3EG0A

Crystal structure of the n114t mutant of abl-sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSTYITPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
molecule tags Transferase
source organism Homo sapiens
total genus 12
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg0A00
1W6XA 2LJ3A 1X27A 2F2VA 4JJBA 2CSIA 1AWOA 4JPBW 1NM7A 1QKXA 5FWBA 2DLPA 5GJVB 2NWMA 5L23A 1WXTA 1QLYA 2LP5A 4KRTA 1G2BA 1GL5A 3H0IA 5IHNA 1I0CA 2FG0A 2M0YA 2FEIA 3CQTA 2EYZA 5FWCA 1N5ZA 1VYTA 1MUZA 2MIOA 1YN8A 4FSSA 1SSHA 2GTJA 2CH4A 1UHCA 4HXJA 2IIMA 2DILA 4RUGA 2KXDA 4D8DA 3VS7A 5I11A 1ZUUA 1PKTA 2J06A 4LUDA 4OMOA 2PZ1A 4K11A 1NEBA 2RMOA 2RQWA 3I5RA 2EYYA 2B86A 3NGPA 2KEAA 3VS4A 2DL3A 4DEYA 1K0XA 5I22A 2DF6A 1KSWA 2X3XD 2RQTA 2PTKA 4LNPA 3EGUA 1QKWA 2RQVA 2YUNA 1M3AA 1M8MA 4CC7A 1RUWA 1TUDA 4J9CA 2OI3A 3RBBB 2YUPA 1PKSA 2KRNA 1I07A 5IHIA 1U06A 2ED1A 1QWEA 2DBMA 2KGTA 4LE9A 3M0TA 4J9IA 2A08A 5ECAA 4JJCA 1GFCA 1AWWA 4J9DA 2JTEA 1TG0A 1JXOA 2LX7A 1UHFA 4GBQA 4F16A 4IIOA 1YCSB 3I9QA 3SEMA 3U23A 1HJDA 4OMNA 1UUEA 1AVZC 1RLQC 1ABQA 1U3OA 1H8KA 2BTTA 1T3SA 4ZNXA 1ZSGA 2J05A 2J7IA 3SHWA 1PRMC 1UJYA 4RTWA 2H8HA 1NG2A 1FYNA 3NPFA 1M3BA 2LMJA 1PRLC 3RNJA 1OV3A 3VRZA 2DBKA 2KRMA 1UJ0A 3VS6A 3H0FA 1UG1A 1XOVA 2K6DA 2YUOA 2DE0X 1S1NA 1V1CA 3FJ5A 2DYBA 3IQLA 2J6OA 4HVVA 4Z8AA 1SRMA 4OMPA 4AFUC 2AKLA 2DRKA 3QWXX 1ZLMA 1KJWA 3VS5A 1NLOC 1AD5A 2CSQA 1UFFA 3H0HA 2C0TA 1AWXA 1E6HA 5IXFA 4CC4B 2K9GA 4J9HA 2D1XA 4LN2A 1OPLA 2BZ8A 4CC3A 1BK2A 2F2WA 3UA6A 2K3BA 2DL8A 4AFQC 2JW4A 1GCQC 3JV3A 1G83A 1ABOA 2YDLA 3EG2A 2FPFA 2G6FX 2DL5A 2DRMA 2JMAA 1WXBA 3TSWA 2O31A 1TUCA 1YWOA 1GCQA 5FW9A 4E6RA 5IXBA 1AEYA 2O9VA 1SPKA 1CKBA 3UATA 4OMMA 2GGRA 2LCSA 4IIMA 3R6NA 1K76A 4RTUA 1H3HA 1WXUA 2AKKA 1PWTA 3M0UA 2A36A 3VS0A 2FPEA 2KROA 1SEMA 1ZX6A 1QCFA 1NLPC 1W70A 2CDTA 2OAWA 3VS1A 1Y0MA 2JT4A 1CSKA 2EYXA 2CUDA 3PVLA 1U5SA 2JS0A 1BBZA 1PHTA 1JO8A 5GJWB 2QDLA 1GBRA 2DL7A 4D8KA 1SHGA 2BZYA 1GCPA 2OJ2A 3H41A 1VYUA 2GNCA 2M51A 4JJDA 2J6KA 3A98A 3GBQA 3QWYA 3M0SA 2PNIA 2HDAA 3EHRA 1OOTA 3EG1A 2EPDA 1YNZA 2D8JA 3REAB 2RF0A 1X6GA 4GLMA 3VS3A 1E6GA 3UF4A 1JXMA 2GBQA 2XMFA 1KFZA 2O2OA 2LJ1A 2DJQA 2CH4W 4Y92A 2LQWA 1UDLA 1HSQA 2AZSA 2DM1A 1X2KA 2V1RA 1GRIA 2JM8A 2DNUA 4ORZA 2JMCA 4Z89A 3ZL7C 1A0NB 3LH5A 4OMLA 2HEQA 2DX1A 3THKA 1MV3A 2EBPA 2LZ6B 2MOXA 4AG2C 1EFNA 2ROLA 3REBB 2EW3A 2KE9A 4EIKA 1RI9A 2RN8A 4F17A 1E7OA 1YWPA 2C0OA 4R0KA 1KIKA 2EGEA 1UTIA 2KR3A 4Z88A 4M4ZA 1ZUKA 2MCNA 1T0HA 3C0CA 2RPNA 3ULRB 1PNJA 1X69A 5IH2A 4J9BA 2JXBA 3EG0A 2L2PA 2EYWA 2BZXA 2DL4A 2GTOA 2W0ZA 2ESWA 2KNBB 1Y57A 4ESRA 1UECA 2GQIA 1RLPC 2L0AA 4DEXA 2CUBA 1B07A 2HCKA 3PE0A 5IHKA 1FMKA 1WYXA 1ZBJA 2VVKA 3TSZA 2I0NA 1K1ZA 1X43A 2FO0A 2CREA 1H92A 2L3QA 2P4RA 2YSQA 1UE9A 2O88A 1OEBA 1M27C 1WDXA 4RTTA 1WA7A 4JZ4A 5EC7A 4HVWA 4LUEA 2AK5A 1LCKA 2NUZA 2J6FA 3VRYA 2HSPA 2RNAA 1WLPB 1GBQA 5HCKA 1J3TA 2V1QA 3EG3A 2L3SA 2DA9A 2K2MA 2KT8A 4AFSC 3M0RA 4RTXA 2ROTA 2ENMA 2KYBA 3I5SA 1W1FA 2RQUA 1GFDA 4A63B 2O9SA 2A28A 2E5KA 2C0IA 4OMQA 4RTYA 1I1JA 3M0QA 1UGVA 2LQNA 1YP5A 2CT4A 1ZUYA 2YT6A 1T3LA 4JZ3A 2DVJA 1WX6A 2K79A 1JQQA 3NHNA 4J9EA 4AFZC 3O5ZA 1M30A 3UA7A 1K9AA 2FRWA 1HD3A 1WIEA 1AOJA 1X6BA 2L3PA 3I35A 2EGAA 2LNHB 1K0SA 2JS2A 2LJ0A 1OPKA 1Z9QA 2A37A 1JEGA 3PVQA 2KYMA 1WI7A 2EGCA 2HBWA 2D8HA 1Z9ZA 4CC2A 4J9GA 3EHQA 2EVRA 1AZGB 2JM9A 2DMOA 2X3WD 1K4US 2EKHA 1AWJA 2W10A 2ED0A 2RQRA 4HVUA 1JU5C 1NEGA 2SEMA 2VKNA 2ECZA 4HCKA 1NYFA 2D0NA 1AZEA 1VYVA 3VS2A 1BB9A 3TVTA 1M3CA 1X2QA 1MV0B 2ABLA 1QWFA 4WCIA 4F14A 2F2XA 2CT3A 2KBTA 4X1VA 3M0PA 1VA7A 1BU1A 3KFVA 4RTVA 4RTZA 2K7AA 2SRCA 1NYGA 2EQIA 2KXCA 1T0JA 1SRLA 4AG1C 2VWFA 1B3QA 2KT1A 2AZVA 4QT7A 4J9FA 1IO6A 1ARKA 3NMZC 1SHFA 1WFWA 1CKAA 2FRYA 2FPDA 2YUQA 2KRSA
chains in the Genus database with same CATH superfamily
1W6XA 2JVVA 2CSIA 1AWOA 1QKXA 3RUXA 1YI2A 3MEVA 1KD1R 1D3BB 2LP5A 1VQ7Q 1G2BA 1GL5A 1VQ8A 1I0CA 1D0YA 3CQTA 1IB8A 1TWBA 4C0ZA 1VYTA 1RADB 4XTXA 3ASKA 4N0AC 1YN8A 4FSSA 5I21A 3CCJA 4B6MA 2RI3A 4M77F 1M2OA 1K8AR 3CC2A 4HXJA 3SB2A 5CAIA 2IIMA 3V8JA 4D8DA 3VS7A 5I11A 3S3MA 3A8OB 4OB0B 1PKTA 4HA8A 2CP2A 2RQWA 3I5RA 5A2QE 1FWZA 2D9TA 2KEAA 3VS4A 2DL3A 1K0XA 4ELYC 2M0OA 2NUTA 2DF6A 4C0DB 3CMAT 1YJ9A 3JCMc 1QKWA 1VQLQ 1PD1A 1M3AA 1D0ZA 2P0QA 3VUZA 1YJ9T 5IN1A 3OYNA 1TUDA 3FIFA 2YUPA 5GAN8 1I07A 4BI4A 5IHIA 2NLUA 5FRNA 1QWEA 4M78G 4CI0C 4F7UA 2EFIA 3T9NA 2A08A 2E6ZA 1GFCA 2DO3A 2JTEA 4IUTA 1TG0A 3M9QA 3CPFA 2X51A 1VIFA 2X4WA 4GBQA 4M7DC 2BE9B 1R77A 3E19A 3U23A 3JCMQ 2EJ9A 1ABQA 3TQ7P 3CCSA 1W4SA 4ZNXA 2J05A 4NS5A 1UJYA 2H8HA 3VRZA 4KGXB 3E1SA 3H0FA 5KYWA 1UG1A 2PVGB 5J39A 3RKWA 3A8HB 2RJDA 2YUOA 1JJ2P 2P84A 1BI0A 2X35A 3P8HA 4HVVA 1SRMA 3VJPA 2ZPEB 4E2FB 2DRKA 1MHNA 1KJWA 1VQ7A 1NLOC 1AD5A 1VQ9Q 4RG2A 5IXFA 1DJ7B 1M4ZA 4BE2A 4M7DF 5GAMf 2K9GA 4C92B 4WTOB 5CKFA 4M75D 4ZN3A 2QA4A 4AT1B 5KYUB 2DKGA 2F2WA 1ZSZC 3QPHA 2DK3A 3Q1JA 3A5ZB 2K3XA 1GCQC 4J7IA 3EG9B 3M4GA 4ZGEB 2G6FX 2JMAA 1WXBA 1M8VA 4N0AA 3MP8A 1TUCA 3I56A 1M1KU 1TH7A 3QZ5B 3G6EA 1RI0A 2O9VA 4E7IA 2L89A 1CKBA 1VQLA 5A0LA 2LCSA 4IIMA 3R6NA 2YLCA 2P4TA 4OF1A 2E64A 2WSFE 2E41A 4JUVA 1VQLT 3J81E 2AKKA 1D3BA 1PWTA 3M0UA 3VS0A 4N4HA 5D6WA 1M1KC 2RB6A 2KVQG 2VGMA 3VS1A 1UEBA 1WHHA 2EQKA 2OX7A 2JS0A 5GJWB 2ZPHB 1VQ4Q 4JRQA 4QQDA 4ZTJA 1M1GA 4DBQA 2B8AA 1B7TA 2OTLQ 2CP7A 2M51A 1UB4A 2J6KA 2HKNA 1S72Q 5C6SA 2HDAA 2EPDA 2OTJQ 4M75A 2D8JA 3VS3A 5KE3A 4E7ZA 4WF2A 2VXFA 1VQPT 2LQWA 1GRIA 2JM8A 2DNUA 2RK1A 1WQ7A 3CPWP 1Y71A 1A0NB 3NFCA 4C92D 2CS7A 3THKA 2EBPA 3SD4A 4BE0A 1EFNA 1VQ9A 1QVGP 1YITQ 3OYAA 1YJWT 1E7OA 1YWPA 1KIKA 1Q82C 1UTIA 4PJMA 3C0CA 2PUOB 2HBPA 4ZTFA 2E70A 5GANg 3EG0A 5D6XA 2PVOB 2D0QB 1UECA 2GQIA 4A4GA 1KHIA 2L0AA 2HCKA 4EMKC 3JCMX 3AT1B 1BI2A 1WYXA 3DLMA 3G7ZA 1ZBJA 3TSZA 3G4SQ 2DXUA 5CIUA 4DBRA 4BE1A 2FO0A 1IHWA 2CREA 4HT8A 1UE9A 3JB9D 3JAME 4RTTA 4VUBA 8AT1B 3GOXA 2H3JA 2X4YA 4IURA 5EC7A 4HVWA 2HKQB 2DIQA 2QQRA 4Z02A 1QCOA 2QQSA 1WLPB 4C92A 2V1QA 1VQ4A 1IGUA 2E1HA 5KYUA 1N9RA 2OTLA 1RABB 3M0RA 5DLOA 2ENMA 5HKCA 3I5SA 1G3SA 1W1FA 1V76A 1S72A 2EYQA 1BI1A 2CP6A 3JCMb 