3EG0A

Crystal structure of the n114t mutant of abl-sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
b'NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSTYITPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
molecule tags Transferase
source organism Homo sapiens
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
total genus 12
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg0A00
5FWBA 3RNJA 3A98A 1PWTA 1YCSB 5HCKA 1T0HA 2D1XA 2LQWA 4ORZA 2O88A 1GCQC 1UGVA 1XOVA 4M4ZA 3VRZA 2EPDA 1X2KA 2PNIA 4HXJA 2JMCA 3H0HA 4D8DA 3C0CA 1JXOA 2DRKA 2JT4A 2EBPA 5IHIA 2KRMA 3I5SA 2FG0A 3M0TA 3QWYA 1T3SA 4LN2A 1W1FA 2KBTA 1MUZA 1UUEA 1OEBA 3ZL7C 3VS7A 1RLPC 1BK2A 1M3CA 1TUDA 2EGEA 2DM1A 1U06A 1Y57A 1JEGA 2V1RA 2E5KA 2J7IA 1OOTA 3NHNA 4FSSA 1KIKA 2C0IA 1KSWA 1AWJA 2OJ2A 2RPNA 3PVQA 1NEGA 1FMKA 5IHNA 2RQUA 2LJ0A 1MV3A 1OPKA 2KXCA 1NYGA 3PE0A 2HEQA 1IO6A 2DL7A 1T3LA 2CUDA 1PHTA 1AZGB 1G2BA 2O31A 2F2VA 2CH4A 1SHGA 2MIOA 2A36A 2BTTA 2AK5A 1SEMA 1YWOA 2YUNA 1AVZC 1ZBJA 2SRCA 2P4RA 2KGTA 1B3QA 2DF6A 1PKSA 5L23A 4AFUC 2DMOA 2K3BA 5ECAA 2C0TA 1WXUA 1AWWA 1H92A 1JU5C 2EGCA 1CKBA 1S1NA 4OMMA 5GJVB 4AFQC 1AWOA 4OMPA 2AKLA 1V1CA 2M51A 1PRLC 3VRYA 1GL5A 4CC3A 4ZNXA 4DEXA 4LNPA 1TG0A 2NUZA 2HCKA 2YSQA 5GJWB 3VS1A 2L0AA 1UE9A 3IQLA 1JO8A 2FO0A 1AZEA 3M0UA 2LQNA 4RTYA 2KEAA 2ED1A 2KRNA 2L3SA 3UA7A 1PKTA 1WIEA 2ROLA 4IIOA 2JMAA 4J9EA 2BZXA 3NGPA 1QLYA 2GGRA 1ABOA 2X3WD 2L2PA 1UTIA 2D8HA 2RMOA 2JS0A 2FPFA 2YUOA 1AOJA 4AG2C 1CKAA 4CC2A 4DEYA 4GLMA 3VS5A 5I11A 3M0QA 2RF0A 3I5RA 1SRMA 2EYWA 2CH4W 4J9FA 2KT8A 1UJYA 2RNAA 2F2XA 2KRSA 3VS6A 2FPEA 3REBB 3NPFA 1MV0B 2GNCA 3I35A 1WFWA 2VVKA 2VWFA 4AG1C 2DBMA 1UHFA 1NLOC 1UECA 1UDLA 1H3HA 3THKA 2EYZA 3EG1A 2O2OA 1LCKA 2J06A 1GFDA 1K76A 1W70A 1QKXA 1NM7A 1U3OA 2RQVA 3VS2A 4RTWA 1K0XA 1UG1A 1GCPA 1HJDA 1OPLA 1K4US 4F14A 1I0CA 2LCSA 2D0NA 1WX6A 2AZVA 2HSPA 2DL3A 4J9IA 4A63B 1UFFA 1K1ZA 2CSIA 2ENMA 1ARKA 1X43A 2DL4A 1M3BA 2EGAA 2ROTA 5I22A 1X6GA 2J6KA 2J6OA 4RTVA 3EHQA 4QT7A 1FYNA 4J9GA 4CC7A 4F17A 1NLPC 3UF4A 1YWPA 1SRLA 2EYYA 1KJWA 2DRMA 1QKWA 3NMZC 3EG2A 1ZX6A 2M0YA 3JV3A 1AEYA 4HVUA 2LJ3A 2JW4A 4Z89A 3GBQA 3M0RA 1QWEA 2DILA 4OMQA 2NWMA 3VS4A 2KR3A 4Z88A 2DYBA 2OI3A 4EIKA 2HBWA 2CT3A 1M30A 1YNZA 1TUCA 1YP5A 1E7OA 5FWCA 3EGUA 4LUEA 4J9DA 2J05A 4X1VA 3H41A 2KNBB 1UJ0A 2GBQA 2GTJA 1PRMC 3REAB 2CDTA 2EYXA 1JXMA 4AFSC 2KYMA 1RUWA 2CREA 4RTTA 1NG2A 2ESWA 3KFVA 1GRIA 2D8JA 1T0JA 2FRYA 2L3PA 4D8KA 3VS3A 1GFCA 3PVLA 1ABQA 2YUQA 1I07A 4HVWA 1M27C 2K9GA 2JTEA 2MCNA 2CT4A 4JJDA 4OMLA 2O9VA 4LE9A 3ULRB 2KE9A 2CSQA 2FRWA 2YDLA 1VYVA 2LX7A 3CQTA 3SEMA 1WXBA 2K2MA 1U5SA 2EKHA 2YUPA 4RTZA 2FEIA 3M0PA 5FW9A 1OV3A 2LMJA 1AD5A 1Y0MA 4J9BA 1QCFA 1AWXA 2BZ8A 4OMNA 3O5ZA 1Z9ZA 4LUDA 5IXBA 1J3TA 1ZSGA 2DL5A 3SHWA 2KXDA 2EQIA 1H8KA 4JJCA 4RTUA 4ESRA 4JZ4A 2ABLA 2DLPA 4JPBW 4Z8AA 2LNHB 3TSWA 1W6XA 5IH2A 3R6NA 3U23A 1Z9QA 1GBQA 1QWFA 2FPDA 1UHCA 4HVVA 2ECZA 2AKKA 1B07A 2LJ1A 2I0NA 2RQTA 2PTKA 2H8HA 1BBZA 1ZUYA 1RLQC 2SEMA 1VYUA 1K0SA 1EFNA 2B86A 3H0IA 3M0SA 2KT1A 1WI7A 2A28A 2MOXA 4Y92A 4F16A 1RI9A 4RUGA 2DE0X 1X2QA 5EC7A 2JS2A 2YT6A 3EHRA 4RTXA 2F2WA 3LH5A 4WCIA 1ZUUA 2EVRA 2JXBA 2RQRA 2VKNA 2K6DA 3I9QA 1WXTA 1BU1A 3EG3A 3H0FA 2AZSA 1ZUKA 2A37A 2LZ6B 2DX1A 5IHKA 2DVJA 2HDAA 2RN8A 1WDXA 1KFZA 3TVTA 3EG0A 4GBQA 1GCQA 2C0OA 2RQWA 3UA6A 1I1JA 2K79A 2A08A 2K7AA 4J9HA 1M3AA 2DJQA 1BB9A 1E6HA 2GTOA 1HSQA 1WYXA 1N5ZA 1WLPB 1ZLMA 2CUBA 2L3QA 1NEBA 2PZ1A 1X6BA 1GBRA 2DA9A 2V1QA 1SPKA 1VA7A 2OAWA 2JM8A 2IIMA 4IIMA 1M8MA 4HCKA 4J9CA 3RBBB 2X3XD 1A0NB 2DL8A 1SHFA 2KYBA 1VYTA 3VS0A 3TSZA 1SSHA 1HD3A 2G6FX 3QWXX 2BZYA 1G83A 2LP5A 4OMOA 1YN8A 4K11A 1X27A 2KROA 2O9SA 5IXFA 2W0ZA 1NYFA 2W10A 1E6GA 1JQQA 1X69A 2JM9A 2DBKA 1K9AA 1PNJA 4JJBA 2EW3A 4AFZC 2XMFA 2DNUA 3FJ5A 4CC4B 2GQIA 4KRTA 2QDLA 1CSKA 2ED0A 4E6RA 4R0KA 4JZ3A 3UATA 2J6FA 1WA7A
chains in the Genus database with same CATH superfamily
5FWBA 2VUBA 2P0KA 2WSFE 3NTHA 4BI3A 4C8QC 1W4SA 5I21A 2LQ8A 4ZN1A 2X4XA 3CCLT 1T0HA 1IB8A 3WXMB 1OU8A 1X2KA 2CKKA 3H0HA 4D8DA 2LVMA 4XU0A 5IHIA 3M55A 1PM3A 2FG0A 3M0TA 4LN2A 4OGEA 3EAEA 2BUDA 1D09B 1W1FA 3VS7A 3MP8A 3CCQQ 4MDWA 1OI1A 4RKUE 3OQ5A 1TUDA 2EGEA 1U06A 2I2LA 1JEGA 3WVDB 1OULA 5CKHA 3FEOA 2C0IA 3VJPA 4J5YA 5D6YA 1VQMT 4PJJA 1JJ2A 1M2OA 4MZPA 1KD1C 2X9HA 4L6V5 2LJ0A 2QAZA 2HKNA 4KUIA 1PD1A 4LDVA 2HEQA 1JJ2S 1H641 5KYUB 1G2BA 1G3TA 2O31A 2RI2A 2DXUA 3SWNB 2AK5A 1YWOA 1VIFA 1AVZC 1Q81R 3OS0A 3HTRA 3SFMA 2LDMA 3QBYA 3UWNA 5ECAA 4N0AA 5GANg 4ZGEB 3EH1A 1TUGB 4OB0B 1YJWQ 4KGVB 1H92A 1S1NA 4QKUA 5GJVB 2L8DA 1HYOA 4LXCA 2AKLA 2M51A 1VQ6A 3VRYA 2QGGA 3A8GB 3X28B 3JCMb 4DEXA 2NUZA 4ZGDB 2A0FB 1SG5A 4BE1A 3IQLA 4NL3A 1AZEA 3OW2P 4A53A 2MWPA 4J7IA 3CPWA 2L3SA 3L2VA 1D1AA 4IIOA 2JMAA 3QUIA 3MKDA 3QXEB 4E7IA 2DIQA 4M77F 2L2PA 2ZAEA 2LT4A 1UTIA 2ZPBB 1SSFA 2XHCA 5CKEA 3VYGA 1JBMA 2QQ9A 3DB4A 4GLMA 3RERA 1D0ZA 3M0QA 4J7FA 2K2VA 1Q82R 5GANh 3FJPA 4XTYA 2F2XA 2RNAA 2M16A 2E70A 2QEXA 3CCMQ 3X24B 2FPEA 4XAXB 2VVKA 2VASA 3LX7A 4QVZA 1HK9A 3QG1A 4JRIA 1NLOC 4J83A 3THKA 1WHKA 2D9TA 4RCCA 2DZ9A 4C5IA 3QSUA 2J06A 1GFDA 1W70A 1Q81U 3GNFB 3QO3A 2XKOC 3HRTA 2QEXT 3EFSA 1NM7A 2BE9B 4XQ3A 2HZYA 3RKXA 5FU7B 1HJDA 3L2WA 2LCSA 2D0NA 3RIRA 1UGRB 3H6ZA 1B34B 4M7AD 3CC7Q 4R55A 1C1AA 4OF1A 2DEUA 4HT8A 3CCST 2KK4A 4M75E 2EGAA 2E65A 1X6GA 2RH2A 2OAUA 2MF2A 4RTVA 5GMKe 4J6YA 5J3BA 4J9GA 2DTOA 3KBGA 4F17A 2VGMA 1SRLA 2DO3A 1UGQB 5GAMh 3CCSA 3CBOA 1AEYA 4M78B 4FYXB 4C0GA 1QWEA 2DILA 1G3WA 3SWNC 1RAIB 3VS4A 2DYBA 1Q7YU 4M7AA 1YJWT 1RADB 4EMKC 3VYHB 1ZHIA 1BIAA 1KHCA 4C92G 4EMKB 5M9OA 5FWCA 4KH0B 3SWNA 3FRNA 4NOYA 5GAMe 2HMAA 4X1VA 3M58A 3V7SA 5GAN6 4JS4A 4IURA 4E47A 3L2QA 1UJ0A 3JSCA 2GTJA 1YJWA 5GAOm 1IGQA 4PJLA 3OMCA 1BI1A 2CREA 1VQNQ 3QDRB 4PFZA 4PJOD 4E7SA 1KC8U 3PVLA 1NPPA 3OY9A 1I07A 4HVWA 3CCEQ 1BI2A 4JJDA 2GFAA 4OMLA 2RA2A 3BDLA 2O9VA 5KYYB 1VQLT 2JNGA 2CSQA 4CRIA 4RTZA 3LLRA 2DD5A 3M0PA 5FW9A 5LJ3d 1AWXA 2BZ8A 4BDZA 1Z9ZA 4LUDA 2EKOA 4C8QB 1J3TA 3SHWA 2JTFA 3V8JA 1YCYA 4PJOF 1I5LA 5LJ3f 1VQLA 4BE0A 1N9RA 2ABLA 2DLPA 4QW2A 3QKJA 4X34A 4DQ2A 3R6NA 