3EG0A

Crystal structure of the n114t mutant of abl-sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSTYITPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
total genus 12
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg0A00
3GBQA 1QKXA 2KRMA 4AFZC 2LJ0A 1W6XA 1PRLC 1T0JA 2M51A 4LNPA 1AEYA 4K11A 1GBQA 1W70A 2KNBB 1H92A 2G6FX 1K9AA 2J05A 2X3WD 5GJWB 1YCSB 2A08A 4JJDA 2KXCA 1LCKA 4AFUC 2OI3A 2FG0A 1JXOA 1U3OA 2GNCA 2DX1A 1XOVA 4M4ZA 2SEMA 2L3SA 4HCKA 2B86A 2YDLA 2O2OA 3REBB 5HCKA 1EFNA 2I0NA 2QDLA 1WFWA 3VS6A 1T3SA 1MV0B 4DEXA 2O9VA 3H0HA 1X69A 2J6KA 3EG3A 2DF6A 4GLMA 1TUCA 2RQWA 2CT4A 4QT7A 2CUDA 1E6HA 4J9DA 2DBKA 5EC7A 1NEGA 4KRTA 1JO8A 2PTKA 4R0KA 4RTWA 2DL5A 2BTTA 2JTEA 1UJ0A 1AWOA 2JS2A 1VYVA 3VS5A 3KFVA 4J9GA 2KBTA 3EHQA 3EG0A 1VYTA 2LJ1A 1AWXA 2KRNA 2DL3A 1NEBA 4HVWA 2BZ8A 2HDAA 1K4US 1ZSGA 2KT8A 4LUDA 3NPFA 2XMFA 3EGUA 4OMNA 2HEQA 2MOXA 3NMZC 4LUEA 5GJVB 4Z8AA 2SRCA 2PZ1A 1K0XA 1GFCA 1OOTA 5ECAA 2PNIA 1G2BA 1GBRA 3LH5A 1RLQC 1YP5A 1M27C 1H8KA 1SHGA 2AZSA 3VS0A 2KYMA 4DEYA 1WI7A 1YN8A 1GFDA 1M3AA 4J9BA 4J9EA 5I22A 3SHWA 1AZGB 2AKLA 1NG2A 1E6GA 1NLPC 2FRWA 2J6FA 1HSQA 2NUZA 1QKWA 4D8DA 1VYUA 4JZ4A 4OMOA 1UGVA 1K0SA 4JZ3A 2JT4A 4CC3A 1JEGA 5IXFA 2F2VA 1UJYA 2A36A 2ENMA 4E6RA 4JJBA 3PE0A 1HD3A 1X43A 4X1VA 2A37A 5IH2A 2KYBA 2KT1A 1Y0MA 2W0ZA 2LZ6B 1PRMC 2J7IA 3C0CA 4WCIA 4F17A 1ZUKA 1YWOA 2EYYA 2YT6A 1JQQA 2F2XA 3I5SA 2K7AA 2L3QA 4RTZA 3TVTA 3VRYA 1V1CA 4GBQA 4HVUA 3REAB 1ARKA 1M3CA 2LCSA 3I5RA 2YSQA 3A98A 4A63B 3H0FA 4OMMA 2EBPA 1AVZC 2DBMA 4OMPA 1ZX6A 1AZEA 4RTTA 2D0NA 3UATA 1MV3A 3VS2A 2EGAA 3FJ5A 1T0HA 1ZUUA 3ULRB 3EG2A 1OPLA 2DL8A 1ABOA 2ED1A 2YUPA 1UHFA 1E7OA 1HJDA 2EGCA 1A0NB 1B07A 2JXBA 3I9QA 3U23A 2ROLA 1PNJA 1PKSA 2JW4A 5IHKA 3I35A 2EVRA 3TSZA 1CKBA 2EGEA 2LQNA 1QWFA 1UFFA 2RNAA 2CH4W 2LX7A 5IHIA 1GCPA 2F2WA 4RTVA 2MIOA 2KR3A 2AZVA 3VS4A 1K1ZA 1YNZA 3QWYA 1JXMA 3UA7A 2GBQA 4OMQA 2X3XD 4D8KA 4CC2A 4CC4B 2DNUA 2ROTA 1W1FA 5I11A 1FYNA 1WDXA 1NLOC 1Z9QA 2DRKA 4LN2A 2A28A 2KRSA 4JJCA 2FPEA 4EIKA 1SRMA 5L23A 2FPDA 2LQWA 3EHRA 4RUGA 1NYGA 2L2PA 2RQVA 1M8MA 2FRYA 2EYWA 1UHCA 2FO0A 2EYXA 2V1QA 2DL7A 1X6BA 1MUZA 1WXTA 2RQUA 5FW9A 4ZNXA 4JPBW 1WXBA 1FMKA 1QWEA 1ZBJA 1X2QA 2RPNA 2DE0X 3H41A 2RQTA 1X27A 1WXUA 2AKKA 2KGTA 3RBBB 4HXJA 2K79A 5FWBA 3VS3A 2CDTA 2RQRA 2L3PA 2VVKA 4IIMA 5IXBA 2JMCA 4HVVA 3R6NA 1AWWA 1I1JA 1PKTA 1M30A 2GQIA 1PHTA 1OEBA 1SSHA 2EKHA 2EW3A 1IO6A 1RUWA 1SHFA 1Z9ZA 1AWJA 1CSKA 2K9GA 2DLPA 1PWTA 3M0UA 1CKAA 4Z89A 2KROA 1BK2A 2DYBA 2DL4A 1X2KA 1VA7A 2FPFA 1KSWA 2DVJA 2DMOA 2FEIA 2DRMA 1ZUYA 2YUOA 2OJ2A 1SEMA 1KIKA 3ZL7C 2LNHB 1QLYA 4J9CA 2DA9A 1K76A 1GCQC 3UA6A 4F16A 2D8JA 2K2MA 3VS7A 3M0QA 2JS0A 1ZLMA 2J6OA 2V1RA 3EG1A 2KXDA 1TUDA 2KE9A 2J06A 2BZYA 2HBWA 2JM8A 1AD5A 1WA7A 2CT3A 3M0PA 1M3BA 2GTJA 2MCNA 3RNJA 1WX6A 1AOJA 1UTIA 3NGPA 3M0RA 4AG2C 2RF0A 1NYFA 2KEAA 3M0SA 2IIMA 2HSPA 2C0IA 1UECA 2CREA 1OPKA 2DM1A 3IQLA 1I0CA 2JMAA 2H8HA 3CQTA 2YUNA 4Z88A 4RTYA 2CSQA 5IHNA 3TSWA 1BU1A 4AFQC 2O31A 2ABLA 2D8HA 2E5KA 1TG0A 3VS1A 2VKNA 1UE9A 2O9SA 2RMOA 1SRLA 1H3HA 1GL5A 3H0IA 2ECZA 3UF4A 2L0AA 2LP5A 1QCFA 1Y57A 1I07A 2C0TA 2EQIA 1WIEA 4IIOA 1ABQA 2K3BA 2DILA 2ESWA 1BB9A 2BZXA 2HCKA 2P4RA 2W10A 2M0YA 1SPKA 1B3QA 4RTUA 2JM9A 1UUEA 3SEMA 2CUBA 3PVQA 1RI9A 3THKA 1WLPB 1GRIA 4CC7A 2NWMA 3QWXX 1KJWA 4AFSC 1NM7A 2LJ3A 3PVLA 1J3TA 3O5ZA 4AG1C 2YUQA 4J9IA 1RLPC 3NHNA 1BBZA 1KFZA 2O88A 1X6GA 2VWFA 2RN8A 1UDLA 1U5SA 1N5ZA 1GCQA 4OMLA 4FSSA 1JU5C 4J9FA 4Y92A 4J9HA 3VRZA 1YWPA 2CH4A 2OAWA 2EPDA 1U06A 1G83A 3M0TA 5FWCA 2D1XA 2DJQA 2AK5A 2EYZA 2GGRA 2K6DA 2ED0A 2LMJA 1T3LA 4ORZA 1UG1A 4ESRA 3JV3A 2GTOA 4LE9A 1OV3A 1WYXA 4RTXA 4F14A 2CSIA 2C0OA 1S1NA