3BDLA 1Q7YU 4RTYA 1I1JA 2OTJA 1YCYA 1YP5A 2K57A 3CCRQ 3HPWA 1JJ2A 2HL5C 4FSXA 2DVJA 4J6WA 1I5LA 1N8RR 2OTJT 4AFZC 4M78E 3OYLA 4KUDK 3UA7A 1TUGB 1I81A 1HD3A 4EDUA 1VQMQ 4QVZA 3CC4Q 2EGAA 2LNHB 1W2BP 3HRUA 3SFMA 1VQ6T 1K0SA 2JS2A 4E7HA 1Q81C 4Q5WA 4DOVA 3QG1A 1OPKA 3C95A 3HRTA 3HRSA 1KC8C 4NL2A 4CC2A 2K5LA 4J9GA 2JM9A 2LRQA 1K4US 7AT1B 2W10A 1TTHB 2ED0A 3CCQA 4ATOA 1YITT 2ZPIB 1JU5C 3QXEB 4KGVB 3CMEA 1AZEA 1VYVA 4PJOB 4NOYA 1BB9A 1NE8A 4XTWA 3PFSA 2QDYB 2MWPA 2FL7A 1NJIR 4RTVA 2K7AA 3QJ6A 3JB9H 3A8GB 4C8QB 2VWFA 3RKYA 2HL3A 3FEOA 4QT7A 1MMAA 3G4SA 4PJJA 1PG5B 3BW1A 3NMZC 3MPUB 2LTOA 2E5QA 3UWNA 4XTUA 3JCMW 1PRLC 4PJOC 2YXYA 3VKIA 3DLLA 4EPCA 2RHXA 5GJVB 3S6WA 2IG0A 1WZOA 4J6XA 2QXFA 2LQ8A 2LCCA 4KRTA 5AYFA 4C8QC 5IHNA 4A4KA 2NUPA 3AHUA 4XK8E 2WACA 1I4K1 1MUZA 2JNGA 1JJ2S 2YLBA 2MI6A 3A8MB 1SSHA 3X28B 2CH4A 1UHCA 2ZGWA 2RA2A 4RUGA 2KXDA 1VQKA 1MNDA 2DZCA 1FXXA 1ZUUA 5LJ3f 2COWA 3OYGA 3CCRA 3GLXA 1YIJA 1NEBA 4AMCA 3CPWA 3NGPA 4J83A 1VQOQ 1Q86C 1QCNA 4DEYA 2COZA 4QKUA 1MMNA 2EQUA 1KSWA 2RQTA 1VQMA 2DJZA 4LNPA 3CC4A 2YUNA 2RQVA 1QVGA 4UC4A 5HK0A 4C8QF 4CC7A 3OW2P 2CZ7B 5FU7C 1VIEA 4OB3B 2QI2A 4PJOD 1Q81R 2PVDB 3CC4T 2EQMA 3J80E 2OI3A 1PKSA 1KC8R 1JB0E 1QQJA 5GAMd 2KGTA 1KHCA 4LE9A 4J9IA 2QGFB 3INZA 5ECAA 2LVMA 1G8XA 4C5GA 1AWWA 2P0KA 2R58A 1JXOA 2FHDA 4KUIA 3PMTA 1UHFA 2KI7A 3QZ9B 4F16A 1YCSB 4HCBA 1UUEA 2DIGA 3KUFA 1ZSGA 3H8ZA 1UGSB 2DERA 4PLLA 2LMJA 2K5IA 2RJEA 4MZMA 4F7UF 2RM4A 2YRCA 2DBKA 3EGDB 4O5VA 5KCHA 1OX9A 4PK4A 1OQKA 5DLQE 1S1NA 3FJ5A 1WHLA 1VQ5Q 2J6OA 2XDDA 4Z8AA 2MF2A 3C12A 4OMPA 4M7DE 2CP5A 1UFFA 4LDXA 2C0TA 1E6HA 4PJOA 4CC4B 1BYMA 4QVDA 5L8RE 3CPWS 2D1XA 4LN2A 1OPLA 2BZ8A 4CC3A 3QSUA 1BK2A 1OX8A 4XU2A 2K3BA 2XDBA 2XI9A 2QAZA 5KH6A 1QVGS 1PC0A 3V7CA 4C8QA 4JLGA 1G83A 4HCCA 1ABOA 4KT0E 2YDLA 3CCUT 1W2BA 1VQOA 4M7AB 3TSWA 2M9UA 2DETA 3CBMA 1OI1A 5FW9A 1Q86R 3E9GA 1SPKA 3HSBA 1VQOT 3UATA 4OMMA 3CMAA 4E7KA 3X25B 3M55A 3GPLA 3M53A 5J3BA 4M75B 4GY5A 2Z0WA 5GAN6 3MEAA 2ZAEA 4MDWA 2LC4A 1UGRB 1SEMA 4PFZA 2FZGB 1NLPC 1JBMA 2OAWA 3PNWC 2JT4A 4M7AC 1CSKA 2EYXA 2CUDA 2VUBA 3JCMf 1UGPB 3E9FA 4OGEA 1BKBA 5CCAA 3CCLQ 2AIRB 2E4HA 3JCMV 1U8RA 1IHVA 2COYA 2DL7A 4D8KA 3CC7Q 1C6VX 1GCPA 2E3HA 4M75C 1IGQA 3H41A 1QW1A 3SWNB 4JJDA 1EZZB 3A98A 2VXEA 1R0CB 3UT1A 3GBQA 4C0DC 3QWYA 4JJNK 3EG1A 3RKXA 3V8LA 1RAAB 1X6GA 1E6GA 4C5HA 2MK5A 2GBQA 2YWWA 3EH1A 2CH4W 4LDWA 3QDRB 3N5BB 2YRDA 3PMIA 1HSQA 5IT9E 1VQPQ 4ORZA 5LJ5d 3ZL7C 1M90U 1XQHA 1MGQA 3G1JA 3SWNC 1OYXA 2D6FA 3JCMJ 1YFNA 2LZ6B 2MOXA 1KG1A 4AG2C 1VQ5T 2JTMA 4F7UG 1XTDA 3HTRA 4M75F 3FDRA 3OS5A 5GMKm 3RR6A 4KH1B 1KQSP 4R0KA 1QVFP 1YJWQ 1D1CA 1ZUKA 1W2BS 4M7AD 1T0HA 1M90C 1OU8A 2RPNA 5GAOn 4ELZC 2L2PA 5FLXE 3NTIA 2EYWA 4B9WA 2RK2A 2ESWA 4ESRA 2DZ9A 3MP1A 3MO8A 4MMLA 2CUBA 4OMFB 3V7SA 1KQ1A 4FIBA 3OW2A 3GP8A 1AT1B 3EGDA 2FZKB 2VVKA 2I0NA 5LL6S 2RD1A 4JDSA 1K1ZA 1X43A 2BKDN 4M77G 1H92A 2BE7D 2L3QA 2YSQA 3OYEA 2DFUA 1OEBA 1M2VB 1M27C 2CP0A 3ZFJA 4N4IA 4C92C 4L6V5 1TSFA 2AK5A 2DTIA 4LD6A 3FB9A 2EJGA 3VRYA 1VUBA 2RNAA 2K2VA 4RCBA 3JB9I 3EG3A 3C4SA 4DBHA 2X4XA 2K3YA 1XNIA 3CC7A 4FT4A 2EKOA 1UGQB 4FU6A 2ROTA 3BFMA 3CCLT 2KYBA 1WNLA 1GFDA 3V7RA 2E5KA 3SDZA 1R0BG 3GF5A 3CC7T 4OMQA 3M0QA 4M7AA 2GFUA 3L1AA 1T3LA 3VYGA 1HYOA 1JQQA 3I55T 3OSSC 3H9NA 4C92F 9ATCB 1VQPA 1M5Q1 2FRWA 3X24B 1WIEA 2QTVA 2YRVA 1FX7A 2L3PA 1N9SA 2K4YA 3CEYA 4C0GA 2LJ0A 2PU9B 1Z9QA 2A37A 1VQ6Q 1K73U 3X26B 3QJYA 4FYYB 2D8HA 3EFOB 2JJ9A 4FW2A 1IRXA 3EHQA 2EVRA 3META 2MYSA 4JS4A 4EMGA 1YJWA 4HVUA 4BD3A 2SEMA 2VKNA 2ECZA 1YJNQ 2YHTA 1NYFA 4HCKA 3ER0A 1VQNT 3OW2S 2BIVA 4HT9A 3SWNA 1OZ2A 1Y7XA 4BUGA 2OAUA 3TVTA 1X2QA 1MV0B 1LVKA 3GIBA 4X1VA 1VA7A 5LJ3d 2NUPB 1U1SA 4RTZA 4QW2A 1NYGA 2EQIA 5CQXA 4FYVB 3JB9J 2LDMA 1KQ2A 1B3QA 2KT1A 4MZPA 2AZVA 3JB9F 4J9FA 4M7DG 2XKOC 1SHFA 1CKAA 1G3TA 2FPDA 2YUQA 4PL6A 4PLIA 1PD0A 3HL8A 2LJ3A 1X27A 4JJBA 2RJCA 4JPBW 2E6NA 1NM7A 5FWBA 2LT1A 2NWMA 5L23A 2QASA 2HQHA 1LJOA 5LJ5f 5CKBA 3H0IA 5KYYB 5LJ3h 2KMTA 5FWCA 2MIOA 5GMKj 2ZZDA 4P5NA 1M1KR 3F70A 5GAOl 3L2ZA 5GAMj 2Y4YA 4PFOA 1WQWA 1NPPA 5FU6B 1X6OA 2J06A 4OMOA 3MEUA 4K11A 2RMOA 3CBPA 1MMDA 4CRIA 2EYYA 2K5FA 2B86A 5AT1B 2GQVA 2X3XD 1G3WA 1O9SA 2L3RA 2PTKA 1M2VA 2DXCA 1XJWB 3VV0A 3OSVA 1VQ6A 1KQSA 3LGLA 4C0FA 1QVFA 4IUQA 4QVCA 2QEXQ 1RUWA 4J9CA 1LNXA 5FU6C 2HQEA 2KRNA 1Q7YC 2ED1A 1G3YA 3CCEQ 1K9MU 3L2UA 1YITA 2RHUA 1WHMA 1SKUB 3G71Q 2R5AA 4J9DA 1RAIB 1YJNT 1RAEB 1X01A 3EGXB 1Q82R 4J8OA 3SEMA 3LYIA 1HJDA 4OMNA 1AVZC 2BTTA 2Y90A 2EWNA 1T3SA 5FROA 4F7UE 4X34A 5M9OA 4FCYA 2P0PA 3SHWA 1ZQ1A 4RTWA 1NG2A 3NPFA 2Y4XA 4JS5A 1D1AA 4J6YA 3RNJA 1OV3A 2DTOA 3QKJA 2K6DA 1D09B 3ZBDA 2DYBA 3IQLA 3EFOA 3JB9G 1X75C 5GANd 1MMGA 3CD6Q 2AKLA 3VS5A 2CSQA 4OB2B 3JCMd 3H0HA 4XU3A 3VUBA 2JUFA 4OVAA 1AWXA 3CCMQ 5CKHA 1BI3A 2ZCFB 2QGGA 1O75A 3OYKA 8ATCB 4MDXA 4A4FA 4M77E 1P92A 1KD1U 3PTAA 2QG9B 4M78B 4AFQC 3PIOA 1KK7A 4A54A 3JV3A 3CXCP 2KAFA 2FPFA 1KQSS 2DRMA 2QQ9A 1I5OB 4ZN1A 1QVFS 4FL6A 2DD5A 3CCUQ 3LLRA 5HK3A 1YWOA 3M5AA 4QQGA 1K8AU 4PJOF 1KD1C 2GGRA 5IAYA 3JCMh 3QIIA 1K76A 1ZA2B 4A4EA 2QEXA 1WXUA 4A53A 2O4XB 2F69A 5KE2A 3R6OA 5LJ5j 1ZX6A 5KYYA 1QCFA 2GFAA 2QEXT 1W70A 1K8AC 1Q7YR 3CCJQ 1U5SA 2XIDA 1BBZA 1PHTA 3RDVA 4E7SA 5J26A 1JO8A 3MJXA 4EMHA 3G71A 2QDLA 2JTFA 3CCET 1SHGA 1Y07A 3PGGA 2BZYA 2EAYA 4BI8B 1IZ6A 4BDZA 2OJ2A 1VYUA 3OYMA 3G71T 2GNCA 3TREA 2IPOB 3A8LB 2MWOA 2JZ2A 4XAXB 2M02A 3EHRA 5DM7R 1YNZA 2V8IA 5GAOp 2RF0A 2HMAA 3FJPA 1KFZA 2LJ1A 2DJQA 2RI2A 4Y92A 1UDLA 2AZSA 1Y96B 2DM1A 1PSEA 1X2KA 3PT9A 2JMCA 3LX7A 4M77B 4Z89A 1QP3A 2RHZA 3LH5A 4OMLA 2HEQA 3LH0A 4XU1A 2RI5A 1R8OB 1MV3A 4C5EA 5GMKh 1G5VA 3REBB 3WXMB 1JRIA 3GNGA 3M57A 4M78D 3MP6A 5DY9A 4X9CA 4EIKA 5GAMh 2RN8A 3CD6T 3EFSA 4Z88A 2QQBA 4M4ZA 3OS0A 4KULA 3L42A 3CCMT 1X69A 3EGXA 2RHIA 4R56A 3OMCA 4DBFA 2F5TX 3CCSQ 2QK0A 2BZXA 2DL4A 2GTOA 2W0ZA 2KNBB 1HXDA 1Y57A 3NTKA 4XTVA 1QVPA 3OB9A 2DAQA 4DEXA 3CCUA 3PE0A 3MCAB 4DQ2A 4LDUA 2KQWA 3M4YA 3OYDA 1M1FA 6AT1B 3OS2A 3JRZA 2FVUA 2CP3A 4XTZA 1WDXA 1YI2T 2XDPA 3OQ5A 1SSFA 4YTLA 2E10A 1WHGA 2DD4A 4JZ4A 5GAN7 1WJRA 4PJOG 1LCKA 2E12A 1VQ8T 