3U23A 3P8DA 2ECZA 1M9SA 2AKKA 4C8QD 1Y96A 5CQYA 4M75D 2RK1A 2H8HA 5CK9A 4B9XA 1BBZA 4C0ZA 4Z02A 1SKUB 1ZUYA 2RJFA 1RLQC 1EFNA 4C5GA 3M0SA 1JJ2P 4MMLA 2C06A 1TWBA 2KT1A 3EFOA 1G8XA 2DTHA 2HQHA 3CCEA 2DE0X 1X2QA 1I81A 4XU2A 1QCOA 3QPHA 2VKNA 5J39A 3JB9D 2RJDA 4C0DB 4EMGA 5CQXA 2AZSA 1ZUKA 2DX1A 1PCXA 1PG5B 5IHKA 4DA4A 5A0GA 4II1A 3RMSA 1D3BB 1YI2A 1GCQA 2C0OA 1VQ5A 3JCMW 2DPPB 2O01E 2CYZB 2P4TA 2QA4Q 2EQUA 1KK7A 5LL6S 1M3AA 1WHHA 1E6HA 2GTOA 3JB9I 1XTDA 1XJWB 2VGNA 1O9SA 1ZLMA 2PZ1A 2CZ6B 1GBRA 2DA9A 2EQJA 1VQ5T 4M77B 1VA7A 2OAWA 2RJEA 2MYSA 4OB1B 5GAOn 1M1KC 1MMNA 1Q82U 1RACB 3JB9F 1W2BP 2DL8A 3OBWA 1FX7A 1VYTA 3VS0A 1F1BB 3CCUQ 3KXTA 2XDDA 2G6FX 3BE3A 1G83A 1X27A 3OYLA 2GF7A 3S3MA 1IRXA 1NYFA 2W10A 5CCAA 3X26B 2IPOB 2WSEE 2JM9A 1K9AA 4LDXA 1WJRA 2DXBA 2XMFA 5IN1A 1S72Q 2QDLA 2HQXA 2X51A 1M1GA 1WA7A 1KC8R 1WZOA 5HCKA 1YCSB 2ZPGB 1GCQC 4E7LA 1UGVA 1XOVA 1Q7YR 2F1LA 3VRZA 5FU6B 3QJYA 4WTOB 2HKQB 2JMCA 2EBPA 1W2BA 2XU8A 3TQ7P 3KUFA 4KULA 2KBTA 5GAMg 1OEBA 2COYA 4PK4A 3G6EQ 1RAGB 4OB2B 1BK2A 1JRIA 4QQ6A 5LJ3e 1ZSZB 3M54A 1IXDA 2DXTA 4BY6B 2J7IA 3CC7A 3NHNA 1KIKA 2DFUA 1AWJA 1KQ1A 2GQVA 2JZ2A 1QVGP 3CCRA 1Q82C 3CMEQ 1YITA 3OS2A 5IT9E 3MPUB 2VXFA 4M7DG 2E64A 1OPKA 1NYGA 5LJ3h 4R56A 1ZBXA 2AIRB 2QK0A 2QASA 2DL7A 1X6OA 4FW2A 4C0FA 3MJXA 3CCRT 4QVDA 1YITT 2LNVA 4ANJA 3JB9J 3LH0A 3OS5A 4XU3A 4XTUA 1YITQ 4O5VA 3CPFA 1ZBJA 1OZ3A 4FYVB 3EGXA 3A8LB 5L23A 2C0TA 2QQSA 1AWWA 5I2MA 1CKBA 3S3OA 4OMMA 4AFQC 3HHTB 1VIEA 4FW1A 5L8RE 1QP3A 5CVIA 4E7KA 3OYIA 3VS1A 1WPYA 2HCKA 1UE9A 4LDWA 2FVUA 1JO8A 1WHGA 5A0DA 2LQNA 5FLXE 4A4GA 1C6VX 3M56A 3TCJA 2ED1A 2KRNA 4FSXA 1QP2A 1Q86C 1WIEA 2ROLA 4M7DF 3OSSC 1MMAA 2GGRA 1M2VA 1VQKQ 4FM4B 2RMOA 1N6AA 3OS1A 4JS5A 2YUOA 3JRZA 1KQSS 1YI2Q 1AOJA 4AG2C 2MK5A 1CKAA 3VS5A 3I5RA 1SRMA 4DOWA 2K5IA 1UJYA 2KRSA 3VS6A 4IKFA 2KVQG 3CMAQ 2DYIA 3NPFA 1MV0B 2GNCA 4BI4A 1WFWA 3QZ9B 4AG1C 3G6EA 1FMVA 2DBMA 3VKIA 2IVWA 1UECA 3H8ZA 1ZSZA 2QGFB 4M7DD 1LJOA 4JRQA 3D7SB 5KYWB 3CCJQ 1U3OA 4M7DC 4E7ZA 4RTWA 3G6ET 4F7UA 4MZTA 1UG1A 3JCMg 3BFMA 4FT2A 2DL3A 4M7AG 1K8AC 1K1ZA 2ENMA 5CAIA 3R6OA 4IUVA 1X43A 2EAYA 5I22A 2ROTA 1VQOQ 2J6KA 4C5HA 4A54A 1LNXA 3A8MB 2J6OA 2KAFA 3L2RA 1S72A 4F7UB 1FYNA 1VQ5Q 2R57A 4CC7A 1N8RR 1NLPC 5KE3A 3MP1A 3FIFA 2V8KA 3L2UA 1QKWA 2XICA 3J7AF 4DBHA 5A2QE 2LJ3A 1WJSA 1ZA2B 4CI0C 2JW4A 2P0QA 1YHQQ 1Q86U 4OMQA 1S72T 4HT9A 3A5ZB 1YJ9T 2KR3A 3J80E 2OI3A 2HBWA 2PU9B 2QG9B 1Y96B 1YHQA 1TUCA 1YP5A 2P84A 2ZPIB 1YFNA 1VQKT 2J05A 2RM4A 5LJ5j 4BY6C 3RUXA 1YJ9A 1R8OB 5KE2A 2GBQA 4M7DE 2X4JA 2CDTA 5KH6A 3OYKA 2KYMA 1RUWA 4RTTA 1NG2A 2ESWA 3KFVA 1GRIA 1VQLQ 1VQ4A 3CC2T 1VQKA 1T0JA 2FRYA 1W2BS 4M7AB 3RR6A 2EJFA 2LX9A 1GFCA 4XTXA 2K5LA 1ABQA 2YUQA 3SD4A 2E12A 5KYYA 5DM7R 2K9GA 3M4GA 2LT1A 1NE8A 2JTEA 3GP8A 4FCYA 1R77A 1M5Q1 1PSFA 3CMAT 2CP2A 1R0BG 2LQKA 2CT4A 1NPRA 4LE9A 3ULRB 3PIPA 2KE9A 4KT0E 1VYVA 1KD1R 3JAME 3HSBA 2E5QA 2K2MA 2YLBA 3CCSQ 1K9MR 1QVGS 1M4ZA 2LMJA 3ZBDA 4J9BA 3O5ZA 5IXBA 1N8RU 3FDRA 2DL5A 3CMAA 4IUUA 4N4HA 3NFCA 2Y4YA 4C92E 4ESRA 4JZ4A 4JPBW 1M90R 3X20B 1Q81C 3HKSA 1H3ZA 2HQEA 5D6WA 1Z9QA 1VQPA 4HCCA 1GBQA 4KUDK 2DKGA 1UHCA 2MI6A 3CCET 3HPWA 1ZQ1A 1B07A 4UC4A 3DLMA 3LGFA 2I0NA 4LDUA 2PTKA 1BCMA 2EQMA 1Y71A 4D6WA 5D6XA 5GMKh 2YXYA 2VB6A 1NJIC 3H0IA 3PIOA 1GXIE 1RL2A 1WI7A 1R0CB 2A28A 2DJZA 1VQPT 1RI9A 1SF9A 1FXXA 1X75C 1QQJA 1BI0A 1PSEA 5I2SA 2YT6A 2F2WA 4C92D 1NJIR 1V29B 2OTJQ 1YI2T 1ZUUA 2EVRA 2JXBA 1WQ7A 2K5FA 2QTXA 3CXCA 2X4WA 3JB9G 5KYXB 3I56Q 3M4YA 3BDUA 1WGSA 4M77G 5GAN2 3I9QA 4ZN3A 1KHIA 4PFOA 2JN0A 2DVJA 2HDAA 1WDXA 4BD3A 3VV0A 1BKBA 3PMTA 4NL2A 1YIJT 3BW1A 2JTMA 3EG0A 3FB9A 2RQWA 3UA6A 5GAN7 4PJOB 1U1TA 5CIUA 2A08A 3VU3C 4J9HA 3OYJA 2DJQA 2L89A 3MEUA 3RDVA 2XD0A 4C92A 1N5ZA 2CUBA 3OYBA 4QQDA 2E3IA 4VUBA 1QVFA 2FYKA 2JM8A 1KG1A 1TSFA 2K3YA 4ELYC 1MMGA 1TXQA 4J9CA 5FRNA 2X3XD 2Y4XA 4XTWA 3EG9B 2MAMA 3GF5A 4F7UE 1MGQA 1DJ7B 2FZGB 2KYBA 1WNLA 2DXCA 3TSZA 2CZ0B 3OYNA 3CCRQ 1V76A 3QWXX 4EMHA 1VQ8Q 2KROA 2QEXQ 1MNEA 4JJBA 4FT4A 5KYNA 2DNUA 3DKMA 4C8QG 1NJIU 4CC4B 4JZ3A 1WHMA 3PGGA 1N9SA 3RNJA 5KCHA 4ATOA 3MEWA 4IUPA 2D1XA 2O88A 3A8HB 4A4KA 1HXDA 4M4ZA 4QQGA 1YJNT 4MMKA 2EPDA 4HXJA 2PNIA 3O8VA 2DRKA 5GAMd 1D3BA 3MO8A 3I5SA 3QWYA 3CC7T 2JOYA 3QJ6A 1LVKA 1TU0B 3M9QA 1Q86R 2A7YA 1D1CA 1MUZA 1UUEA 1NBEB 1VQ6Q 1YJNA 3L2ZA 4JDSA 1YJ9Q 2DM1A 2OX7A 3LWIA 7AT1B 4M78D 1Y57A 3E1SA 4BE2A 3RESA 2L3RA 1ZSZC 2V1RA 3DLLA 2E5KA 3EGDA 2A3LA 2WSCE 2E6NA 2OTLA 3CCUA 1KSWA 2OJ2A 4RG8A 1D1BA 2CP6A 2DERA 3PVQA 3CXCS 5IHNA 1MNDA 2PVOB 1AHJB 2E6ZA 2YRDA 1QVFP 3CBMA 3PE0A 2LCLA 4C92B 3LYIA 2OTLT 1VQOT 1PHTA 3S6WA 2KQWA 2F2VA 1SHGA 2PVGB 4MDXA 1OX9A 4M75A 2BE7D 2K3XA 4C8QA 2P4RA 1RAHB 2ZZDA 4PLIA 1B3QA 4AFUC 2K3BA 1M1KU 1Q95G 1WXUA 1JU5C 2EGCA 1AT1B 1AWOA 4KGXB 2VYTA 3TEEA 4ME7A 8AT1B 2AT1B 3A8OB 1PRLC 1QW1A 3OYHA 4CC3A 5DLOA 2GFUA 2KI7A 5GJWB 3L1AA 5CKBA 2ATCB 2RHUA 3META 3M0UA 1BYMA 2QQBA 4RTYA 4JUVA 2KEAA 2CZ1B 1PKTA 3V7CA 2JJ9A 2CZ7B 1QLYA 2X3WD 3RKYA 2D8HA 2E3HA 2O4XB 3MHXA 4LD9K 2NUTB 2FPFA 4PJOC 3V7RA 3UPUA 1M8VA 2QYZA 4PFPA 2L5QA 3P8HA 4LD6A 4P5NA 5FROA 2RF0A 4RMOA 2G3RA 4N4IA 4EMKA 2EYWA 2CH4W 4PJOG 4F7UG 2RD1A 1KD1U 4C8QE 3REBB 1WJQA 1TH7A 1UHFA 3AHUA 3LWHA 1UDLA 2E10A 1H3HA 1VQMQ 3S3NA 2YHTA 4B9WA 5LJ5g 2O2OA 1K76A 2V26A 1VQNT 5A0LA 3HFOA 2O4XA 3GLXA 1K0XA 2NYSA 1K4US 1GCPA 2EYQA 1I0CA 2F5TX 2AZVA 2HSPA 4A63B 4M7AE 3JCMQ 5GMKi 1ARKA 2KMTA 1VQNA 2HNIA 3E9FA 2DTIA 4QT7A 1K73U 2NLUA 3JCMe 4TVRA 3CCLQ 1QMCA 4BI8B 2DETA 2YRCA 2DRMA 3CBPA 3CMET 3NMZC 1YHQT 3EG2A 1MMDA 3JV3A 4HKEA 3V8KA 4AMCA 4HA8A 2DVEA 4C92C 2FZKB 3GBQA 3M0RA 1OX8A 6AT1B 5GMKm 3OW2S 2NWMA 4Z88A 4EIKA 2CT3A 3CMEA 4A4FA 3JCMJ 3LW5E 5FU6C 4LDYA 1E7OA 4OB3B 1C0MA 2WACA 1VQ7Q 1VQ9Q 1VQ4T 3CC2A 4HCZA 2B8AA 2KNBB 3PNWC 3N5BB 1PRMC 2Z0WA 2E1HA 3M5AA 2E41A 3VUZA 2D8JA 3E2UA 1MHNA 2L3PA 1OU9A 4D8KA 4QVCA 3VS3A 2M1HA 2CGHA 3HP9A 1M27C 2YLCA 3EGXB 5J26A 4E7JA 2XI9A 5GAMf 3PTAA 1RAFB 3BY7A 3CQTA 3SEMA 2LTOA 3EGDB 4OGCA 2EKHA 2YUPA 3GOXA 1M2VB 4BACA 1OV3A 2FB7A 2KDSA 3M57A 1AD5A 1Y0MA 3C95A 4M77C 3CC4T 3CXCP 5GAOq 3PMIA 2KXDA 4V2SA 3JCMX 2EQIA 