chains in the Genus database with same CATH superfamily
2EAYA 2FYKA 3GBQA 2HL5C 1I8FA 1HXDA 3OSVA 3C95A 2P4TA 3HP9A 1WPYA 1S72T 3L2VA 3GOXA 2AT1B 2G6FX 1K9AA 2X3WD 5GANf 4FT4A 2VASA 4JJDA 3I56A 2X35A 4KUDK 2QASA 4M75E 3CC7T 1XOVA 2LC4A 3X28B 1VQMA 1VQPA 4HCKA 4OB0B 5CAIA 2B86A 2XI9A 2O2OA 2QDLA 2I0NA 3CCEA 1WHLA 5CK9A 4DEXA 2YWWA 1QVFP 3X24B 3EG3A 2DF6A 1D1BA 2NUTB 4C8QE 2CT4A 5FU6B 2AHJB 4PFOA 2PU9B 2HMAA 4M75D 5CCAA 4DBQA 3DLLA 3A8HB 2CP5A 4KRTA 1JO8A 4M77B 1RI0A 3CCVT 2BTTA 4PJNA 2JTEA 5GAN2 2JS2A 1WJSA 2DJZA 2RA2A 2RJDA 3JCMJ 2KBTA 4C8QD 2NUPB 1AWXA 2QXFA 1Q7YR 3A1PA 4HVWA 1P92A 4ZN1A 5GAOq 5D6XA 2XMFA 5GJVB 3PMIA 4KH1B 3PTAA 1OOTA 4M7DD 3M5AA 4E2FB 3HRUA 1ZBXA 3ASKA 1YJNQ 1YP5A 3QJ6A 4F7UG 3JCMg 3G4ST 4F7UF 3EG9A 1FX7A 3QSUA 3MO8A 3QO3A 5M9OA 2FRWA 2J6FA 1AHJB 2NUZA 1MNDA 4D8DA 1VYUA 4FYYB 5LJ5j 3CMEA 4JZ4A 4OMOA 3NFCA 1BIBA 1WJRA 2DEQA 4A4GA 2LNVA 4J83A 2F2VA 1UJYA 2A36A 2ENMA 3A8OB 1ACMB 3MCAB 2J7IA 1ZUKA 2V26A 2OTLA 3J81E 2ZPBB 2K7AA 3TVTA 3VRYA 1V1CA 3RR6A 3REAB 4LDVA 1PD1A 2LCSA 1D0XA 1AVZC 3NTHA 4OMPA 3OYDA 1ZX6A 1AZEA 2K5IA 3E9GA 4RTTA 1YI2T 3L2RA 1OYXA 2K3YA 4A53A 3FJ5A 2RJCA 4KGZB 5IT9E 1EX4A 4O6JA 2EIFA 2XG8D 2K57A 1M5Q1 2EGCA 3I9QA 1PSEA 1YHQT 4BI4A 2O4XA 4M7DB 4X9DA 3CPFA 2WACA 2P0KA 1CKBA 2EGEA 3BW1A 2RNAA 2YLBA 3PIPA 3M4GA 5HY6A 2CH4W 5IHIA 1SSFA 2HQEA 2QTVA 3OYHA 3VS4A 2KK4A 1YITQ 3MPUB 3FEOA 1M2OA 5FLXE 2LVMA 1JXMA 1YJ9T 1M90U 4RMOA 4OMQA 1NBEB 3DB4A 3SDZA 1K8AU 4JRIA 2JZ2A 1N8RC 4C0FA 4F7UA 4MZPA 2DNUA 2OX7A 4OMFB 1VQOA 1QVFA 2DEUA 1WDXA 1PSFA 4RG2A 1G3TA 4C8QA 1NLOC 1YIJA 2DRKA 1PCXA 4JLGA 2WSEE 3GIBA 1SRMA 1K9MR 3OW2P 2LQWA 2EQMA 1NYGA 3E9FA 2I2LA 2L2PA 2EYWA 4HCZA 2E6NA 3MJXA 2V1QA 3HFNA 3QXEB 3OS5A 1WXBA 1M9SA 1X2QA 2MI6A 2RPNA 5GAMf 3CCJT 4FYVB 2KGTA 1WXUA 2E4HA 2EWNA 4XU1A 2FVUA 5GAOn 3VS3A 1Q81U 8ATCB 4JDSA 1YITA 5IXBA 2E1HA 1TXQA 2CP0A 2JMCA 4HVVA 4MZMA 1I1JA 1K9MU 2VGMA 3PMTA 3CC2A 3CC2Q 1OU9A 1SSHA 2EKHA 2DERA 7AT1B 2Y4YA 1CSKA 5GAMh 4ZTJA 1YIJQ 1BK2A 2K2VA 1X2KA 1IGQA 3CEYA 4EPCA 3MKDA 3PGGA 3ZL7C 5GAOl 4AMCA 1M1KR 4PJOG 3FDRA 1M1GA 4PJOD 4F7UE 2X4JA 4PJOF 2QEXA 1B7TA 1U8RA 2A0FB 4XTZA 1GCQC 4IUUA 1VQNT 2QI2A 2RHXA 3UA6A 1V29B 3VS7A 3MP1A 4FT2A 1ZA1B 4KBMB 1O9SA 2JS0A 3CBPA 1ZLMA 3EG1A 1TUDA 3BDLA 2BZYA 4C0GA 3M0PA 1M3BA 4ZTFA 4BY6B 3OYGA 1UTIA 1VQ9T 3CMAA 3JCMP 2JTFA 2P84A 2FZGB 5CQYA 2KEAA 3G71T 1VQ8Q 3H9NA 1VQ6T 3JCMb 2WSFE 4C0DC 5LJ5h 3OS0A 1QVFS 1KQSA 2JMAA 2RHZA 2A7YA 1UGPB 2E5KA 3I56T 5GAOm 3CCLA 1KK7A 4JS5A 3X26B 3H0IA 3UF4A 4M7AB 4B9WA 2XDBA 4LDUA 1I07A 5FU7C 4DBHA 1WIEA 4IIOA 1ZSZA 2K3BA 2DILA 1BB9A 3OYAA 2BZXA 1IGUA 4RCBA 2P4RA 4LDYA 3VYHB 3EH2A 4QQDA 1VQ7Q 1UUEA 1WJQA 1OQKA 1UGQB 1WZOA 3OYBA 4BDYA 2L3RA 3MEVA 1WQ7A 2RH2A 2E64A 1ZHIA 1WHHA 1Q81R 3OYEA 4DOVA 4C92C 2RK2A 3CCJQ 4XTYA 1V76A 1FXXA 4BI8B 1J3TA 1OZ3A 3PVLA 4AG1C 2XD0A 4J9IA 1UEBA 3M54A 1WGSA 2X4YA 2O88A 3SWNC 4M7AC 1UDLA 1WHGA 1YJWQ 2JVVA 4JUVA 2K4YA 2QA4Q 1N5ZA 1GCQA 4OMLA 1NJIC 5DY9A 4J9FA 2HD0A 3C4SA 1YWPA 2OAWA 3CXCP 1U06A 1XNIA 5FWCA 1D1AA 2D1XA 2DJQA 4M7DG 2EYZA 4ESRA 2GTOA 4LE9A 1MMGA 3CBOA 2JUFA 4C92B 1YJNT 1Q82C 1W2BA 3OW2S 5A0GA 1WHKA 2D0QB 1QMCA 1BCOA 1W6XA 2E12A 1C0MA 4ZGEB 1M2VB 2NYSA 4LNPA 3QZ5B 2KNBB 4RG8A 3V7RA 3JB9H 3M53A 3P8HA 1S72A 1Y71A 1WNLA 4V2SA 4JRKA 2GFUA 3ZFJA 3HPWA 8AT1B 1LCKA 3OYNA 3FRNA 2F5TX 1PM3A 2OI3A 3CC7Q 2DX1A 4M4ZA 2SEMA 1Q7YU 3RKWA 5GANd 2DK3A 5HCKA 3TCJA 1EFNA 1WFWA 2CZ1B 4XK8E 1T3SA 5KCOA 3H0HA 1OI1A 2J6KA 4XTVA 3DLMA 2K5LA 4P5NA 1TUCA 2DO3A 5CIUA 2BKDN 1IB8A 1OX8A 3GF5A 4F04B 2DBKA 5DLOA 2PUKB 5KYXA 2EFIA 2PTKA 2Y4XA 3EG9B 3M56A 2VGNA 1UJ0A 3CPWP 1AWOA 1RAHB 4FM4B 