3QA 1GRIA 2JS0A 1T3SA 3M0TA 3EHQA 1ABOA 2RF0A 1WFWA 1GL5A 4AFQC 1K0SA 2F2WA 2YUPA 1MUZA 3ZL7C 2RQWA 3CQTA 4F17A 1X27A 2LCSA 2CUBA 3UA7A 3UF4A 4Z89A 2EVRA 2EYYA 2M51A 2ED1A 2CSIA 2HSPA 1X69A 1OEBA 4K11A 1W1FA 2LP5A 1GBQA 2EYZA 2FO0A 1UFFA 3THKA 2A37A 1AWJA 3LH5A 2KT8A 5IHNA 4CC2A 3EG2A 1NEGA 4Z8AA 1RLPC 2KRNA 4J9FA 3H41A 2ABLA 2DJQA 4D8DA 1UECA 1YWOA 2FPDA 2KGTA 4FSSA 2HCKA 1NYGA 4AG1C 2CH4W 4RTUA 1I1JA 1ZUYA 5GJWB 1EFNA 2F2XA 4AG2C 5ECAA 1QCFA 2K9GA 1SEMA 1G2BA 4RUGA 2KBTA 2EGAA 4CC7A 1A0NB 2BZ8A 1JEGA 4CC4B 2KROA 1GBRA 2KT1A 1M3AA 1E6HA 1X2KA 2XMFA 3EHRA 3NHNA 4GLMA 5HCKA 4JZ3A 4AFUC 3M0UA 1YWPA 2GBQA 2GNCA 2I0NA 1GFDA 2EW3A 1PNJA 4HVWA 2J7IA 4EIKA 2OAWA 2C0OA 2J6KA 2AZSA 1QWEA 4KRTA 3SEMA 4LNPA 4HVUA 5IH2A 1CSKA 1X43A 2DYBA 1H3HA 1W6XA 2GTJA 2JM8A 1AWWA 1OPKA 1VA7A 1V1CA 2CSQA 2JT4A 1BK2A 1X6GA 2HBWA 2KYMA 1K76A 2KRSA 5FWCA 4X1VA 1MV0B 4WCIA 2DL5A 3EG0A 2KR3A 2D8JA 4OMPA 1NG2A 1UE9A 2EGEA 2O31A 3PE0A 1ZLMA 4DEXA 2JM9A 1AWXA 1K1ZA 2J05A 1WXUA 2ESWA 2D0NA 1NLOC 2DE0X 2RQRA 1ZUUA 2JXBA 1RI9A 1H92A 2CREA 2CDTA 2DL4A 3O5ZA 2P4RA 2RQUA 3TSZA 2L2PA 1NYFA 1PHTA 1WA7A 4J9BA 2BTTA 2V1QA 2V1RA 1WDXA 2IIMA 3VS7A 1NLPC 3I35A 1AD5A 3PVLA 1M3BA 2YUOA 1K4US 3M0SA 1T3LA 1JXMA 5IHIA 1WYXA 2OI3A 2RQTA 1XOVA 2AKLA 1OV3A 4JJDA 2J6OA 2F2VA 4D8KA 2LQNA 1CKAA 2GTOA 3GBQA 1PRLC 2CT3A 1X6BA 1G83A 4J9CA 1ZX6A 4RTYA 4F14A 5I22A 1UJ0A 5L23A 4J9EA 1TUDA 4IIMA 2KYBA 3REAB 3RNJA 2AK5A 1UUEA 2K6DA 2MOXA 2RQVA 1ZUKA 4J9GA 2DL8A 1KJWA 1SRMA 1CKBA 3NPFA 2O9SA 1QKXA 2JTEA 2FEIA 3VRZA 2SRCA 3IQLA 5GJVB 1UG1A 1WX6A 5IXBA 4R0KA 3H0FA 2DF6A 1KFZA 1GCQA 3I9QA 2DLPA 1K9AA 4LE9A 2D1XA 2OJ2A 2FG0A 2FRYA 3C0CA 1GCPA 1M27C 1ZBJA 2A28A 1UHCA 1PWTA 1WLPB 1ZSGA 3U23A 2RNAA 1J3TA 2YUQA 2K79A 3EG3A 1AEYA 4HVVA 3UATA 2O88A 2DILA 1RLQC 2DX1A 2ED0A 2KXCA 4HXJA 4RTXA 1IO6A 2RPNA 1HSQA 3A98A 1TG0A 1B3QA 1PRMC 1GFCA 1U06A 2D8HA 2FPEA 2LX7A 2RN8A 1E7OA 3VS6A 2H8HA 5IXFA 2DM1A 2BZYA 2EPDA 2VVKA 2SEMA 2L3SA 4Y92A 1JO8A 2DVJA 1NEBA 1T0HA 3R6NA 2NWMA 1E6GA 1Z9QA 2L0AA 3H0IA 2YUNA 2GGRA 4HCKA 2FPFA 4Z88A 1AZEA 2LMJA 1NM7A 3VS3A 4RTZA 4OMOA 4LUDA 2YSQA 4A63B 2O2OA 1JXOA 1UGVA 3NMZC 2L3PA 1YN8A 2EYWA 2C0TA 1UDLA 1AVZC 3TSWA 4ESRA 1M8MA 2JMCA 2KRMA 2J6FA 1WI7A 1Y57A 4CC3A 2X3WD
chains in the Genus database with same CATH superfamily
1VUBA 4C92G 1D09B 1BBZA 1D0XA 2XD0A 4IUVA 2RH2A 3RBBB 4ME7A 1QLYA 2KXDA 4XU1A 1PM3A 4O6JA 5EG2A 5I21A 3OYEA 1I81A 2FZCB 2QI2A 5LJ5d 2O4XB 4IKFA 2ROLA 2AZVA 2NUPA 4OMMA 1YJNA 2KE9A 4J6XA 1VQLT 3LGFA 2B86A 2K3BA 3SHWA 4TVRA 1X2QA 2VB6A 3DKMA 1JJ2P 1WHMA 1OPLA 4N0AC 1M3CA 4JZ4A 1SKUB 1W2BS 5J39A 3BDLA 2PQWA 1SRLA 4A4EA 4DOWA 1PKSA 2RI5A 4JPBW 2R57A 3M0QA 1X75C 1VQ5A 2LC4A 1T0JA 4L59A 4C8QC 1ABQA 2LVMA 2NUPB 2EAYA 3OMCA 2ECZA 4M4ZA 3OYDA 3JB9D 3TEEA 5GAN2 4JLGA 2EJGA 3CCRT 1TUCA 3D7SB 1YHQT 4KBMB 1VQ6A 5KYUA 3SWNA 2E10A 2R58A 3EH2A 3CCMA 2DMOA 2DBKA 2DRKA 3OY9A 4M7AE 2JNGA 4BB7A 2DL7A 4XTXA 2DRMA 3VS5A 1PSEA 3VS0A 1M90C 5L8RE 3CBMA 3MHXA 2LJ1A 5EC7A 1VYVA 3CMEQ 3VRYA 2LQWA 5GANj 3ME9A 1Z9ZA 1H8KA 1VQPT 3AHUA 4AFZC 2XDDA 3CMAT 2DEQA 2F1LA 1GXIE 1W70A 2PTKA 2HEQA 4M7DA 2E6ZA 5LJ3d 4QT7A 3LX7A 4DEYA 3CCQA 2CT4A 2RK1A 5GAOn 1V76A 5IN1A 5LJ5h 1KC8C 5KYUB 3SWNB 2HZYA 4A53A 2CS7A 2PVDB 1QKWA 2DFUA 3X24B 4ZN1A 1VYUA 4JLIA 1AOJA 1WPYA 3S6WA 1X01A 1VYTA 1I07A 1AWOA 1KQ1A 2DO3A 3HRSA 4PFZA 1K9MC 2A08A 2L8DA 3I55A 2XKOC 1M90U 4BE2A 1EIFA 1D1AA 4ZGEB 4BI8B 2KNBB 1U5SA 3I5RA 4FCYA 1SSHA 2B8AA 5HK0A 4M7DB 2EBPA 2XK0A 5FWBA 1VQOA 1VQ4T 4FW1A 1EX4A 1R0BG 1GL5A 3QBYA 3PIOA 3ASKA 4J8OA 1VQ7A 2ATCB 2DK3A 2OX7A 4F17A 3OYBA 5AT1B 3GP8A 2GFUA 3JCMW 2ZGWA 1K73C 2MI6A 4OP0A 4C92F 2QA4Q 2M51A 2HSPA 2C06A 1X69A 2EJ9A 2MF2A 2P0PA 4K11A 2HQEA 2EYZA 1K9MU 4KH0B 2A37A 2ZPHB 1AWJA 4F04B 1LJOA 2KT8A 3LH5A 3FJPA 5FROA 3CC2A 2QTVA 4N4GA 2YLBA 4LDWA 2K5IA 3OYIA 4XTWA 1RLPC 2HKQB 4J9FA 2ABLA 2ZAEA 5GANf 5KE3A 1UECA 1VQKT 4ZTJA 1EFNA 4AG2C 1F1BB 5ECAA 4CI0C 2LDMA 3MP8A 1SEMA 1O75A 4X34A 4CC4B 5KCOA 4EMKC 1E6HA 2XMFA 3X25B 1K73U 4BY6C 3OYJA 4C8QE 3ZEHA 4CRIA 5GAMd 3A1PA 2GBQA 2DTIA 1G5VA 1WHGA 3L2RA 4PJOA 1QVFA 1VQ9T 3UWNA 2QQ9A 4DOVA 1YJWA 1Y07A 3MKDA 1YI2T 5GMKm 2R5MA 4JRKA 3CD6T 1HXDA 1VA7A 2PVGB 1BK2A 3CPWP 2HBWA 3OQ5A 4M75D 3JB9I 3G6ET 2KRSA 1NG2A 4ZGJB 1UE9A 2O31A 3PE0A 2VC8A 4PJOB 1QP2A 4C8QF 1QVGP 3V7CA 3EGDA 3PIPA 2D0NA 1NLOC 2RQRA 1ZUUA 2BUDA 2RHUA 5GMKh 5CR2A 3A8MB 5CKDA 2RA2A 2X4WA 2DL4A 4PJOG 1VQLQ 1MMGA 3JB9H 2V1RA 1WDXA 4M78A 4DQ2A 1K4US 1WHJA 1JJ2S 4LDXA 2MYSA 5GANe 4P5NA 2RQTA 1ZA1B 2AKLA 2FZKB 1KQSP 3QIIA 4FYVB 1YJ9T 3OYGA 4HA8A 1PRLC 4NOYA 2OTLA 1OQKA 4ANJA 3EGDB 3OYCA 2X51A 3JCMc 4F14A 5I22A 4J9EA 1TUDA 2KQWA 4FIBA 5DM7R 3HRUA 1M2OA 2KYBA 3RNJA 3E9GA 3FRNA 2K6DA 4C0DB 1VQ8T 1RAAB 3CCRQ 4M78B 1S72A 3MEUA 4J9GA 3BDUA 1YHQQ 1KJWA 1SRMA 2ZCFB 4LD9K 3OYAA 4EMGA 5GAOl 5DLQE 2QG9B 3IQLA 3QKJA 3DB4A 3CCEA 1GCQA 5FU6B 4M78G 2X4XA 2L89A 2FG0A 2OAUA 5HK3A 1GCPA 3OSSC 1ZBJA 2A28A 3OSVA 4GY5A 1UHCA 3CC4A 1WLPB 3A5ZB 1VQPQ 2GFAA 3CMAQ 2RNAA 5KE2A 2HL3A 3QJYA 2WSCE 2LX9A 2F5TX 3OW2A 2KY9A 4M75C 4OGCA 2VXFA 2E4HA 2DX1A 3QPHA 4C5HA 1M2VA 3M59A 1N27A 1N9SA 3J81E 5LL6S 4RCBA 1U06A 2NUTA 3P8HA 3I56T 5D6XA 2EQKA 2DM1A 3JB9F 4BDZA 8AT1B 1M8VA 2L3SA 5D6WA 3L2UA 3A8OB 2DVJA 1NEBA 3R6NA 2LT1A 2NWMA 2QTXA 2ZPIB 3RUXA 3H0IA 4KULA 3UT1A 4MMKA 2JN0A 1AZEA 1M2VB 4IURA 1WQ7A 1MMDA 3F70A 1NPRA 4OMOA 1YJNT 2YSQA 3G4SA 5KH6A 2NUTB 1XTDA 3PGGA 1ZHIA 1WGSA 3TSWA 1M8MA 3M5AA 2J6FA 4QVDA 1WI7A 4PK4A 1NZ9A 1W2BA 2X3WD 3JSCA 2QDLA 1Q86R 4RKUE 2K2MA 2QEXA 1R0CB 2ZZDA 2LZ6B 3JRZA 5I2MA 2DNUA 3RKXA 4OB1B 1VQKQ 3EH1A 5GMKi 1VQ6T 1KC8R 2JMAA 2ZPEB 5I11A 2O9VA 4JRPA 2PUKB 3NTHA 2EYXA 1UTIA 4M7AA 3HPWA 4JUVA 5I2SA 1K8AC 2E41A 1LPLA 4O5VA 4RTWA 3V8KA 2DYIA 3UA6A 2CP5A 1WXTA 2E5KA 2RK2A 2X3XD 2RI2A 1M1GA 1FX7A 2AKKA 2E1HA 2E3IA 1UB4A 4NL3A 3KFVA 4ZN3A 2C0IA 1YITT 3J80E 2EQMA 2J06A 3KXTA 2BZXA 1VQ9Q 3OS1A 2Z0WA 