1OQKA 4FL6A 2PUOB 4JJCA 4M77D 3HRUA 2LNHB 3TSWA 1UB4A 5LJ5h 2MMPA 3ZFJA 5IH2A 2QI2A 1QWFA 2M9UA 1UGPB 4HVVA 1EX4A 3M53A 2CP0A 5C6SA 2LJ1A 4PJOA 1PD0A 1Q7YC 3QHSA 5GANj 1VYUA 1K0SA 1XQHA 3E19A 1YBYA 5IAYA 4XTVA 4Y92A 4F16A 3E9GA 5LJ5e 4XK8E 3I55Q 5EC7A 2JS2A 4XTZA 3LH5A 4DOVA 2DD4A 5GANe 4RG2A 1YIJA 2RI3A 1VQ8T 4N4GA 2K6DA 3QZ5B 2QA4A 5GANd 3GNGA 3H0FA 3SB2A 1VQ7T 2LZ6B 1D0YA 3CC4Q 4O6JA 4A4EA 4DBFA 4F04B 2RN8A 4FU6A 3JCMf 4M7AF 3G71A 3CCMA 3QYGB 1G3YA 2EQKA 2CP3A 2K7AA 3C12A 4HCBA 4ZTJA 2R5AA 1HSQA 3OYDA 1BIBA 4FIBA 3JCMc 5GANf 4GLKA 4KBMB 3C4SA 3G71T 3CCMT 2V1QA 4IIMA 4HCKA 2PUKB 2LCCA 3OYFA 3OW2A 1YIJQ 1A0NB 1M1FA 3Q1JA 3GIBA 3T9NA 3I55A 5KYUA 5FRMA 5GAN5 2QTVA 4Y28E 1HD3A 2HBPA 4PNOA 1NZ9A 4OMOA 3I56T 1YN8A 4K11A 2O9SA 5IXFA 1KQSA 1E6GA 1K8AR 3CPWS 2CS7A 2RB6A 2RHYA 1X69A 2X35A 3I55T 2DBKA 2M02A 3ZEHA 3RMQA 2RHZA 3CCQA 2CP5A 1P92A 2GQIA 3TREA 4KRTA 3OYGA 5LJ5d 2ED0A 5GAN4 4R0KA 3FC3A 3I56A 4A4HA 2HL5C 3UATA 2J6FA 1QVFS 1N8RC 2QQRA 3A98A 1PWTA 4BDYA 4M75C 3X25B 2NUTA 2LQWA 4ORZA 3CCQT 3OYAA 1D0XA 1IREB 4ZTFA 5HKCA 3P8BB 3CCVT 3C0CA 1JXOA 2JT4A 2PQWA 3PFSA 2KRMA 3F70A 1EZZB 4PJMA 4PJNA 4Y91A 1T3SA 4FYWB 3CCUT 3CCLA 4M78C 4PKCC 1RI0A 3HL8A 3ZL7C 2AHJB 2ZGWA 1RLPC 1IHVA 1M3CA 5CKFA 3V8LA 1I5OB 1IHWA 5C0MA 5GMKl 1OOTA 4NS5A 4FSSA 1VQOA 3CD6Q 4XU1A 2RPNA 3MP6A 2VC8A 4DBQA 5LJ3j 2FZCB 5DLQE 1NEGA 1BI3A 5LJ5f 3CD6T 2DEQA 4GY5A 4RCBA 1FMKA 4C8QF 2E4HA 2RQUA 3SDZA 3URGA 4M75B 4M75F 1MV3A 3CC2Q 3UT1A 2KXCA 1K73C 3ER0A 1RAEB 4C5EA 1IO6A 1QVPA 1T3LA 3EFRA 2CUDA 1VQMA 1AZGB 5GAOl 2R5MA 4BUGA 2RK2A 1M1KR 2CH4A 2BKDN 2MIOA 2A36A 4PLLA 2BTTA 3CD6A 1SEMA 2YUNA 1JB0E 1VQ4Q 1K9MC 2EWNA 2SRCA 1O75A 2KGTA 3NTIA 1K8AU 2DF6A 1PKSA 1WQWA 2XDPA 2DMOA 5CO7A 4B6MA 4M7DA 5GAOr 4JJNK 2PVDB 4OMPA 1V1CA 3OYCA 1M90C 1GL5A 2Y90A 5GAN3 1U1SA 4ZNXA 4LNPA 4M7DB 1TG0A 2YSQA 1IZ6A 2HD0A 1KQ2A 2XIDA 2L0AA 3HRSA 3CPWP 2YWWA 2FO0A 4DBRA 3MEVA 4N0AC 3J81E 3UA7A 8ATCB 1VQ6T 1KC8C 1BCOA 1UEBA 2JUFA 2K57A 4J6WA 4J9EA 2BZXA 3NGPA 4M78E 4OVAA 1ABOA 4L5GA 2JS0A 5KCOA 3NTKA 2ZPEB 1YJNQ 3AT1B 4CC2A 4DEYA 5I11A 3CCJT 4M78A 4JRKA 4M78G 4J9FA 3OYEA 2KT8A 4F7UF 1Y7XA 1LOJA 3MCAB 3OA6A 3I35A 3G7ZA 2VWFA 2CP7A 1FWZA 2EYZA 4C92F 1QCNA 3CCJA 3EG1A 4WF2A 4AT1B 2M0OA 1LCKA 3LGLA 1XNIA 3ASKA 1QKXA 1B34A 3JB9H 2RQVA 3VS2A 5CKDA 1OPLA 4F14A 5AYFA 1WX6A 2JVVA 5GMKj 4J9IA 1UFFA 2BIVA 5HK0A 2CSIA 4L59A 2V8IA 2KSSA 1UGSB 2DL4A 1M3BA 5GAOp 2RHXA 2HL3A 4M7AC 2FL7A 3EHQA 1TS9A 2MWOA 3EG9A 1KQSP 4BB7A 3G71Q 3H9NA 3UF4A 1YWPA 2DZCA 4ELZC 3FLGA 2EYYA 1KJWA 3A1PA 1I8FA 1TOVA 1ZX6A 2M0YA 1N27A 1G5VA 3G4SQ 4HVUA 2VXEA 4Z89A 3VUBA 3OMGA 4JLGA 5HK3A 5GAMj 4J6XA 1M30A 2ZCFB 1YNZA 4J8OA 2V8JA 3INZA 2DIGA 2EJGA 3EGUA 4LUEA 3JCMV 3G1JA 1PC0A 3RKWA 4J9DA 2RHIA 3H41A 3GPLA 2MPXC 3REAB 2ZPHB 3TU4K 2EYXA 3MEAA 1JXMA 5KYXA 4AFSC 3PT9A 2OTLQ 1LPLA 2XK0A 4IUQA 3QYHB 3OYMA 2P0PA 5HY6A 1TTHB 4ZGJB 2MCNA 3CC4A 1ZA1B 2FRWA 5GAN8 2YDLA 4MZMA 2EJ9A 2LX7A 2D6FA 1WXBA 1U5SA 2COZA 2FEIA 3JCMd 4E2FB 2YRVA 3UDCA 1QCFA 4OMNA 2IG0A 1X01A 1ZSGA 3JCMh 3DB3A 2QDYB 4M77E 4M78F 2D0QB 3OYYA 1RABB 1H8KA 4RTUA 2RO0A 2RI5A 4YTLA 3G4SA 3OSVA 1Y07A 2VV5A 2DK3A 4Z8AA 2RJCA 1W6XA 3JCMP 2FPDA 2EFIA 2RQTA 3WVEB 3EH2A 3L42A 4Q5WA 4E7HA 1VQ8A 2SEMA 3G4ST 1I4K1 2B86A 1QVGA 2QA4T 2F5KA 9ATCB 1VQ7A 2MOXA 1EIFA 4RUGA 1WHLA 5AT1B 1IGUA 2XG8D 1WHJA 3EHRA 4RTXA 2HAXA 4WCIA 4IUTA 2RQRA 2F69A 1OYXA 1FMWA 1WXTA 2H3JA 1BU1A 3EG3A 2EIFA 4JRPA 2A37A 3QIIA 3EFOB 3CCVQ 1KFZA 3ME9A 2HSEB 4OP0A 4PL6A 3TVTA 4GBQA 2R58A 1I1JA 2DAQA 2K4YA 2NUPB 5CR2A 2K79A 4KGZB 2LC4A 4EDUA 1B7TA 4X9DA 3OBYA 4C0DC 1BB9A 1RAAB 5FU7C 1WYXA 1ACMB 4JLIA 1WLPB 2L3QA 1K9MU 3QDFA 4M77A 4EPCA 1NEBA 1X6BA 2GCXA 3C94A 3CEYA 3HFNA 1SPKA 2X4YA 5DY9A 4M75G 4PJOE 2IIMA 4FYYB 1M8MA 1VQ9A 3RBBB 2KY9A 2OTJA 1SHFA 1M90U 4X9CA 2ZPFB 2COWA 1OZ2A 1K73R 3M59A 1SSHA 2QQAA 2QXFA 1VQ9T 2BZYA 2LP5A 1VOMA 2H3EB 2W0ZA 5LJ3g 1U8RA 2OTJT 1JQQA 2LRQA 1G3SA 2FHDA 1PNJA 2EW3A 4AFZC 5EG2A 1VQPQ 2XDBA 5KYWA 4OMFB 5D7UA 3FJ5A 3OB9A 1VUBA 1CSKA 2NUPA 4E6RA 3CCVA 4KH1B
chains in the Genus database with same CATH topology
5FWBA 3RNJA 3A98A 1PWTA 1YCSB 5HCKA 1T0HA 2D1XA 2LQWA 4ORZA 2O88A 1GCQC 1UGVA 1XOVA 4M4ZA 3VRZA 2EPDA 1X2KA 2PNIA 4HXJA 2JMCA 3H0HA 4D8DA 3C0CA 1JXOA 2DRKA 2JT4A 2EBPA 5IHIA 2KRMA 3I5SA 2FG0A 3M0TA 3QWYA 1T3SA 4LN2A 1W1FA 2KBTA 1MUZA 1UUEA 1OEBA 3ZL7C 3VS7A 1RLPC 1BK2A 1M3CA 1TUDA 2EGEA 2DM1A 1U06A 1Y57A 1JEGA 2V1RA 2E5KA 2J7IA 1OOTA 3NHNA 4FSSA 1KIKA 2C0IA 1KSWA 1AWJA 2OJ2A 2RPNA 3PVQA 1NEGA 1FMKA 5IHNA 2RQUA 2LJ0A 1MV3A 1OPKA 2KXCA 1NYGA 3PE0A 2HEQA 1IO6A 2DL7A 1T3LA 2CUDA 1PHTA 1AZGB 1G2BA 2O31A 2F2VA 2CH4A 1SHGA 2MIOA 2A36A 2BTTA 2AK5A 1SEMA 1YWOA 2YUNA 1AVZC 1ZBJA 2SRCA 2P4RA 2KGTA 1B3QA 2DF6A 1PKSA 5L23A 4AFUC 2DMOA 2K3BA 5ECAA 2C0TA 1WXUA 1AWWA 1H92A 1JU5C 2EGCA 1CKBA 1S1NA 4OMMA 5GJVB 4AFQC 1AWOA 4OMPA 2AKLA 1V1CA 2M51A 1PRLC 3VRYA 1GL5A 4CC3A 4ZNXA 4DEXA 4LNPA 1TG0A 2NUZA 2HCKA 2YSQA 5GJWB 3VS1A 2L0AA 1UE9A 3IQLA 1JO8A 2FO0A 1AZEA 3M0UA 2LQNA 4RTYA 2KEAA 2ED1A 2KRNA 2L3SA 3UA7A 1PKTA 1WIEA 2ROLA 4IIOA 2JMAA 4J9EA 2BZXA 3NGPA 1QLYA 2GGRA 1ABOA 2X3WD 2L2PA 1UTIA 2D8HA 2RMOA 2JS0A 2FPFA 2YUOA 1AOJA 4AG2C 1CKAA 4CC2A 4DEYA 4GLMA 3VS5A 5I11A 3M0QA 2RF0A 3I5RA 1SRMA 2EYWA 2CH4W 4J9FA 2KT8A 1UJYA 2RNAA 2F2XA 2KRSA 3VS6A 2FPEA 3REBB 3NPFA 1MV0B 2GNCA 3I35A 1WFWA 2VVKA 2VWFA 4AG1C 2DBMA 1UHFA 1NLOC 1UECA 1UDLA 1H3HA 3THKA 2EYZA 3EG1A 2O2OA 1LCKA 2J06A 1GFDA 1K76A 1W70A 1QKXA 1NM7A 1U3OA 2RQVA 3VS2A 4RTWA 1K0XA 1UG1A 1GCPA 1HJDA 1OPLA 1K4US 4F14A 1I0CA 2LCSA 2D0NA 1WX6A 2AZVA 2HSPA 2DL3A 4J9IA 4A63B 1UFFA 1K1ZA 2CSIA 2ENMA 1ARKA 1X43A 2DL4A 1M3BA 2EGAA 2ROTA 5I22A 1X6GA 2J6KA 2J6OA 4RTVA 3EHQA 4QT7A 1FYNA 4J9GA 4CC7A 4F17A 1NLPC 3UF4A 1YWPA 1SRLA 2EYYA 1KJWA 2DRMA 1QKWA 3NMZC 3EG2A 1ZX6A 2M0YA 3JV3A 1AEYA 4HVUA 2LJ3A 2JW4A 4Z89A 3GBQA 3M0RA 1QWEA 2DILA 4OMQA 2NWMA 3VS4A 2KR3A 4Z88A 2DYBA 2OI3A 4EIKA 2HBWA 2CT3A 1M30A 1YNZA 1TUCA 1YP5A 1E7OA 5FWCA 3EGUA 4LUEA 4J9DA 2J05A 4X1VA 3H41A 2KNBB 1UJ0A 2GBQA 2GTJA 1PRMC 3REAB 2CDTA 2EYXA 1JXMA 4AFSC 2KYMA 1RUWA 2CREA 4RTTA 