1VYVA 4WF2A 3KFVA 3WVDB 1KQ1A 4J9GA 4JJNK 3D7SB 1VQKA 2KY9A 2KRNA 4FU6A 1OX9A 3CCLT 2BZ8A 1KC8C 4LUDA 3C12A 2IVWA 3NPFA 3EGUA 4OMNA 4QQ6A 1UB4A 4LUEA 3I55Q 4M7AG 1YIJT 1TU0B 1K0XA 1GFCA 2EQKA 4QVZA 4XU2A 3G7ZA 2X4WA 5KE2A 1VQMQ 1G2BA 1GBRA 1AT1B 1Q86R 1RLQC 1M27C 1SHGA 1OU8A 3CCVA 1NJIR 2KYMA 4DEYA 3JB9I 1WI7A 1M3AA 4J9BA 4J9EA 5I22A 1AZGB 5HK0A 1M1FA 3MEAA 1NG2A 5LJ5d 1E6GA 1NLPC 3EGDA 3TQ7P 1HSQA 3PNWC 5GMKj 1QKWA 3LGFA 2QQBA 1ZA2B 1UGVA 3WXMB 1K0SA 4C0ZA 3CCQT 4JZ3A 3DB3A 4FL6A 3VV0A 2FB7A 1JEGA 5IXFA 1G8XA 2V8KA 3OS2A 3JCMc 3E1SA 4KULA 1I81A 5KYUA 1X43A 4X1VA 1SKUB 1NPPA 1VQPT 1M1KC 4M7AA 2W0ZA 1G3YA 4C8QC 2O4XB 5GMKi 4KT0E 1BI1A 4M7DA 2LRQA 5I2MA 4F17A 1BI2A 1K8AC 3OYLA 1YWOA 1JQQA 1FMVA 1M90C 1IREB 4GBQA 4HVUA 3I5RA 1B34A 4QW2A 4M78C 2ZGWA 2FZCB 3OYIA 2DBMA 3CC4A 3E2UA 4M78F 5GAN8 4C5GA 2MYSA 3TREA 4PLLA 5CQXA 1MV3A 4M77C 2EGAA 1OULA 2LX9A 4PKCC 1ZUUA 1W2BS 3ULRB 4N4IA 2YUPA 2DL8A 5LJ3e 1E7OA 1HJDA 3U23A 5GAMg 2JW4A 5FU6C 3M58A 3V7CA 4M7DE 3I35A 3CCQQ 2QDYB 2ZCFB 3TSZA 5A0DA 5KYYB 2LQNA 2L8DA 3INZA 3CCRT 2OTJT 4X9CA 2F2WA 4E7SA 4JS4A 2QTXA 3RIRA 4RTVA 1K9MC 2MIOA 1K1ZA 3G71Q 3BY7A 1YNZA 3QWYA 3CPWA 4QKUA 2E5QA 2DFUA 3CCRA 1NPRA 1YBYA 3UA7A 2DXBA 2GBQA 2EYQA 2MK5A 2X3XD 3M9QA 1VQLT 3CMEQ 4CC2A 3JCMX 5KH6A 4DOWA 4IUPA 4DBFA 1FYNA 3OS1A 4OVAA 5HKCA 4BI3A 4JJCA 4JRPA 2VUBA 5CKEA 4EIKA 2FZKB 2FPDA 2KSSA 3HL8A 4RUGA 3FIFA 1M4ZA 4MZTA 2DTHA 1VQ6Q 2COZA 2ZZDA 1X6BA 1MUZA 4PFPA 5GAMd 4ZNXA 4XU3A 1FMKA 1ZBJA 2DE0X 3H41A 4IKFA 1QCNA 3UDCA 4EMKB 2RJEA 4HXJA 5FWBA 3QYGB 2RQRA 3A8LB 2L3PA 3CCMA 3H6ZA 3R6NA 1D3BA 4BY6C 1VQNQ 3OMGA 2JJ9A 3GP8A 1PKTA 1M30A 2GQIA 1PHTA 3ME9A 1IO6A 1SHFA 1D0YA 4M77A 1VQ5Q 5GAN5 5KYUB 3KBGA 3MP6A 2FEIA 3RMSA 1TWBA 2DRMA 2YUOA 1SEMA 2LNHB 2EJ9A 1QLYA 1R0CB 1X75C 1VUBA 3CC2T 4BD3A 2DA9A 1QP2A 1K76A 4E7HA 1VQPQ 1JBMA 1K73U 4F16A 2L89A 4C8QF 2QYZA 1QVGP 3V7SA 2KE9A 4R55A 2HBWA 2VV5A 3OQ5A 3I56Q 3WVEB 1BCMA 2GTJA 2MCNA 1WX6A 2DZCA 1JJ2A 1VQKT 1M90R 1Y7XA 1NYFA 2A3LA 3FLGA 5LJ5g 3OYFA 5CO7A 4C92D 4JRQA 4L5GA 1OPKA 2GCXA 1MMAA 3SWNB 1I0CA 1BI0A 4N0AC 4Q5WA 2YUNA 3TSWA 4RTYA 2CSQA 3L2UA 2O31A 4JLIA 3VS1A 3LYIA 4WTOB 1UE9A 5AYFA 2ECZA 2L0AA 4J8OA 4XTUA 2EQIA 4PL6A 3CCST 5CR2A 4OB3B 2Y90A 4QVCA 5LJ5f 1YJWA 1VOMA 2YXYA 4ZN3A 2M0YA 2GFAA 1BKBA 2PVDB 3SEMA 3L2ZA 1FMWA 1RI9A 4E7IA 4BE0A 3MEUA 3LX7A 3CBMA 3QDFA 4CC7A 1TTHB 2NWMA 1KJWA 2QGGA 4FYXB 3QZ9B 2YUQA 4BE2A 5GANj 1BBZA 3CC4Q 1M2VA 2LT1A 3JB9J 1YHQA 4PJOE 2CP6A 1Q7YC 3S6WA 1JU5C 3UPUA 1D0ZA 3LWHA 2COYA 5GANg 2EPDA 1KQSS 5FRMA 3T9NA 2GGRA 2LDMA 2K6DA 1H3ZA 2ED0A 1T3LA 4ORZA 2X9HA 4F14A 2CSIA 1S1NA 3VYGA 2E3IA 2VYTA 4N0AA 4B9XA 2LJ0A 1EZZB 2M51A 1VQ4Q 3BE3A 1GBQA 1KC8U 1H92A 2MF2A 2J05A 5GJWB 3OW2A 2D9TA 2A08A 4KH0B 2EQUA 1N27A 4PK4A 4ANJA 1ZSZC 2XIDA 2LQ8A 4AFUC 2HQXA 5CKHA 2FG0A 2RJFA 4FW1A 4OB1B 1OZ2A 1MMNA 5D6WA 1YCYA 1DJ7B 5A0LA 2KI7A 3X20B 2YDLA 2RHIA 4E7KA 4Y28E 1KD1R 3EFOB 3VS6A 2R5AA 2M02A 3ZBDA 3P8BB 3RKXA 2ZAEA 3QG1A 5LJ3g 3CMET 3G71A 3URGA 5FRNA 3CD6A 2CUDA 1E6HA 1VQ7A 2H3EB 5C0MA 4DQ2A 2HQHA 3EAEA 4VUBA 1NEGA 4XU0A 3KXTA 5GANh 3CCSQ 5FU7B 2ZPIB 3VS5A 3EGXB 5A2QE 4N4GA 2GF7A 2LJ1A 2QEXT 2DXCA 1Q82R 3AT1B 5GAOr 4HT8A 2DL3A 2HDAA 1TSFA 3L1AA 5AT1B 3JAME 2M0OA 4L59A 4C5IA 2MOXA 3NMZC 2MAMA 4MMLA 5CKFA 5EG2A 2XKOC 3I55T 5ECAA 2DTOA 4GY5A 1Q81C 2LCLA 4FSXA 5LJ3j 2XICA 1W2BP 4LDWA 1WHJA 1H8KA 2F69A 3G6EA 3MHXA 2AZSA 2P0QA 3VS0A 5KYXB 2IG0A 4FCYA 1YN8A 2O01E 1GFDA 4IUTA 3JCMQ 2AKLA 4C8QB 3CCMT 1KQ2A 3SWNA 4A4KA 1XJWB 2E41A 2JOYA 3BDUA 3P8DA 3DKMA 4CC3A 1RAGB 4KGVB 3CCJA 3PFSA 5LJ5e 1QVGA 2CYZB 1LJOA 3PE0A 3SB2A 5IH2A 3JCMh 2KYBA 2KT1A 3JCMf 1PRMC 3C0CA 4WCIA 4LD6A 1KD1C 