2RD1A 2DKGA 2LT4A 5A0DA 2FVUA 2E3HA 3CD6Q 3I5SA 3JCMV 4M7AB 3CCST 4FW2A 4M77D 3GNFB 1YIJT 1YCSB 2LNHB 1N8RU 3N5BB 1NBEB 2M0YA 3TQ7P 4J9DA 3CCLT 1FMVA 4FL6A 3CPWS 4RG2A 4E2FB 2YDLA 4M7AG 3CCUT 4FYXB 5KYNA 4XTZA 2VWFA 2CP0A 4LUEA 2W10A 2XICA 4C0GA 3MEWA 4M75E 1LCKA 3FLGA 1LVKA 1QVGS 3ULRB 3M0RA 2DVEA 2JS2A 1PKTA 1PSFA 1AZGB 1KIKA 3JCMJ 4XTUA 1I4K1 3V7SA 2XI9A 4PLLA 2JTFA 3RKWA 3OS0A 3CBOA 1K0XA 3T9NA 3M0PA 3NTIA 1OOTA 3FJ5A 4Q5WA 5GANg 4V2SA 1YJ9Q 2WSEE 4ZTFA 1KQSS 3QZ9B 3VS2A 1I8FA 4AFSC 1I5OB 4VUBA 4IIOA 4D6WA 1IGQA 2L3QA 4OB2B 1RAEB 4FYWB 1GRIA 3E19A 2QYZA 4XAXB 1T3SA 1ABOA 2RF0A 1VQ8Q 4AFQC 5A0LA 1M1KC 3CCVQ 2YUPA 2YRDA 3JCMe 2COWA 3CQTA 1X27A 1BIBA 2LCSA 3WXMB 4L6V5 3CMEA 3SDZA 3M4GA 1JRIA 2ED1A 2CSIA 2F69A 1VQNQ 1OEBA 1W1FA 5D6YA 5KYXA 1BCOA 4C8QA 3QXEB 5IHNA 1WZOA 1UEBA 4M77C 2HD0A 4CC2A 2A3LA 4Z8AA 2KRNA 3HKSA 1TSFA 2KGTA 4QVCA 4QW2A 4AG1C 3PNWC 4PFPA 1QVPA 1BCMA 2K9GA 1WHLA 4GLKA 2BZ8A 1GBRA 2KT1A 1R8OB 1QMCA 2X4YA 3SB2A 4LD6A 5GANh 4IUQA 2RB6A 3I56Q 3L2VA 3CXCA 1B34A 1ZSZC 5KYXB 3NFCA 4C8QB 1Q86C 4GLMA 5HCKA 1ACMB 4JZ3A 1Q95G 1Y7XA 3ZFJA 4FU6A 3X20B 2I0NA 1GFDA 3OS5A 1RAIB 3EFSA 2A7YA 2DTOA 2CZ6B 4FSXA 2AZSA 2X35A 4A4KA 4C8QG 4KRTA 3SEMA 4HVUA 2E70A 3QG1A 2K57A 1X43A 2DYBA 1W6XA 2JM8A 5GAOp 3X26B 3L1AA 1TH7A 1V1CA 2QA4A 1B34B 1JJ2A 1X6GA 2KYMA 3J7AF 2ZPBB 4X1VA 5GMKl 3GF5A 4M7AF 4J7IA 2D8JA 4XTVA 3TCJA 1BI0A 2FB7A 3KBGA 3X28B 2OTLT 4HCZA 3MEVA 2BKDN 3CCJT 1ZLMA 4M7DC 2DZ9A 1KHIA 2J05A 2O01E 1G8XA 1AHJB 2DE0X 1RI9A 3LH0A 1H92A 3JAME 2CREA 3MJXA 3QYGB 5LJ5j 3O5ZA 3HSBA 2P4RA 3VYGA 3TSZA 5HY6A 1PHTA 2BTTA 4E47A 3VS7A 1NLPC 1KC8U 2YUOA 1JXMA 1WYXA 5DLOA 5D7UA 4R56A 4Z02A 3MP6A 1HYOA 3TREA 1XOVA 2VUBA 2VV5A 1OV3A 1Y71A 4D8KA 1QVFP 1CKAA 1PD1A 3EG9A 2QQBA 3S3NA 1M1FA 3WVDB 4J9CA 1ZX6A 4RTYA 1UJ0A 3OMGA 4A4HA 2RHYA 1G3TA 1YITQ 5HKCA 2BE7D 1X6OA 5IT9E 4PJMA 3REAB 2CP3A 2RQVA 1WQWA 1Q81C 4E7LA 2DL8A 1UGPB 2RJEA 1CKBA 3CCSQ 2FEIA 1YIJQ 3VUBA 2SRCA 1UG1A 4XU2A 5IXBA 1VIEA 3H0FA 3VJPA 3DLMA 3I9QA 3EG9B 3CCLQ 3EAEA 1PC0A 3G71T 4OB3B 4M77E 3CC7T 3CCUQ 1ZBXA 4YTLA 1ZSGA 1UGSB 3JB9G 3U23A 4BE0A 3C94A 4E7SA 1J3TA 4FM4B 5FU7C 1AEYA 3QYHB 1VQLA 4KGZB 3RIRA 2P84A 5LJ3j 2OTJT 4DA4A 3OBWA 4RTXA 4E7KA 1IO6A 3CBPA 2RPNA 4E7IA 4EMKB 1B3QA 1PRMC 1GFCA 1OX8A 2DETA 4BY6B 2EJFA 5M9OA 4II1A 3QSUA 5GAN5 2FPEA 3O8VA 3H9NA 1D1CA 2FYKA 2RN8A 1E7OA 3VS6A 5CKHA 3JB9J 1K8AR 1JO8A 5FLXE 5GAMg 1WJQA 1MMAA 3MCAB 2IPOB 2QEXT 4M77F 5J26A 3CCRA 2GGRA 2RO0A 2M16A 3G1JA 4Z88A 2LMJA 1YHQA 4QKUA 4C0FA 4RTZA 2V8KA 4A63B 3FC3A 1UGVA 5DY9A 3A8GB 2EYWA 1OULA 5CAIA 3OA6A 2FHDA 2DTHA 2PU9B 3JCMg 2XU8A 4HT8A 2CP7A 2KRMA 3M9QA 1MMNA 1UGRB 1Y57A 4R55A 4CC3A 1V29B 4J6WA 3HP9A 1VQPA 4ATOA 2RM4A 3CMAA 3OW2P 4B6MA 2LJ0A 1U3OA 2A36A 1Y0MA 2QXFA 1R77A 1VQMT 4GBQA 2QAZA 2V26A 4C0DC 1TWBA 4J9HA 2M9UA 4BDYA 3UPUA 3P8BB 1NE8A 1OZ3A 4JJCA 3JCMX 1Q7YC 2KEAA 2EKHA 4KUDK 3REBB 1TOVA 5C6SA 1YBYA 3OYMA 4RTTA 1M30A 2D0QB 2DXCA 5GAMj 1QVGA 4M75A 4JDSA 1UGQB 4WF2A 2JUFA 3QWYA 1QQJA 1SPKA 3JCMh 4JJBA 1M1KR 1NJIC 1KD1R 1QP3A 4DBFA 2LRQA 3OYYA 1GCQC 2X9HA 4AT1B 1Q82C 2YLCA 4OF1A 3EG1A 1MGQA 1SG5A 5CQXA 4OMNA 2K5FA 2MCNA 1IHWA 1KQSA 2HDAA 1WHKA 1SHGA 1BB9A 4M75B 2OTLQ 3OYNA 3CCJQ 2CZ7B 2NUZA 2DXBA 2P0QA 1VQKA 2EIFA 1HD3A 4N4HA 4KT0E 2JVVA 4DBRA 3TVTA 3JCMP 2EQUA 1VQ4Q 1ARKA 4ORZA 2E65A 4M75G 4PFOA 3PVQA 4XK8E 4ZNXA 3R6OA 3CMET 1RUWA 3GLXA 5CKEA 2VGMA 2YT6A 1KHCA 3RR6A 4C5EA 2K7AA 2EQJA 4Y28E 3ZBDA 3META 4KGXB 1C1AA 3HTRA 2E12A 2VXEA 4HCBA 2PZ1A 1QW1A 4C92D 4C0ZA 1WJSA 1VQ9A 1QVFS 4XU0A 5LJ3e 2XIDA 1VQ5T 2JS0A 3CD6A 3EHQA 3V8JA 3NTKA 4XU3A 4BI4A 2AHJB 1MUZA 4F7UE 5GAMf 4WTOB 2LTOA 1OI1A 3PTAA 3EFOA 3QZ5B 1U8RA 4XQ3A 3EGXA 2CUBA 3UA7A 3CCMT 4Z89A 4MZMA 2H3EB 2EYYA 3RKYA 2DJZA 4JJNK 1GBQA 1UFFA 3LLRA 3G71Q 4ELZC 3CC7Q 2EKOA 3EG2A 4MMLA 3JCMf 1O9SA 4AMCA 2I2LA 3H41A 4D8DA 1YWOA 2FPDA 4BE1A 2HSEB 2DXTA 3CCQT 2WACA 3P8DA 2CH4W 4RTUA 1I1JA 2OTJQ 3EFOB 1TTHB 1YI2Q 3EGXB 1H3ZA 4F7UF 1P92A 4RUGA 2KBTA 4CC7A 1A0NB 5FRMA 2QGGA 2CZ0B 2Y90A 3FDRA 1YJ9A 2NYSA 4NL2A 4JS4A 4X9DA 2DZCA 3C4SA 3M4YA 3G6EQ 4EPCA 3I55T 2QASA 3FB9A 3M0UA 1K8AU 1YWPA 2EW3A 4DBHA 1PNJA 1VQ8A 3GIBA 3CCVA 1QWEA 2LCCA 1VQOT 1D3BA 5IH2A 1CSKA 4IUUA 5FRNA 1Q81R 2CP6A 2HNIA 1KK7A 1FMWA 1VQ7T 3SD4A 4NS5A 2CSQA 2JT4A 4C92C 4E7HA 1VQNA 5CKFA 1K76A 5GANd 4BI3A 1RADB 2RJFA 3QHSA 3BE3A 2EGEA 4BUGA 5GAMe 3OYLA 1BKBA 1MHNA 3HL8A 2JM9A 1RAHB 1K1ZA 2M02A 3OW2S 3CC2T 4OMFB 1D3BB 1WXUA 2ESWA 1KG1A 2PUOB 1VQMQ 1BI2A 3PMTA 4M75F 5C0MA 1Y96B 2HBPA 3BY7A 4J9BA 1NYFA 1WA7A 2AT1B 3OBYA 3CXCP 3RMSA 3I56A 1KD1C 3I35A 3PVLA 4N4IA 4M7DD 3M0SA 3MEAA 4IUPA 5IHIA 3DLLA 3MP1A 4N0AA 1IZ6A 1ZQ1A 2HMAA 2J6OA 3VU3C 2LQNA 2GTOA 5GAOr 2CT3A 2IG0A 4J83A 1ZA2B 4M77A 1X6BA 4L5GA 1H641 2RJDA 4MZPA 2AIRB 2HQHA 3DB3A 8ATCB 5LJ5g 2MOXA 2KAFA 1ZUKA 1YJWT 1QCNA 1OU9A 3UDCA 1MNDA 2O9SA 2JTEA 4E7JA 4PLIA 2D6FA 3VRZA 3PT9A 1WX6A 3BW1A 2KMTA 1ZSZA 1M1KU 1KFZA 3GPLA 1KD1U 9ATCB 2HQXA 4LE9A 1YCYA 4M77B 5CO7A 1VIFA 2FRYA 3C0CA 3H8ZA 1M27C 5GAOq 2WSFE 4KGVB 1PWTA 2KK4A 2DD4A 2YUQA 3EG3A 3UATA 4M77G 2YRVA 3L2WA 1IREB 1RLQC 1WHHA 1M4ZA 1HSQA 1TG0A 3WVEB 1ZSZB 1WNLA 1YFNA 3SWNC 1YJNQ 4XTYA 4C5GA 1XNIA 1G3SA 2LCLA 2LX7A 3GOXA 2H8HA 2BZYA 2EFIA 2KI7A 2VVKA 2FZGB 1Q7YR 3MO8A 2YWWA 3FIFA 1YITA 1SF9A 4IUTA 2L0AA 3URGA 2G3RA 2DPPB 3OYHA 2YUNA 1VQ5Q 2PVOB 3M55A 1Q86U 2CGHA 5LJ3g 1NM7A 2MWPA 3VS3A 5CKBA 2EWNA 3CCSA 1YIJA 1JXOA 2L3PA 2MAMA 4C92E 1UDLA 1S72T 1AVZC 2V8JA 2H3JA 4ESRA 2QK0A 2V8IA 3CCLA 1VQ6Q 4PJOD 3LYIA 3C95A 4A4GA 1BYMA 3CCMQ 1OX9A 2RJCA 1NJIR 3AT1B 3CCUA 3VV0A 3M54A 4PJNA 1I5LA 3CCET 1HJDA 3HFOA 3LW5E 1Q82R 1RL2A 2YRCA 3TU4K 3QJ6A 4PNOA 2E5QA 2W0ZA 4J9IA 3CC4T 5IHKA 4J7FA 2LQ8A 4M7DG 4J5YA 1KSWA 3LWHA 2RHZA 3CCQQ 2LQKA 3PFSA 2YHTA 2LJ3A 5CIUA 3INZA 2XHCA 1S1NA 1B7TA 5IAYA 2DBMA 4LN2A 1C6VX 4RG8A 2XDBA 4RTVA 3VS1A 3CEYA 4EMKA 3QUIA 1SHFA 3H0HA 3KUFA 4E6RA 2EQIA 4RMOA 