1NG2A 2ESWA 3KFVA 1GRIA 2D8JA 1T0JA 2FRYA 2L3PA 4D8KA 3VS3A 1GFCA 3PVLA 1ABQA 2YUQA 1I07A 4HVWA 1M27C 2K9GA 2JTEA 2MCNA 2CT4A 4JJDA 4OMLA 2O9VA 4LE9A 3ULRB 2KE9A 2CSQA 2FRWA 2YDLA 1VYVA 2LX7A 3CQTA 3SEMA 1WXBA 2K2MA 1U5SA 2EKHA 2YUPA 4RTZA 2FEIA 3M0PA 5FW9A 1OV3A 2LMJA 1AD5A 1Y0MA 4J9BA 1QCFA 1AWXA 2BZ8A 4OMNA 3O5ZA 1Z9ZA 4LUDA 5IXBA 1J3TA 1ZSGA 2DL5A 3SHWA 2KXDA 2EQIA 1H8KA 4JJCA 4RTUA 4ESRA 4JZ4A 2ABLA 2DLPA 4JPBW 4Z8AA 2LNHB 3TSWA 1W6XA 5IH2A 3R6NA 3U23A 1Z9QA 1GBQA 1QWFA 2FPDA 1UHCA 4HVVA 2ECZA 2AKKA 1B07A 2LJ1A 2I0NA 2RQTA 2PTKA 2H8HA 1BBZA 1ZUYA 1RLQC 2SEMA 1VYUA 1K0SA 1EFNA 2B86A 3H0IA 3M0SA 2KT1A 1WI7A 2A28A 2MOXA 4Y92A 4F16A 1RI9A 4RUGA 2DE0X 1X2QA 5EC7A 2JS2A 2YT6A 3EHRA 4RTXA 2F2WA 3LH5A 4WCIA 1ZUUA 2EVRA 2JXBA 2RQRA 2VKNA 2K6DA 3I9QA 1WXTA 1BU1A 3EG3A 3H0FA 2AZSA 1ZUKA 2A37A 2LZ6B 2DX1A 5IHKA 2DVJA 2HDAA 2RN8A 1WDXA 1KFZA 3TVTA 3EG0A 4GBQA 1GCQA 2C0OA 2RQWA 3UA6A 1I1JA 2K79A 2A08A 2K7AA 4J9HA 1M3AA 2DJQA 1BB9A 1E6HA 2GTOA 1HSQA 1WYXA 1N5ZA 1WLPB 1ZLMA 2CUBA 2L3QA 1NEBA 2PZ1A 1X6BA 1GBRA 2DA9A 2V1QA 1SPKA 1VA7A 2OAWA 2JM8A 2IIMA 4IIMA 1M8MA 4HCKA 4J9CA 3RBBB 2X3XD 1A0NB 2DL8A 1SHFA 2KYBA 1VYTA 3VS0A 3TSZA 1SSHA 1HD3A 2G6FX 3QWXX 2BZYA 1G83A 2LP5A 4OMOA 1YN8A 4K11A 1X27A 2KROA 2O9SA 5IXFA 2W0ZA 1NYFA 2W10A 1E6GA 1JQQA 1X69A 2JM9A 2DBKA 1K9AA 1PNJA 4JJBA 2EW3A 4AFZC 2XMFA 2DNUA 3FJ5A 4CC4B 2GQIA 4KRTA 2QDLA 1CSKA 2ED0A 4E6RA 4R0KA 4JZ3A 3UATA 2J6FA 1WA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FWB A;  3RNJ A;  3A98 A;  1PWT A;  1YCS B;  5HCK A;  1T0H A;  2D1X A;  2LQW A;  4ORZ A;  2O88 A;  1GCQ C;  1UGV A;  1XOV A;  4M4Z A;  3VRZ A;  2EPD A;  1X2K A;  2PNI A;  4HXJ A;  2JMC A;  3H0H A;  4D8D A;  3C0C A;  1JXO A;  2DRK A;  2JT4 A;  2EBP A;  5IHI A;  2KRM A;  3I5S A;  2FG0 A;  3M0T A;  3QWY A;  1T3S A;  4LN2 A;  1W1F A;  2KBT A;  1MUZ A;  1UUE A;  1OEB A;  3ZL7 C;  3VS7 A;  1RLP C;  1BK2 A;  1M3C A;  1TUD A;  2EGE A;  2DM1 A;  1U06 A;  1Y57 A;  1JEG A;  2V1R A;  2E5K A;  2J7I A;  1OOT A;  3NHN A;  4FSS A;  1KIK A;  2C0I A;  1KSW A;  1AWJ A;  2OJ2 A;  2RPN A;  3PVQ A;  1NEG A;  1FMK A;  5IHN A;  2RQU A;  2LJ0 A;  1MV3 A;  1OPK A;  2KXC A;  1NYG A;  3PE0 A;  2HEQ A;  1IO6 A;  2DL7 A;  1T3L A;  2CUD A;  1PHT A;  1AZG B;  1G2B A;  2O31 A;  2F2V A;  2CH4 A;  1SHG A;  2MIO A;  2A36 A;  2BTT A;  2AK5 A;  1SEM A;  1YWO A;  2YUN A;  1AVZ C;  1ZBJ A;  2SRC A;  2P4R A;  2KGT A;  1B3Q A;  2DF6 A;  1PKS A;  5L23 A;  4AFU C;  2DMO A;  2K3B A;  5ECA A;  2C0T A;  1WXU A;  1AWW A;  1H92 A;  1JU5 C;  2EGC A;  1CKB A;  1S1N A;  4OMM A;  5GJV B;  4AFQ C;  1AWO A;  4OMP A;  2AKL A;  1V1C A;  2M51 A;  1PRL C;  3VRY A;  1GL5 A;  4CC3 A;  4ZNX A;  4DEX A;  4LNP A;  1TG0 A;  2NUZ A;  2HCK A;  2YSQ A;  5GJW B;  3VS1 A;  2L0A A;  1UE9 A;  3IQL A;  1JO8 A;  2FO0 A;  1AZE A;  3M0U A;  2LQN A;  4RTY A;  2KEA A;  2ED1 A;  2KRN A;  2L3S A;  3UA7 A;  1PKT A;  1WIE A;  2ROL A;  4IIO A;  2JMA A;  4J9E A;  2BZX A;  3NGP A;  1QLY A;  2GGR A;  1ABO A;  2X3W D;  2L2P A;  1UTI A;  2D8H A;  2RMO A;  2JS0 A;  2FPF A;  2YUO A;  1AOJ A;  4AG2 C;  1CKA A;  4CC2 A;  4DEY A;  4GLM A;  3VS5 A;  5I11 A;  3M0Q A;  2RF0 A;  3I5R A;  1SRM A;  2EYW A;  2CH4 W;  4J9F A;  2KT8 A;  1UJY A;  2RNA A;  2F2X A;  2KRS A;  3VS6 A;  2FPE A;  3REB B;  3NPF A;  1MV0 B;  2GNC A;  3I35 A;  1WFW A;  2VVK A;  2VWF A;  4AG1 C;  2DBM A;  1UHF A;  1NLO C;  1UEC A;  1UDL A;  1H3H A;  3THK A;  2EYZ A;  3EG1 A;  2O2O A;  1LCK A;  2J06 A;  1GFD A;  1K76 A;  1W70 A;  1QKX A;  1NM7 A;  1U3O A;  2RQV A;  3VS2 A;  4RTW A;  1K0X A;  1UG1 A;  1GCP A;  1HJD A;  1OPL A;  1K4U S;  4F14 A;  1I0C A;  2LCS A;  2D0N A;  1WX6 A;  2AZV A;  2HSP A;  2DL3 A;  4J9I A;  4A63 B;  1UFF A;  1K1Z A;  2CSI A;  2ENM A;  1ARK A;  1X43 A;  2DL4 A;  1M3B A;  2EGA A;  2ROT A;  5I22 A;  1X6G A;  2J6K A;  2J6O A;  4RTV A;  3EHQ A;  4QT7 A;  1FYN A;  4J9G A;  4CC7 A;  4F17 A;  1NLP C;  3UF4 A;  1YWP A;  1SRL A;  2EYY A;  1KJW A;  2DRM A;  1QKW A;  3NMZ C;  3EG2 A;  1ZX6 A;  2M0Y A;  3JV3 A;  1AEY A;  4HVU A;  2LJ3 A;  2JW4 A;  4Z89 A;  3GBQ A;  3M0R A;  1QWE A;  2DIL A;  4OMQ A;  2NWM A;  3VS4 A;  2KR3 A;  4Z88 A;  2DYB A;  2OI3 A;  4EIK A;  2HBW A;  2CT3 A;  1M30 A;  1YNZ A;  1TUC A;  1YP5 A;  1E7O A;  5FWC A;  3EGU A;  4LUE A;  4J9D A;  2J05 A;  4X1V A;  3H41 A;  2KNB B;  1UJ0 A;  2GBQ A;  2GTJ A;  1PRM C;  3REA B;  2CDT A;  2EYX A;  1JXM A;  4AFS C;  2KYM A;  1RUW A;  2CRE A;  4RTT A;  1NG2 A;  2ESW A;  3KFV A;  1GRI A;  2D8J A;  1T0J A;  2FRY A;  2L3P A;  4D8K A;  3VS3 A;  1GFC A;  3PVL A;  1ABQ A;  2YUQ A;  1I07 A;  4HVW A;  1M27 C;  2K9G A;  2JTE A;  2MCN A;  2CT4 A;  4JJD A;  4OML A;  2O9V A;  4LE9 A;  3ULR B;  2KE9 A;  2CSQ A;  2FRW A;  2YDL A;  1VYV A;  2LX7 A;  3CQT A;  3SEM A;  1WXB A;  2K2M A;  1U5S A;  2EKH A;  2YUP A;  4RTZ A;  2FEI A;  3M0P A;  5FW9 A;  1OV3 A;  2LMJ A;  1AD5 A;  1Y0M A;  4J9B A;  1QCF A;  1AWX A;  2BZ8 A;  4OMN A;  3O5Z A;  1Z9Z A;  4LUD A;  5IXB A;  1J3T A;  1ZSG A;  2DL5 A;  3SHW A;  2KXD A;  2EQI A;  1H8K A;  4JJC A;  4RTU A;  4ESR A;  4JZ4 A;  2ABL A;  2DLP A;  4JPB W;  4Z8A A;  2LNH B;  3TSW A;  1W6X A;  5IH2 A;  3R6N A;  3U23 A;  1Z9Q A;  1GBQ A;  1QWF A;  2FPD A;  1UHC A;  4HVV A;  2ECZ A;  2AKK A;  1B07 A;  2LJ1 A;  2I0N A;  2RQT A;  2PTK A;  2H8H A;  1BBZ A;  1ZUY A;  1RLQ C;  2SEM A;  1VYU A;  1K0S A;  1EFN A;  2B86 A;  3H0I A;  3M0S A;  2KT1 A;  1WI7 A;  2A28 A;  2MOX A;  4Y92 A;  4F16 A;  1RI9 A;  4RUG A;  2DE0 X;  1X2Q A;  5EC7 A;  2JS2 A;  2YT6 A;  3EHR A;  4RTX A;  2F2W A;  3LH5 A;  4WCI A;  1ZUU A;  2EVR A;  2JXB A;  2RQR A;  2VKN A;  2K6D A;  3I9Q A;  1WXT A;  1BU1 A;  3EG3 A;  3H0F A;  2AZS A;  1ZUK A;  2A37 A;  2LZ6 B;  2DX1 A;  5IHK A;  2DVJ A;  2HDA A;  2RN8 A;  1WDX A;  1KFZ A;  3TVT A;  3EG0 A;  4GBQ A;  1GCQ A;  2C0O A;  2RQW A;  3UA6 A;  1I1J A;  2K79 A;  2A08 A;  2K7A A;  4J9H A;  1M3A A;  2DJQ A;  1BB9 A;  1E6H A;  2GTO A;  1HSQ A;  1WYX A;  1N5Z A;  1WLP B;  1ZLM A;  2CUB A;  2L3Q A;  1NEB A;  2PZ1 A;  1X6B A;  1GBR A;  2DA9 A;  2V1Q A;  1SPK A;  1VA7 A;  2OAW A;  2JM8 A;  2IIM A;  4IIM A;  1M8M A;  4HCK A;  4J9C A;  3RBB B;  2X3X D;  1A0N B;  2DL8 A;  1SHF A;  2KYB A;  1VYT A;  3VS0 A;  3TSZ A;  1SSH A;  1HD3 A;  2G6F X;  3QWX X;  2BZY A;  1G83 A;  2LP5 A;  4OMO A;  1YN8 A;  4K11 A;  1X27 A;  2KRO A;  2O9S A;  5IXF A;  2W0Z A;  1NYF A;  2W10 A;  1E6G A;  1JQQ A;  1X69 A;  2JM9 A;  2DBK A;  1K9A A;  1PNJ A;  4JJB A;  2EW3 A;  4AFZ C;  2XMF A;  2DNU A;  3FJ5 A;  4CC4 B;  2GQI A;  4KRT A;  2QDL A;  1CSK A;  2ED0 A;  4E6R A;  4R0K A;  4JZ3 A;  3UAT A;  2J6F A;  1WA7 A; 