3BDUA 2J6FA 4DOWA 2A7YA 2QA4Q 2FYKA 1GBQA 5GANf 4FW1A 3CCJT 2KT8A 2VC8A 4MMKA 3OS1A 1SF9A 3P8BB 2X9HA 4M78A 4RTXA 3CC2T 4C8QG 2E65A 2DVEA 3JSCA 1PSFA 3WVEB 2O9SA 2A28A 2XG8D 2CZ6B 1WPYA 2BUDA 3LGFA 5CKEA 3I56Q 1M9SA 4PJLA 4M77D 4II1A 3LWIA 3G6EQ 4C92E 4L59A 2CT4A 2YT6A 1ZHIA 2HD0A 2F1LA 3VYHB 5LJ3j 3OYFA 1WX6A 2K79A 5GMKe 3GNFB 1K9AA 2NYSA 4M7DB 5GAMe 1D1BA 2KK4A 1QMCA 2M16A 3M56A 3I55Q 2LQKA 4HKEA 4QQ6A 5A0DA 1NBEB 1AOJA 1X6BA 4FT2A 2O4XA 4V2SA 4KH0B 4LD9K 1OULA 3NTHA 2G3RA 2RHYA 2EGCA 1H3ZA 2HBWA 1I8FA 3OYCA 5CO7A 1Z9ZA 4M7AF 4MZTA 1VQ5A 2DMOA 2A3LA 5GAN2 1Q95G 5KYNA 2HAXA 4ME7A 3P8DA 1NEGA 2LT4A 3CXCA 5KYXB 5CKDA 4ZGDB 1VQNQ 2ABLA 1QWFA 4XQ3A 3QO3A 3OYBA 3EAEA 2KBTA 3M0PA 3VU3C 3KFVA 4DA4A 3LW5E 3UPUA 1V29B 2KXCA 3CCST 2C06A 4J5YA 4AG1C 2HNIA 1Y96A 5LJ3g 1IXDA 4NL3A 1ZSZB 5HY6A 4IUPA 1WFWA 2QTXA 4M77A 1RL2A 5LJ5h 3ZEHA 3S3OA 4FYXB 2F2VA 2XU8A 3TU4K 2DLPA 4Y28E 3EH2A 1N27A 2V8JA 4JLIA 1WXTA 2ZPBB 1VQ7T 1QLYA 1RAHB 2VGNA 4KBMB 1B34B 3L2WA 1AHJB 3OYYA 3LWHA 1FMVA 2LNVA 2FG0A 2M0YA 4GLKA 2FEIA 2EYZA 1N5ZA 2QA4T 1YBYA 2GTJA 3CCLA 2CZ0B 1PM3A 4M7DD 1IREB 2DILA 2H3EB 5CR2A 2FB7A 4LUDA 3ME9A 2LX9A 2PZ1A 4XU0A 5CK9A 3URGA 3QUIA 4JRPA 3I56T 1TXQA 3G6ET 3OBWA 2CKKA 5GAOm 5I22A 3C94A 3I55A 1MNEA 3EGUA 1M8MA 1QP2A 5CQYA 3X20B 4KGZB 3KXTA 2DXTA 3CXCS 4FYWB 4IUVA 1N8RU 3RBBB 3QHSA 2M1HA 5D7UA 1N6AA 3WVDB 4R55A 1U06A 2DBMA 4HCZA 5GANj 3M58A 3M0TA 2CZ1B 2QYZA 4E7LA 3QYGB 2V8KA 5FRMA 4JJCA 1VQNA 4M7AG 2LX7A 1N8RC 5LJ5e 4BI3A 4IIOA 3I9QA 4RMOA 1M90R 1RLQC 1Q82U 5GMKl 1U3OA 1H8KA 4M75G 1K73C 2J7IA 1FMWA 4M7DA 2E3IA 1PRMC 2DPPB 1WJSA 1FYNA 3DB4A 1U1TA 1VOMA 1M3BA 1TOVA 2EIFA 2V26A 5CVIA 1C1AA 2GCXA 3HFOA 3MKDA 2ZPFB 2KRMA 4X9DA 1UJ0A 3VS6A 1NJIU 4PFPA 1XOVA 5GAN4 2DE0X 4EMKB 1V1CA 4JRIA 3RIRA 2DEQA 1BCMA 4N4GA 4TVRA 1VQ9T 3CCQQ 4AFUC 4RCCA 3QWXX 1ZLMA 3CMEQ 3HP9A 2PQWA 3FC3A 4E7JA 2L8DA 5KYXA 1NJIC 1WJQA 3H6ZA 3HFNA 4J9HA 3JCMg 3UA6A 4O6JA 2DL8A 1ZA1B 1EIFA 2JW4A 2XK0A 5A0GA 3FLGA 3V8KA 2DEUA 2VASA 2KY9A 3EG2A 4PJOE 2KDSA 2DL5A 1OU9A 1ZSZA 4OP0A 3RERA 5KCOA 2O31A 1TU0B 2DTHA 1GCQA 3MHXA 2MAMA 4E6RA 5IXBA 1AEYA 3BE3A 3OY9A 4LDYA 2VV5A 3DB3A 3HKSA 3D7SB 4C8QE 2HZYA 4RTUA 4A4HA 1NPRA 1ACMB 1H3HA 1BIAA 4XTYA 1YHQQ 2A36A 4PJNA 1B34A 2FPEA 2KROA 4OGCA 4F04B 2CDTA 2X4JA 1Y0MA 1OZ3A 3PVLA 2FZCB 2RH2A 1VQ4T 3UDCA 3EG9A 1D0XA 4C92G 5GAOq 4E47A 1GBRA 2OTLT 3PIPA 1VQKQ 3TEEA 2JOYA 1Q81U 4LXCA 2AT1B 1S72T 2MMPA 3RMSA 3L2QA 3DKMA 1YIJQ 4IKFA 1YJNA 1KC8U 3M0SA 2PNIA 1OOTA 4OB1B 3REAB 4GLMA 3KBGA 5GAMg 4BDYA 2VB6A 3UF4A 1JXMA 1K73R 2XMFA 3L2VA 2O2OA 3QYHB 3L2RA 1HK9A 4BY6B 4C5IA 3RESA 2A0FB 2V1RA 3BY7A 1K9MC 4Y91A 3QDFA 2DX1A 2L5QA 5LJ3e 2ROLA 2EW3A 4BB7A 2KE9A 5GAN3 4IUUA 1RI9A 4BACA 4D6WA 4F17A 4J7FA 2PUKB 5D6YA 3CCQT 2C0OA 2DYIA 2EGEA 4BY6C 2KR3A 3OYIA 3CMET 4PKCC 3CCVQ 2QQAA 2MCNA 3MEWA 3ULRB 3J7AF 1PNJA 5IH2A 3FRNA 2WSEE 4FM4B 4J9BA 2RJFA 2JXBA 5GAN5 2GF7A 5GMKi 1RLPC 1B07A 2RO0A 1FMKA 5IHKA 3G4ST 1TS9A 1PCXA 2NUTB 2HSEB 4EMKA 4L5GA 2P4RA 2O01E 2AHJB 2O88A 1RAGB 5GANh 3OYHA 2JN0A 2XICA 1YHQA 1WA7A 1YI2Q 4LUEA 1Q86U 2F5KA 2XD0A 2NUZA 3TCJA 3M59A 1YHQT 2HSPA 4M78C 5FU7B 1LPLA 5HCKA 1VQ8Q 1J3TA 2L3SA 2VYTA 2DA9A 2K2MA 5GAOr 1LOJA 4AFSC 4F7UB 3CCEA 2WSCE 2ZPGB 2RQUA 4A63B 1VQKT 3CC2Q 2I2LA 2C0IA 1ZBXA 3CCRT 4JRKA 1GXIE 1UGVA 2DXBA 1YIJT 2LQNA 2ATCB 3OBYA 1ZUYA 1WGSA 1EX4A 5EG2A 3RMQA 3CMAQ 4ANJA 4JZ3A 3NHNA 1WHKA 4J9EA 3O5ZA 1NZ9A 1M30A 1VQMT 2MPXC 1RAFB 1YJ9Q 3EFRA 3I35A 1RACB 1K9MR 4M78F 3QBYA 4M7AE 2EQJA 3E2UA 5KYWB 1JEGA 3PVQA 1F1BB 1WI7A 2KYMA 5I2MA 2HQXA 3OA6A 2XHCA 4PNOA 4C8QD 2EJFA 1AZGB 1BIBA 2X3WD 4M75E 2IVWA 2EKHA 1AWJA 3OYJA 3CD6A 3CCVA 2RQRA 3M54A 3OMGA 2D0NA 4RG8A 5LJ5g 4LDVA 3VS2A 4B9XA 2KSSA 3CCMA 3CCVT 1M3CA 1BCOA 4WCIA 3A1PA 4F14A 4RKUE 2F2XA 2CT3A 2CGHA 2CYZB 1BU1A 2LCLA 3HHTB 4ZGJB 2SRCA 5GANe 5C0MA 4M77C 1T0JA 1SRLA 3CBOA 3S3NA 3O8VA 1WHJA 2R57A 3JCMe 1IO6A 1ARKA 3JCMP 5I2SA 2FRYA 1SG5A 2R5MA 1C0MA 1H641 2KRSA
chains in the Genus database with same CATH topology
1W6XA 2LJ3A 1X27A 2F2VA 4JJBA 2CSIA 1AWOA 4JPBW 1NM7A 1QKXA 5FWBA 2DLPA 5GJVB 2NWMA 5L23A 1WXTA 1QLYA 2LP5A 4KRTA 1G2BA 1GL5A 3H0IA 5IHNA 1I0CA 2FG0A 2M0YA 2FEIA 3CQTA 2EYZA 5FWCA 1N5ZA 1VYTA 1MUZA 2MIOA 1YN8A 4FSSA 1SSHA 2GTJA 2CH4A 1UHCA 4HXJA 2IIMA 2DILA 4RUGA 2KXDA 4D8DA 3VS7A 5I11A 1ZUUA 1PKTA 2J06A 4LUDA 4OMOA 2PZ1A 4K11A 1NEBA 2RMOA 2RQWA 3I5RA 2EYYA 2B86A 3NGPA 2KEAA 3VS4A 2DL3A 4DEYA 1K0XA 5I22A 2DF6A 1KSWA 2X3XD 2RQTA 2PTKA 4LNPA 3EGUA 1QKWA 2RQVA 2YUNA 1M3AA 1M8MA 4CC7A 1RUWA 1TUDA 4J9CA 2OI3A 3RBBB 2YUPA 1PKSA 2KRNA 1I07A 5IHIA 1U06A 2ED1A 1QWEA 2DBMA 2KGTA 4LE9A 3M0TA 4J9IA 2A08A 5ECAA 4JJCA 1GFCA 1AWWA 4J9DA 2JTEA 1TG0A 1JXOA 2LX7A 1UHFA 4GBQA 4F16A 4IIOA 1YCSB 3I9QA 3SEMA 3U23A 1HJDA 4OMNA 1UUEA 1AVZC 1RLQC 1ABQA 1U3OA 1H8KA 2BTTA 1T3SA 4ZNXA 1ZSGA 2J05A 2J7IA 3SHWA 1PRMC 1UJYA 4RTWA 2H8HA 1NG2A 1FYNA 3NPFA 1M3BA 2LMJA 1PRLC 3RNJA 1OV3A 3VRZA 2DBKA 2KRMA 1UJ0A 3VS6A 3H0FA 1UG1A 1XOVA 2K6DA 2YUOA 2DE0X 1S1NA 1V1CA 3FJ5A 2DYBA 3IQLA 2J6OA 4HVVA 4Z8AA 1SRMA 4OMPA 4AFUC 2AKLA 2DRKA 3QWXX 1ZLMA 1KJWA 3VS5A 1NLOC 1AD5A 2CSQA 1UFFA 3H0HA 2C0TA 1AWXA 1E6HA 5IXFA 4CC4B 2K9GA 4J9HA 2D1XA 4LN2A 1OPLA 2BZ8A 4CC3A 1BK2A 2F2WA 3UA6A 2K3BA 2DL8A 4AFQC 2JW4A 1GCQC 3JV3A 1G83A 1ABOA 2YDLA 3EG2A 2FPFA 2G6FX 2DL5A 2DRMA 2JMAA 1WXBA 3TSWA 2O31A 1TUCA 1YWOA 1GCQA 5FW9A 4E6RA 5IXBA 1AEYA 2O9VA 1SPKA 1CKBA 3UATA 4OMMA 2GGRA 2LCSA 4IIMA 3R6NA 1K76A 4RTUA 1H3HA 1WXUA 2AKKA 1PWTA 3M0UA 2A36A 3VS0A 2FPEA 2KROA 1SEMA 1ZX6A 1QCFA 1NLPC 1W70A 2CDTA 2OAWA 3VS1A 1Y0MA 2JT4A 1CSKA 2EYXA 2CUDA 3PVLA 1U5SA 2JS0A 1BBZA 1PHTA 1JO8A 5GJWB 2QDLA 1GBRA 2DL7A 4D8KA 1SHGA 2BZYA 1GCPA 2OJ2A 3H41A 1VYUA 2GNCA 2M51A 4JJDA 2J6KA 3A98A 3GBQA 3QWYA 3M0SA 2PNIA 2HDAA 3EHRA 1OOTA 3EG1A 2EPDA 1YNZA 2D8JA 3REAB 2RF0A 1X6GA 4GLMA 3VS3A 1E6GA 3UF4A 1JXMA 2GBQA 2XMFA 1KFZA 2O2OA 2LJ1A 2DJQA 2CH4W 4Y92A 2LQWA 1UDLA 1HSQA 2AZSA 2DM1A 1X2KA 2V1RA 1GRIA 2JM8A 2DNUA 4ORZA 2JMCA 4Z89A 3ZL7C 1A0NB 3LH5A 4OMLA 2HEQA 2DX1A 3THKA 1MV3A 2EBPA 2LZ6B 2MOXA 4AG2C 1EFNA 2ROLA 3REBB 2EW3A 