3JV3A 1NPPA 4M78D 3I55Q 2P0KA 5LJ3h 2COZA 1BI1A 3A8LB 1RI0A 3RDVA 2JW4A 2CH4A 1YP5A 1VQOQ 1LNXA 3VKIA 3VS4A 5KYWA 4PJJA 3M57A 3RERA 1N9RA 3G4ST 2XDPA 2BIVA 1MV3A 2A0FB 1M5Q1 3C12A 2PNIA 2JZ2A 1FMKA 3EGUA 3NGPA 2ROTA 1JQQA 2GQVA 2M1HA 1VQ7Q 2GQIA 2NLUA 4QQDA 1UJYA 1Q81U 4EMHA 3EFRA 4EDUA 4JRQA 3VUZA 3OYFA 1EZZB 5LJ5f 1WIEA 1YNZA 3OS2A 1I0CA 2X4JA 1BU1A 5FU7B 3SFMA 1TXQA 4A54A 1FYNA 4OMLA 2RMOA 2EGCA 1TU0B 4RCCA 1JU5C 2ENMA 3CC2Q 1N8RR 4PJOC 5KYWB 1WXBA 2COYA 3HRTA 2MIOA 2HAXA 4JRIA 2DAQA 4KH1B 4C5IA 3S3MA 4F7UA 5FW9A 3H6ZA 3JCMd 5GAN4 1IB8A 1WJRA 4A4FA 4F16A 4QQ6A 2DA9A 4OMQA 2CUDA 1N5ZA 3CXCS 1G3WA 2D9TA 3ER0A 5KYYA 2DD5A 2G6FX 1IGUA 2FRWA 2DL3A 1UHFA 5A0GA 3QWXX 3S3OA 4Y91A 4X9CA 2R5AA 1B07A 1W4SA 2VKNA 1MNEA 1QWFA 3PMIA 4M7DE 2Y4XA 4UC4A 3M0TA 2K4YA 1RAGB 2YXYA 4F7UB 1WFWA 2P4TA 1K0SA 2F2WA 2QGFB 1YJWQ 3ZL7C 2RQWA 2VGNA 2MPXC 5GMKj 3OB9A 2L5QA 5KYYB 4M78C 2KSSA 5CVIA 3UF4A 4F7UG 2EVRA 2M0OA 4JS5A 5LJ3f 4HKEA 3CCJA 2LP5A 5GAMh 3CPWA 2FO0A 2DIGA 4KUIA 1BI3A 3THKA 5FU6C 2GCXA 1U1TA 1NEGA 1VQ4A 4M7DF 3CCVT 1AT1B 2DJQA 3OYKA 3M58A 4J6YA 4MDXA 3LWIA 4FSSA 5LJ5e 2HCKA 1NYGA 3JCMb 1ZUYA 3HFNA 5GJWB 2F2XA 1QCFA 4FYYB 1G2BA 2EGAA 1G3YA 1JEGA 2KROA 1VQNT 1W2BP 1M3AA 1KQ2A 1IHVA 1SSFA 2LNVA 1X2KA 3EHRA 1IRXA 3M53A 3NHNA 4AFUC 1Q7YU 1PCXA 2GNCA 3E1SA 4HVWA 2J7IA 4M7AD 1IXDA 4EIKA 2OAWA 2C0OA 2J6KA 1PG5B 3RESA 2DERA 4E7ZA 4LNPA 1C0MA 4FT4A 1D1BA 1H3HA 2GTJA 1D0YA 1AWWA 1OPKA 4LDUA 1S72Q 3CPFA 5FWCA 2JOYA 5CCAA 1MV0B 4WCIA 3G71A 2DL5A 3EG0A 2KR3A 3CC7A 4OMPA 1TS9A 4OVAA 1NJIU 3CCEQ 2EYQA 4HT9A 1PD0A 3VYHB 4DEXA 1Q82U 1AWXA 2CP2A 4PJOE 3CC4Q 1LOJA 2OTJA 2JXBA 5GAN7 2CKKA 3V7RA 2K2VA 1YI2A 2CDTA 3A8HB 3E9FA 3Q1JA 4BACA 1DJ7B 4LDVA 2RQUA 1U1SA 2L2PA 3RMQA 1TUGB 2V1QA 4FT2A 4DBQA 2MK5A 2IIMA 1JBMA 1FXXA 1AD5A 1M3BA 1D0ZA 2QQRA 4PJLA 1M90R 1T3LA 2HL5C 4PKCC 3G6EA 2OI3A 1HK9A 4JJDA 3QO3A 2F2VA 3GBQA 1G83A 5L23A 1N6AA 3E2UA 2DEUA 5GAOm 4IIMA 2Y4YA 2QQAA 4HCCA 4PJOF 4ELYC 1N8RC 2AK5A 1VOMA 1UUEA 2K5LA 4ZGDB 1JB0E 2KVQG 2CYZB 4LDYA 2K3YA 6AT1B 2RI3A 3LGLA 4M78E 3NPFA 1QKXA 4QVZA 1RACB 3G4SQ 1XQHA 5GJVB 7AT1B 5J3BA 2E64A 4R0KA 2DF6A 2RHIA 4M7AC 3QDRB 2IVWA 5GAN8 2QA4T 1K9MR 1FWZA 2DLPA 1K9AA 2DXUA 2D1XA 2OJ2A 4B9XA 3BFMA 4B9WA 2HKNA 2VYTA 1M9SA 1VQMA 4MDWA 2F5KA 5KCHA 2K79A 4HVVA 2QEXQ 1BIAA 2QQSA 5GAN6 4BD3A 2O88A 2DILA 4LXCA 5GMKe 2L3RA 5A2QE 2MMPA 2ED0A 2KXCA 4HXJA 3L42A 3G7ZA 3A98A 2K3XA 3GNGA 3L2QA 4C8QD 4C92A 4M78F 4MZTA 2D8HA 3M56A 1K73R 4OB0B 1OU8A 3JCMQ 5GAN3 2CZ1B 2DIQA 1Y96A 5IXFA 2KDSA 2FL7A 1RAFB 2EPDA 4Y92A 2SEMA 2XG8D 1OYXA 5CQYA 2E6NA 3FEOA 5AYFA 2ZPGB 1T0HA 1XJWB 1E6GA 1Z9QA 4OGEA 3MPUB 1RABB 2GF7A 4HCKA 2QDYB 2FPFA 2ZPFB 2JJ9A 2VASA 4PL6A 3HHTB 4LUDA 5CK9A 2O4XA 4C92B 2O2OA 3NMZC 2RHXA 1YN8A 1QCOA 2C0TA 3V8LA 4QQGA 2JTMA 1OZ2A 2BE9B 3L2ZA 2JMCA 2MWOA 3QDFA
chains in the Genus database with same CATH topology
1HJDA 2QDLA 1BBZA 2K2MA 3RBBB 1QLYA 2KXDA 2LJ0A 1U3OA 2A36A 4J9IA 1Y0MA 2W0ZA 2LZ6B 5IHKA 2DNUA 4GBQA 2ROLA 1KSWA 2AZVA 4OMMA 2KE9A 2B86A 2K3BA 2JMAA 4J9HA 3SHWA 2LJ3A 5I11A 1X2QA 2O9VA 1S1NA 2EYXA 1UTIA 4JJCA 1OPLA 2DBMA 4LN2A 1M3CA 2KEAA 4JZ4A 4RTVA 2EKHA 4RTWA 3VS1A 3UA6A 1SRLA 1SHFA 3H0HA 1WXTA 2E5KA 3REBB 4E6RA 2X3XD 2EQIA 1PKSA 4JPBW 2AKKA 3JV3A 3M0QA 4RTTA 3KFVA 1M30A 1T0JA 2C0IA 1ABQA 2J06A 2ECZA 4M4ZA 2BZXA 2JW4A 3QWYA 2CH4A 1YP5A 1SPKA 1TUCA 3VS4A 3I5SA 4JJBA 1YCSB 2DMOA 2LNHB 2DBKA 1MV3A 2DRKA 2PNIA 2DL7A 1FMKA 3EGUA 3NGPA 2ROTA 1JQQA 2DRMA 3VS5A 2GQIA 2M0YA 1GCQC 1UJYA 3VS0A 2LJ1A 4J9DA 5EC7A 1VYVA 1WIEA 1YNZA 3EG1A 1I0CA 2YDLA 4OMNA 1BU1A 2LQWA 2MCNA 3VRYA 2HDAA 1SHGA 1H8KA 1BB9A 1Z9ZA 2VWFA 4AFZC 1FYNA 4LUEA 2W10A 4OMLA 2RMOA 2EGCA 2NUZA 1W70A 2PTKA 2HEQA 1JU5C 1LCKA 4DEYA 4QT7A 1HD3A 2CT4A 2ENMA 3ULRB 1WXBA 3M0RA 3TVTA 2MIOA 2JS2A 1PKTA 1QKWA 4ORZA 1ARKA 1VYUA 5FW9A 1AOJA 1AZGB 3PVQA 4ZNXA 1KIKA 4F16A 2DA9A 4OMQA 2CUDA 1N5ZA 1I07A 1VYTA 1AWOA 1RUWA 2G6FX 1K0XA 2YT6A 3M0PA 2K7AA 2FRWA 2DL3A 1UHFA 2A08A 3QWXX 1OOTA 3FJ5A 2KNBB 1U5SA 3I5RA 1SSHA 1B07A 2EBPA 2VKNA 2PZ1A 3VS2A 4AFSC 1QWFA 5FWBA 4IIOA 2L3QA 1GRIA 2JS0A 1T3SA 3M0TA 3EHQA 1ABOA 2RF0A 1WFWA 1GL5A 4AFQC 1K0SA 2F2WA 2YUPA 1MUZA 3ZL7C 2RQWA 3CQTA 4F17A 1X27A 2LCSA 2CUBA 3UA7A 3UF4A 4Z89A 2EVRA 2EYYA 2M51A 2ED1A 2CSIA 2HSPA 1X69A 1OEBA 4K11A 1W1FA 2LP5A 1GBQA 2EYZA 2FO0A 1UFFA 3THKA 2A37A 1AWJA 3LH5A 2KT8A 5IHNA 4CC2A 3EG2A 1NEGA 4Z8AA 1RLPC 2KRNA 4J9FA 3H41A 2ABLA 2DJQA 4D8DA 1UECA 1YWOA 2FPDA 2KGTA 4FSSA 2HCKA 1NYGA 4AG1C 2CH4W 4RTUA 1I1JA 1ZUYA 5GJWB 1EFNA 2F2XA 4AG2C 5ECAA 1QCFA 2K9GA 1SEMA 1G2BA 4RUGA 2KBTA 2EGAA 4CC7A 1A0NB 2BZ8A 1JEGA 4CC4B 2KROA 1GBRA 2KT1A 1M3AA 1E6HA 1X2KA 2XMFA 3EHRA 3NHNA 4GLMA 5HCKA 4JZ3A 4AFUC 3M0UA 1YWPA 2GBQA 2GNCA 2I0NA 1GFDA 2EW3A 1PNJA 4HVWA 2J7IA 4EIKA 2OAWA 2C0OA 2J6KA 2AZSA 1QWEA 4KRTA 3SEMA 4LNPA 4HVUA 5IH2A 1CSKA 1X43A 2DYBA 1H3HA 1W6XA 2GTJA 2JM8A 1AWWA 1OPKA 1VA7A 1V1CA 2CSQA 2JT4A 1BK2A 1X6GA 2HBWA 2KYMA 1K76A 2KRSA 5FWCA 4X1VA 1MV0B 4WCIA 2DL5A 3EG0A 2KR3A 2D8JA 4OMPA 1NG2A 1UE9A 2EGEA 2O31A 3PE0A 1ZLMA 4DEXA 2JM9A 1AWXA 1K1ZA 2J05A 1WXUA 2ESWA 2D0NA 1NLOC 2DE0X 2RQRA 1ZUUA 2JXBA 1RI9A 1H92A 2CREA 2CDTA 2DL4A 3O5ZA 2P4RA 2RQUA 3TSZA 2L2PA 1NYFA 1PHTA 1WA7A 4J9BA 2BTTA 2V1QA 2V1RA 1WDXA 2IIMA 3VS7A 1NLPC 3I35A 1AD5A 3PVLA 1M3BA 2YUOA 1K4US 3M0SA 1T3LA 1JXMA 5IHIA 1WYXA 2OI3A 2RQTA 1XOVA 2AKLA 1OV3A 4JJDA 2J6OA 2F2VA 4D8KA 2LQNA 1CKAA 2GTOA 3GBQA 1PRLC 2CT3A 1X6BA 1G83A 4J9CA 1ZX6A 4RTYA 4F14A 5I22A 1UJ0A 5L23A 4J9EA 1TUDA 4IIMA 2KYBA 3REAB 3RNJA 2AK5A 1UUEA 2K6DA 2MOXA 2RQVA 1ZUKA 4J9GA 2DL8A 1KJWA 1SRMA 1CKBA 3NPFA 2O9SA 1QKXA 2JTEA 2FEIA 3VRZA 2SRCA 3IQLA 5GJVB 1UG1A 1WX6A 5IXBA 4R0KA 3H0FA 2DF6A 1KFZA 1GCQA 3I9QA 2DLPA 1K9AA 4LE9A 2D1XA 2OJ2A 2FG0A 2FRYA 3C0CA 1GCPA 1M27C 1ZBJA 2A28A 1UHCA 1PWTA 1WLPB 1ZSGA 3U23A 2RNAA 1J3TA 2YUQA 2K79A 3EG3A 1AEYA 4HVVA 3UATA 2O88A 2DILA 1RLQC 2DX1A 2ED0A 