#chains in the Genus database with same CATH topology
 5FWB A;  2VUB A;  2P0K A;  2WSF E;  3NTH A;  4BI3 A;  4C8Q C;  1W4S A;  5I21 A;  2LQ8 A;  4ZN1 A;  2X4X A;  3CCL T;  1T0H A;  1IB8 A;  3WXM B;  1OU8 A;  1X2K A;  2CKK A;  3H0H A;  4D8D A;  2LVM A;  4XU0 A;  5IHI A;  3M55 A;  1PM3 A;  2FG0 A;  3M0T A;  4LN2 A;  4OGE A;  3EAE A;  2BUD A;  1D09 B;  1W1F A;  3VS7 A;  3MP8 A;  3CCQ Q;  4MDW A;  1OI1 A;  4RKU E;  3OQ5 A;  1TUD A;  2EGE A;  1U06 A;  2I2L A;  1JEG A;  3WVD B;  1OUL A;  5CKH A;  3FEO A;  2C0I A;  3VJP A;  4J5Y A;  5D6Y A;  1VQM T;  4PJJ A;  1JJ2 A;  1M2O A;  4MZP A;  1KD1 C;  2X9H A;  4L6V 5;  2LJ0 A;  2QAZ A;  2HKN A;  4KUI A;  1PD1 A;  4LDV A;  2HEQ A;  1JJ2 S;  1H64 1;  5KYU B;  1G2B A;  1G3T A;  2O31 A;  2RI2 A;  2DXU A;  3SWN B;  2AK5 A;  1YWO A;  1VIF A;  1AVZ C;  1Q81 R;  3OS0 A;  3HTR A;  3SFM A;  2LDM A;  3QBY A;  3UWN A;  5ECA A;  4N0A A;  5GAN g;  4ZGE B;  3EH1 A;  1TUG B;  4OB0 B;  1YJW Q;  4KGV B;  1H92 A;  1S1N A;  4QKU A;  5GJV B;  2L8D A;  1HYO A;  4LXC A;  2AKL A;  2M51 A;  1VQ6 A;  3VRY A;  2QGG A;  3A8G B;  3X28 B;  3JCM b;  4DEX A;  2NUZ A;  4ZGD B;  2A0F B;  1SG5 A;  4BE1 A;  3IQL A;  4NL3 A;  1AZE A;  3OW2 P;  4A53 A;  2MWP A;  4J7I A;  3CPW A;  2L3S A;  3L2V A;  1D1A A;  4IIO A;  2JMA A;  3QUI A;  3MKD A;  3QXE B;  4E7I A;  2DIQ A;  4M77 F;  2L2P A;  2ZAE A;  2LT4 A;  1UTI A;  2ZPB B;  1SSF A;  2XHC A;  5CKE A;  3VYG A;  1JBM A;  2QQ9 A;  3DB4 A;  4GLM A;  3RER A;  1D0Z A;  3M0Q A;  4J7F A;  2K2V A;  1Q82 R;  5GAN h;  3FJP A;  4XTY A;  2F2X A;  2RNA A;  2M16 A;  2E70 A;  2QEX A;  3CCM Q;  3X24 B;  2FPE A;  4XAX B;  2VVK A;  2VAS A;  3LX7 A;  4QVZ A;  1HK9 A;  3QG1 A;  4JRI A;  1NLO C;  4J83 A;  3THK A;  1WHK A;  2D9T A;  4RCC A;  2DZ9 A;  4C5I A;  3QSU A;  2J06 A;  1GFD A;  1W70 A;  1Q81 U;  3GNF B;  3QO3 A;  2XKO C;  3HRT A;  2QEX T;  3EFS A;  1NM7 A;  2BE9 B;  4XQ3 A;  2HZY A;  3RKX A;  5FU7 B;  1HJD A;  3L2W A;  2LCS A;  2D0N A;  3RIR A;  1UGR B;  3H6Z A;  1B34 B;  4M7A D;  3CC7 Q;  4R55 A;  1C1A A;  4OF1 A;  2DEU A;  4HT8 A;  3CCS T;  2KK4 A;  4M75 E;  2EGA A;  2E65 A;  1X6G A;  2RH2 A;  2OAU A;  2MF2 A;  4RTV A;  5GMK e;  4J6Y A;  5J3B A;  4J9G A;  2DTO A;  3KBG A;  4F17 A;  2VGM A;  1SRL A;  2DO3 A;  1UGQ B;  5GAM h;  3CCS A;  3CBO A;  1AEY A;  4M78 B;  4FYX B;  4C0G A;  1QWE A;  2DIL A;  1G3W A;  3SWN C;  1RAI B;  3VS4 A;  2DYB A;  1Q7Y U;  4M7A A;  1YJW T;  1RAD B;  4EMK C;  3VYH B;  1ZHI A;  1BIA A;  1KHC A;  4C92 G;  4EMK B;  5M9O A;  5FWC A;  4KH0 B;  3SWN A;  3FRN A;  4NOY A;  5GAM e;  2HMA A;  4X1V A;  3M58 A;  3V7S A;  5GAN 6;  4JS4 A;  4IUR A;  4E47 A;  3L2Q A;  1UJ0 A;  3JSC A;  2GTJ A;  1YJW A;  5GAO m;  1IGQ A;  4PJL A;  3OMC A;  1BI1 A;  2CRE A;  1VQN Q;  3QDR B;  4PFZ A;  4PJO D;  4E7S A;  1KC8 U;  3PVL A;  1NPP A;  3OY9 A;  1I07 A;  4HVW A;  3CCE Q;  1BI2 A;  4JJD A;  2GFA A;  4OML A;  2RA2 A;  3BDL A;  2O9V A;  5KYY B;  1VQL T;  2JNG A;  2CSQ A;  4CRI A;  4RTZ A;  3LLR A;  2DD5 A;  3M0P A;  5FW9 A;  5LJ3 d;  1AWX A;  2BZ8 A;  4BDZ A;  1Z9Z A;  4LUD A;  2EKO A;  4C8Q B;  1J3T A;  3SHW A;  2JTF A;  3V8J A;  1YCY A;  4PJO F;  1I5L A;  5LJ3 f;  1VQL A;  4BE0 A;  1N9R A;  2ABL A;  2DLP A;  4QW2 A;  3QKJ A;  4X34 A;  4DQ2 A;  3R6N A;  3U23 A;  3P8D A;  2ECZ A;  1M9S A;  2AKK A;  4C8Q D;  1Y96 A;  5CQY A;  4M75 D;  2RK1 A;  2H8H A;  5CK9 A;  4B9X A;  1BBZ A;  4C0Z A;  4Z02 A;  1SKU B;  1ZUY A;  2RJF A;  1RLQ C;  1EFN A;  4C5G A;  3M0S A;  1JJ2 P;  4MML A;  2C06 A;  1TWB A;  2KT1 A;  3EFO A;  1G8X A;  2DTH A;  2HQH A;  3CCE A;  2DE0 X;  1X2Q A;  1I81 A;  4XU2 A;  1QCO A;  3QPH A;  2VKN A;  5J39 A;  3JB9 D;  2RJD A;  4C0D B;  4EMG A;  5CQX A;  2AZS A;  1ZUK A;  2DX1 A;  1PCX A;  1PG5 B;  5IHK A;  4DA4 A;  5A0G A;  4II1 A;  3RMS A;  1D3B B;  1YI2 A;  1GCQ A;  2C0O A;  1VQ5 A;  3JCM W;  2DPP B;  2O01 E;  2CYZ B;  2P4T A;  2QA4 Q;  2EQU A;  1KK7 A;  5LL6 S;  1M3A A;  1WHH A;  1E6H A;  2GTO A;  3JB9 I;  1XTD A;  1XJW B;  2VGN A;  1O9S A;  1ZLM A;  2PZ1 A;  2CZ6 B;  1GBR A;  2DA9 A;  2EQJ A;  1VQ5 T;  4M77 B;  1VA7 A;  2OAW A;  2RJE A;  2MYS A;  4OB1 B;  5GAO n;  1M1K C;  1MMN A;  1Q82 U;  1RAC B;  3JB9 F;  1W2B P;  2DL8 A;  3OBW A;  1FX7 A;  1VYT A;  3VS0 A;  1F1B B;  3CCU Q;  3KXT A;  2XDD A;  2G6F X;  3BE3 A;  1G83 A;  1X27 A;  3OYL A;  2GF7 A;  3S3M A;  1IRX A;  1NYF A;  2W10 A;  5CCA A;  3X26 B;  2IPO B;  2WSE E;  2JM9 A;  1K9A A;  4LDX A;  1WJR A;  2DXB A;  2XMF A;  5IN1 A;  1S72 Q;  2QDL A;  2HQX A;  2X51 A;  1M1G A;  1WA7 A;  1KC8 R;  1WZO A;  5HCK A;  1YCS B;  2ZPG B;  1GCQ C;  4E7L A;  1UGV A;  1XOV A;  1Q7Y R;  2F1L A;  3VRZ A;  5FU6 B;  3QJY A;  4WTO B;  2HKQ B;  2JMC A;  2EBP A;  1W2B A;  2XU8 A;  3TQ7 P;  3KUF A;  4KUL A;  2KBT A;  5GAM g;  1OEB A;  2COY A;  4PK4 A;  3G6E Q;  1RAG B;  4OB2 B;  1BK2 A;  1JRI A;  4QQ6 A;  5LJ3 e;  1ZSZ B;  3M54 A;  1IXD A;  2DXT A;  4BY6 B;  2J7I A;  3CC7 A;  3NHN A;  1KIK A;  2DFU A;  1AWJ A;  1KQ1 A;  2GQV A;  2JZ2 A;  1QVG P;  3CCR A;  1Q82 C;  3CME Q;  1YIT A;  3OS2 A;  5IT9 E;  3MPU B;  2VXF A;  4M7D G;  2E64 A;  1OPK A;  1NYG A;  5LJ3 h;  4R56 A;  1ZBX A;  2AIR B;  2QK0 A;  2QAS A;  2DL7 A;  1X6O A;  4FW2 A;  4C0F A;  3MJX A;  3CCR T;  4QVD A;  1YIT T;  2LNV A;  4ANJ A;  3JB9 J;  3LH0 A;  3OS5 A;  4XU3 A;  4XTU A;  1YIT Q;  4O5V A;  3CPF A;  1ZBJ A;  1OZ3 A;  4FYV B;  3EGX A;  3A8L B;  5L23 A;  2C0T A;  2QQS A;  1AWW A;  5I2M A;  1CKB A;  3S3O A;  4OMM