2KE9A 4EIKA 1RI9A 2RN8A 4F17A 1E7OA 1YWPA 2C0OA 4R0KA 1KIKA 2EGEA 1UTIA 2KR3A 4Z88A 4M4ZA 1ZUKA 2MCNA 1T0HA 3C0CA 2RPNA 3ULRB 1PNJA 1X69A 5IH2A 4J9BA 2JXBA 3EG0A 2L2PA 2EYWA 2BZXA 2DL4A 2GTOA 2W0ZA 2ESWA 2KNBB 1Y57A 4ESRA 1UECA 2GQIA 1RLPC 2L0AA 4DEXA 2CUBA 1B07A 2HCKA 3PE0A 5IHKA 1FMKA 1WYXA 1ZBJA 2VVKA 3TSZA 2I0NA 1K1ZA 1X43A 2FO0A 2CREA 1H92A 2L3QA 2P4RA 2YSQA 1UE9A 2O88A 1OEBA 1M27C 1WDXA 4RTTA 1WA7A 4JZ4A 5EC7A 4HVWA 4LUEA 2AK5A 1LCKA 2NUZA 2J6FA 3VRYA 2HSPA 2RNAA 1WLPB 1GBQA 5HCKA 1J3TA 2V1QA 3EG3A 2L3SA 2DA9A 2K2MA 2KT8A 4AFSC 3M0RA 4RTXA 2ROTA 2ENMA 2KYBA 3I5SA 1W1FA 2RQUA 1GFDA 4A63B 2O9SA 2A28A 2E5KA 2C0IA 4OMQA 4RTYA 1I1JA 3M0QA 1UGVA 2LQNA 1YP5A 2CT4A 1ZUYA 2YT6A 1T3LA 4JZ3A 2DVJA 1WX6A 2K79A 1JQQA 3NHNA 4J9EA 4AFZC 3O5ZA 1M30A 3UA7A 1K9AA 2FRWA 1HD3A 1WIEA 1AOJA 1X6BA 2L3PA 3I35A 2EGAA 2LNHB 1K0SA 2JS2A 2LJ0A 1OPKA 1Z9QA 2A37A 1JEGA 3PVQA 2KYMA 1WI7A 2EGCA 2HBWA 2D8HA 1Z9ZA 4CC2A 4J9GA 3EHQA 2EVRA 1AZGB 2JM9A 2DMOA 2X3WD 1K4US 2EKHA 1AWJA 2W10A 2ED0A 2RQRA 4HVUA 1JU5C 1NEGA 2SEMA 2VKNA 2ECZA 4HCKA 1NYFA 2D0NA 1AZEA 1VYVA 3VS2A 1BB9A 3TVTA 1M3CA 1X2QA 1MV0B 2ABLA 1QWFA 4WCIA 4F14A 2F2XA 2CT3A 2KBTA 4X1VA 3M0PA 1VA7A 1BU1A 3KFVA 4RTVA 4RTZA 2K7AA 2SRCA 1NYGA 2EQIA 2KXCA 1T0JA 1SRLA 4AG1C 2VWFA 1B3QA 2KT1A 2AZVA 4QT7A 4J9FA 1IO6A 1ARKA 3NMZC 1SHFA 1WFWA 1CKAA 2FRYA 2FPDA 2YUQA 2KRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6X A;  2LJ3 A;  1X27 A;  2F2V A;  4JJB A;  2CSI A;  1AWO A;  4JPB W;  1NM7 A;  1QKX A;  5FWB A;  2DLP A;  5GJV B;  2NWM A;  5L23 A;  1WXT A;  1QLY A;  2LP5 A;  4KRT A;  1G2B A;  1GL5 A;  3H0I A;  5IHN A;  1I0C A;  2FG0 A;  2M0Y A;  2FEI A;  3CQT A;  2EYZ A;  5FWC A;  1N5Z A;  1VYT A;  1MUZ A;  2MIO A;  1YN8 A;  4FSS A;  1SSH A;  2GTJ A;  2CH4 A;  1UHC A;  4HXJ A;  2IIM A;  2DIL A;  4RUG A;  2KXD A;  4D8D A;  3VS7 A;  5I11 A;  1ZUU A;  1PKT A;  2J06 A;  4LUD A;  4OMO A;  2PZ1 A;  4K11 A;  1NEB A;  2RMO A;  2RQW A;  3I5R A;  2EYY A;  2B86 A;  3NGP A;  2KEA A;  3VS4 A;  2DL3 A;  4DEY A;  1K0X A;  5I22 A;  2DF6 A;  1KSW A;  2X3X D;  2RQT A;  2PTK A;  4LNP A;  3EGU A;  1QKW A;  2RQV A;  2YUN A;  1M3A A;  1M8M A;  4CC7 A;  1RUW A;  1TUD A;  4J9C A;  2OI3 A;  3RBB B;  2YUP A;  1PKS A;  2KRN A;  1I07 A;  5IHI A;  1U06 A;  2ED1 A;  1QWE A;  2DBM A;  2KGT A;  4LE9 A;  3M0T A;  4J9I A;  2A08 A;  5ECA A;  4JJC A;  1GFC A;  1AWW A;  4J9D A;  2JTE A;  1TG0 A;  1JXO A;  2LX7 A;  1UHF A;  4GBQ A;  4F16 A;  4IIO A;  1YCS B;  3I9Q A;  3SEM A;  3U23 A;  1HJD A;  4OMN A;  1UUE A;  1AVZ C;  1RLQ C;  1ABQ A;  1U3O A;  1H8K A;  2BTT A;  1T3S A;  4ZNX A;  1ZSG A;  2J05 A;  2J7I A;  3SHW A;  1PRM C;  1UJY A;  4RTW A;  2H8H A;  1NG2 A;  1FYN A;  3NPF A;  1M3B A;  2LMJ A;  1PRL C;  3RNJ A;  1OV3 A;  3VRZ A;  2DBK A;  2KRM A;  1UJ0 A;  3VS6 A;  3H0F A;  1UG1 A;  1XOV A;  2K6D A;  2YUO A;  2DE0 X;  1S1N A;  1V1C A;  3FJ5 A;  2DYB A;  3IQL A;  2J6O A;  4HVV A;  4Z8A A;  1SRM A;  4OMP A;  4AFU C;  2AKL A;  2DRK A;  3QWX X;  1ZLM A;  1KJW A;  3VS5 A;  1NLO C;  1AD5 A;  2CSQ A;  1UFF A;  3H0H A;  2C0T A;  1AWX A;  1E6H A;  5IXF A;  4CC4 B;  2K9G A;  4J9H A;  2D1X A;  4LN2 A;  1OPL A;  2BZ8 A;  4CC3 A;  1BK2 A;  2F2W A;  3UA6 A;  2K3B A;  2DL8 A;  4AFQ C;  2JW4 A;  1GCQ C;  3JV3 A;  1G83 A;  1ABO A;  2YDL A;  3EG2 A;  2FPF A;  2G6F X;  2DL5 A;  2DRM A;  2JMA A;  1WXB A;  3TSW A;  2O31 A;  1TUC A;  1YWO A;  1GCQ A;  5FW9 A;  4E6R A;  5IXB A;  1AEY A;  2O9V A;  1SPK A;  1CKB A;  3UAT A;  4OMM A;  2GGR A;  2LCS A;  4IIM A;  3R6N A;  1K76 A;  4RTU A;  1H3H A;  1WXU A;  2AKK A;  1PWT A;  3M0U A;  2A36 A;  3VS0 A;  2FPE A;  2KRO A;  1SEM A;  1ZX6 A;  1QCF A;  1NLP C;  1W70 A;  2CDT A;  2OAW A;  3VS1 A;  1Y0M A;  2JT4 A;  1CSK A;  2EYX A;  2CUD A;  3PVL A;  1U5S A;  2JS0 A;  1BBZ A;  1PHT A;  1JO8 A;  5GJW B;  2QDL A;  1GBR A;  2DL7 A;  4D8K A;  1SHG A;  2BZY A;  1GCP A;  2OJ2 A;  3H41 A;  1VYU A;  2GNC A;  2M51 A;  4JJD A;  2J6K A;  3A98 A;  3GBQ A;  3QWY A;  3M0S A;  2PNI A;  2HDA A;  3EHR A;  1OOT A;  3EG1 A;  2EPD A;  1YNZ A;  2D8J A;  3REA B;  2RF0 A;  1X6G A;  4GLM A;  3VS3 A;  1E6G A;  3UF4 A;  1JXM A;  2GBQ A;  2XMF A;  1KFZ A;  2O2O A;  2LJ1 A;  2DJQ A;  2CH4 W;  4Y92 A;  2LQW A;  1UDL A;  1HSQ A;  2AZS A;  2DM1 A;  1X2K A;  2V1R A;  1GRI A;  2JM8 A;  2DNU A;  4ORZ A;  2JMC A;  4Z89 A;  3ZL7 C;  1A0N B;  3LH5 A;  4OML A;  2HEQ A;  2DX1 A;  3THK A;  1MV3 A;  2EBP A;  2LZ6 B;  2MOX A;  4AG2 C;  1EFN A;  2ROL A;  3REB B;  2EW3 A;  2KE9 A;  4EIK A;  1RI9 A;  2RN8 A;  4F17 A;  1E7O A;  1YWP A;  2C0O A;  4R0K A;  1KIK A;  2EGE A;  1UTI A;  2KR3 A;  4Z88 A;  4M4Z A;  1ZUK A;  2MCN A;  1T0H A;  3C0C A;  2RPN A;  3ULR B;  1PNJ A;  1X69 A;  5IH2 A;  4J9B A;  2JXB A;  3EG0 A;  2L2P A;  2EYW A;  2BZX A;  2DL4 A;  2GTO A;  2W0Z A;  2ESW A;  2KNB B;  1Y57 A;  4ESR A;  1UEC A;  2GQI A;  1RLP C;  2L0A A;  4DEX A;  2CUB A;  1B07 A;  2HCK A;  3PE0 A;  5IHK A;  1FMK A;  1WYX A;  1ZBJ A;  2VVK A;  3TSZ A;  2I0N A;  1K1Z A;  1X43 A;  2FO0 A;  2CRE A;  1H92 A;  2L3Q A;  2P4R A;  2YSQ A;  1UE9 A;  2O88 A;  1OEB A;  1M27 C;  1WDX A;  4RTT A;  1WA7 A;  4JZ4 A;  5EC7 A;  4HVW A;  4LUE A;  2AK5 A;  1LCK A;  2NUZ A;  2J6F A;  3VRY A;  2HSP A;  2RNA A;  1WLP B;  1GBQ A;  5HCK A;  1J3T A;  2V1Q A;  3EG3 A;  2L3S A;  2DA9 A;  2K2M A;  2KT8 A;  4AFS C;  3M0R A;  4RTX A;  2ROT A;  2ENM A;  2KYB A;  3I5S A;  1W1F A;  2RQU A;  1GFD A;  4A63 B;  2O9S A;  2A28 A;  2E5K A;  2C0I A;  4OMQ A;  4RTY A;  1I1J A;  3M0Q A;  1UGV A;  2LQN A;  1YP5 A;  2CT4 A;  1ZUY A;  2YT6 A;  1T3L A;  4JZ3 A;  2DVJ A;  1WX6 A;  2K79 A;  1JQQ A;  3NHN A;  4J9E A;  4AFZ C;  3O5Z A;  1M30 A;  3UA7 A;  1K9A A;  2FRW A;  1HD3 A;  1WIE A;  1AOJ A;  1X6B A;  2L3P A;  3I35 A;  2EGA A;  2LNH B;  1K0S A;  2JS2 A;  2LJ0 A;  1OPK A;  1Z9Q A;  2A37 A;  1JEG A;  3PVQ A;  2KYM A;  1WI7 A;  2EGC A;  2HBW A;  2D8H A;  1Z9Z A;  4CC2 A;  4J9G A;  3EHQ A;  2EVR A;  1AZG B;  2JM9 A;  2DMO A;  2X3W D;  1K4U S;  2EKH A;  1AWJ A;  2W10 A;  2ED0 A;  2RQR A;  4HVU A;  1JU5 C;  1NEG A;  2SEM A;  2VKN A;  2ECZ A;  4HCK A;  1NYF A;  2D0N A;  1AZE A;  1VYV A;  3VS2 A;  1BB9 A;  3TVT A;  1M3C A;  1X2Q A;  1MV0 B;  2ABL A;  1QWF A;  4WCI A;  4F14 A;  2F2X A;  2CT3 A;  2KBT A;  4X1V A;  3M0P A;  1VA7 A;  1BU1 A;  3KFV A;  4RTV A;  4RTZ A;  2K7A A;  2SRC A;  1NYG A;  2EQI A;  2KXC A;  1T0J A;  1SRL A;  4AG1 C;  2VWF A;  1B3Q A;  2KT1 A;  2AZV A;  4QT7 A;  4J9F A;  1IO6 A;  1ARK A;  3NMZ C;  1SHF A;  1WFW A;  1CKA A;  2FRY A;  2FPD A;  2YUQ A;  2KRS A; 