2KXCA 4HXJA 4RTXA 1IO6A 2RPNA 1HSQA 3A98A 1TG0A 1B3QA 1PRMC 1GFCA 1U06A 2D8HA 2FPEA 2LX7A 2RN8A 1E7OA 3VS6A 2H8HA 5IXFA 2DM1A 2BZYA 2EPDA 2VVKA 2SEMA 2L3SA 4Y92A 1JO8A 2DVJA 1NEBA 1T0HA 3R6NA 2NWMA 1E6GA 1Z9QA 2L0AA 3H0IA 2YUNA 2GGRA 4HCKA 2FPFA 4Z88A 1AZEA 2LMJA 1NM7A 3VS3A 4RTZA 4OMOA 4LUDA 2YSQA 4A63B 2O2OA 1JXOA 1UGVA 3NMZC 2L3PA 1YN8A 2EYWA 2C0TA 1UDLA 1AVZC 3TSWA 4ESRA 1M8MA 2JMCA 2KRMA 2J6FA 1WI7A 1Y57A 4CC3A 2X3WD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJD A;  2QDL A;  1BBZ A;  2K2M A;  3RBB B;  1QLY A;  2KXD A;  2LJ0 A;  1U3O A;  2A36 A;  4J9I A;  1Y0M A;  2W0Z A;  2LZ6 B;  5IHK A;  2DNU A;  4GBQ A;  2ROL A;  1KSW A;  2AZV A;  4OMM A;  2KE9 A;  2B86 A;  2K3B A;  2JMA A;  4J9H A;  3SHW A;  2LJ3 A;  5I11 A;  1X2Q A;  2O9V A;  1S1N A;  2EYX A;  1UTI A;  4JJC A;  1OPL A;  2DBM A;  4LN2 A;  1M3C A;  2KEA A;  4JZ4 A;  4RTV A;  2EKH A;  4RTW A;  3VS1 A;  3UA6 A;  1SRL A;  1SHF A;  3H0H A;  1WXT A;  2E5K A;  3REB B;  4E6R A;  2X3X D;  2EQI A;  1PKS A;  4JPB W;  2AKK A;  3JV3 A;  3M0Q A;  4RTT A;  3KFV A;  1M30 A;  1T0J A;  2C0I A;  1ABQ A;  2J06 A;  2ECZ A;  4M4Z A;  2BZX A;  2JW4 A;  3QWY A;  2CH4 A;  1YP5 A;  1SPK A;  1TUC A;  3VS4 A;  3I5S A;  4JJB A;  1YCS B;  2DMO A;  2LNH B;  2DBK A;  1MV3 A;  2DRK A;  2PNI A;  2DL7 A;  1FMK A;  3EGU A;  3NGP A;  2ROT A;  1JQQ A;  2DRM A;  3VS5 A;  2GQI A;  2M0Y A;  1GCQ C;  1UJY A;  3VS0 A;  2LJ1 A;  4J9D A;  5EC7 A;  1VYV A;  1WIE A;  1YNZ A;  3EG1 A;  1I0C A;  2YDL A;  4OMN A;  1BU1 A;  2LQW A;  2MCN A;  3VRY A;  2HDA A;  1SHG A;  1H8K A;  1BB9 A;  1Z9Z A;  2VWF A;  4AFZ C;  1FYN A;  4LUE A;  2W10 A;  4OML A;  2RMO A;  2EGC A;  2NUZ A;  1W70 A;  2PTK A;  2HEQ A;  1JU5 C;  1LCK A;  4DEY A;  4QT7 A;  1HD3 A;  2CT4 A;  2ENM A;  3ULR B;  1WXB A;  3M0R A;  3TVT A;  2MIO A;  2JS2 A;  1PKT A;  1QKW A;  4ORZ A;  1ARK A;  1VYU A;  5FW9 A;  1AOJ A;  1AZG B;  3PVQ A;  4ZNX A;  1KIK A;  4F16 A;  2DA9 A;  4OMQ A;  2CUD A;  1N5Z A;  1I07 A;  1VYT A;  1AWO A;  1RUW A;  2G6F X;  1K0X A;  2YT6 A;  3M0P A;  2K7A A;  2FRW A;  2DL3 A;  1UHF A;  2A08 A;  3QWX X;  1OOT A;  3FJ5 A;  2KNB B;  1U5S A;  3I5R A;  1SSH A;  1B07 A;  2EBP A;  2VKN A;  2PZ1 A;  3VS2 A;  4AFS C;  1QWF A;  5FWB A;  4IIO A;  2L3Q A;  1GRI A;  2JS0 A;  1T3S A;  3M0T A;  3EHQ A;  1ABO A;  2RF0 A;  1WFW A;  1GL5 A;  4AFQ C;  1K0S A;  2F2W A;  2YUP A;  1MUZ A;  3ZL7 C;  2RQW A;  3CQT A;  4F17 A;  1X27 A;  2LCS A;  2CUB A;  3UA7 A;  3UF4 A;  4Z89 A;  2EVR A;  2EYY A;  2M51 A;  2ED1 A;  2CSI A;  2HSP A;  1X69 A;  1OEB A;  4K11 A;  1W1F A;  2LP5 A;  1GBQ A;  2EYZ A;  2FO0 A;  1UFF A;  3THK A;  2A37 A;  1AWJ A;  3LH5 A;  2KT8 A;  5IHN A;  4CC2 A;  3EG2 A;  1NEG A;  4Z8A A;  1RLP C;  2KRN A;  4J9F A;  3H41 A;  2ABL A;  2DJQ A;  4D8D A;  1UEC A;  1YWO A;  2FPD A;  2KGT A;  4FSS A;  2HCK A;  1NYG A;  4AG1 C;  2CH4 W;  4RTU A;  1I1J A;  1ZUY A;  5GJW B;  1EFN A;  2F2X A;  4AG2 C;  5ECA A;  1QCF A;  2K9G A;  1SEM A;  1G2B A;  4RUG A;  2KBT A;  2EGA A;  4CC7 A;  1A0N B;  2BZ8 A;  1JEG A;  4CC4 B;  2KRO A;  1GBR A;  2KT1 A;  1M3A A;  1E6H A;  1X2K A;  2XMF A;  3EHR A;  3NHN A;  4GLM A;  5HCK A;  4JZ3 A;  4AFU C;  3M0U A;  1YWP A;  2GBQ A;  2GNC A;  2I0N A;  1GFD A;  2EW3 A;  1PNJ A;  4HVW A;  2J7I A;  4EIK A;  2OAW A;  2C0O A;  2J6K A;  2AZS A;  1QWE A;  4KRT A;  3SEM A;  4LNP A;  4HVU A;  5IH2 A;  1CSK A;  1X43 A;  2DYB A;  1H3H A;  1W6X A;  2GTJ A;  2JM8 A;  1AWW A;  1OPK A;  1VA7 A;  1V1C A;  2CSQ A;  2JT4 A;  1BK2 A;  1X6G A;  2HBW A;  2KYM A;  1K76 A;  2KRS A;  5FWC A;  4X1V A;  1MV0 B;  4WCI A;  2DL5 A;  3EG0 A;  2KR3 A;  2D8J A;  4OMP A;  1NG2 A;  1UE9 A;  2EGE A;  2O31 A;  3PE0 A;  1ZLM A;  4DEX A;  2JM9 A;  1AWX A;  1K1Z A;  2J05 A;  1WXU A;  2ESW A;  2D0N A;  1NLO C;  2DE0 X;  2RQR A;  1ZUU A;  2JXB A;  1RI9 A;  1H92 A;  2CRE A;  2CDT A;  2DL4 A;  3O5Z A;  2P4R A;  2RQU A;  3TSZ A;  2L2P A;  1NYF A;  1PHT A;  1WA7 A;  4J9B A;  2BTT A;  2V1Q A;  2V1R A;  1WDX A;  2IIM A;  3VS7 A;  1NLP C;  3I35 A;  1AD5 A;  3PVL A;  1M3B A;  2YUO A;  1K4U S;  3M0S A;  1T3L A;  1JXM A;  5IHI A;  1WYX A;  2OI3 A;  2RQT A;  1XOV A;  2AKL A;  1OV3 A;  4JJD A;  2J6O A;  2F2V A;  4D8K A;  2LQN A;  1CKA A;  2GTO A;  3GBQ A;  1PRL C;  2CT3 A;  1X6B A;  1G83 A;  4J9C A;  1ZX6 A;  4RTY A;  4F14 A;  5I22 A;  1UJ0 A;  5L23 A;  4J9E A;  1TUD A;  4IIM A;  2KYB A;  3REA B;  3RNJ A;  2AK5 A;  1UUE A;  2K6D A;  2MOX A;  2RQV A;  1ZUK A;  4J9G A;  2DL8 A;  1KJW A;  1SRM A;  1CKB A;  3NPF A;  2O9S A;  1QKX A;  2JTE A;  2FEI A;  3VRZ A;  2SRC A;  3IQL A;  5GJV B;  1UG1 A;  1WX6 A;  5IXB A;  4R0K A;  3H0F A;  2DF6 A;  1KFZ A;  1GCQ A;  3I9Q A;  2DLP A;  1K9A A;  4LE9 A;  2D1X A;  2OJ2 A;  2FG0 A;  2FRY A;  3C0C A;  1GCP A;  1M27 C;  1ZBJ A;  2A28 A;  1UHC A;  1PWT A;  1WLP B;  1ZSG A;  3U23 A;  2RNA A;  1J3T A;  2YUQ A;  2K79 A;  3EG3 A;  1AEY A;  4HVV A;  3UAT A;  2O88 A;  2DIL A;  1RLQ C;  2DX1 A;  2ED0 A;  2KXC A;  4HXJ A;  4RTX A;  1IO6 A;  2RPN A;  1HSQ A;  3A98 A;  1TG0 A;  1B3Q A;  1PRM C;  1GFC A;  1U06 A;  2D8H A;  2FPE A;  2LX7 A;  2RN8 A;  1E7O A;  3VS6 A;  2H8H A;  5IXF A;  2DM1 A;  2BZY A;  2EPD A;  2VVK A;  2SEM A;  2L3S A;  4Y92 A;  1JO8 A;  2DVJ A;  1NEB A;  1T0H A;  3R6N A;  2NWM A;  1E6G A;  1Z9Q A;  2L0A A;  3H0I A;  2YUN A;  2GGR A;  4HCK A;  2FPF A;  4Z88 A;  1AZE A;  2LMJ A;  1NM7 A;  3VS3 A;  4RTZ A;  4OMO A;  4LUD A;  2YSQ A;  4A63 B;  2O2O A;  1JXO A;  1UGV A;  3NMZ C;  2L3P A;  1YN8 A;  2EYW A;  2C0T A;  1UDL A;  1AVZ C;  3TSW A;  4ESR A;  1M8M A;  2JMC A;  2KRM A;  2J6F A;  1WI7 A;  1Y57 A;  4CC3 A;  2X3W D; 
#chains in the Genus database with same CATH topology