A;  4AFQ C;  3HHT B;  1VIE A;  4FW1 A;  5L8R E;  1QP3 A;  5CVI A;  4E7K A;  3OYI A;  3VS1 A;  1WPY A;  2HCK A;  1UE9 A;  4LDW A;  2FVU A;  1JO8 A;  1WHG A;  5A0D A;  2LQN A;  5FLX E;  4A4G A;  1C6V X;  3M56 A;  3TCJ A;  2ED1 A;  2KRN A;  4FSX A;  1QP2 A;  1Q86 C;  1WIE A;  2ROL A;  4M7D F;  3OSS C;  1MMA A;  2GGR A;  1M2V A;  1VQK Q;  4FM4 B;  2RMO A;  1N6A A;  3OS1 A;  4JS5 A;  2YUO A;  3JRZ A;  1KQS S;  1YI2 Q;  1AOJ A;  4AG2 C;  2MK5 A;  1CKA A;  3VS5 A;  3I5R A;  1SRM A;  4DOW A;  2K5I A;  1UJY A;  2KRS A;  3VS6 A;  4IKF A;  2KVQ G;  3CMA Q;  2DYI A;  3NPF A;  1MV0 B;  2GNC A;  4BI4 A;  1WFW A;  3QZ9 B;  4AG1 C;  3G6E A;  1FMV A;  2DBM A;  3VKI A;  2IVW A;  1UEC A;  3H8Z A;  1ZSZ A;  2QGF B;  4M7D D;  1LJO A;  4JRQ A;  3D7S B;  5KYW B;  3CCJ Q;  1U3O A;  4M7D C;  4E7Z A;  4RTW A;  3G6E T;  4F7U A;  4MZT A;  1UG1 A;  3JCM g;  3BFM A;  4FT2 A;  2DL3 A;  4M7A G;  1K8A C;  1K1Z A;  2ENM A;  5CAI A;  3R6O A;  4IUV A;  1X43 A;  2EAY A;  5I22 A;  2ROT A;  1VQO Q;  2J6K A;  4C5H A;  4A54 A;  1LNX A;  3A8M B;  2J6O A;  2KAF A;  3L2R A;  1S72 A;  4F7U B;  1FYN A;  1VQ5 Q;  2R57 A;  4CC7 A;  1N8R R;  1NLP C;  5KE3 A;  3MP1 A;  3FIF A;  2V8K A;  3L2U A;  1QKW A;  2XIC A;  3J7A F;  4DBH A;  5A2Q E;  2LJ3 A;  1WJS A;  1ZA2 B;  4CI0 C;  2JW4 A;  2P0Q A;  1YHQ Q;  1Q86 U;  4OMQ A;  1S72 T;  4HT9 A;  3A5Z B;  1YJ9 T;  2KR3 A;  3J80 E;  2OI3 A;  2HBW A;  2PU9 B;  2QG9 B;  1Y96 B;  1YHQ A;  1TUC A;  1YP5 A;  2P84 A;  2ZPI B;  1YFN A;  1VQK T;  2J05 A;  2RM4 A;  5LJ5 j;  4BY6 C;  3RUX A;  1YJ9 A;  1R8O B;  5KE2 A;  2GBQ A;  4M7D E;  2X4J A;  2CDT A;  5KH6 A;  3OYK A;  2KYM A;  1RUW A;  4RTT A;  1NG2 A;  2ESW A;  3KFV A;  1GRI A;  1VQL Q;  1VQ4 A;  3CC2 T;  1VQK A;  1T0J A;  2FRY A;  1W2B S;  4M7A B;  3RR6 A;  2EJF A;  2LX9 A;  1GFC A;  4XTX A;  2K5L A;  1ABQ A;  2YUQ A;  3SD4 A;  2E12 A;  5KYY A;  5DM7 R;  2K9G A;  3M4G A;  2LT1 A;  1NE8 A;  2JTE A;  3GP8 A;  4FCY A;  1R77 A;  1M5Q 1;  1PSF A;  3CMA T;  2CP2 A;  1R0B G;  2LQK A;  2CT4 A;  1NPR A;  4LE9 A;  3ULR B;  3PIP A;  2KE9 A;  4KT0 E;  1VYV A;  1KD1 R;  3JAM E;  3HSB A;  2E5Q A;  2K2M A;  2YLB A;  3CCS Q;  1K9M R;  1QVG S;  1M4Z A;  2LMJ A;  3ZBD A;  4J9B A;  3O5Z A;  5IXB A;  1N8R U;  3FDR A;  2DL5 A;  3CMA A;  4IUU A;  4N4H A;  3NFC A;  2Y4Y A;  4C92 E;  4ESR A;  4JZ4 A;  4JPB W;  1M90 R;  3X20 B;  1Q81 C;  3HKS A;  1H3Z A;  2HQE A;  5D6W A;  1Z9Q A;  1VQP A;  4HCC A;  1GBQ A;  4KUD K;  2DKG A;  1UHC A;  2MI6 A;  3CCE T;  3HPW A;  1ZQ1 A;  1B07 A;  4UC4 A;  3DLM A;  3LGF A;  2I0N A;  4LDU A;  2PTK A;  1BCM A;  2EQM A;  1Y71 A;  4D6W A;  5D6X A;  5GMK h;  2YXY A;  2VB6 A;  1NJI C;  3H0I A;  3PIO A;  1GXI E;  1RL2 A;  1WI7 A;  1R0C B;  2A28 A;  2DJZ A;  1VQP T;  1RI9 A;  1SF9 A;  1FXX A;  1X75 C;  1QQJ A;  1BI0 A;  1PSE A;  5I2S A;  2YT6 A;  2F2W A;  4C92 D;  1NJI R;  1V29 B;  2OTJ Q;  1YI2 T;  1ZUU A;  2EVR A;  2JXB A;  1WQ7 A;  2K5F A;  2QTX A;  3CXC A;  2X4W A;  3JB9 G;  5KYX B;  3I56 Q;  3M4Y A;  3BDU A;  1WGS A;  4M77 G;  5GAN 2;  3I9Q A;  4ZN3 A;  1KHI A;  4PFO A;  2JN0 A;  2DVJ A;  2HDA A;  1WDX A;  4BD3 A;  3VV0 A;  1BKB A;  3PMT A;  4NL2 A;  1YIJ T;  3BW1 A;  2JTM A;  3EG0 A;  3FB9 A;  2RQW A;  3UA6 A;  5GAN 7;  4PJO B;  1U1T A;  5CIU A;  2A08 A;  3VU3 C;  4J9H A;  3OYJ A;  2DJQ A;  2L89 A;  3MEU A;  3RDV A;  2XD0 A;  4C92 A;  1N5Z A;  2CUB A;  3OYB A;  4QQD A;  2E3I A;  4VUB A;  1QVF A;  2FYK A;  2JM8 A;  1KG1 A;  1TSF A;  2K3Y A;  4ELY C;  1MMG A;  1TXQ A;  4J9C A;  5FRN A;  2X3X D;  2Y4X A;  4XTW A;  3EG9 B;  2MAM A;  3GF5 A;  4F7U E;  1MGQ A;  1DJ7 B;  2FZG B;  2KYB A;  1WNL A;  2DXC A;  3TSZ A;  2CZ0 B;  3OYN A;  3CCR Q;  1V76 A;  3QWX X;  4EMH A;  1VQ8 Q;  2KRO A;  2QEX Q;  1MNE A;  4JJB A;  4FT4 A;  5KYN A;  2DNU A;  3DKM A;  4C8Q G;  1NJI U;  4CC4 B;  4JZ3 A;  1WHM A;  3PGG A;  1N9S A;  3RNJ A;  5KCH A;  4ATO A;  3MEW A;  4IUP A;  2D1X A;  2O88 A;  3A8H B;  4A4K A;  1HXD A;  4M4Z A;  4QQG A;  1YJN T;  4MMK A;  2EPD A;  4HXJ A;  2PNI A;  3O8V A;  2DRK A;  5GAM d;  1D3B A;  3MO8 A;  3I5S A;  3QWY A;  3CC7 T;  2JOY A;  3QJ6 A;  1LVK A;  1TU0 B;  3M9Q A;  1Q86 R;  2A7Y A;  1D1C A;  1MUZ A;  1UUE A;  1NBE B;  1VQ6 Q;  1YJN A;  3L2Z A;  4JDS A;  1YJ9 Q;  2DM1 A;  2OX7 A;  3LWI A;  7AT1 B;  4M78 D;  1Y57 A;  3E1S A;  4BE2 A;  3RES A;  2L3R A;  1ZSZ C;  2V1R A;  3DLL A;  2E5K A;  3EGD A;  2A3L A;  2WSC E;  2E6N A;  2OTL A;  3CCU A;  1KSW A;  2OJ2 A;  4RG8 A;  1D1B A;  2CP6 A;  2DER A;  3PVQ A;  3CXC S;  5IHN A;  1MND A;  2PVO B;  1AHJ B;  2E6Z A;  2YRD A;  1QVF P;  3CBM A;  3PE0 A;  2LCL A;  4C92 B;  3LYI A;  2OTL T;  1VQO T;  1PHT A;  3S6W A;  2KQW A;  2F2V A;  1SHG A;  2PVG B;  4MDX A;  1OX9 A;  4M75 A;  2BE7 D;  2K3X A;  4C8Q A;  2P4R A;  1RAH B;  2ZZD A;  4PLI A;  1B3Q A;  4AFU C;  2K3B A;  1M1K U;  1Q95 G;  1WXU A;  1JU5 C;  2EGC A;  1AT1 B;  1AWO A;  4KGX B;  2VYT A;  3TEE A;  4ME7 A;  8AT1 B;  2AT1 B;  3A8O B;  1PRL C;  1QW1 A;  3OYH A;  4CC3 A;  5DLO A;  2GFU A;  2KI7 A;  5GJW B;  3L1A A;  5CKB A;  2ATC B;  2RHU A;  3MET A;  3M0U A;  1BYM A;  2QQB A;  4RTY A;  4JUV A;  2KEA A;  2CZ1 B;  1PKT A;  3V7C A;  2JJ9 A;  2CZ7 B;  1QLY A;  2X3W D;  3RKY A;  2D8H A;  2E3H A;  2O4X B;  3MHX A;  4LD9 K;  2NUT B;  2FPF A;  4PJO C;  3V7R A;  3UPU A;  1M8V A;  2QYZ A;  4PFP A;  2L5Q A;  3P8H A;  4LD6 A;  4P5N A;  5FRO A;  2RF0 A;  4RMO A;  2G3R A;  4N4I A;  4EMK A;  2EYW A;  2CH4 W;  4PJO G;  4F7U G;  2RD1 A;  1KD1 U;  4C8Q E;  3REB B;  1WJQ A;  1TH7 A;  1UHF A;  3AHU A;  3LWH A;  1UDL A;  2E10 A;  1H3H A;  1VQM Q;  3S3N A;  2YHT A;  4B9W A;  5LJ5 g;  2O2O A;  1K76 A;  2V26 A;  1VQN T;  5A0L A;  3HFO A;  2O4X A;  3GLX A;  1K0X A;  2NYS A;  1K4U S;  1GCP A;  2EYQ A;  1I0C A;  2F5T X;  2AZV A;  2HSP A;  4A63 B;  4M7A E;  3JCM Q;  5GMK i;  1ARK A;  2KMT A;  1VQN A;  2HNI A;  3E9F A;  2DTI A;  4QT7 A;  1K73 U;  2NLU A;  3JCM e;  4TVR A;  3CCL Q;  1QMC A;  4BI8 B;  2DET A;  2YRC A;  2DRM A;  3CBP A;  3CME T;  3NMZ C;  1YHQ T;  3EG2 A;  1MMD A;  3JV3 A;  4HKE