#chains in the Genus database with same CATH topology
 1W6X A;  2JVV A;  2CSI A;  1AWO A;  1QKX A;  3RUX A;  1YI2 A;  3MEV A;  1KD1 R;  1D3B B;  2LP5 A;  1VQ7 Q;  1G2B A;  1GL5 A;  1VQ8 A;  1I0C A;  1D0Y A;  3CQT A;  1IB8 A;  1TWB A;  4C0Z A;  1VYT A;  1RAD B;  4XTX A;  3ASK A;  4N0A C;  1YN8 A;  4FSS A;  5I21 A;  3CCJ A;  4B6M A;  2RI3 A;  4M77 F;  1M2O A;  1K8A R;  3CC2 A;  4HXJ A;  3SB2 A;  5CAI A;  2IIM A;  3V8J A;  4D8D A;  3VS7 A;  5I11 A;  3S3M A;  3A8O B;  4OB0 B;  1PKT A;  4HA8 A;  2CP2 A;  2RQW A;  3I5R A;  5A2Q E;  1FWZ A;  2D9T A;  2KEA A;  3VS4 A;  2DL3 A;  1K0X A;  4ELY C;  2M0O A;  2NUT A;  2DF6 A;  4C0D B;  3CMA T;  1YJ9 A;  3JCM c;  1QKW A;  1VQL Q;  1PD1 A;  1M3A A;  1D0Z A;  2P0Q A;  3VUZ A;  1YJ9 T;  5IN1 A;  3OYN A;  1TUD A;  3FIF A;  2YUP A;  5GAN 8;  1I07 A;  4BI4 A;  5IHI A;  2NLU A;  5FRN A;  1QWE A;  4M78 G;  4CI0 C;  4F7U A;  2EFI A;  3T9N A;  2A08 A;  2E6Z A;  1GFC A;  2DO3 A;  2JTE A;  4IUT A;  1TG0 A;  3M9Q A;  3CPF A;  2X51 A;  1VIF A;  2X4W A;  4GBQ A;  4M7D C;  2BE9 B;  1R77 A;  3E19 A;  3U23 A;  3JCM Q;  2EJ9 A;  1ABQ A;  3TQ7 P;  3CCS A;  1W4S A;  4ZNX A;  2J05 A;  4NS5 A;  1UJY A;  2H8H A;  3VRZ A;  4KGX B;  3E1S A;  3H0F A;  5KYW A;  1UG1 A;  2PVG B;  5J39 A;  3RKW A;  3A8H B;  2RJD A;  2YUO A;  1JJ2 P;  2P84 A;  1BI0 A;  2X35 A;  3P8H A;  4HVV A;  1SRM A;  3VJP A;  2ZPE B;  4E2F B;  2DRK A;  1MHN A;  1KJW A;  1VQ7 A;  1NLO C;  1AD5 A;  1VQ9 Q;  4RG2 A;  5IXF A;  1DJ7 B;  1M4Z A;  4BE2 A;  4M7D F;  5GAM f;  2K9G A;  4C92 B;  4WTO B;  5CKF A;  4M75 D;  4ZN3 A;  2QA4 A;  4AT1 B;  5KYU B;  2DKG A;  2F2W A;  1ZSZ C;  3QPH A;  2DK3 A;  3Q1J A;  3A5Z B;  2K3X A;  1GCQ C;  4J7I A;  3EG9 B;  3M4G A;  4ZGE B;  2G6F X;  2JMA A;  1WXB A;  1M8V A;  4N0A A;  3MP8 A;  1TUC A;  3I56 A;  1M1K U;  1TH7 A;  3QZ5 B;  3G6E A;  1RI0 A;  2O9V A;  4E7I A;  2L89 A;  1CKB A;  1VQL A;  5A0L A;  2LCS A;  4IIM A;  3R6N A;  2YLC A;  2P4T A;  4OF1 A;  2E64 A;  2WSF E;  2E41 A;  4JUV A;  1VQL T;  3J81 E;  2AKK A;  1D3B A;  1PWT A;  3M0U A;  3VS0 A;  4N4H A;  5D6W A;  1M1K C;  2RB6 A;  2KVQ G;  2VGM A;  3VS1 A;  1UEB A;  1WHH A;  2EQK A;  2OX7 A;  2JS0 A;  5GJW B;  2ZPH B;  1VQ4 Q;  4JRQ A;  4QQD A;  4ZTJ A;  1M1G A;  4DBQ A;  2B8A A;  1B7T A;  2OTL Q;  2CP7 A;  2M51 A;  1UB4 A;  2J6K A;  2HKN A;  1S72 Q;  5C6S A;  2HDA A;  2EPD A;  2OTJ Q;  4M75 A;  2D8J A;  3VS3 A;  5KE3 A;  4E7Z A;  4WF2 A;  2VXF A;  1VQP T;  2LQW A;  1GRI A;  2JM8 A;  2DNU A;  2RK1 A;  1WQ7 A;  3CPW P;  1Y71 A;  1A0N B;  3NFC A;  4C92 D;  2CS7 A;  3THK A;  2EBP A;  3SD4 A;  4BE0 A;  1EFN A;  1VQ9 A;  1QVG P;  1YIT Q;  3OYA A;  1YJW T;  1E7O A;  1YWP A;  1KIK A;  1Q82 C;  1UTI A;  4PJM A;  3C0C A;  2PUO B;  2HBP A;  4ZTF A;  2E70 A;  5GAN g;  3EG0 A;  5D6X A;  2PVO B;  2D0Q B;  1UEC A;  2GQI A;  4A4G A;  1KHI A;  2L0A A;  2HCK A;  4EMK C;  3JCM X;  3AT1 B;  1BI2 A;  1WYX A;  3DLM A;  3G7Z A;  1ZBJ A;  3TSZ A;  3G4S Q;  2DXU A;  5CIU A;  4DBR A;  4BE1 A;  2FO0 A;  1IHW A;  2CRE A;  4HT8 A;  1UE9 A;  3JB9 D;  3JAM E;  4RTT A;  4VUB A;  8AT1 B;  3GOX A;  2H3J A;  2X4Y A;  4IUR A;  5EC7 A;  4HVW A;  2HKQ B;  2DIQ A;  2QQR A;  4Z02 A;  1QCO A;  2QQS A;  1WLP B;  4C92 A;  2V1Q A;  1VQ4 A;  1IGU A;  2E1H A;  5KYU A;  1N9R A;  2OTL A;  1RAB B;  3M0R A;  5DLO A;  2ENM A;  5HKC A;  3I5S A;  1G3S A;  1W1F A;  1V76 A;  1S72 A;  2EYQ A;  1BI1 A;  2CP6 A;  3JCM b;  3BDL A;  1Q7Y U;  4RTY A;  1I1J A;  2OTJ A;  1YCY A;  1YP5 A;  2K57 A;  3CCR Q;  3HPW A;  1JJ2 A;  2HL5 C;  4FSX A;  2DVJ A;  4J6W A;  1I5L A;  1N8R R;  2OTJ T;  4AFZ C;  4M78 E;  3OYL A;  4KUD K;  3UA7 A;  1TUG B;  1I81 A;  1HD3 A;  4EDU A;  1VQM Q;  4QVZ A;  3CC4 Q;  2EGA A;  2LNH B;  1W2B P;  3HRU A;  3SFM A;  1VQ6 T;  1K0S A;  2JS2 A;  4E7H A;  1Q81 C;  4Q5W A;  4DOV A;  3QG1 A;  1OPK A;  3C95 A;  3HRT A;  3HRS A;  1KC8 C;  4NL2 A;  4CC2 A;  2K5L A;  4J9G A;  2JM9 A;  2LRQ A;  1K4U S;  7AT1 B;  2W10 A;  1TTH B;  2ED0 A;  3CCQ A;  4ATO A;  1YIT T;  2ZPI B;  1JU5 C;  3QXE B;  4KGV B;  3CME A;  1AZE A;  1VYV A;  4PJO B;  4NOY A;  1BB9 A;  1NE8 A;  4XTW A;  3PFS A;  2QDY B;  2MWP A;  2FL7 A;  1NJI R;  4RTV A;  2K7A A;  3QJ6 A;  3JB9 H;  3A8G B;  4C8Q B;  2VWF A;  3RKY A;  2HL3 A;  3FEO A;  4QT7 A;  1MMA A;  3G4S A;  4PJJ A;  1PG5 B;  3BW1 A;  3NMZ C;  3MPU B;  2LTO A;  2E5Q A;  3UWN A;  4XTU A;  3JCM W;  1PRL C;  4PJO C;  2YXY A;  3VKI A;  3DLL A;  4EPC A;  2RHX A;  5GJV B;  3S6W A;  2IG0 A;  1WZO A;  4J6X A;  2QXF A;  2LQ8 A;  2LCC A;  4KRT A;  5AYF A;  4C8Q C;  5IHN A;  4A4K A;  2NUP A;  3AHU A;  4XK8 E;  2WAC A;  1I4K 1;  1MUZ A;  2JNG A;  1JJ2 S;  2YLB A;  2MI6 A;  3A8M B;  1SSH A;  3X28 B;  2CH4 A;  1UHC A;  2ZGW A;  2RA2 A;  4RUG A;  2KXD A;  1VQK A;  1MND A;  2DZC A;  1FXX A;  1ZUU A;  5LJ3 f;  2COW A;  3OYG A;  3CCR A;  3GLX A;  1YIJ A;  1NEB A;  4AMC A;  3CPW A;  3NGP A;  4J83 A;  1VQO Q;  1Q86 C;  1QCN A;  4DEY A;  2COZ A;  4QKU A;  1MMN A;  2EQU A;  1KSW A;  2RQT A;  1VQM A;  2DJZ A;  4LNP A;  3CC4 A;  2YUN A;  2RQV A;  1QVG A;  4UC4 A;  5HK0 A;  4C8Q F;  4CC7 A;  3OW2 P;  2CZ7 B;  5FU7 C;  1VIE A;  4OB3 B;  2QI2 A;  4PJO D;  1Q81 R;  2PVD B;  3CC4 T;  2EQM A;  3J80 E;  2OI3 A;  1PKS A;  1KC8 R;  1JB0 E;  1QQJ A;  5GAM d;  2KGT A;  1KHC A;  4LE9 A;  4J9I A;  2QGF B;  3INZ A;  5ECA A;  2LVM A;  1G8X A;  4C5G A;  1AWW A;  2P0K A;  2R58 A;  1JXO A;  2FHD A;  4KUI A;  3PMT A;  1UHF A;  2KI7 A;  3QZ9 B;  4F16 A;  1YCS B;  4HCB A;  1UUE A;  2DIG A;  3KUF A;  1ZSG