 1VUB A;  4C92 G;  1D09 B;  1BBZ A;  1D0X A;  2XD0 A;  4IUV A;  2RH2 A;  3RBB B;  4ME7 A;  1QLY A;  2KXD A;  4XU1 A;  1PM3 A;  4O6J A;  5EG2 A;  5I21 A;  3OYE A;  1I81 A;  2FZC B;  2QI2 A;  5LJ5 d;  2O4X B;  4IKF A;  2ROL A;  2AZV A;  2NUP A;  4OMM A;  1YJN A;  2KE9 A;  4J6X A;  1VQL T;  3LGF A;  2B86 A;  2K3B A;  3SHW A;  4TVR A;  1X2Q A;  2VB6 A;  3DKM A;  1JJ2 P;  1WHM A;  1OPL A;  4N0A C;  1M3C A;  4JZ4 A;  1SKU B;  1W2B S;  5J39 A;  3BDL A;  2PQW A;  1SRL A;  4A4E A;  4DOW A;  1PKS A;  2RI5 A;  4JPB W;  2R57 A;  3M0Q A;  1X75 C;  1VQ5 A;  2LC4 A;  1T0J A;  4L59 A;  4C8Q C;  1ABQ A;  2LVM A;  2NUP B;  2EAY A;  3OMC A;  2ECZ A;  4M4Z A;  3OYD A;  3JB9 D;  3TEE A;  5GAN 2;  4JLG A;  2EJG A;  3CCR T;  1TUC A;  3D7S B;  1YHQ T;  4KBM B;  1VQ6 A;  5KYU A;  3SWN A;  2E10 A;  2R58 A;  3EH2 A;  3CCM A;  2DMO A;  2DBK A;  2DRK A;  3OY9 A;  4M7A E;  2JNG A;  4BB7 A;  2DL7 A;  4XTX A;  2DRM A;  3VS5 A;  1PSE A;  3VS0 A;  1M90 C;  5L8R E;  3CBM A;  3MHX A;  2LJ1 A;  5EC7 A;  1VYV A;  3CME Q;  3VRY A;  2LQW A;  5GAN j;  3ME9 A;  1Z9Z A;  1H8K A;  1VQP T;  3AHU A;  4AFZ C;  2XDD A;  3CMA T;  2DEQ A;  2F1L A;  1GXI E;  1W70 A;  2PTK A;  2HEQ A;  4M7D A;  2E6Z A;  5LJ3 d;  4QT7 A;  3LX7 A;  4DEY A;  3CCQ A;  2CT4 A;  2RK1 A;  5GAO n;  1V76 A;  5IN1 A;  5LJ5 h;  1KC8 C;  5KYU B;  3SWN B;  2HZY A;  4A53 A;  2CS7 A;  2PVD B;  1QKW A;  2DFU A;  3X24 B;  4ZN1 A;  1VYU A;  4JLI A;  1AOJ A;  1WPY A;  3S6W A;  1X01 A;  1VYT A;  1I07 A;  1AWO A;  1KQ1 A;  2DO3 A;  3HRS A;  4PFZ A;  1K9M C;  2A08 A;  2L8D A;  3I55 A;  2XKO C;  1M90 U;  4BE2 A;  1EIF A;  1D1A A;  4ZGE B;  4BI8 B;  2KNB B;  1U5S A;  3I5R A;  4FCY A;  1SSH A;  2B8A A;  5HK0 A;  4M7D B;  2EBP A;  2XK0 A;  5FWB A;  1VQO A;  1VQ4 T;  4FW1 A;  1EX4 A;  1R0B G;  1GL5 A;  3QBY A;  3PIO A;  3ASK A;  4J8O A;  1VQ7 A;  2ATC B;  2DK3 A;  2OX7 A;  4F17 A;  3OYB A;  5AT1 B;  3GP8 A;  2GFU A;  3JCM W;  2ZGW A;  1K73 C;  2MI6 A;  4OP0 A;  4C92 F;  2QA4 Q;  2M51 A;  2HSP A;  2C06 A;  1X69 A;  2EJ9 A;  2MF2 A;  2P0P A;  4K11 A;  2HQE A;  2EYZ A;  1K9M U;  4KH0 B;  2A37 A;  2ZPH B;  1AWJ A;  4F04 B;  1LJO A;  2KT8 A;  3LH5 A;  3FJP A;  5FRO A;  3CC2 A;  2QTV A;  4N4G A;  2YLB A;  4LDW A;  2K5I A;  3OYI A;  4XTW A;  1RLP C;  2HKQ B;  4J9F A;  2ABL A;  2ZAE A;  5GAN f;  5KE3 A;  1UEC A;  1VQK T;  4ZTJ A;  1EFN A;  4AG2 C;  1F1B B;  5ECA A;  4CI0 C;  2LDM A;  3MP8 A;  1SEM A;  1O75 A;  4X34 A;  4CC4 B;  5KCO A;  4EMK C;  1E6H A;  2XMF A;  3X25 B;  1K73 U;  4BY6 C;  3OYJ A;  4C8Q E;  3ZEH A;  4CRI A;  5GAM d;  3A1P A;  2GBQ A;  2DTI A;  1G5V A;  1WHG A;  3L2R A;  4PJO A;  1QVF A;  1VQ9 T;  3UWN A;  2QQ9 A;  4DOV A;  1YJW A;  1Y07 A;  3MKD A;  1YI2 T;  5GMK m;  2R5M A;  4JRK A;  3CD6 T;  1HXD A;  1VA7 A;  2PVG B;  1BK2 A;  3CPW P;  2HBW A;  3OQ5 A;  4M75 D;  3JB9 I;  3G6E T;  2KRS A;  1NG2 A;  4ZGJ B;  1UE9 A;  2O31 A;  3PE0 A;  2VC8 A;  4PJO B;  1QP2 A;  4C8Q F;  1QVG P;  3V7C A;  3EGD A;  3PIP A;  2D0N A;  1NLO C;  2RQR A;  1ZUU A;  2BUD A;  2RHU A;  5GMK h;  5CR2 A;  3A8M B;  5CKD A;  2RA2 A;  2X4W A;  2DL4 A;  4PJO G;  1VQL Q;  1MMG A;  3JB9 H;  2V1R A;  1WDX A;  4M78 A;  4DQ2 A;  1K4U S;  1WHJ A;  1JJ2 S;  4LDX A;  2MYS A;  5GAN e;  4P5N A;  2RQT A;  1ZA1 B;  2AKL A;  2FZK B;  1KQS P;  3QII A;  4FYV B;  1YJ9 T;  3OYG A;  4HA8 A;  1PRL C;  4NOY A;  2OTL A;  1OQK A;  4ANJ A;  3EGD B;  3OYC A;  2X51 A;  3JCM c;  4F14 A;  5I22 A;  4J9E A;  1TUD A;  2KQW A;  4FIB A;  5DM7 R;  3HRU A;  1M2O A;  2KYB A;  3RNJ A;  3E9G A;  3FRN A;  2K6D A;  4C0D B;  1VQ8 T;  1RAA B;  3CCR Q;  4M78 B;  1S72 A;  3MEU A;  4J9G A;  3BDU A;  1YHQ Q;  1KJW A;  1SRM A;  2ZCF B;  4LD9 K;  3OYA A;  4EMG A;  5GAO l;  5DLQ E;  2QG9 B;  3IQL A;  3QKJ A;  3DB4 A;  3CCE A;  1GCQ A;  5FU6 B;  4M78 G;  2X4X A;  2L89 A;  2FG0 A;  2OAU A;  5HK3 A;  1GCP A;  3OSS C;  1ZBJ A;  2A28 A;  3OSV A;  4GY5 A;  1UHC A;  3CC4 A;  1WLP B;  3A5Z B;  1VQP Q;  2GFA A;  3CMA Q;  2RNA A;  5KE2 A;  2HL3 A;  3QJY A;  2WSC E;  2LX9 A;  2F5T X;  3OW2 A;  2KY9 A;  4M75 C;  4OGC A;  2VXF A;  2E4H A;  2DX1 A;  3QPH A;  4C5H A;  1M2V A;  3M59 A;  1N27 A;  1N9S A;  3J81 E;  5LL6 S;  4RCB A;  1U06 A;  2NUT A;  3P8H A;  3I56 T;  5D6X A;  2EQK A;  2DM1 A;  3JB9 F;  4BDZ A;  8AT1 B;  1M8V A;  2L3S A;  5D6W A;  3L2U A;  3A8O B;  2DVJ A;  1NEB A;  3R6N A;  2LT1 A;  2NWM A;  2QTX A;  2ZPI B;  3RUX A;  3H0I A;  4KUL A;  3UT1 A;  4MMK A;  2JN0 A;  1AZE A;  1M2V B;  4IUR A;  1WQ7 A;  1MMD A;  3F70 A;  1NPR A;  4OMO A;  1YJN T;  2YSQ A;  3G4S A;  5KH6 A;  2NUT B;  1XTD A;  3PGG A;  1ZHI A;  1WGS A;  3TSW A;  1M8M A;  3M5A A;  2J6F A;  4QVD A;  1WI7 A;  4PK4 A;  1NZ9 A;  1W2B A;  2X3W D;  3JSC A;  2QDL A;  1Q86 R;  4RKU E;  2K2M A;  2QEX A;  1R0C B;  2ZZD A;  2LZ6 B;  3JRZ A;  5I2M A;  2DNU A;  3RKX A;  4OB1 B;  1VQK Q;  3EH1 A;  5GMK i;  1VQ6 T;  1KC8 R;  2JMA A;  2ZPE B;  5I11 A;  2O9V A;  4JRP A;  2PUK B;  3NTH A;  2EYX A;  1UTI A;  4M7A A;  3HPW A;  4JUV A;  5I2S A;  1K8A C;  2E41 A;  1LPL A;  4O5V A;  4RTW A;  3V8K A;  2DYI A;  3UA6 A;  2CP5 A;  1WXT A;  2E5K A;  2RK2 A;  2X3X D;  2RI2 A;  1M1G A;  1FX7 A;  2AKK A;  2E1H A;  2E3I A;  1UB4 A;  4NL3 A;  3KFV A;  4ZN3 A;  2C0I A;  1YIT T;  3J80 E;  2EQM A;  2J06 A;  3KXT A;  2BZX A;  1VQ9 Q;  3OS1 A;  2Z0W A;  2RD1 A;  2DKG A;  2LT4 A;  5A0D A;  2FVU A;  2E3H A;  3CD6 Q;  3I5S A;  3JCM V;  4M7A B;  3CCS T;  4FW2 A;  4M77 D;  3GNF B;  1YIJ T;  1YCS B;  2LNH B;  1N8R U;  3N5B B;  1NBE B;  2M0Y A;  3TQ7 P;  4J9D A;  3CCL T;  1FMV A;  4FL6 A;  3CPW S;  4RG2 A;  4E2F B;  2YDL A;  4M7A G;  3CCU T;  4FYX B;  5KYN A;  4XTZ A;  2VWF A;  2CP0 A;  4LUE A;  2W10 A;  2XIC A;  4C0G A;  3MEW A;  4M75 E;  1LCK A;  3FLG A;  1LVK A;  1QVG S;  3ULR B;  3M0R A;  2DVE A;  2JS2 A;  1PKT A;  1PSF A;  1AZG B;  1KIK A;  3JCM J;  4XTU A;  1I4K 1;  3V7S A;  2XI9 A;  4PLL A;  2JTF A;  3RKW A;  3OS0 A;  3CBO A;  1K0X A;  3T9N A;  3M0P A;  3NTI A;  1OOT A;  3FJ5 A;  4Q5W A;  5GAN g;  4V2S A;  