A;  3V8K A;  4AMC A;  4HA8 A;  2DVE A;  4C92 C;  2FZK B;  3GBQ A;  3M0R A;  1OX8 A;  6AT1 B;  5GMK m;  3OW2 S;  2NWM A;  4Z88 A;  4EIK A;  2CT3 A;  3CME A;  4A4F A;  3JCM J;  3LW5 E;  5FU6 C;  4LDY A;  1E7O A;  4OB3 B;  1C0M A;  2WAC A;  1VQ7 Q;  1VQ9 Q;  1VQ4 T;  3CC2 A;  4HCZ A;  2B8A A;  2KNB B;  3PNW C;  3N5B B;  1PRM C;  2Z0W A;  2E1H A;  3M5A A;  2E41 A;  3VUZ A;  2D8J A;  3E2U A;  1MHN A;  2L3P A;  1OU9 A;  4D8K A;  4QVC A;  3VS3 A;  2M1H A;  2CGH A;  3HP9 A;  1M27 C;  2YLC A;  3EGX B;  5J26 A;  4E7J A;  2XI9 A;  5GAM f;  3PTA A;  1RAF B;  3BY7 A;  3CQT A;  3SEM A;  2LTO A;  3EGD B;  4OGC A;  2EKH A;  2YUP A;  3GOX A;  1M2V B;  4BAC A;  1OV3 A;  2FB7 A;  2KDS A;  3M57 A;  1AD5 A;  1Y0M A;  3C95 A;  4M77 C;  3CC4 T;  3CXC P;  5GAO q;  3PMI A;  2KXD A;  4V2S A;  3JCM X;  2EQI A;  1OQK A;  4FL6 A;  2PUO B;  4JJC A;  4M77 D;  3HRU A;  2LNH B;  3TSW A;  1UB4 A;  5LJ5 h;  2MMP A;  3ZFJ A;  5IH2 A;  2QI2 A;  1QWF A;  2M9U A;  1UGP B;  4HVV A;  1EX4 A;  3M53 A;  2CP0 A;  5C6S A;  2LJ1 A;  4PJO A;  1PD0 A;  1Q7Y C;  3QHS A;  5GAN j;  1VYU A;  1K0S A;  1XQH A;  3E19 A;  1YBY A;  5IAY A;  4XTV A;  4Y92 A;  4F16 A;  3E9G A;  5LJ5 e;  4XK8 E;  3I55 Q;  5EC7 A;  2JS2 A;  4XTZ A;  3LH5 A;  4DOV A;  2DD4 A;  5GAN e;  4RG2 A;  1YIJ A;  2RI3 A;  1VQ8 T;  4N4G A;  2K6D A;  3QZ5 B;  2QA4 A;  5GAN d;  3GNG A;  3H0F A;  3SB2 A;  1VQ7 T;  2LZ6 B;  1D0Y A;  3CC4 Q;  4O6J A;  4A4E A;  4DBF A;  4F04 B;  2RN8 A;  4FU6 A;  3JCM f;  4M7A F;  3G71 A;  3CCM A;  3QYG B;  1G3Y A;  2EQK A;  2CP3 A;  2K7A A;  3C12 A;  4HCB A;  4ZTJ A;  2R5A A;  1HSQ A;  3OYD A;  1BIB A;  4FIB A;  3JCM c;  5GAN f;  4GLK A;  4KBM B;  3C4S A;  3G71 T;  3CCM T;  2V1Q A;  4IIM A;  4HCK A;  2PUK B;  2LCC A;  3OYF A;  3OW2 A;  1YIJ Q;  1A0N B;  1M1F A;  3Q1J A;  3GIB A;  3T9N A;  3I55 A;  5KYU A;  5FRM A;  5GAN 5;  2QTV A;  4Y28 E;  1HD3 A;  2HBP A;  4PNO A;  1NZ9 A;  4OMO A;  3I56 T;  1YN8 A;  4K11 A;  2O9S A;  5IXF A;  1KQS A;  1E6G A;  1K8A R;  3CPW S;  2CS7 A;  2RB6 A;  2RHY A;  1X69 A;  2X35 A;  3I55 T;  2DBK A;  2M02 A;  3ZEH A;  3RMQ A;  2RHZ A;  3CCQ A;  2CP5 A;  1P92 A;  2GQI A;  3TRE A;  4KRT A;  3OYG A;  5LJ5 d;  2ED0 A;  5GAN 4;  4R0K A;  3FC3 A;  3I56 A;  4A4H A;  2HL5 C;  3UAT A;  2J6F A;  1QVF S;  1N8R C;  2QQR A;  3A98 A;  1PWT A;  4BDY A;  4M75 C;  3X25 B;  2NUT A;  2LQW A;  4ORZ A;  3CCQ T;  3OYA A;  1D0X A;  1IRE B;  4ZTF A;  5HKC A;  3P8B B;  3CCV T;  3C0C A;  1JXO A;  2JT4 A;  2PQW A;  3PFS A;  2KRM A;  3F70 A;  1EZZ B;  4PJM A;  4PJN A;  4Y91 A;  1T3S A;  4FYW B;  3CCU T;  3CCL A;  4M78 C;  4PKC C;  1RI0 A;  3HL8 A;  3ZL7 C;  2AHJ B;  2ZGW A;  1RLP C;  1IHV A;  1M3C A;  5CKF A;  3V8L A;  1I5O B;  1IHW A;  5C0M A;  5GMK l;  1OOT A;  4NS5 A;  4FSS A;  1VQO A;  3CD6 Q;  4XU1 A;  2RPN A;  3MP6 A;  2VC8 A;  4DBQ A;  5LJ3 j;  2FZC B;  5DLQ E;  1NEG A;  1BI3 A;  5LJ5 f;  3CD6 T;  2DEQ A;  4GY5 A;  4RCB A;  1FMK A;  4C8Q F;  2E4H A;  2RQU A;  3SDZ A;  3URG A;  4M75 B;  4M75 F;  1MV3 A;  3CC2 Q;  3UT1 A;  2KXC A;  1K73 C;  3ER0 A;  1RAE B;  4C5E A;  1IO6 A;  1QVP A;  1T3L A;  3EFR A;  2CUD A;  1VQM A;  1AZG B;  5GAO l;  2R5M A;  4BUG A;  2RK2 A;  1M1K R;  2CH4 A;  2BKD N;  2MIO A;  2A36 A;  4PLL A;  2BTT A;  3CD6 A;  1SEM A;  2YUN A;  1JB0 E;  1VQ4 Q;  1K9M C;  2EWN A;  2SRC A;  1O75 A;  2KGT A;  3NTI A;  1K8A U;  2DF6 A;  1PKS A;  1WQW A;  2XDP A;  2DMO A;  5CO7 A;  4B6M A;  4M7D A;  5GAO r;  4JJN K;  2PVD B;  4OMP A;  1V1C A;  3OYC A;  1M90 C;  1GL5 A;  2Y90 A;  5GAN 3;  1U1S A;  4ZNX A;  4LNP A;  4M7D B;  1TG0 A;  2YSQ A;  1IZ6 A;  2HD0 A;  1KQ2 A;  2XID A;  2L0A A;  3HRS A;  3CPW P;  2YWW A;  2FO0 A;  4DBR A;  3MEV A;  4N0A C;  3J81 E;  3UA7 A;  8ATC B;  1VQ6 T;  1KC8 C;  1BCO A;  1UEB A;  2JUF A;  2K57 A;  4J6W A;  4J9E A;  2BZX A;  3NGP A;  4M78 E;  4OVA A;  1ABO A;  4L5G A;  2JS0 A;  5KCO A;  3NTK A;  2ZPE B;  1YJN Q;  3AT1 B;  4CC2 A;  4DEY A;  5I11 A;  3CCJ T;  4M78 A;  4JRK A;  4M78 G;  4J9F A;  3OYE A;  2KT8 A;  4F7U F;  1Y7X A;  1LOJ A;  3MCA B;  3OA6 A;  3I35 A;  3G7Z A;  2VWF A;  2CP7 A;  1FWZ A;  2EYZ A;  4C92 F;  1QCN A;  3CCJ A;  3EG1 A;  4WF2 A;  4AT1 B;  2M0O A;  1LCK A;  3LGL A;  1XNI A;  3ASK A;  1QKX A;  1B34 A;  3JB9 H;  2RQV A;  3VS2 A;  5CKD A;  1OPL A;  4F14 A;  5AYF A;  1WX6 A;  2JVV A;  5GMK j;  4J9I A;  1UFF A;  2BIV A;  5HK0 A;  2CSI A;  4L59 A;  2V8I A;  2KSS A;  1UGS B;  2DL4 A;  1M3B A;  5GAO p;  2RHX A;  2HL3 A;  4M7A C;  2FL7 A;  3EHQ A;  1TS9 A;  2MWO A;  3EG9 A;  1KQS P;  4BB7 A;  3G71 Q;  3H9N A;  3UF4 A;  1YWP A;  2DZC A;  4ELZ C;  3FLG A;  2EYY A;  1KJW A;  3A1P A;  1I8F A;  1TOV A;  1ZX6 A;  2M0Y A;  1N27 A;  1G5V A;  3G4S Q;  4HVU A;  2VXE A;  4Z89 A;  3VUB A;  3OMG A;  4JLG A;  5HK3 A;  5GAM j;  4J6X A;  1M30 A;  2ZCF B;  1YNZ A;  4J8O A;  2V8J A;  3INZ A;  2DIG A;  2EJG A;  3EGU A;  4LUE A;  3JCM V;  3G1J A;  1PC0 A;  3RKW A;  4J9D A;  2RHI A;  3H41 A;  3GPL A;  2MPX C;  3REA B;  2ZPH B;  3TU4 K;  2EYX A;  3MEA A;  1JXM A;  5KYX A;  4AFS C;  3PT9 A;  2OTL Q;  1LPL A;  2XK0 A;  4IUQ A;  3QYH B;  3OYM A;  2P0P A;  5HY6 A;  1TTH B;  4ZGJ B;  2MCN A;  3CC4 A;  1ZA1 B;  2FRW A;  5GAN 8;  2YDL A;  4MZM A;  2EJ9 A;  2LX7 A;  2D6F A;  1WXB A;  1U5S A;  2COZ A;  2FEI A;  3JCM d;  4E2F B;  2YRV A;  3UDC A;  1QCF A;  4OMN A;  2IG0 A;  1X01 A;  1ZSG A;  3JCM h;  3DB3 A;  2QDY B;  4M77 E;  4M78 F;  2D0Q B;  3OYY A;  1RAB B;  1H8K A;  4RTU A;  2RO0 A;  2RI5 A;  4YTL A;  3G4S A;  3OSV A;  1Y07 A;  2VV5 A;  2DK3 A;  4Z8A A;  2RJC A;  1W6X A;  3JCM P;  2FPD A;  2EFI A;  2RQT A;  3WVE B;  3EH2 A;  3L42 A;  4Q5W A;  4E7H A;  1VQ8 A;  2SEM A;  3G4S T;  1I4K 1;  2B86 A;  1QVG A;  2QA4 T;  2F5K A;  9ATC B;  1VQ7 A;  2MOX A;  1EIF A;  4RUG A;  1WHL A;  5AT1 B;  1IGU A;  2XG8 D;  1WHJ A;  3EHR A;  4RTX A;  2HAX A;  4WCI A;  4IUT A;  2RQR A;  2F69 A;  1OYX A;  1FMW A;  1WXT A;  2H3J A;  1BU1 A;  3EG3 A;  2EIF A;  4JRP A;  2A37 A;  3QII A;  3EFO B;  3CCV Q;  1KFZ A;  3ME9 A;  2HSE B;  4OP0 A;  4PL6 A;  3TVT A;  4GBQ A;  2R58 A;  1I1J A;  2DAQ A;  2K4Y A;  2NUP B;  5CR2 A;  2K79 A;  4KGZ B;  2LC4 A;  4EDU A;  1B7T A;  4X9D A;  3OBY A;  4C0D C;  1BB9 A;  1RAA B;  5FU7 C;  1WYX A;  1ACM B;  4JLI A;  1WLP B;  2L3Q A;  1K9M U;  3QDF A;  4M77 A;  4EPC A;  1NEB A;  1X6B A;  2GCX A;  3C94 A;  3CEY A;  3HFN A;  1SPK A;  2X4Y A;  5DY9 A;  4M75 G;  4PJO E;  2IIM A;  4FYY B;  1M8M A;  1VQ9 A;  3RBB B;  2KY9 A;  2OTJ A;  1SHF A;  1M90 U;  4X9C A;  2ZPF B;  2COW A;  1OZ2 A;  1K73 R;  3M59 A;  1SSH A;  2QQA A;  2QXF A;  1VQ9 T;  2BZY A;  2LP5 A;  1VOM A;  2H3E B;  2W0Z A;  5LJ3 g;  1U8R A;  2OTJ T;  1JQQ A;  2LRQ A;  1G3S A;  2FHD A;  1PNJ A;  2EW3 A;  4AFZ C;  5EG2 A;  1VQP Q;  2XDB A;  5KYW A;  4OMF B;  5D7U A;  3FJ5 A;  3OB9 A;  1VUB A;  1CSK A;  2NUP A;  4E6R A;  3CCV A;  4KH1 B; 