5GAN4 2EYYA 1VQ5T 4D6WA 2L3QA 2RI2A 4OB2B 4KGXB 1ARKA 3OMCA 1M3CA 5D7UA 2YSQA 2R5MA 1GXIE 3H0FA 4OMMA 3RKYA 2R57A 1VQOT 5IN1A 4FYWB 2ZPFB 1K73R 3OY9A 1HYOA 1G3WA 3FB9A 4UC4A 1UGRB 2D0NA 3R6OA 4E7ZA 4BDZA 2BUDA 1OPLA 3UT1A 1ABOA 2ED1A 3LLRA 3CCUT 2QAZA 1B07A 1D09B 2JXBA 3JRZA 4M7AE 4HT9A 1G5VA 1PG5B 2HZYA 1RAFB 2KMTA 1TOVA 5HK3A 4M75C 1UFFA 1YJ9A 2PQWA 1X6OA 3S3OA 4Y91A 2NUTA 1GCPA 4PJJA 1RACB 1M1KU 3LH0A 2RM4A 5CKDA 4J7FA 3EFSA 1XTDA 5J39A 3Q1JA 2X51A 4IUVA 4XTWA 3M55A 3OYYA 2EJFA 4C92A 2DTIA 4O5VA 4D8KA 2QK0A 4CC4B 3S3MA 2MMPA 3CMAT 2HKNA 2ZPGB 5I11A 1MMDA 4C92G 3CC4T 1RAIB 4C92F 2D6FA 2NUPA 2A28A 3SFMA 1NJIU 2VC8A 4EMKC 5L23A 4M77E 1N9SA 1YJ9Q 3EHRA 2COWA 3C94A 1VQNA 1M8MA 2FRYA 2DVEA 4M78A 2FO0A 3G1JA 2DL7A 1K73C 1QWEA 4B6MA 4MDXA 1N8RU 2RQTA 2QQRA 3RERA 4J6WA 2AKKA 3RBBB 4M77F 3OB9A 4IURA 4LD9K 4M77D 1VQKQ 2CDTA 2HKQB 5KE3A 3NTKA 2VVKA 4OGEA 2DD5A 2JN0A 3OBYA 2V8JA 2HBPA 2PUOB 2CZ6B 1OEBA 2RI3A 3G4SA 5FROA 3EFRA 2DKGA 1RUWA 2HAXA 1R77A 1MGQA 1AWJA 1VQLQ 2XDDA 2DYBA 1VA7A 1YHQQ 2HL3A 5GAN7 2DVJA 2XK0A 1ZUYA 4TVRA 2OJ2A 1KIKA 1LPLA 3LGLA 4R56A 3NTIA 1Y07A 4RCCA 3EH1A 3JB9D 1YFNA 1N9RA 2CP7A 1VQ6A 2D8JA 1VQ4T 3L2WA 5GAN3 3M0QA 4RKUE 2V1RA 4M7AD 1MHNA 2J06A 4HCCA 4M7AF 2JM8A 2X4XA 1WA7A 2YRCA 4IUQA 1AOJA 1N6AA 3CPWS 2DYIA 2JNGA 3M0SA 3EGDB 1UECA 3JCMW 1K8AR 1IHWA 1FWZA 3IQLA 2F5KA 3A8MB 3CQTA 4Z88A 5IHNA 3QDRB 1BU1A 2FHDA 2ABLA 3CCUQ 4PJOA 1LVKA 2V8IA 2PVOB 2DPPB 1SRLA 3V8JA 1H3HA 5CKBA 2LP5A 5GMKm 4L6V5 2QQ9A 2C0TA 2CP2A 2DD4A 4AT1B 3QYHB 4Z02A 1WHMA 3G4SQ 2ZPEB 4M75A 4C5HA 1XQHA 1I5LA 1B3QA 4RTUA 2HNIA 2CUBA 2C06A 1Y96A 3HRSA 1WLPB 1GRIA 4C8QG 2YRDA 4E7JA 3QPHA 2QQAA 1YI2A 4J6YA 4AFSC 1JJ2S 3QKJA 2MWPA 3O5ZA 3NHNA 1KFZA 1UGSB 1X6GA 1H641 2VWFA 1VQ9Q 1U5SA 1TUGB 3LW5E 4PNOA 4PJMA 1YITT 4FSSA 1C6VX 4ELYC 3S3NA 4J9HA 1WQWA 1Q86U 5GMKl 3M57A 2AK5A 2LMJA 3CCLQ 1QCOA 3CCUA 5L8RE 1OV3A 1WYXA 3EFOA 2C0OA 2RO0A 5I21A 4C92E 5GAMe 1QKXA 2KRMA 3VKIA 5GMKe 4A54A 4AFZC 4ZGDB 1TH7A 9ATCB 1PRLC 1VQ8A 1B34B 1T0JA 4EMGA 3M4YA 5LJ3d 1AEYA 3QUIA 4K11A 1KQSP 1W70A 5LL6S 3GLXA 1Q95G 5I2SA 1YCSB 2KXCA 1TS9A 1KG1A 1RABB 2CS7A 2RB6A 4HKEA 3A5ZB 1JXOA 1U3OA 3EGXA 1R0BG 2GNCA 2LQKA 3PT9A 4PJLA 2L3SA 1KC8R 2GQVA 1Q82U 3N5BB 4XAXB 4PJOC 3REBB 1O75A 1QQJA 4FIBA 4PLIA 2YRVA 5KYYA 1MV0B 3GPLA 2O9VA 3TU4K 1X69A 4GLMA 4OF1A 3OA6A 4BE1A 3GNFB 3X25B 2RQWA 4M7DC 5DLQE 4QT7A 3JB9G 3MP8A 4J9DA 1QP3A 2XU8A 1U1TA 2R58A 3PIOA 5EC7A 4R0KA 4RTWA 2DL5A 3OYMA 3CCQA 4NOYA 2OTLT 4ME7A 2QA4A 2CZ0B 2MWOA 1KD1U 4PJOB 3EHQA 3EG0A 1VYTA 1C1AA 2DAQA 3JSCA 3V8KA 4BB7A 2DIGA 3BFMA 3CXCS 1NEBA 1LOJA 1K4US 2BE9B 1ZSGA 2KT8A 2CZ7B 4BUGA 2HEQA 5C6SA 4Z8AA 3RDVA 2SRCA 2PZ1A 2E3HA 1VQMT 2PNIA 5LJ3h 3META 5GAOp 1ZQ1A 5D6YA 3LH5A 2L5QA 2QA4T 4C5EA 4ELZC 4CI0C 3OYCA 2EKOA 1LNXA 3MEWA 1PD0A 4PFZA 3SHWA 1RL2A 4C0DB 2BE7D 2RI5A 4LDXA 3CD6T 1IZ6A 4MMKA 3FC3A 4XQ3A 3LWIA 2M1HA 2F1LA 2KAFA 2JT4A 4LXCA 1G3SA 1VIFA 2LTOA 2OTJQ 1YI2Q 3CCRQ 3OBWA 1QW1A 4E6RA 4JJBA 1HD3A 2A37A 2M16A 1Y0MA 2LZ6B 5GMKh 4II1A 2YT6A 3VJPA 2F2XA 1VQLA 4EMKA 3I5SA 3HKSA 4RTZA 2RHYA 3AHUA 3A98A 2CKKA 4M78E 4A63B 2EBPA 2K3XA 1BIAA 1KHIA 2E6ZA 1VQ8T 4EDUA 2RHUA 3UATA 2IPOB 3VS2A 1IXDA 2OTJA 2DXUA 1RAEB 1T0HA 4HCBA 3EG2A 4J6XA 2K5FA 2YHTA 1UHFA 1SF9A 2QG9B 5KCHA 5KYWA 3RESA 1A0NB 4M7DF 2DXTA 2ROLA 1PNJA 2Z0WA 3F70A 1PKSA 2KQWA 5IHKA 2DIQA 3VUBA 2EVRA 3CC7A 5DM7R 1VQ5A 3VUZA 3SD4A 3TEEA 4A4HA 1QWFA 1KHCA 2AIRB 2LX7A 1U1SA 3H8ZA 1NZ9A 4ATOA 1S72Q 4M78B 5GAMj 5J26A 2XHCA 4KUIA 2WSCE 2KR3A 2AZVA 2ZPHB 5GANe 2OAUA 2QEXQ 2DZ9A 4OGCA 2YLCA 4A4EA 6AT1B 2FL7A 2HSEB 3CCEQ 3JB9F 4A4FA 2ROTA 2LT4A 1W1FA 4HA8A 5J3BA 1JJ2P 2QGFB 1Z9QA 1I5OB 2MPXC 