1YJ9 Q;  2WSE E;  4ZTF A;  1KQS S;  3QZ9 B;  3VS2 A;  1I8F A;  4AFS C;  1I5O B;  4VUB A;  4IIO A;  4D6W A;  1IGQ A;  2L3Q A;  4OB2 B;  1RAE B;  4FYW B;  1GRI A;  3E19 A;  2QYZ A;  4XAX B;  1T3S A;  1ABO A;  2RF0 A;  1VQ8 Q;  4AFQ C;  5A0L A;  1M1K C;  3CCV Q;  2YUP A;  2YRD A;  3JCM e;  2COW A;  3CQT A;  1X27 A;  1BIB A;  2LCS A;  3WXM B;  4L6V 5;  3CME A;  3SDZ A;  3M4G A;  1JRI A;  2ED1 A;  2CSI A;  2F69 A;  1VQN Q;  1OEB A;  1W1F A;  5D6Y A;  5KYX A;  1BCO A;  4C8Q A;  3QXE B;  5IHN A;  1WZO A;  1UEB A;  4M77 C;  2HD0 A;  4CC2 A;  2A3L A;  4Z8A A;  2KRN A;  3HKS A;  1TSF A;  2KGT A;  4QVC A;  4QW2 A;  4AG1 C;  3PNW C;  4PFP A;  1QVP A;  1BCM A;  2K9G A;  1WHL A;  4GLK A;  2BZ8 A;  1GBR A;  2KT1 A;  1R8O B;  1QMC A;  2X4Y A;  3SB2 A;  4LD6 A;  5GAN h;  4IUQ A;  2RB6 A;  3I56 Q;  3L2V A;  3CXC A;  1B34 A;  1ZSZ C;  5KYX B;  3NFC A;  4C8Q B;  1Q86 C;  4GLM A;  5HCK A;  1ACM B;  4JZ3 A;  1Q95 G;  1Y7X A;  3ZFJ A;  4FU6 A;  3X20 B;  2I0N A;  1GFD A;  3OS5 A;  1RAI B;  3EFS A;  2A7Y A;  2DTO A;  2CZ6 B;  4FSX A;  2AZS A;  2X35 A;  4A4K A;  4C8Q G;  4KRT A;  3SEM A;  4HVU A;  2E70 A;  3QG1 A;  2K57 A;  1X43 A;  2DYB A;  1W6X A;  2JM8 A;  5GAO p;  3X26 B;  3L1A A;  1TH7 A;  1V1C A;  2QA4 A;  1B34 B;  1JJ2 A;  1X6G A;  2KYM A;  3J7A F;  2ZPB B;  4X1V A;  5GMK l;  3GF5 A;  4M7A F;  4J7I A;  2D8J A;  4XTV A;  3TCJ A;  1BI0 A;  2FB7 A;  3KBG A;  3X28 B;  2OTL T;  4HCZ A;  3MEV A;  2BKD N;  3CCJ T;  1ZLM A;  4M7D C;  2DZ9 A;  1KHI A;  2J05 A;  2O01 E;  1G8X A;  1AHJ B;  2DE0 X;  1RI9 A;  3LH0 A;  1H92 A;  3JAM E;  2CRE A;  3MJX A;  3QYG B;  5LJ5 j;  3O5Z A;  3HSB A;  2P4R A;  3VYG A;  3TSZ A;  5HY6 A;  1PHT A;  2BTT A;  4E47 A;  3VS7 A;  1NLP C;  1KC8 U;  2YUO A;  1JXM A;  1WYX A;  5DLO A;  5D7U A;  4R56 A;  4Z02 A;  3MP6 A;  1HYO A;  3TRE A;  1XOV A;  2VUB A;  2VV5 A;  1OV3 A;  1Y71 A;  4D8K A;  1QVF P;  1CKA A;  1PD1 A;  3EG9 A;  2QQB A;  3S3N A;  1M1F A;  3WVD B;  4J9C A;  1ZX6 A;  4RTY A;  1UJ0 A;  3OMG A;  4A4H A;  2RHY A;  1G3T A;  1YIT Q;  5HKC A;  2BE7 D;  1X6O A;  5IT9 E;  4PJM A;  3REA B;  2CP3 A;  2RQV A;  1WQW A;  1Q81 C;  4E7L A;  2DL8 A;  1UGP B;  2RJE A;  1CKB A;  3CCS Q;  2FEI A;  1YIJ Q;  3VUB A;  2SRC A;  1UG1 A;  4XU2 A;  5IXB A;  1VIE A;  3H0F A;  3VJP A;  3DLM A;  3I9Q A;  3EG9 B;  3CCL Q;  3EAE A;  1PC0 A;  3G71 T;  4OB3 B;  4M77 E;  3CC7 T;  3CCU Q;  1ZBX A;  4YTL A;  1ZSG A;  1UGS B;  3JB9 G;  3U23 A;  4BE0 A;  3C94 A;  4E7S A;  1J3T A;  4FM4 B;  5FU7 C;  1AEY A;  3QYH B;  1VQL A;  4KGZ B;  3RIR A;  2P84 A;  5LJ3 j;  2OTJ T;  4DA4 A;  3OBW A;  4RTX A;  4E7K A;  1IO6 A;  3CBP A;  2RPN A;  4E7I A;  4EMK B;  1B3Q A;  1PRM C;  1GFC A;  1OX8 A;  2DET A;  4BY6 B;  2EJF A;  5M9O A;  4II1 A;  3QSU A;  5GAN 5;  2FPE A;  3O8V A;  3H9N A;  1D1C A;  2FYK A;  2RN8 A;  1E7O A;  3VS6 A;  5CKH A;  3JB9 J;  1K8A R;  1JO8 A;  5FLX E;  5GAM g;  1WJQ A;  1MMA A;  3MCA B;  2IPO B;  2QEX T;  4M77 F;  5J26 A;  3CCR A;  2GGR A;  2RO0 A;  2M16 A;  3G1J A;  4Z88 A;  2LMJ A;  1YHQ A;  4QKU A;  4C0F A;  4RTZ A;  2V8K A;  4A63 B;  3FC3 A;  1UGV A;  5DY9 A;  3A8G B;  2EYW A;  1OUL A;  5CAI A;  3OA6 A;  2FHD A;  2DTH A;  2PU9 B;  3JCM g;  2XU8 A;  4HT8 A;  2CP7 A;  2KRM A;  3M9Q A;  1MMN A;  1UGR B;  1Y57 A;  4R55 A;  4CC3 A;  1V29 B;  4J6W A;  3HP9 A;  1VQP A;  4ATO A;  2RM4 A;  3CMA A;  3OW2 P;  4B6M A;  2LJ0 A;  1U3O A;  2A36 A;  1Y0M A;  2QXF A;  1R77 A;  1VQM T;  4GBQ A;  2QAZ A;  2V26 A;  4C0D C;  1TWB A;  4J9H A;  2M9U A;  4BDY A;  3UPU A;  3P8B B;  1NE8 A;  1OZ3 A;  4JJC A;  3JCM X;  1Q7Y C;  2KEA A;  2EKH A;  4KUD K;  3REB B;  1TOV A;  5C6S A;  1YBY A;  3OYM A;  4RTT A;  1M30 A;  2D0Q B;  2DXC A;  5GAM j;  1QVG A;  4M75 A;  4JDS A;  1UGQ B;  4WF2 A;  2JUF A;  3QWY A;  1QQJ A;  1SPK A;  3JCM h;  4JJB A;  1M1K R;  1NJI C;  1KD1 R;  1QP3 A;  4DBF A;  2LRQ A;  3OYY A;  1GCQ C;  2X9H A;  4AT1 B;  1Q82 C;  2YLC A;  4OF1 A;  3EG1 A;  1MGQ A;  1SG5 A;  5CQX A;  4OMN A;  2K5F A;  2MCN A;  1IHW A;  1KQS A;  2HDA A;  1WHK A;  1SHG A;  1BB9 A;  4M75 B;  2OTL Q;  3OYN A;  3CCJ Q;  2CZ7 B;  2NUZ A;  2DXB A;  2P0Q A;  1VQK A;  2EIF A;  1HD3 A;  4N4H A;  4KT0 E;  2JVV A;  4DBR A;  3TVT A;  3JCM P;  2EQU A;  1VQ4 Q;  1ARK A;  4ORZ A;  2E65 A;  4M75 G;  4PFO A;  3PVQ A;  4XK8 E;  4ZNX A;  3R6O A;  3CME T;  1RUW A;  3GLX A;  5CKE A;  2VGM A;  2YT6 A;  1KHC A;  3RR6 A;  4C5E A;  2K7A A;  2EQJ A;  4Y28 E;  3ZBD A;  3MET A;  4KGX B;  1C1A A;  3HTR A;  2E12 A;  2VXE A;  4HCB A;  2PZ1 A;  1QW1 A;  4C92 D;  4C0Z A;  1WJS A;  1VQ9 A;  1QVF S;  4XU0 A;  5LJ3 e;  2XID A;  1VQ5 T;  2JS0 A;  3CD6 A;  3EHQ A;  3V8J A;  3NTK A;  4XU3 A;  4BI4 A;  2AHJ B;  1MUZ A;  4F7U E;  5GAM f;  4WTO B;  2LTO A;  1OI1 A;  3PTA A;  3EFO A;  3QZ5 B;  1U8R A;  4XQ3 A;  3EGX A;  2CUB A;  3UA7 A;  3CCM T;  4Z89 A;  4MZM A;  2H3E B;  2EYY A;  3RKY A;  2DJZ A;  4JJN K;  1GBQ A;  1UFF A;  3LLR A;  3G71 Q;  4ELZ C;  3CC7 Q;  2EKO A;  3EG2 A;  4MML A;  3JCM f;  1O9S A;  4AMC A;  2I2L A;  3H41 A;  4D8D A;  1YWO A;  2FPD A;  4BE1 A;  2HSE B;  2DXT A;  3CCQ T;  2WAC A;  3P8D A;  2CH4 W;  4RTU A;  1I1J A;  2OTJ Q;  3EFO B;  1TTH B;  1YI2 Q;  3EGX B;  1H3Z A;  4F7U F;  1P92 A;  4RUG A;  2KBT A;  4CC7 A;  1A0N B;  5FRM A;  2QGG A;  2CZ0 B;  2Y90 A;  3FDR A;  1YJ9 A;  2NYS A;  4NL2 A;  4JS4 A;  4X9D A;  2DZC A;  3C4S A;  3M4Y A;  3G6E Q;  4EPC A;  3I55 T;  2QAS A;  3FB9 A;  3M0U A;  1K8A U;  1YWP A;  2EW3 A;  4DBH A;  1PNJ A;  1VQ8 A;  3GIB A;  3CCV A;  1QWE A;  2LCC A;  1VQO T;  1D3B A;  5IH2 A;  1CSK A;  4IUU A;  5FRN A;  1Q81 R;  2CP6 A;  2HNI A;  1KK7 A;  1FMW A;  1VQ7 T;  3SD4 A;  4NS5 A;  2CSQ A;  2JT4 A;  4C92 C;  4E7H A;  1VQN A;  5CKF A;  1K76 A;  5GAN d;  4BI3 A;  1RAD B;  2RJF A;  3QHS A;  3BE3 A;  2EGE A;  4BUG A;  5GAM e;  3OYL A;  1BKB A;  1MHN A;  3HL8 A;  