A;  3H8Z A;  1UGS B;  2DER A;  4PLL A;  2LMJ A;  2K5I A;  2RJE A;  4MZM A;  4F7U F;  2RM4 A;  2YRC A;  2DBK A;  3EGD B;  4O5V A;  5KCH A;  1OX9 A;  4PK4 A;  1OQK A;  5DLQ E;  1S1N A;  3FJ5 A;  1WHL A;  1VQ5 Q;  2J6O A;  2XDD A;  4Z8A A;  2MF2 A;  3C12 A;  4OMP A;  4M7D E;  2CP5 A;  1UFF A;  4LDX A;  2C0T A;  1E6H A;  4PJO A;  4CC4 B;  1BYM A;  4QVD A;  5L8R E;  3CPW S;  2D1X A;  4LN2 A;  1OPL A;  2BZ8 A;  4CC3 A;  3QSU A;  1BK2 A;  1OX8 A;  4XU2 A;  2K3B A;  2XDB A;  2XI9 A;  2QAZ A;  5KH6 A;  1QVG S;  1PC0 A;  3V7C A;  4C8Q A;  4JLG A;  1G83 A;  4HCC A;  1ABO A;  4KT0 E;  2YDL A;  3CCU T;  1W2B A;  1VQO A;  4M7A B;  3TSW A;  2M9U A;  2DET A;  3CBM A;  1OI1 A;  5FW9 A;  1Q86 R;  3E9G A;  1SPK A;  3HSB A;  1VQO T;  3UAT A;  4OMM A;  3CMA A;  4E7K A;  3X25 B;  3M55 A;  3GPL A;  3M53 A;  5J3B A;  4M75 B;  4GY5 A;  2Z0W A;  5GAN 6;  3MEA A;  2ZAE A;  4MDW A;  2LC4 A;  1UGR B;  1SEM A;  4PFZ A;  2FZG B;  1NLP C;  1JBM A;  2OAW A;  3PNW C;  2JT4 A;  4M7A C;  1CSK A;  2EYX A;  2CUD A;  2VUB A;  3JCM f;  1UGP B;  3E9F A;  4OGE A;  1BKB A;  5CCA A;  3CCL Q;  2AIR B;  2E4H A;  3JCM V;  1U8R A;  1IHV A;  2COY A;  2DL7 A;  4D8K A;  3CC7 Q;  1C6V X;  1GCP A;  2E3H A;  4M75 C;  1IGQ A;  3H41 A;  1QW1 A;  3SWN B;  4JJD A;  1EZZ B;  3A98 A;  2VXE A;  1R0C B;  3UT1 A;  3GBQ A;  4C0D C;  3QWY A;  4JJN K;  3EG1 A;  3RKX A;  3V8L A;  1RAA B;  1X6G A;  1E6G A;  4C5H A;  2MK5 A;  2GBQ A;  2YWW A;  3EH1 A;  2CH4 W;  4LDW A;  3QDR B;  3N5B B;  2YRD A;  3PMI A;  1HSQ A;  5IT9 E;  1VQP Q;  4ORZ A;  5LJ5 d;  3ZL7 C;  1M90 U;  1XQH A;  1MGQ A;  3G1J A;  3SWN C;  1OYX A;  2D6F A;  3JCM J;  1YFN A;  2LZ6 B;  2MOX A;  1KG1 A;  4AG2 C;  1VQ5 T;  2JTM A;  4F7U G;  1XTD A;  3HTR A;  4M75 F;  3FDR A;  3OS5 A;  5GMK m;  3RR6 A;  4KH1 B;  1KQS P;  4R0K A;  1QVF P;  1YJW Q;  1D1C A;  1ZUK A;  1W2B S;  4M7A D;  1T0H A;  1M90 C;  1OU8 A;  2RPN A;  5GAO n;  4ELZ C;  2L2P A;  5FLX E;  3NTI A;  2EYW A;  4B9W A;  2RK2 A;  2ESW A;  4ESR A;  2DZ9 A;  3MP1 A;  3MO8 A;  4MML A;  2CUB A;  4OMF B;  3V7S A;  1KQ1 A;  4FIB A;  3OW2 A;  3GP8 A;  1AT1 B;  3EGD A;  2FZK B;  2VVK A;  2I0N A;  5LL6 S;  2RD1 A;  4JDS A;  1K1Z A;  1X43 A;  2BKD N;  4M77 G;  1H92 A;  2BE7 D;  2L3Q A;  2YSQ A;  3OYE A;  2DFU A;  1OEB A;  1M2V B;  1M27 C;  2CP0 A;  3ZFJ A;  4N4I A;  4C92 C;  4L6V 5;  1TSF A;  2AK5 A;  2DTI A;  4LD6 A;  3FB9 A;  2EJG A;  3VRY A;  1VUB A;  2RNA A;  2K2V A;  4RCB A;  3JB9 I;  3EG3 A;  3C4S A;  4DBH A;  2X4X A;  2K3Y A;  1XNI A;  3CC7 A;  4FT4 A;  2EKO A;  1UGQ B;  4FU6 A;  2ROT A;  3BFM A;  3CCL T;  2KYB A;  1WNL A;  1GFD A;  3V7R A;  2E5K A;  3SDZ A;  1R0B G;  3GF5 A;  3CC7 T;  4OMQ A;  3M0Q A;  4M7A A;  2GFU A;  3L1A A;  1T3L A;  3VYG A;  1HYO A;  1JQQ A;  3I55 T;  3OSS C;  3H9N A;  4C92 F;  9ATC B;  1VQP A;  1M5Q 1;  2FRW A;  3X24 B;  1WIE A;  2QTV A;  2YRV A;  1FX7 A;  2L3P A;  1N9S A;  2K4Y A;  3CEY A;  4C0G A;  2LJ0 A;  2PU9 B;  1Z9Q A;  2A37 A;  1VQ6 Q;  1K73 U;  3X26 B;  3QJY A;  4FYY B;  2D8H A;  3EFO B;  2JJ9 A;  4FW2 A;  1IRX A;  3EHQ A;  2EVR A;  3MET A;  2MYS A;  4JS4 A;  4EMG A;  1YJW A;  4HVU A;  4BD3 A;  2SEM A;  2VKN A;  2ECZ A;  1YJN Q;  2YHT A;  1NYF A;  4HCK A;  3ER0 A;  1VQN T;  3OW2 S;  2BIV A;  4HT9 A;  3SWN A;  1OZ2 A;  1Y7X A;  4BUG A;  2OAU A;  3TVT A;  1X2Q A;  1MV0 B;  1LVK A;  3GIB A;  4X1V A;  1VA7 A;  5LJ3 d;  2NUP B;  1U1S A;  4RTZ A;  4QW2 A;  1NYG A;  2EQI A;  5CQX A;  4FYV B;  3JB9 J;  2LDM A;  1KQ2 A;  1B3Q A;  2KT1 A;  4MZP A;  2AZV A;  3JB9 F;  4J9F A;  4M7D G;  2XKO C;  1SHF A;  1CKA A;  1G3T A;  2FPD A;  2YUQ A;  4PL6 A;  4PLI A;  1PD0 A;  3HL8 A;  2LJ3 A;  1X27 A;  4JJB A;  2RJC A;  4JPB W;  2E6N A;  1NM7 A;  5FWB A;  2LT1 A;  2NWM A;  5L23 A;  2QAS A;  2HQH A;  1LJO A;  5LJ5 f;  5CKB A;  3H0I A;  5KYY B;  5LJ3 h;  2KMT A;  5FWC A;  2MIO A;  5GMK j;  2ZZD A;  4P5N A;  1M1K R;  3F70 A;  5GAO l;  3L2Z A;  5GAM j;  2Y4Y A;  4PFO A;  1WQW A;  1NPP A;  5FU6 B;  1X6O A;  2J06 A;  4OMO A;  3MEU A;  4K11 A;  2RMO A;  3CBP A;  1MMD A;  4CRI A;  2EYY A;  2K5F A;  2B86 A;  5AT1 B;  2GQV A;  2X3X D;  1G3W A;  1O9S A;  2L3R A;  2PTK A;  1M2V A;  2DXC A;  1XJW B;  3VV0 A;  3OSV A;  1VQ6 A;  1KQS A;  3LGL A;  4C0F A;  1QVF A;  4IUQ A;  4QVC A;  2QEX Q;  1RUW A;  4J9C A;  1LNX A;  5FU6 C;  2HQE A;  2KRN A;  1Q7Y C;  2ED1 A;  1G3Y A;  3CCE Q;  1K9M U;  3L2U A;  1YIT A;  2RHU A;  1WHM A;  1SKU B;  3G71 Q;  2R5A A;  4J9D A;  1RAI B;  1YJN T;  1RAE B;  1X01 A;  3EGX B;  1Q82 R;  4J8O A;  3SEM A;  3LYI A;  1HJD A;  4OMN A;  1AVZ C;  2BTT A;  2Y90 A;  2EWN A;  1T3S A;  5FRO A;  4F7U E;  4X34 A;  5M9O A;  4FCY A;  2P0P A;  3SHW A;  1ZQ1 A;  4RTW A;  1NG2 A;  3NPF A;  2Y4X A;  4JS5 A;  1D1A A;  4J6Y A;  3RNJ A;  1OV3 A;  2DTO A;  3QKJ A;  2K6D A;  1D09 B;  3ZBD A;  2DYB A;  3IQL A;  3EFO A;  3JB9 G;  1X75 C;  5GAN d;  1MMG A;  3CD6 Q;  2AKL A;  3VS5 A;  2CSQ A;  4OB2 B;  3JCM d;  3H0H A;  4XU3 A;  3VUB A;  2JUF A;  4OVA A;  1AWX A;  3CCM Q;  5CKH A;  1BI3 A;  2ZCF B;  2QGG A;  1O75 A;  3OYK A;  8ATC B;  4MDX A;  4A4F A;  4M77 E;  1P92 A;  1KD1 U;  3PTA A;  2QG9 B;  4M78 B;  4AFQ C;  3PIO A;  1KK7 A;  4A54 A;  3JV3 A;  3CXC P;  2KAF A;  2FPF A;  1KQS S;  2DRM A;  2QQ9 A;  1I5O B;  4ZN1 A;  1QVF S;  4FL6 A;  2DD5 A;  3CCU Q;  3LLR A;  5HK3 A;  1YWO A;  3M5A A;  4QQG A;  1K8A U;  4PJO F;  1KD1 C;  2GGR A;  5IAY A;  3JCM h;  3QII A;  1K76 A;  1ZA2 B;  4A4E A;  2QEX A;  1WXU A;  4A53 A;  2O4X B;  2F69 A;  5KE2 A;  3R6O A;  5LJ5 j;  1ZX6 A;  5KYY A;  1QCF A;  2GFA A;  2QEX T;  1W70 A;  1K8A C;  1Q7Y R;  3CCJ Q;  1U5S A;  2XID A;  1BBZ A;  1PHT A;  3RDV A;  4E7S A;  5J26 A;  1JO8 A;  3MJX A;  4EMH A;  3G71 A;  2QDL A;  2JTF A;  3CCE T;  1SHG A;  1Y07 A;  3PGG A;  2BZY A;  2EAY A;  4BI8 B;  1IZ6 A;  4BDZ A;  2OJ2 A;  1VYU A;  3OYM A;  3G71 T;  2GNC A;  3TRE A;  2IPO B;  3A8L B;  2MWO A;  2JZ2 A;  4XAX B;  2M02 A;  3EHR A;  5DM7 R;  1YNZ A;  2V8I A;  5GAO p;  2RF0 A;  2HMA A;  3FJP A;  1KFZ A;  2LJ1 A;  2DJQ A;  2RI2 