4LN2A 3UWNA 2KRSA 2FPEA 4NL2A 3OYKA 4BACA 3HTRA 4XTXA 3FJPA 2RQVA 3J80E 1IHVA 1UHCA 1QVPA 4J5YA 2EYXA 4ZGJB 2E10A 1WXTA 2RQUA 5FW9A 1X01A 3V8LA 4JPBW 3HHTB 1W4SA 2M9UA 3KUFA 2B8AA 4M75G 1F1BB 2VXFA 2E65A 1X27A 3A8GB 2K79A 3QIIA 4F7UB 1IRXA 3OSSC 4IIMA 1JB0E 2VXEA 2EJGA 1AWWA 1MNEA 3VU3C 3JCMe 1I4K1 2EW3A 5GAN6 1Z9ZA 2ATCB 1PC0A 2K9GA 3JCMV 2DLPA 1PWTA 3M0UA 1CKAA 4Z89A 2KROA 3CD6Q 2DL4A 3GNGA 1VQ4A 2FPFA 1VQ9A 1KSWA 2DMOA 2RD1A 4M78D 5KYWB 3HSBA 3M59A 4E7LA 4EMHA 4MDWA 2H3JA 4J9CA 2KVQG 3CXCA 3RMQA 1JRIA 2CGHA 5LJ3f 3OYJA 2K2MA 3CMAQ 2J6OA 2XDPA 2KXDA 1RAAB 1AD5A 2CT3A 3RNJA 1D1CA 4GLKA 3NGPA 4E47A 3M0RA 4AG2C 2RF0A 3G6ET 4M77G 3L2QA 1M8VA 2E70A 2IIMA 2HSPA 2C0IA 5CVIA 1Y96B 2CREA 1Q86C 2DM1A 2H8HA 3I55A 2RK1A 4AFQC 2NLUA 4N4HA 2PVGB 3CCET 2D8HA 1TG0A 1VIEA 1N8RR 2VKNA 1QVGS 2O9SA 2RMOA 3HFOA 1GL5A 4DA4A 1QCFA 3ZEHA 2CP3A 5IAYA 1Y57A 4M78G 1ABQA 2ESWA 3CCVQ 4NL3A 3G6EQ 1BYMA 1YJNA 3J7AF 1BI3A 2HCKA 2W10A 1R8OB 4QVDA 2JTMA 1SPKA 2JM9A 1VQ7T 3PVQA 4NS5A 3THKA 2G3RA 4DBRA 2QQSA 3QWXX 1HK9A 3HRTA 4YTLA 1NM7A 2LJ3A 2P0PA 2DETA 1RLPC 3E19A 2EQJA 2VB6A 3JCMd 5KYNA 3RUXA 2RN8A 3O8VA 3QBYA 1YJWT 1EIFA 2KDSA 3QHSA 4CRIA 3CCSA 4Y92A 3QJYA 2OTLQ 4OP0A 3VRZA 2CH4A 3L42A 1ZSZB 1G83A 3M0TA 4QQGA 1NE8A 4FW2A 4M75B 4X34A 3CCMQ 1UG1A 2LCCA 3JV3A 4M75F 1RADB 1VQOQ 3ER0A 4RTXA 2BIVA 1D3BB 1SG5A 4J7IA
chains in the Genus database with same CATH topology
3GBQA 1QKXA 2KRMA 4AFZC 2LJ0A 1W6XA 1PRLC 1T0JA 2M51A 4LNPA 1AEYA 4K11A 1GBQA 1W70A 2KNBB 1H92A 2G6FX 1K9AA 2J05A 2X3WD 5GJWB 1YCSB 2A08A 4JJDA 2KXCA 1LCKA 4AFUC 2OI3A 2FG0A 1JXOA 1U3OA 2GNCA 2DX1A 1XOVA 4M4ZA 2SEMA 2L3SA 4HCKA 2B86A 2YDLA 2O2OA 3REBB 5HCKA 1EFNA 2I0NA 2QDLA 1WFWA 3VS6A 1T3SA 1MV0B 4DEXA 2O9VA 3H0HA 1X69A 2J6KA 3EG3A 2DF6A 4GLMA 1TUCA 2RQWA 2CT4A 4QT7A 2CUDA 1E6HA 4J9DA 2DBKA 5EC7A 1NEGA 4KRTA 1JO8A 2PTKA 4R0KA 4RTWA 2DL5A 2BTTA 2JTEA 1UJ0A 1AWOA 2JS2A 1VYVA 3VS5A 3KFVA 4J9GA 2KBTA 3EHQA 3EG0A 1VYTA 2LJ1A 1AWXA 2KRNA 2DL3A 1NEBA 4HVWA 2BZ8A 2HDAA 1K4US 1ZSGA 2KT8A 4LUDA 3NPFA 2XMFA 3EGUA 4OMNA 2HEQA 2MOXA 3NMZC 4LUEA 5GJVB 4Z8AA 2SRCA 2PZ1A 1K0XA 1GFCA 1OOTA 5ECAA 2PNIA 1G2BA 1GBRA 3LH5A 1RLQC 1YP5A 1M27C 1H8KA 1SHGA 2AZSA 3VS0A 2KYMA 4DEYA 1WI7A 1YN8A 1GFDA 1M3AA 4J9BA 4J9EA 5I22A 3SHWA 1AZGB 2AKLA 1NG2A 1E6GA 1NLPC 2FRWA 2J6FA 1HSQA 2NUZA 1QKWA 4D8DA 1VYUA 4JZ4A 4OMOA 1UGVA 1K0SA 4JZ3A 2JT4A 4CC3A 1JEGA 5IXFA 2F2VA 1UJYA 2A36A 2ENMA 4E6RA 4JJBA 3PE0A 1HD3A 1X43A 4X1VA 2A37A 5IH2A 2KYBA 2KT1A 1Y0MA 2W0ZA 2LZ6B 1PRMC 2J7IA 3C0CA 4WCIA 4F17A 1ZUKA 1YWOA 2EYYA 2YT6A 1JQQA 2F2XA 3I5SA 2K7AA 2L3QA 4RTZA 3TVTA 3VRYA 1V1CA 4GBQA 4HVUA 3REAB 1ARKA 1M3CA 2LCSA 3I5RA 2YSQA 3A98A 4A63B 3H0FA 4OMMA 2EBPA 1AVZC 2DBMA 4OMPA 1ZX6A 1AZEA 4RTTA 2D0NA 3UATA 1MV3A 3VS2A 2EGAA 3FJ5A 1T0HA 1ZUUA 3ULRB 3EG2A 1OPLA 2DL8A 1ABOA 2ED1A 2YUPA 1UHFA 1E7OA 1HJDA 2EGCA 1A0NB 1B07A 2JXBA 3I9QA 3U23A 2ROLA 1PNJA 1PKSA 2JW4A 5IHKA 3I35A 2EVRA 3TSZA 1CKBA 2EGEA 2LQNA 1QWFA 1UFFA 2RNAA 2CH4W 2LX7A 5IHIA 1GCPA 2F2WA 4RTVA 2MIOA 2KR3A 2AZVA 3VS4A 1K1ZA 1YNZA 3QWYA 1JXMA 3UA7A 2GBQA 4OMQA 2X3XD 4D8KA 4CC2A 4CC4B 2DNUA 2ROTA 1W1FA 5I11A 1FYNA 1WDXA 1NLOC 1Z9QA 2DRKA 4LN2A 2A28A 2KRSA 4JJCA 2FPEA 4EIKA 1SRMA 5L23A 2FPDA 2LQWA 3EHRA 4RUGA 1NYGA 2L2PA 2RQVA 1M8MA 2FRYA 2EYWA 1UHCA 2FO0A 2EYXA 2V1QA 2DL7A 1X6BA 1MUZA 1WXTA 2RQUA 5FW9A 4ZNXA 4JPBW 1WXBA 1FMKA 1QWEA 1ZBJA 1X2QA 2RPNA 2DE0X 3H41A 2RQTA 1X27A 1WXUA 2AKKA 2KGTA 3RBBB 4HXJA 2K79A 5FWBA 3VS3A 2CDTA 2RQRA 2L3PA 2VVKA 4IIMA 5IXBA 2JMCA 4HVVA 3R6NA 1AWWA 1I1JA 1PKTA 1M30A 2GQIA 1PHTA 1OEBA 1SSHA 2EKHA 2EW3A 1IO6A 1RUWA 1SHFA 1Z9ZA 1AWJA 1CSKA 2K9GA 2DLPA 1PWTA 3M0UA 1CKAA 