2JM9 A;  1RAH B;  1K1Z A;  2M02 A;  3OW2 S;  3CC2 T;  4OMF B;  1D3B B;  1WXU A;  2ESW A;  1KG1 A;  2PUO B;  1VQM Q;  1BI2 A;  3PMT A;  4M75 F;  5C0M A;  1Y96 B;  2HBP A;  3BY7 A;  4J9B A;  1NYF A;  1WA7 A;  2AT1 B;  3OBY A;  3CXC P;  3RMS A;  3I56 A;  1KD1 C;  3I35 A;  3PVL A;  4N4I A;  4M7D D;  3M0S A;  3MEA A;  4IUP A;  5IHI A;  3DLL A;  3MP1 A;  4N0A A;  1IZ6 A;  1ZQ1 A;  2HMA A;  2J6O A;  3VU3 C;  2LQN A;  2GTO A;  5GAO r;  2CT3 A;  2IG0 A;  4J83 A;  1ZA2 B;  4M77 A;  1X6B A;  4L5G A;  1H64 1;  2RJD A;  4MZP A;  2AIR B;  2HQH A;  3DB3 A;  8ATC B;  5LJ5 g;  2MOX A;  2KAF A;  1ZUK A;  1YJW T;  1QCN A;  1OU9 A;  3UDC A;  1MND A;  2O9S A;  2JTE A;  4E7J A;  4PLI A;  2D6F A;  3VRZ A;  3PT9 A;  1WX6 A;  3BW1 A;  2KMT A;  1ZSZ A;  1M1K U;  1KFZ A;  3GPL A;  1KD1 U;  9ATC B;  2HQX A;  4LE9 A;  1YCY A;  4M77 B;  5CO7 A;  1VIF A;  2FRY A;  3C0C A;  3H8Z A;  1M27 C;  5GAO q;  2WSF E;  4KGV B;  1PWT A;  2KK4 A;  2DD4 A;  2YUQ A;  3EG3 A;  3UAT A;  4M77 G;  2YRV A;  3L2W A;  1IRE B;  1RLQ C;  1WHH A;  1M4Z A;  1HSQ A;  1TG0 A;  3WVE B;  1ZSZ B;  1WNL A;  1YFN A;  3SWN C;  1YJN Q;  4XTY A;  4C5G A;  1XNI A;  1G3S A;  2LCL A;  2LX7 A;  3GOX A;  2H8H A;  2BZY A;  2EFI A;  2KI7 A;  2VVK A;  2FZG B;  1Q7Y R;  3MO8 A;  2YWW A;  3FIF A;  1YIT A;  1SF9 A;  4IUT A;  2L0A A;  3URG A;  2G3R A;  2DPP B;  3OYH A;  2YUN A;  1VQ5 Q;  2PVO B;  3M55 A;  1Q86 U;  2CGH A;  5LJ3 g;  1NM7 A;  2MWP A;  3VS3 A;  5CKB A;  2EWN A;  3CCS A;  1YIJ A;  1JXO A;  2L3P A;  2MAM A;  4C92 E;  1UDL A;  1S72 T;  1AVZ C;  2V8J A;  2H3J A;  4ESR A;  2QK0 A;  2V8I A;  3CCL A;  1VQ6 Q;  4PJO D;  3LYI A;  3C95 A;  4A4G A;  1BYM A;  3CCM Q;  1OX9 A;  2RJC A;  1NJI R;  3AT1 B;  3CCU A;  3VV0 A;  3M54 A;  4PJN A;  1I5L A;  3CCE T;  1HJD A;  3HFO A;  3LW5 E;  1Q82 R;  1RL2 A;  2YRC A;  3TU4 K;  3QJ6 A;  4PNO A;  2E5Q A;  2W0Z A;  4J9I A;  3CC4 T;  5IHK A;  4J7F A;  2LQ8 A;  4M7D G;  4J5Y A;  1KSW A;  3LWH A;  2RHZ A;  3CCQ Q;  2LQK A;  3PFS A;  2YHT A;  2LJ3 A;  5CIU A;  3INZ A;  2XHC A;  1S1N A;  1B7T A;  5IAY A;  2DBM A;  4LN2 A;  1C6V X;  4RG8 A;  2XDB A;  4RTV A;  3VS1 A;  3CEY A;  4EMK A;  3QUI A;  1SHF A;  3H0H A;  3KUF A;  4E6R A;  2EQI A;  4RMO A;  3JV3 A;  1NPP A;  4M78 D;  3I55 Q;  2P0K A;  5LJ3 h;  2COZ A;  1BI1 A;  3A8L B;  1RI0 A;  3RDV A;  2JW4 A;  2CH4 A;  1YP5 A;  1VQO Q;  1LNX A;  3VKI A;  3VS4 A;  5KYW A;  4PJJ A;  3M57 A;  3RER A;  1N9R A;  3G4S T;  2XDP A;  2BIV A;  1MV3 A;  2A0F B;  1M5Q 1;  3C12 A;  2PNI A;  2JZ2 A;  1FMK A;  3EGU A;  3NGP A;  2ROT A;  1JQQ A;  2GQV A;  2M1H A;  1VQ7 Q;  2GQI A;  2NLU A;  4QQD A;  1UJY A;  1Q81 U;  4EMH A;  3EFR A;  4EDU A;  4JRQ A;  3VUZ A;  3OYF A;  1EZZ B;  5LJ5 f;  1WIE A;  1YNZ A;  3OS2 A;  1I0C A;  2X4J A;  1BU1 A;  5FU7 B;  3SFM A;  1TXQ A;  4A54 A;  1FYN A;  4OML A;  2RMO A;  2EGC A;  1TU0 B;  4RCC A;  1JU5 C;  2ENM A;  3CC2 Q;  1N8R R;  4PJO C;  5KYW B;  1WXB A;  2COY A;  3HRT A;  2MIO A;  2HAX A;  4JRI A;  2DAQ A;  4KH1 B;  4C5I A;  3S3M A;  4F7U A;  5FW9 A;  3H6Z A;  3JCM d;  5GAN 4;  1IB8 A;  1WJR A;  4A4F A;  4F16 A;  4QQ6 A;  2DA9 A;  4OMQ A;  2CUD A;  1N5Z A;  3CXC S;  1G3W A;  2D9T A;  3ER0 A;  5KYY A;  2DD5 A;  2G6F X;  1IGU A;  2FRW A;  2DL3 A;  1UHF A;  5A0G A;  3QWX X;  3S3O A;  4Y91 A;  4X9C A;  2R5A A;  1B07 A;  1W4S A;  2VKN A;  1MNE A;  1QWF A;  3PMI A;  4M7D E;  2Y4X A;  4UC4 A;  3M0T A;  2K4Y A;  1RAG B;  2YXY A;  4F7U B;  1WFW A;  2P4T A;  1K0S A;  2F2W A;  2QGF B;  1YJW Q;  3ZL7 C;  2RQW A;  2VGN A;  2MPX C;  5GMK j;  3OB9 A;  2L5Q A;  5KYY B;  4M78 C;  2KSS A;  5CVI A;  3UF4 A;  4F7U G;  2EVR A;  2M0O A;  4JS5 A;  5LJ3 f;  4HKE A;  3CCJ A;  2LP5 A;  5GAM h;  3CPW A;  2FO0 A;  2DIG A;  4KUI A;  1BI3 A;  3THK A;  5FU6 C;  2GCX A;  1U1T A;  1NEG A;  1VQ4 A;  4M7D F;  3CCV T;  1AT1 B;  2DJQ A;  3OYK A;  3M58 A;  4J6Y A;  4MDX A;  3LWI A;  4FSS A;  5LJ5 e;  2HCK A;  1NYG A;  3JCM b;  1ZUY A;  3HFN A;  5GJW B;  2F2X A;  1QCF A;  4FYY B;  1G2B A;  2EGA A;  1G3Y A;  1JEG A;  2KRO A;  1VQN T;  1W2B P;  1M3A A;  1KQ2 A;  1IHV A;  1SSF A;  2LNV A;  1X2K A;  3EHR A;  1IRX A;  3M53 A;  3NHN A;  4AFU C;  1Q7Y U;  1PCX A;  2GNC A;  3E1S A;  4HVW A;  2J7I A;  4M7A D;  1IXD A;  4EIK A;  2OAW A;  2C0O A;  2J6K A;  1PG5 B;  3RES A;  2DER A;  4E7Z A;  4LNP A;  1C0M A;  4FT4 A;  1D1B A;  1H3H A;  2GTJ A;  1D0Y A;  1AWW A;  1OPK A;  4LDU A;  1S72 Q;  3CPF A;  5FWC A;  2JOY A;  5CCA A;  1MV0 B;  4WCI A;  3G71 A;  2DL5 A;  3EG0 A;  2KR3 A;  3CC7 A;  4OMP A;  1TS9 A;  4OVA A;  1NJI U;  3CCE Q;  2EYQ A;  4HT9 A;  1PD0 A;  3VYH B;  4DEX A;  1Q82 U;  1AWX A;  2CP2 A;  4PJO E;  3CC4 Q;  1LOJ A;  2OTJ A;  2JXB A;  5GAN 7;  2CKK A;  3V7R A;  2K2V A;  1YI2 A;  2CDT A;  3A8H B;  3E9F A;  3Q1J A;  4BAC A;  1DJ7 B;  4LDV A;  2RQU A;  1U1S A;  2L2P A;  3RMQ A;  1TUG B;  2V1Q A;  4FT2 A;  4DBQ A;  2MK5 A;  2IIM A;  1JBM A;  1FXX A;  1AD5 A;  1M3B A;  1D0Z A;  2QQR A;  4PJL A;  1M90 R;  1T3L A;  2HL5 C;  4PKC C;  3G6E A;  2OI3 A;  1HK9 A;  4JJD A;  3QO3 A;  2F2V A;  3GBQ A;  1G83 A;  5L23 A;  1N6A A;  3E2U A;  2DEU A;  5GAO m;  4IIM A;  2Y4Y A;  2QQA A;  4HCC A;  4PJO F;  4ELY C;  1N8R C;  2AK5 A;  1VOM A;  1UUE A;  2K5L A;  4ZGD B;  1JB0 E;  2KVQ G;  2CYZ B;  4LDY A;  2K3Y A;  6AT1 B;  2RI3 A;  3LGL A;  4M78 E;  3NPF A;  1QKX A;  4QVZ A;  1RAC B;  3G4S Q;  1XQH A;  5GJV B;  7AT1 B;  5J3B A;  2E64 A;  4R0K A;  2DF6 A;  2RHI A;  4M7A C;  3QDR B;  2IVW A;  5GAN 8;  2QA4 T;  1K9M R;  1FWZ A;  2DLP A;  1K9A A;  2DXU A;  2D1X A;  2OJ2 A;  4B9X A;  3BFM A;  4B9W A;  2HKN A;  2VYT A;  1M9S A;  1VQM A;  4MDW A;  2F5K A;  5KCH A;  2K79 A;  4HVV A;  2QEX Q;  1BIA A;  2QQS A;  5GAN 6;  4BD3 A;  2O88 A;  2DIL A;  4LXC A;  5GMK e;  2L3R A;  5A2Q E;  2MMP A;  2ED0 A;  2KXC A;  4HXJ A;  3L42 A;  3G7Z A;  3A98 A;  2K3X A;  3GNG A;  3L2Q A;  4C8Q D;  4C92 A;  4M78 F;  4MZT A;  2D8H A;  3M56 A;  1K73 R;  4OB0 B;  1OU8 A;  3JCM Q;  5GAN 3;  2CZ1 B;  2DIQ A;  1Y96 A;  5IXF A;  2KDS A;  2FL7 A;  1RAF B;  2EPD A;  4Y92 A;  2SEM A;  2XG8 D;  1OYX A;  5CQY A;  2E6N A;  3FEO A;  5AYF A;  2ZPG B;  1T0H A;  1XJW B;  1E6G A;  1Z9Q A;  4OGE A;  3MPU B;  1RAB B;  2GF7 A;  4HCK A;  2QDY B;  2FPF A;  2ZPF B;  2JJ9 A;  2VAS A;  4PL6 A;  3HHT B;  4LUD A;  5CK9 A;  2O4X A;  4C92 B;  2O2O A;  3NMZ C;  2RHX A;  1YN8 A;  1QCO A;  2C0T A;  3V8L A;  4QQG A;  2JTM A;  1OZ2 A;  2BE9 B;  3L2Z A;  2JMC A;  2MWO A;  3QDF A; 