A;  4Y92 A;  1UDL A;  2AZS A;  1Y96 B;  2DM1 A;  1PSE A;  1X2K A;  3PT9 A;  2JMC A;  3LX7 A;  4M77 B;  4Z89 A;  1QP3 A;  2RHZ A;  3LH5 A;  4OML A;  2HEQ A;  3LH0 A;  4XU1 A;  2RI5 A;  1R8O B;  1MV3 A;  4C5E A;  5GMK h;  1G5V A;  3REB B;  3WXM B;  1JRI A;  3GNG A;  3M57 A;  4M78 D;  3MP6 A;  5DY9 A;  4X9C A;  4EIK A;  5GAM h;  2RN8 A;  3CD6 T;  3EFS A;  4Z88 A;  2QQB A;  4M4Z A;  3OS0 A;  4KUL A;  3L42 A;  3CCM T;  1X69 A;  3EGX A;  2RHI A;  4R56 A;  3OMC A;  4DBF A;  2F5T X;  3CCS Q;  2QK0 A;  2BZX A;  2DL4 A;  2GTO A;  2W0Z A;  2KNB B;  1HXD A;  1Y57 A;  3NTK A;  4XTV A;  1QVP A;  3OB9 A;  2DAQ A;  4DEX A;  3CCU A;  3PE0 A;  3MCA B;  4DQ2 A;  4LDU A;  2KQW A;  3M4Y A;  3OYD A;  1M1F A;  6AT1 B;  3OS2 A;  3JRZ A;  2FVU A;  2CP3 A;  4XTZ A;  1WDX A;  1YI2 T;  2XDP A;  3OQ5 A;  1SSF A;  4YTL A;  2E10 A;  1WHG A;  2DD4 A;  4JZ4 A;  5GAN 7;  1WJR A;  4PJO G;  1LCK A;  2E12 A;  1VQ8 T;  3BDU A;  2J6F A;  4DOW A;  2A7Y A;  2QA4 Q;  2FYK A;  1GBQ A;  5GAN f;  4FW1 A;  3CCJ T;  2KT8 A;  2VC8 A;  4MMK A;  3OS1 A;  1SF9 A;  3P8B B;  2X9H A;  4M78 A;  4RTX A;  3CC2 T;  4C8Q G;  2E65 A;  2DVE A;  3JSC A;  1PSF A;  3WVE B;  2O9S A;  2A28 A;  2XG8 D;  2CZ6 B;  1WPY A;  2BUD A;  3LGF A;  5CKE A;  3I56 Q;  1M9S A;  4PJL A;  4M77 D;  4II1 A;  3LWI A;  3G6E Q;  4C92 E;  4L59 A;  2CT4 A;  2YT6 A;  1ZHI A;  2HD0 A;  2F1L A;  3VYH B;  5LJ3 j;  3OYF A;  1WX6 A;  2K79 A;  5GMK e;  3GNF B;  1K9A A;  2NYS A;  4M7D B;  5GAM e;  1D1B A;  2KK4 A;  1QMC A;  2M16 A;  3M56 A;  3I55 Q;  2LQK A;  4HKE A;  4QQ6 A;  5A0D A;  1NBE B;  1AOJ A;  1X6B A;  4FT2 A;  2O4X A;  4V2S A;  4KH0 B;  4LD9 K;  1OUL A;  3NTH A;  2G3R A;  2RHY A;  2EGC A;  1H3Z A;  2HBW A;  1I8F A;  3OYC A;  5CO7 A;  1Z9Z A;  4M7A F;  4MZT A;  1VQ5 A;  2DMO A;  2A3L A;  5GAN 2;  1Q95 G;  5KYN A;  2HAX A;  4ME7 A;  3P8D A;  1NEG A;  2LT4 A;  3CXC A;  5KYX B;  5CKD A;  4ZGD B;  1VQN Q;  2ABL A;  1QWF A;  4XQ3 A;  3QO3 A;  3OYB A;  3EAE A;  2KBT A;  3M0P A;  3VU3 C;  3KFV A;  4DA4 A;  3LW5 E;  3UPU A;  1V29 B;  2KXC A;  3CCS T;  2C06 A;  4J5Y A;  4AG1 C;  2HNI A;  1Y96 A;  5LJ3 g;  1IXD A;  4NL3 A;  1ZSZ B;  5HY6 A;  4IUP A;  1WFW A;  2QTX A;  4M77 A;  1RL2 A;  5LJ5 h;  3ZEH A;  3S3O A;  4FYX B;  2F2V A;  2XU8 A;  3TU4 K;  2DLP A;  4Y28 E;  3EH2 A;  1N27 A;  2V8J A;  4JLI A;  1WXT A;  2ZPB B;  1VQ7 T;  1QLY A;  1RAH B;  2VGN A;  4KBM B;  1B34 B;  3L2W A;  1AHJ B;  3OYY A;  3LWH A;  1FMV A;  2LNV A;  2FG0 A;  2M0Y A;  4GLK A;  2FEI A;  2EYZ A;  1N5Z A;  2QA4 T;  1YBY A;  2GTJ A;  3CCL A;  2CZ0 B;  1PM3 A;  4M7D D;  1IRE B;  2DIL A;  2H3E B;  5CR2 A;  2FB7 A;  4LUD A;  3ME9 A;  2LX9 A;  2PZ1 A;  4XU0 A;  5CK9 A;  3URG A;  3QUI A;  4JRP A;  3I56 T;  1TXQ A;  3G6E T;  3OBW A;  2CKK A;  5GAO m;  5I22 A;  3C94 A;  3I55 A;  1MNE A;  3EGU A;  1M8M A;  1QP2 A;  5CQY A;  3X20 B;  4KGZ B;  3KXT A;  2DXT A;  3CXC S;  4FYW B;  4IUV A;  1N8R U;  3RBB B;  3QHS A;  2M1H A;  5D7U A;  1N6A A;  3WVD B;  4R55 A;  1U06 A;  2DBM A;  4HCZ A;  5GAN j;  3M58 A;  3M0T A;  2CZ1 B;  2QYZ A;  4E7L A;  3QYG B;  2V8K A;  5FRM A;  4JJC A;  1VQN A;  4M7A G;  2LX7 A;  1N8R C;  5LJ5 e;  4BI3 A;  4IIO A;  3I9Q A;  4RMO A;  1M90 R;  1RLQ C;  1Q82 U;  5GMK l;  1U3O A;  1H8K A;  4M75 G;  1K73 C;  2J7I A;  1FMW A;  4M7D A;  2E3I A;  1PRM C;  2DPP B;  1WJS A;  1FYN A;  3DB4 A;  1U1T A;  1VOM A;  1M3B A;  1TOV A;  2EIF A;  2V26 A;  5CVI A;  1C1A A;  2GCX A;  3HFO A;  3MKD A;  2ZPF B;  2KRM A;  4X9D A;  1UJ0 A;  3VS6 A;  1NJI U;  4PFP A;  1XOV A;  5GAN 4;  2DE0 X;  4EMK B;  1V1C A;  4JRI A;  3RIR A;  2DEQ A;  1BCM A;  4N4G A;  4TVR A;  1VQ9 T;  3CCQ Q;  4AFU C;  4RCC A;  3QWX X;  1ZLM A;  3CME Q;  3HP9 A;  2PQW A;  3FC3 A;  4E7J A;  2L8D A;  5KYX A;  1NJI C;  1WJQ A;  3H6Z A;  3HFN A;  4J9H A;  3JCM g;  3UA6 A;  4O6J A;  2DL8 A;  1ZA1 B;  1EIF A;  2JW4 A;  2XK0 A;  5A0G A;  3FLG A;  3V8K A;  2DEU A;  2VAS A;  2KY9 A;  3EG2 A;  4PJO E;  2KDS A;  2DL5 A;  1OU9 A;  1ZSZ A;  4OP0 A;  3RER A;  5KCO A;  2O31 A;  1TU0 B;  2DTH A;  1GCQ A;  3MHX A;  2MAM A;  4E6R A;  5IXB A;  1AEY A;  3BE3 A;  3OY9 A;  4LDY A;  2VV5 A;  3DB3 A;  3HKS A;  3D7S B;  4C8Q E;  2HZY A;  4RTU A;  4A4H A;  1NPR A;  1ACM B;  1H3H A;  1BIA A;  4XTY A;  1YHQ Q;  2A36 A;  4PJN A;  1B34 A;  2FPE A;  2KRO A;  4OGC A;  4F04 B;  2CDT A;  2X4J A;  1Y0M A;  1OZ3 A;  3PVL A;  2FZC B;  2RH2 A;  1VQ4 T;  3UDC A;  3EG9 A;  1D0X A;  4C92 G;  5GAO q;  4E47 A;  1GBR A;  2OTL T;  3PIP A;  1VQK Q;  3TEE A;  2JOY A;  1Q81 U;  4LXC A;  2AT1 B;  1S72 T;  2MMP A;  3RMS A;  3L2Q A;  3DKM A;  1YIJ Q;  4IKF A;  1YJN A;  1KC8 U;  3M0S A;  2PNI A;  1OOT A;  4OB1 B;  3REA B;  4GLM A;  3KBG A;  5GAM g;  4BDY A;  2VB6 A;  3UF4 A;  1JXM A;  1K73 R;  2XMF A;  3L2V A;  2O2O A;  3QYH B;  3L2R A;  1HK9 A;  4BY6 B;  4C5I A;  3RES A;  2A0F B;  2V1R A;  3BY7 A;  1K9M C;  4Y91 A;  3QDF A;  2DX1 A;  2L5Q A;  5LJ3 e;  2ROL A;  2EW3 A;  4BB7 A;  2KE9 A;  5GAN 3;  4IUU A;  1RI9 A;  4BAC A;  4D6W A;  4F17 A;  4J7F A;  2PUK B;  5D6Y A;  3CCQ T;  2C0O A;  2DYI A;  2EGE A;  4BY6 C;  2KR3 A;  3OYI A;  3CME T;  4PKC C;  3CCV Q;  2QQA A;  2MCN A;  3MEW A;  3ULR B;  3J7A F;  1PNJ A;  5IH2 A;  3FRN A;  2WSE E;  4FM4 B;  4J9B A;  2RJF A;  2JXB A;  5GAN 5;  2GF7 A;  5GMK i;  1RLP C;  1B07 A;  2RO0 A;  1FMK A;  5IHK A;  3G4S T;  1TS9 A;  1PCX A;  2NUT B;  2HSE B;  4EMK A;  4L5G A;  2P4R A;  2O01 E;  2AHJ B;  2O88 A;  1RAG B;  5GAN h;  3OYH A;  2JN0 A;  2XIC A;  1YHQ A;  1WA7 A;  1YI2 Q;  4LUE A;  1Q86 U;  2F5K A;  2XD0 A;  2NUZ A;  3TCJ A;  3M59 A;  1YHQ T;  2HSP A;  4M78 C;  5FU7 B;  1LPL A;  5HCK A;  1VQ8 Q;  1J3T A;  2L3S A;  2VYT A;  2DA9 A;  2K2M A;  5GAO r;  1LOJ A;  4AFS C;  4F7U B;  3CCE A;  2WSC E;  2ZPG B;  2RQU A;  4A63 B;  1VQK T;  3CC2 Q;  2I2L A;  2C0I A;  1ZBX A;  3CCR T;  4JRK A;  1GXI E;  1UGV A;  2DXB A;  1YIJ T;  2LQN A;  2ATC B;  3OBY A;  1ZUY A;  1WGS A;  1EX4 A;  5EG2 A;  3RMQ A;  3CMA Q;  4ANJ A;  4JZ3 A;  3NHN A;  1WHK A;  4J9E A;  3O5Z A;  1NZ9 A;  1M30 A;  1VQM T;  2MPX C;  1RAF B;  1YJ9 Q;  3EFR A;  3I35 A;  1RAC B;  1K9M R;  4M78 F;  3QBY A;  4M7A E;  2EQJ A;  3E2U A;  5KYW B;  1JEG A;  3PVQ A;  1F1B B;  1WI7 A;  2KYM A;  5I2M A;  2HQX A;  3OA6 A;  2XHC A;  4PNO A;  4C8Q D;  2EJF A;  1AZG B;  1BIB A;  2X3W D;  4M75 E;  2IVW A;  2EKH A;  1AWJ A;  3OYJ A;  3CD6 A;  3CCV A;  2RQR A;  3M54 A;  3OMG A;  2D0N A;  4RG8 A;  5LJ5 g;  4LDV A;  3VS2 A;  4B9X A;  2KSS A;  3CCM A;  3CCV T;  1M3C A;  1BCO A;  4WCI A;  3A1P A;  4F14 A;  4RKU E;  2F2X A;  2CT3 A;  2CGH A;  2CYZ B;  1BU1 A;  2LCL A;  3HHT B;  4ZGJ B;  2SRC A;  5GAN e;  5C0M A;  4M77 C;  1T0J A;  1SRL A;  3CBO A;  3S3N A;  3O8V A;  1WHJ A;  2R57 A;  3JCM e;  1IO6 A;  1ARK A;  3JCM P;  5I2S A;  2FRY A;  1SG5 A;  2R5M A;  1C0M A;  1H64 1;  2KRS A; 