4Z89A 2KROA 1BK2A 2DYBA 2DL4A 1X2KA 1VA7A 2FPFA 1KSWA 2DVJA 2DMOA 2FEIA 2DRMA 1ZUYA 2YUOA 2OJ2A 1SEMA 1KIKA 3ZL7C 2LNHB 1QLYA 4J9CA 2DA9A 1K76A 1GCQC 3UA6A 4F16A 2D8JA 2K2MA 3VS7A 3M0QA 2JS0A 1ZLMA 2J6OA 2V1RA 3EG1A 2KXDA 1TUDA 2KE9A 2J06A 2BZYA 2HBWA 2JM8A 1AD5A 1WA7A 2CT3A 3M0PA 1M3BA 2GTJA 2MCNA 3RNJA 1WX6A 1AOJA 1UTIA 3NGPA 3M0RA 4AG2C 2RF0A 1NYFA 2KEAA 3M0SA 2IIMA 2HSPA 2C0IA 1UECA 2CREA 1OPKA 2DM1A 3IQLA 1I0CA 2JMAA 2H8HA 3CQTA 2YUNA 4Z88A 4RTYA 2CSQA 5IHNA 3TSWA 1BU1A 4AFQC 2O31A 2ABLA 2D8HA 2E5KA 1TG0A 3VS1A 2VKNA 1UE9A 2O9SA 2RMOA 1SRLA 1H3HA 1GL5A 3H0IA 2ECZA 3UF4A 2L0AA 2LP5A 1QCFA 1Y57A 1I07A 2C0TA 2EQIA 1WIEA 4IIOA 1ABQA 2K3BA 2DILA 2ESWA 1BB9A 2BZXA 2HCKA 2P4RA 2W10A 2M0YA 1SPKA 1B3QA 4RTUA 2JM9A 1UUEA 3SEMA 2CUBA 3PVQA 1RI9A 3THKA 1WLPB 1GRIA 4CC7A 2NWMA 3QWXX 1KJWA 4AFSC 1NM7A 2LJ3A 3PVLA 1J3TA 3O5ZA 4AG1C 2YUQA 4J9IA 1RLPC 3NHNA 1BBZA 1KFZA 2O88A 1X6GA 2VWFA 2RN8A 1UDLA 1U5SA 1N5ZA 1GCQA 4OMLA 4FSSA 1JU5C 4J9FA 4Y92A 4J9HA 3VRZA 1YWPA 2CH4A 2OAWA 2EPDA 1U06A 1G83A 3M0TA 5FWCA 2D1XA 2DJQA 2AK5A 2EYZA 2GGRA 2K6DA 2ED0A 2LMJA 1T3LA 4ORZA 1UG1A 4ESRA 3JV3A 2GTOA 4LE9A 1OV3A 1WYXA 4RTXA 4F14A 2CSIA 2C0OA 1S1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GBQ A;  1QKX A;  2KRM A;  4AFZ C;  2LJ0 A;  1W6X A;  1PRL C;  1T0J A;  2M51 A;  4LNP A;  1AEY A;  4K11 A;  1GBQ A;  1W70 A;  2KNB B;  1H92 A;  2G6F X;  1K9A A;  2J05 A;  2X3W D;  5GJW B;  1YCS B;  2A08 A;  4JJD A;  2KXC A;  1LCK A;  4AFU C;  2OI3 A;  2FG0 A;  1JXO A;  1U3O A;  2GNC A;  2DX1 A;  1XOV A;  4M4Z A;  2SEM A;  2L3S A;  4HCK A;  2B86 A;  2YDL A;  2O2O A;  3REB B;  5HCK A;  1EFN A;  2I0N A;  2QDL A;  1WFW A;  3VS6 A;  1T3S A;  1MV0 B;  4DEX A;  2O9V A;  3H0H A;  1X69 A;  2J6K A;  3EG3 A;  2DF6 A;  4GLM A;  1TUC A;  2RQW A;  2CT4 A;  4QT7 A;  2CUD A;  1E6H A;  4J9D A;  2DBK A;  5EC7 A;  1NEG A;  4KRT A;  1JO8 A;  2PTK A;  4R0K A;  4RTW A;  2DL5 A;  2BTT A;  2JTE A;  1UJ0 A;  1AWO A;  2JS2 A;  1VYV A;  3VS5 A;  3KFV A;  4J9G A;  2KBT A;  3EHQ A;  3EG0 A;  1VYT A;  2LJ1 A;  1AWX A;  2KRN A;  2DL3 A;  1NEB A;  4HVW A;  2BZ8 A;  2HDA A;  1K4U S;  1ZSG A;  2KT8 A;  4LUD A;  3NPF A;  2XMF A;  3EGU A;  4OMN A;  2HEQ A;  2MOX A;  3NMZ C;  4LUE A;  5GJV B;  4Z8A A;  2SRC A;  2PZ1 A;  1K0X A;  1GFC A;  1OOT A;  5ECA A;  2PNI A;  1G2B A;  1GBR A;  3LH5 A;  1RLQ C;  1YP5 A;  1M27 C;  1H8K A;  1SHG A;  2AZS A;  3VS0 A;  2KYM A;  4DEY A;  1WI7 A;  1YN8 A;  1GFD A;  1M3A A;  4J9B A;  4J9E A;  5I22 A;  3SHW A;  1AZG B;  2AKL A;  1NG2 A;  1E6G A;  1NLP C;  2FRW A;  2J6F A;  1HSQ A;  2NUZ A;  1QKW A;  4D8D A;  1VYU A;  4JZ4 A;  4OMO A;  1UGV A;  1K0S A;  4JZ3 A;  2JT4 A;  4CC3 A;  1JEG A;  5IXF A;  2F2V A;  1UJY A;  2A36 A;  2ENM A;  4E6R A;  4JJB A;  3PE0 A;  1HD3 A;  1X43 A;  4X1V A;  2A37 A;  5IH2 A;  2KYB A;  2KT1 A;  1Y0M A;  2W0Z A;  2LZ6 B;  1PRM C;  2J7I A;  3C0C A;  4WCI A;  4F17 A;  1ZUK A;  1YWO A;  2EYY A;  2YT6 A;  1JQQ A;  2F2X A;  3I5S A;  2K7A A;  2L3Q A;  4RTZ A;  3TVT A;  3VRY A;  1V1C A;  4GBQ A;  4HVU A;  3REA B;  1ARK A;  1M3C A;  2LCS A;  3I5R A;  2YSQ A;  3A98 A;  4A63 B;  3H0F A;  4OMM A;  2EBP A;  1AVZ C;  2DBM A;  4OMP A;  1ZX6 A;  1AZE A;  4RTT A;  2D0N A;  3UAT A;  1MV3 A;  3VS2 A;  2EGA A;  3FJ5 A;  1T0H A;  1ZUU A;  3ULR B;  3EG2 A;  1OPL A;  2DL8 A;  1ABO A;  2ED1 A;  2YUP A;  1UHF A;  1E7O A;  1HJD A;  2EGC A;  1A0N B;  1B07 A;  2JXB A;  3I9Q A;  3U23 A;  2ROL A;  1PNJ A;  1PKS A;  2JW4 A;  5IHK A;  3I35 A;  2EVR A;  3TSZ A;  1CKB A;  2EGE A;  2LQN A;  1QWF A;  1UFF A;  2RNA A;  2CH4 W;  2LX7 A;  5IHI A;  1GCP A;  2F2W A;  4RTV A;  2MIO A;  2KR3 