#chains in the Genus database with same CATH homology
 1HJD A;  2QDL A;  1BBZ A;  2K2M A;  3RBB B;  1QLY A;  2KXD A;  2LJ0 A;  1U3O A;  2A36 A;  4J9I A;  1Y0M A;  2W0Z A;  2LZ6 B;  5IHK A;  2DNU A;  4GBQ A;  2ROL A;  1KSW A;  2AZV A;  4OMM A;  2KE9 A;  2B86 A;  2K3B A;  2JMA A;  4J9H A;  3SHW A;  2LJ3 A;  5I11 A;  1X2Q A;  2O9V A;  1S1N A;  2EYX A;  1UTI A;  4JJC A;  1OPL A;  2DBM A;  4LN2 A;  1M3C A;  2KEA A;  4JZ4 A;  4RTV A;  2EKH A;  4RTW A;  3VS1 A;  3UA6 A;  1SRL A;  1SHF A;  3H0H A;  1WXT A;  2E5K A;  3REB B;  4E6R A;  2X3X D;  2EQI A;  1PKS A;  4JPB W;  2AKK A;  3JV3 A;  3M0Q A;  4RTT A;  3KFV A;  1M30 A;  1T0J A;  2C0I A;  1ABQ A;  2J06 A;  2ECZ A;  4M4Z A;  2BZX A;  2JW4 A;  3QWY A;  2CH4 A;  1YP5 A;  1SPK A;  1TUC A;  3VS4 A;  3I5S A;  4JJB A;  1YCS B;  2DMO A;  2LNH B;  2DBK A;  1MV3 A;  2DRK A;  2PNI A;  2DL7 A;  1FMK A;  3EGU A;  3NGP A;  2ROT A;  1JQQ A;  2DRM A;  3VS5 A;  2GQI A;  2M0Y A;  1GCQ C;  1UJY A;  3VS0 A;  2LJ1 A;  4J9D A;  5EC7 A;  1VYV A;  1WIE A;  1YNZ A;  3EG1 A;  1I0C A;  2YDL A;  4OMN A;  1BU1 A;  2LQW A;  2MCN A;  3VRY A;  2HDA A;  1SHG A;  1H8K A;  1BB9 A;  1Z9Z A;  2VWF A;  4AFZ C;  1FYN A;  4LUE A;  2W10 A;  4OML A;  2RMO A;  2EGC A;  2NUZ A;  1W70 A;  2PTK A;  2HEQ A;  1JU5 C;  1LCK A;  4DEY A;  4QT7 A;  1HD3 A;  2CT4 A;  2ENM A;  3ULR B;  1WXB A;  3M0R A;  3TVT A;  2MIO A;  2JS2 A;  1PKT A;  1QKW A;  4ORZ A;  1ARK A;  1VYU A;  5FW9 A;  1AOJ A;  1AZG B;  3PVQ A;  4ZNX A;  1KIK A;  4F16 A;  2DA9 A;  4OMQ A;  2CUD A;  1N5Z A;  1I07 A;  1VYT A;  1AWO A;  1RUW A;  2G6F X;  1K0X A;  2YT6 A;  3M0P A;  2K7A A;  2FRW A;  2DL3 A;  1UHF A;  2A08 A;  3QWX X;  1OOT A;  3FJ5 A;  2KNB B;  1U5S A;  3I5R A;  1SSH A;  1B07 A;  2EBP A;  2VKN A;  2PZ1 A;  3VS2 A;  4AFS C;  1QWF A;  5FWB A;  4IIO A;  2L3Q A;  1GRI A;  2JS0 A;  1T3S A;  3M0T A;  3EHQ A;  1ABO A;  2RF0 A;  1WFW A;  1GL5 A;  4AFQ C;  1K0S A;  2F2W A;  2YUP A;  1MUZ A;  3ZL7 C;  2RQW A;  3CQT A;  4F17 A;  1X27 A;  2LCS A;  2CUB A;  3UA7 A;  3UF4 A;  4Z89 A;  2EVR A;  2EYY A;  2M51 A;  2ED1 A;  2CSI A;  2HSP A;  1X69 A;  1OEB A;  4K11 A;  1W1F A;  2LP5 A;  1GBQ A;  2EYZ A;  2FO0 A;  1UFF A;  3THK A;  2A37 A;  1AWJ A;  3LH5 A;  2KT8 A;  5IHN A;  4CC2 A;  3EG2 A;  1NEG A;  4Z8A A;  1RLP C;  2KRN A;  4J9F A;  3H41 A;  2ABL A;  2DJQ A;  4D8D A;  1UEC A;  1YWO A;  2FPD A;  2KGT A;  4FSS A;  2HCK A;  1NYG A;  4AG1 C;  2CH4 W;  4RTU A;  1I1J A;  1ZUY A;  5GJW B;  1EFN A;  2F2X A;  4AG2 C;  5ECA A;  1QCF A;  2K9G A;  1SEM A;  1G2B A;  4RUG A;  2KBT A;  2EGA A;  4CC7 A;  1A0N B;  2BZ8 A;  1JEG A;  4CC4 B;  2KRO A;  1GBR A;  2KT1 A;  1M3A A;  1E6H A;  1X2K A;  2XMF A;  3EHR A;  3NHN A;  4GLM A;  5HCK A;  4JZ3 A;  4AFU C;  3M0U A;  1YWP A;  2GBQ A;  2GNC A;  2I0N A;  1GFD A;  2EW3 A;  1PNJ A;  4HVW A;  2J7I A;  4EIK A;  2OAW A;  2C0O A;  2J6K A;  2AZS A;  1QWE A;  4KRT A;  3SEM A;  4LNP A;  4HVU A;  5IH2 A;  1CSK A;  1X43 A;  2DYB A;  1H3H A;  1W6X A;  2GTJ A;  2JM8 A;  1AWW A;  1OPK A;  1VA7 A;  1V1C A;  2CSQ A;  2JT4 A;  1BK2 A;  1X6G A;  2HBW A;  2KYM A;  1K76 A;  2KRS A;  5FWC A;  4X1V A;  1MV0 B;  4WCI A;  2DL5 A;  3EG0 A;  2KR3 A;  2D8J A;  4OMP A;  1NG2 A;  1UE9 A;  2EGE A;  2O31 A;  3PE0 A;  1ZLM A;  4DEX A;  2JM9 A;  1AWX A;  1K1Z A;  2J05 A;  1WXU A;  2ESW A;  2D0N A;  1NLO C;  2DE0 X;  2RQR A;  1ZUU A;  2JXB A;  1RI9 A;  1H92 A;  2CRE A;  2CDT A;  2DL4 A;  3O5Z A;  2P4R A;  2RQU A;  3TSZ A;  2L2P A;  1NYF A;  1PHT A;  1WA7 A;  4J9B A;  2BTT A;  2V1Q A;  2V1R A;  1WDX A;  2IIM A;  3VS7 A;  1NLP C;  3I35 A;  1AD5 A;  3PVL A;  1M3B A;  2YUO A;  1K4U S;  3M0S A;  1T3L A;  1JXM A;  5IHI A;  1WYX A;  2OI3 A;  2RQT A;  1XOV A;  2AKL A;  1OV3 A;  4JJD A;  2J6O A;  2F2V A;  4D8K A;  2LQN A;  1CKA A;  2GTO A;  3GBQ A;  1PRL C;  2CT3 A;  1X6B A;  1G83 A;  4J9C A;  1ZX6 A;  4RTY A;  4F14 A;  5I22 A;  1UJ0 A;  5L23 A;  4J9E A;  1TUD A;  4IIM A;  2KYB A;  3REA B;  3RNJ A;  2AK5 A;  1UUE A;  2K6D A;  2MOX A;  2RQV A;  1ZUK A;  4J9G A;  2DL8 A;  1KJW A;  1SRM A;  1CKB A;  3NPF A;  2O9S A;  1QKX A;  2JTE A;  2FEI A;  3VRZ A;  2SRC A;  3IQL A;  5GJV B;  1UG1 A;  1WX6 A;  5IXB A;  4R0K A;  3H0F A;  2DF6 A;  1KFZ A;  1GCQ A;  3I9Q A;  2DLP A;  1K9A A;  4LE9 A;  2D1X A;  2OJ2 A;  2FG0 A;  2FRY A;  3C0C A;  1GCP A;  1M27 C;  1ZBJ A;  2A28 A;  1UHC A;  1PWT A;  1WLP B;  1ZSG A;  3U23 A;  2RNA A;  1J3T A;  2YUQ A;  2K79 A;  3EG3 A;  1AEY A;  4HVV A;  3UAT A;  2O88 A;  2DIL A;  1RLQ C;  2DX1 A;  2ED0 A;  2KXC A;  4HXJ A;  4RTX A;  1IO6 A;  2RPN A;  1HSQ A;  3A98 A;  1TG0 A;  1B3Q A;  1PRM C;  1GFC A;  1U06 A;  2D8H A;  2FPE A;  2LX7 A;  2RN8 A;  1E7O A;  3VS6 A;  2H8H A;  5IXF A;  2DM1 A;  2BZY A;  2EPD A;  2VVK A;  2SEM A;  2L3S A;  4Y92 A;  1JO8 A;  2DVJ A;  1NEB A;  1T0H A;  3R6N A;  2NWM A;  1E6G A;  1Z9Q A;  2L0A A;  3H0I A;  2YUN A;  2GGR A;  4HCK A;  2FPF A;  4Z88 A;  1AZE A;  2LMJ A;  1NM7 A;  3VS3 A;  4RTZ A;  4OMO A;  4LUD A;  2YSQ A;  4A63 B;  2O2O A;  1JXO A;  1UGV A;  3NMZ C;  2L3P A;  1YN8 A;  2EYW A;  2C0T A;  1UDL A;  1AVZ C;  3TSW A;  4ESR A;  1M8M A;  2JMC A;  2KRM A;  2J6F A;  1WI7 A;  1Y57 A;  4CC3 A;  2X3W D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...