#chains in the Genus database with same CATH homology
 1W6X A;  2LJ3 A;  1X27 A;  2F2V A;  4JJB A;  2CSI A;  1AWO A;  4JPB W;  1NM7 A;  1QKX A;  5FWB A;  2DLP A;  5GJV B;  2NWM A;  5L23 A;  1WXT A;  1QLY A;  2LP5 A;  4KRT A;  1G2B A;  1GL5 A;  3H0I A;  5IHN A;  1I0C A;  2FG0 A;  2M0Y A;  2FEI A;  3CQT A;  2EYZ A;  5FWC A;  1N5Z A;  1VYT A;  1MUZ A;  2MIO A;  1YN8 A;  4FSS A;  1SSH A;  2GTJ A;  2CH4 A;  1UHC A;  4HXJ A;  2IIM A;  2DIL A;  4RUG A;  2KXD A;  4D8D A;  3VS7 A;  5I11 A;  1ZUU A;  1PKT A;  2J06 A;  4LUD A;  4OMO A;  2PZ1 A;  4K11 A;  1NEB A;  2RMO A;  2RQW A;  3I5R A;  2EYY A;  2B86 A;  3NGP A;  2KEA A;  3VS4 A;  2DL3 A;  4DEY A;  1K0X A;  5I22 A;  2DF6 A;  1KSW A;  2X3X D;  2RQT A;  2PTK A;  4LNP A;  3EGU A;  1QKW A;  2RQV A;  2YUN A;  1M3A A;  1M8M A;  4CC7 A;  1RUW A;  1TUD A;  4J9C A;  2OI3 A;  3RBB B;  2YUP A;  1PKS A;  2KRN A;  1I07 A;  5IHI A;  1U06 A;  2ED1 A;  1QWE A;  2DBM A;  2KGT A;  4LE9 A;  3M0T A;  4J9I A;  2A08 A;  5ECA A;  4JJC A;  1GFC A;  1AWW A;  4J9D A;  2JTE A;  1TG0 A;  1JXO A;  2LX7 A;  1UHF A;  4GBQ A;  4F16 A;  4IIO A;  1YCS B;  3I9Q A;  3SEM A;  3U23 A;  1HJD A;  4OMN A;  1UUE A;  1AVZ C;  1RLQ C;  1ABQ A;  1U3O A;  1H8K A;  2BTT A;  1T3S A;  4ZNX A;  1ZSG A;  2J05 A;  2J7I A;  3SHW A;  1PRM C;  1UJY A;  4RTW A;  2H8H A;  1NG2 A;  1FYN A;  3NPF A;  1M3B A;  2LMJ A;  1PRL C;  3RNJ A;  1OV3 A;  3VRZ A;  2DBK A;  2KRM A;  1UJ0 A;  3VS6 A;  3H0F A;  1UG1 A;  1XOV A;  2K6D A;  2YUO A;  2DE0 X;  1S1N A;  1V1C A;  3FJ5 A;  2DYB A;  3IQL A;  2J6O A;  4HVV A;  4Z8A A;  1SRM A;  4OMP A;  4AFU C;  2AKL A;  2DRK A;  3QWX X;  1ZLM A;  1KJW A;  3VS5 A;  1NLO C;  1AD5 A;  2CSQ A;  1UFF A;  3H0H A;  2C0T A;  1AWX A;  1E6H A;  5IXF A;  4CC4 B;  2K9G A;  4J9H A;  2D1X A;  4LN2 A;  1OPL A;  2BZ8 A;  4CC3 A;  1BK2 A;  2F2W A;  3UA6 A;  2K3B A;  2DL8 A;  4AFQ C;  2JW4 A;  1GCQ C;  3JV3 A;  1G83 A;  1ABO A;  2YDL A;  3EG2 A;  2FPF A;  2G6F X;  2DL5 A;  2DRM A;  2JMA A;  1WXB A;  3TSW A;  2O31 A;  1TUC A;  1YWO A;  1GCQ A;  5FW9 A;  4E6R A;  5IXB A;  1AEY A;  2O9V A;  1SPK A;  1CKB A;  3UAT A;  4OMM A;  2GGR A;  2LCS A;  4IIM A;  3R6N A;  1K76 A;  4RTU A;  1H3H A;  1WXU A;  2AKK A;  1PWT A;  3M0U A;  2A36 A;  3VS0 A;  2FPE A;  2KRO A;  1SEM A;  1ZX6 A;  1QCF A;  1NLP C;  1W70 A;  2CDT A;  2OAW A;  3VS1 A;  1Y0M A;  2JT4 A;  1CSK A;  2EYX A;  2CUD A;  3PVL A;  1U5S A;  2JS0 A;  1BBZ A;  1PHT A;  1JO8 A;  5GJW B;  2QDL A;  1GBR A;  2DL7 A;  4D8K A;  1SHG A;  2BZY A;  1GCP A;  2OJ2 A;  3H41 A;  1VYU A;  2GNC A;  2M51 A;  4JJD A;  2J6K A;  3A98 A;  3GBQ A;  3QWY A;  3M0S A;  2PNI A;  2HDA A;  3EHR A;  1OOT A;  3EG1 A;  2EPD A;  1YNZ A;  2D8J A;  3REA B;  2RF0 A;  1X6G A;  4GLM A;  3VS3 A;  1E6G A;  3UF4 A;  1JXM A;  2GBQ A;  2XMF A;  1KFZ A;  2O2O A;  2LJ1 A;  2DJQ A;  2CH4 W;  4Y92 A;  2LQW A;  1UDL A;  1HSQ A;  2AZS A;  2DM1 A;  1X2K A;  2V1R A;  1GRI A;  2JM8 A;  2DNU A;  4ORZ A;  2JMC A;  4Z89 A;  3ZL7 C;  1A0N B;  3LH5 A;  4OML A;  2HEQ A;  2DX1 A;  3THK A;  1MV3 A;  2EBP A;  2LZ6 B;  2MOX A;  4AG2 C;  1EFN A;  2ROL A;  3REB B;  2EW3 A;  2KE9 A;  4EIK A;  1RI9 A;  2RN8 A;  4F17 A;  1E7O A;  1YWP A;  2C0O A;  4R0K A;  1KIK A;  2EGE A;  1UTI A;  2KR3 A;  4Z88 A;  4M4Z A;  1ZUK A;  2MCN A;  1T0H A;  3C0C A;  2RPN A;  3ULR B;  1PNJ A;  1X69 A;  5IH2 A;  4J9B A;  2JXB A;  3EG0 A;  2L2P A;  2EYW A;  2BZX A;  2DL4 A;  2GTO A;  2W0Z A;  2ESW A;  2KNB B;  1Y57 A;  4ESR A;  1UEC A;  2GQI A;  1RLP C;  2L0A A;  4DEX A;  2CUB A;  1B07 A;  2HCK A;  3PE0 A;  5IHK A;  1FMK A;  1WYX A;  1ZBJ A;  2VVK A;  3TSZ A;  2I0N A;  1K1Z A;  1X43 A;  2FO0 A;  2CRE A;  1H92 A;  2L3Q A;  2P4R A;  2YSQ A;  1UE9 A;  2O88 A;  1OEB A;  1M27 C;  1WDX A;  4RTT A;  1WA7 A;  4JZ4 A;  5EC7 A;  4HVW A;  4LUE A;  2AK5 A;  1LCK A;  2NUZ A;  2J6F A;  3VRY A;  2HSP A;  2RNA A;  1WLP B;  1GBQ A;  5HCK A;  1J3T A;  2V1Q A;  3EG3 A;  2L3S A;  2DA9 A;  2K2M A;  2KT8 A;  4AFS C;  3M0R A;  4RTX A;  2ROT A;  2ENM A;  2KYB A;  3I5S A;  1W1F A;  2RQU A;  1GFD A;  4A63 B;  2O9S A;  2A28 A;  2E5K A;  2C0I A;  4OMQ A;  4RTY A;  1I1J A;  3M0Q A;  1UGV A;  2LQN A;  1YP5 A;  2CT4 A;  1ZUY A;  2YT6 A;  1T3L A;  4JZ3 A;  2DVJ A;  1WX6 A;  2K79 A;  1JQQ A;  3NHN A;  4J9E A;  4AFZ C;  3O5Z A;  1M30 A;  3UA7 A;  1K9A A;  2FRW A;  1HD3 A;  1WIE A;  1AOJ A;  1X6B A;  2L3P A;  3I35 A;  2EGA A;  2LNH B;  1K0S A;  2JS2 A;  2LJ0 A;  1OPK A;  1Z9Q A;  2A37 A;  1JEG A;  3PVQ A;  2KYM A;  1WI7 A;  2EGC A;  2HBW A;  2D8H A;  1Z9Z A;  4CC2 A;  4J9G A;  3EHQ A;  2EVR A;  1AZG B;  2JM9 A;  2DMO A;  2X3W D;  1K4U S;  2EKH A;  1AWJ A;  2W10 A;  2ED0 A;  2RQR A;  4HVU A;  1JU5 C;  1NEG A;  2SEM A;  2VKN A;  2ECZ A;  4HCK A;  1NYF A;  2D0N A;  1AZE A;  1VYV A;  3VS2 A;  1BB9 A;  3TVT A;  1M3C A;  1X2Q A;  1MV0 B;  2ABL A;  1QWF A;  4WCI A;  4F14 A;  2F2X A;  2CT3 A;  2KBT A;  4X1V A;  3M0P A;  1VA7 A;  1BU1 A;  3KFV A;  4RTV A;  4RTZ A;  2K7A A;  2SRC A;  1NYG A;  2EQI A;  2KXC A;  1T0J A;  1SRL A;  4AG1 C;  2VWF A;  1B3Q A;  2KT1 A;  2AZV A;  4QT7 A;  4J9F A;  1IO6 A;  1ARK A;  3NMZ C;  1SHF A;  1WFW A;  1CKA A;  2FRY A;  2FPD A;  2YUQ A;  2KRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...