A;  2AZV A;  3VS4 A;  1K1Z A;  1YNZ A;  3QWY A;  1JXM A;  3UA7 A;  2GBQ A;  4OMQ A;  2X3X D;  4D8K A;  4CC2 A;  4CC4 B;  2DNU A;  2ROT A;  1W1F A;  5I11 A;  1FYN A;  1WDX A;  1NLO C;  1Z9Q A;  2DRK A;  4LN2 A;  2A28 A;  2KRS A;  4JJC A;  2FPE A;  4EIK A;  1SRM A;  5L23 A;  2FPD A;  2LQW A;  3EHR A;  4RUG A;  1NYG A;  2L2P A;  2RQV A;  1M8M A;  2FRY A;  2EYW A;  1UHC A;  2FO0 A;  2EYX A;  2V1Q A;  2DL7 A;  1X6B A;  1MUZ A;  1WXT A;  2RQU A;  5FW9 A;  4ZNX A;  4JPB W;  1WXB A;  1FMK A;  1QWE A;  1ZBJ A;  1X2Q A;  2RPN A;  2DE0 X;  3H41 A;  2RQT A;  1X27 A;  1WXU A;  2AKK A;  2KGT A;  3RBB B;  4HXJ A;  2K79 A;  5FWB A;  3VS3 A;  2CDT A;  2RQR A;  2L3P A;  2VVK A;  4IIM A;  5IXB A;  2JMC A;  4HVV A;  3R6N A;  1AWW A;  1I1J A;  1PKT A;  1M30 A;  2GQI A;  1PHT A;  1OEB A;  1SSH A;  2EKH A;  2EW3 A;  1IO6 A;  1RUW A;  1SHF A;  1Z9Z A;  1AWJ A;  1CSK A;  2K9G A;  2DLP A;  1PWT A;  3M0U A;  1CKA A;  4Z89 A;  2KRO A;  1BK2 A;  2DYB A;  2DL4 A;  1X2K A;  1VA7 A;  2FPF A;  1KSW A;  2DVJ A;  2DMO A;  2FEI A;  2DRM A;  1ZUY A;  2YUO A;  2OJ2 A;  1SEM A;  1KIK A;  3ZL7 C;  2LNH B;  1QLY A;  4J9C A;  2DA9 A;  1K76 A;  1GCQ C;  3UA6 A;  4F16 A;  2D8J A;  2K2M A;  3VS7 A;  3M0Q A;  2JS0 A;  1ZLM A;  2J6O A;  2V1R A;  3EG1 A;  2KXD A;  1TUD A;  2KE9 A;  2J06 A;  2BZY A;  2HBW A;  2JM8 A;  1AD5 A;  1WA7 A;  2CT3 A;  3M0P A;  1M3B A;  2GTJ A;  2MCN A;  3RNJ A;  1WX6 A;  1AOJ A;  1UTI A;  3NGP A;  3M0R A;  4AG2 C;  2RF0 A;  1NYF A;  2KEA A;  3M0S A;  2IIM A;  2HSP A;  2C0I A;  1UEC A;  2CRE A;  1OPK A;  2DM1 A;  3IQL A;  1I0C A;  2JMA A;  2H8H A;  3CQT A;  2YUN A;  4Z88 A;  4RTY A;  2CSQ A;  5IHN A;  3TSW A;  1BU1 A;  4AFQ C;  2O31 A;  2ABL A;  2D8H A;  2E5K A;  1TG0 A;  3VS1 A;  2VKN A;  1UE9 A;  2O9S A;  2RMO A;  1SRL A;  1H3H A;  1GL5 A;  3H0I A;  2ECZ A;  3UF4 A;  2L0A A;  2LP5 A;  1QCF A;  1Y57 A;  1I07 A;  2C0T A;  2EQI A;  1WIE A;  4IIO A;  1ABQ A;  2K3B A;  2DIL A;  2ESW A;  1BB9 A;  2BZX A;  2HCK A;  2P4R A;  2W10 A;  2M0Y A;  1SPK A;  1B3Q A;  4RTU A;  2JM9 A;  1UUE A;  3SEM A;  2CUB A;  3PVQ A;  1RI9 A;  3THK A;  1WLP B;  1GRI A;  4CC7 A;  2NWM A;  3QWX X;  1KJW A;  4AFS C;  1NM7 A;  2LJ3 A;  3PVL A;  1J3T A;  3O5Z A;  4AG1 C;  2YUQ A;  4J9I A;  1RLP C;  3NHN A;  1BBZ A;  1KFZ A;  2O88 A;  1X6G A;  2VWF A;  2RN8 A;  1UDL A;  1U5S A;  1N5Z A;  1GCQ A;  4OML A;  4FSS A;  1JU5 C;  4J9F A;  4Y92 A;  4J9H A;  3VRZ A;  1YWP A;  2CH4 A;  2OAW A;  2EPD A;  1U06 A;  1G83 A;  3M0T A;  5FWC A;  2D1X A;  2DJQ A;  2AK5 A;  2EYZ A;  2GGR A;  2K6D A;  2ED0 A;  2LMJ A;  1T3L A;  4ORZ A;  1UG1 A;  4ESR A;  3JV3 A;  2GTO A;  4LE9 A;  1OV3 A;  1WYX A;  4RTX A;  4F14 A;  2CSI A;  2C0O A;  1S1N A; 
#chains in the Genus database with same CATH topology
 2EAY A;  2FYK A;  3GBQ A;  2HL5 C;  1I8F A;  1HXD A;  3OSV A;  3C95 A;  2P4T A;  3HP9 A;  1WPY A;  1S72 T;  3L2V A;  3GOX A;  2AT1 B;  2G6F X;  1K9A A;  2X3W D;  5GAN f;  4FT4 A;  2VAS A;  4JJD A;  3I56 A;  2X35 A;  4KUD K;  2QAS A;  4M75 E;  3CC7 T;  1XOV A;  2LC4 A;  3X28 B;  1VQM A;  1VQP A;  4HCK A;  4OB0 B;  5CAI A;  2B86 A;  2XI9 A;  2O2O A;  2QDL A;  2I0N A;  3CCE A;  1WHL A;  5CK9 A;  4DEX A;  2YWW A;  1QVF P;  3X24 B;  3EG3 A;  2DF6 A;  1D1B A;  2NUT B;  4C8Q E;  2CT4 A;  5FU6 B;  2AHJ B;  4PFO A;  2PU9 B;  2HMA A;  4M75 D;  5CCA A;  4DBQ A;  3DLL A;  3A8H B;  2CP5 A;  4KRT A;  1JO8 A;  4M77 B;  1RI0 A;  3CCV T;  2BTT A;  4PJN A;  2JTE A;  5GAN 2;  2JS2 A;  1WJS A;  2DJZ A;  2RA2 A;  2RJD A;  3JCM J;  2KBT A;  4C8Q D;  2NUP B;  1AWX A;  2QXF A;  1Q7Y R;  3A1P A;  4HVW A;  1P92 A;  4ZN1 A;  5GAO q;  5D6X A;  