#chains in the Genus database with same CATH homology
 5FWB A;  3RNJ A;  3A98 A;  1PWT A;  1YCS B;  5HCK A;  1T0H A;  2D1X A;  2LQW A;  4ORZ A;  2O88 A;  1GCQ C;  1UGV A;  1XOV A;  4M4Z A;  3VRZ A;  2EPD A;  1X2K A;  2PNI A;  4HXJ A;  2JMC A;  3H0H A;  4D8D A;  3C0C A;  1JXO A;  2DRK A;  2JT4 A;  2EBP A;  5IHI A;  2KRM A;  3I5S A;  2FG0 A;  3M0T A;  3QWY A;  1T3S A;  4LN2 A;  1W1F A;  2KBT A;  1MUZ A;  1UUE A;  1OEB A;  3ZL7 C;  3VS7 A;  1RLP C;  1BK2 A;  1M3C A;  1TUD A;  2EGE A;  2DM1 A;  1U06 A;  1Y57 A;  1JEG A;  2V1R A;  2E5K A;  2J7I A;  1OOT A;  3NHN A;  4FSS A;  1KIK A;  2C0I A;  1KSW A;  1AWJ A;  2OJ2 A;  2RPN A;  3PVQ A;  1NEG A;  1FMK A;  5IHN A;  2RQU A;  2LJ0 A;  1MV3 A;  1OPK A;  2KXC A;  1NYG A;  3PE0 A;  2HEQ A;  1IO6 A;  2DL7 A;  1T3L A;  2CUD A;  1PHT A;  1AZG B;  1G2B A;  2O31 A;  2F2V A;  2CH4 A;  1SHG A;  2MIO A;  2A36 A;  2BTT A;  2AK5 A;  1SEM A;  1YWO A;  2YUN A;  1AVZ C;  1ZBJ A;  2SRC A;  2P4R A;  2KGT A;  1B3Q A;  2DF6 A;  1PKS A;  5L23 A;  4AFU C;  2DMO A;  2K3B A;  5ECA A;  2C0T A;  1WXU A;  1AWW A;  1H92 A;  1JU5 C;  2EGC A;  1CKB A;  1S1N A;  4OMM A;  5GJV B;  4AFQ C;  1AWO A;  4OMP A;  2AKL A;  1V1C A;  2M51 A;  1PRL C;  3VRY A;  1GL5 A;  4CC3 A;  4ZNX A;  4DEX A;  4LNP A;  1TG0 A;  2NUZ A;  2HCK A;  2YSQ A;  5GJW B;  3VS1 A;  2L0A A;  1UE9 A;  3IQL A;  1JO8 A;  2FO0 A;  1AZE A;  3M0U A;  2LQN A;  4RTY A;  2KEA A;  2ED1 A;  2KRN A;  2L3S A;  3UA7 A;  1PKT A;  1WIE A;  2ROL A;  4IIO A;  2JMA A;  4J9E A;  2BZX A;  3NGP A;  1QLY A;  2GGR A;  1ABO A;  2X3W D;  2L2P A;  1UTI A;  2D8H A;  2RMO A;  2JS0 A;  2FPF A;  2YUO A;  1AOJ A;  4AG2 C;  1CKA A;  4CC2 A;  4DEY A;  4GLM A;  3VS5 A;  5I11 A;  3M0Q A;  2RF0 A;  3I5R A;  1SRM A;  2EYW A;  2CH4 W;  4J9F A;  2KT8 A;  1UJY A;  2RNA A;  2F2X A;  2KRS A;  3VS6 A;  2FPE A;  3REB B;  3NPF A;  1MV0 B;  2GNC A;  3I35 A;  1WFW A;  2VVK A;  2VWF A;  4AG1 C;  2DBM A;  1UHF A;  1NLO C;  1UEC A;  1UDL A;  1H3H A;  3THK A;  2EYZ A;  3EG1 A;  2O2O A;  1LCK A;  2J06 A;  1GFD A;  1K76 A;  1W70 A;  1QKX A;  1NM7 A;  1U3O A;  2RQV A;  3VS2 A;  4RTW A;  1K0X A;  1UG1 A;  1GCP A;  1HJD A;  1OPL A;  1K4U S;  4F14 A;  1I0C A;  2LCS A;  2D0N A;  1WX6 A;  2AZV A;  2HSP A;  2DL3 A;  4J9I A;  4A63 B;  1UFF A;  1K1Z A;  2CSI A;  2ENM A;  1ARK A;  1X43 A;  2DL4 A;  1M3B A;  2EGA A;  2ROT A;  5I22 A;  1X6G A;  2J6K A;  2J6O A;  4RTV A;  3EHQ A;  4QT7 A;  1FYN A;  4J9G A;  4CC7 A;  4F17 A;  1NLP C;  3UF4 A;  1YWP A;  1SRL A;  2EYY A;  1KJW A;  2DRM A;  1QKW A;  3NMZ C;  3EG2 A;  1ZX6 A;  2M0Y A;  3JV3 A;  1AEY A;  4HVU A;  2LJ3 A;  2JW4 A;  4Z89 A;  3GBQ A;  3M0R A;  1QWE A;  2DIL A;  4OMQ A;  2NWM A;  3VS4 A;  2KR3 A;  4Z88 A;  2DYB A;  2OI3 A;  4EIK A;  2HBW A;  2CT3 A;  1M30 A;  1YNZ A;  1TUC A;  1YP5 A;  1E7O A;  5FWC A;  3EGU A;  4LUE A;  4J9D A;  2J05 A;  4X1V A;  3H41 A;  2KNB B;  1UJ0 A;  2GBQ A;  2GTJ A;  1PRM C;  3REA B;  2CDT A;  2EYX A;  1JXM A;  4AFS C;  2KYM A;  1RUW A;  2CRE A;  4RTT A;  1NG2 A;  2ESW A;  3KFV A;  1GRI A;  2D8J A;  1T0J A;  2FRY A;  2L3P A;  4D8K A;  3VS3 A;  1GFC A;  3PVL A;  1ABQ A;  2YUQ A;  1I07 A;  4HVW A;  1M27 C;  2K9G A;  2JTE A;  2MCN A;  2CT4 A;  4JJD A;  4OML A;  2O9V A;  4LE9 A;  3ULR B;  2KE9 A;  2CSQ A;  2FRW A;  2YDL A;  1VYV A;  2LX7 A;  3CQT A;  3SEM A;  1WXB A;  2K2M A;  1U5S A;  2EKH A;  2YUP A;  4RTZ A;  2FEI A;  3M0P A;  5FW9 A;  1OV3 A;  2LMJ A;  1AD5 A;  1Y0M A;  4J9B A;  1QCF A;  1AWX A;  2BZ8 A;  4OMN A;  3O5Z A;  1Z9Z A;  4LUD A;  5IXB A;  1J3T A;  1ZSG A;  2DL5 A;  3SHW A;  2KXD A;  2EQI A;  1H8K A;  4JJC A;  4RTU A;  4ESR A;  4JZ4 A;  2ABL A;  2DLP A;  4JPB W;  4Z8A A;  2LNH B;  3TSW A;  1W6X A;  5IH2 A;  3R6N A;  3U23 A;  1Z9Q A;  1GBQ A;  1QWF A;  2FPD A;  1UHC A;  4HVV A;  2ECZ A;  2AKK A;  1B07 A;  2LJ1 A;  2I0N A;  2RQT A;  2PTK A;  2H8H A;  1BBZ A;  1ZUY A;  1RLQ C;  2SEM A;  1VYU A;  1K0S A;  1EFN A;  2B86 A;  3H0I A;  3M0S A;  2KT1 A;  1WI7 A;  2A28 A;  2MOX A;  4Y92 A;  4F16 A;  1RI9 A;  4RUG A;  2DE0 X;  1X2Q A;  5EC7 A;  2JS2 A;  2YT6 A;  3EHR A;  4RTX A;  2F2W A;  3LH5 A;  4WCI A;  1ZUU A;  2EVR A;  2JXB A;  2RQR A;  2VKN A;  2K6D A;  3I9Q A;  1WXT A;  1BU1 A;  3EG3 A;  3H0F A;  2AZS A;  1ZUK A;  2A37 A;  2LZ6 B;  2DX1 A;  5IHK A;  2DVJ A;  2HDA A;  2RN8 A;  1WDX A;  1KFZ A;  3TVT A;  3EG0 A;  4GBQ A;  1GCQ A;  2C0O A;  2RQW A;  3UA6 A;  1I1J A;  2K79 A;  2A08 A;  2K7A A;  4J9H A;  1M3A A;  2DJQ A;  1BB9 A;  1E6H A;  2GTO A;  1HSQ A;  1WYX A;  1N5Z A;  1WLP B;  1ZLM A;  2CUB A;  2L3Q A;  1NEB A;  2PZ1 A;  1X6B A;  1GBR A;  2DA9 A;  2V1Q A;  1SPK A;  1VA7 A;  2OAW A;  2JM8 A;  2IIM A;  4IIM A;  1M8M A;  4HCK A;  4J9C A;  3RBB B;  2X3X D;  1A0N B;  2DL8 A;  1SHF A;  2KYB A;  1VYT A;  3VS0 A;  3TSZ A;  1SSH A;  1HD3 A;  2G6F X;  3QWX X;  2BZY A;  1G83 A;  2LP5 A;  4OMO A;  1YN8 A;  4K11 A;  1X27 A;  2KRO A;  2O9S A;  5IXF A;  2W0Z A;  1NYF A;  2W10 A;  1E6G A;  1JQQ A;  1X69 A;  2JM9 A;  2DBK A;  1K9A A;  1PNJ A;  4JJB A;  2EW3 A;  4AFZ C;  2XMF A;  2DNU A;  3FJ5 A;  4CC4 B;  2GQI A;  4KRT A;  2QDL A;  1CSK A;  2ED0 A;  4E6R A;  4R0K A;  4JZ3 A;  3UAT A;  2J6F A;  1WA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...