2XMF A;  5GJV B;  3PMI A;  4KH1 B;  3PTA A;  1OOT A;  4M7D D;  3M5A A;  4E2F B;  3HRU A;  1ZBX A;  3ASK A;  1YJN Q;  1YP5 A;  3QJ6 A;  4F7U G;  3JCM g;  3G4S T;  4F7U F;  3EG9 A;  1FX7 A;  3QSU A;  3MO8 A;  3QO3 A;  5M9O A;  2FRW A;  2J6F A;  1AHJ B;  2NUZ A;  1MND A;  4D8D A;  1VYU A;  4FYY B;  5LJ5 j;  3CME A;  4JZ4 A;  4OMO A;  3NFC A;  1BIB A;  1WJR A;  2DEQ A;  4A4G A;  2LNV A;  4J83 A;  2F2V A;  1UJY A;  2A36 A;  2ENM A;  3A8O B;  1ACM B;  3MCA B;  2J7I A;  1ZUK A;  2V26 A;  2OTL A;  3J81 E;  2ZPB B;  2K7A A;  3TVT A;  3VRY A;  1V1C A;  3RR6 A;  3REA B;  4LDV A;  1PD1 A;  2LCS A;  1D0X A;  1AVZ C;  3NTH A;  4OMP A;  3OYD A;  1ZX6 A;  1AZE A;  2K5I A;  3E9G A;  4RTT A;  1YI2 T;  3L2R A;  1OYX A;  2K3Y A;  4A53 A;  3FJ5 A;  2RJC A;  4KGZ B;  5IT9 E;  1EX4 A;  4O6J A;  2EIF A;  2XG8 D;  2K57 A;  1M5Q 1;  2EGC A;  3I9Q A;  1PSE A;  1YHQ T;  4BI4 A;  2O4X A;  4M7D B;  4X9D A;  3CPF A;  2WAC A;  2P0K A;  1CKB A;  2EGE A;  3BW1 A;  2RNA A;  2YLB A;  3PIP A;  3M4G A;  5HY6 A;  2CH4 W;  5IHI A;  1SSF A;  2HQE A;  2QTV A;  3OYH A;  3VS4 A;  2KK4 A;  1YIT Q;  3MPU B;  3FEO A;  1M2O A;  5FLX E;  2LVM A;  1JXM A;  1YJ9 T;  1M90 U;  4RMO A;  4OMQ A;  1NBE B;  3DB4 A;  3SDZ A;  1K8A U;  4JRI A;  2JZ2 A;  1N8R C;  4C0F A;  4F7U A;  4MZP A;  2DNU A;  2OX7 A;  4OMF B;  1VQO A;  1QVF A;  2DEU A;  1WDX A;  1PSF A;  4RG2 A;  1G3T A;  4C8Q A;  1NLO C;  1YIJ A;  2DRK A;  1PCX A;  4JLG A;  2WSE E;  3GIB A;  1SRM A;  1K9M R;  3OW2 P;  2LQW A;  2EQM A;  1NYG A;  3E9F A;  2I2L A;  2L2P A;  2EYW A;  4HCZ A;  2E6N A;  3MJX A;  2V1Q A;  3HFN A;  3QXE B;  3OS5 A;  1WXB A;  1M9S A;  1X2Q A;  2MI6 A;  2RPN A;  5GAM f;  3CCJ T;  4FYV B;  2KGT A;  1WXU A;  2E4H A;  2EWN A;  4XU1 A;  2FVU A;  5GAO n;  3VS3 A;  1Q81 U;  8ATC B;  4JDS A;  1YIT A;  5IXB A;  2E1H A;  1TXQ A;  2CP0 A;  2JMC A;  4HVV A;  4MZM A;  1I1J A;  1K9M U;  2VGM A;  3PMT A;  3CC2 A;  3CC2 Q;  1OU9 A;  1SSH A;  2EKH A;  2DER A;  7AT1 B;  2Y4Y A;  1CSK A;  5GAM h;  4ZTJ A;  1YIJ Q;  1BK2 A;  2K2V A;  1X2K A;  1IGQ A;  3CEY A;  4EPC A;  3MKD A;  3PGG A;  3ZL7 C;  5GAO l;  4AMC A;  1M1K R;  4PJO G;  3FDR A;  1M1G A;  4PJO D;  4F7U E;  2X4J A;  4PJO F;  2QEX A;  1B7T A;  1U8R A;  2A0F B;  4XTZ A;  1GCQ C;  4IUU A;  1VQN T;  2QI2 A;  2RHX A;  3UA6 A;  1V29 B;  3VS7 A;  3MP1 A;  4FT2 A;  1ZA1 B;  4KBM B;  1O9S A;  2JS0 A;  3CBP A;  1ZLM A;  3EG1 A;  1TUD A;  3BDL A;  2BZY A;  4C0G A;  3M0P A;  1M3B A;  4ZTF A;  4BY6 B;  3OYG A;  1UTI A;  1VQ9 T;  3CMA A;  3JCM P;  2JTF A;  2P84 A;  2FZG B;  5CQY A;  2KEA A;  3G71 T;  1VQ8 Q;  3H9N A;  1VQ6 T;  3JCM b;  2WSF E;  4C0D C;  5LJ5 h;  3OS0 A;  1QVF S;  1KQS A;  2JMA A;  2RHZ A;  2A7Y A;  1UGP B;  2E5K A;  3I56 T;  5GAO m;  3CCL A;  1KK7 A;  4JS5 A;  3X26 B;  3H0I A;  3UF4 A;  4M7A B;  4B9W A;  2XDB A;  4LDU A;  1I07 A;  5FU7 C;  4DBH A;  1WIE A;  4IIO A;  1ZSZ A;  2K3B A;  2DIL A;  1BB9 A;  3OYA A;  2BZX A;  1IGU A;  4RCB A;  2P4R A;  4LDY A;  3VYH B;  3EH2 A;  4QQD A;  1VQ7 Q;  1UUE A;  1WJQ A;  1OQK A;  1UGQ B;  1WZO A;  3OYB A;  4BDY A;  2L3R A;  3MEV A;  1WQ7 A;  2RH2 A;  2E64 A;  1ZHI A;  1WHH A;  1Q81 R;  3OYE A;  4DOV A;  4C92 C;  2RK2 A;  3CCJ Q;  4XTY A;  1V76 A;  1FXX A;  4BI8 B;  1J3T A;  1OZ3 A;  3PVL A;  4AG1 C;  2XD0 A;  4J9I A;  1UEB A;  3M54 A;  1WGS A;  2X4Y A;  2O88 A;  3SWN C;  4M7A C;  1UDL A;  1WHG A;  1YJW Q;  2JVV A;  4JUV A;  2K4Y A;  2QA4 Q;  1N5Z A;  1GCQ A;  4OML A;  1NJI C;  5DY9 A;  4J9F A;  2HD0 A;  3C4S A;  1YWP A;  2OAW A;  3CXC P;  1U06 A;  1XNI A;  5FWC A;  1D1A A;  2D1X A;  2DJQ A;  4M7D G;  2EYZ A;  4ESR A;  2GTO A;  4LE9 A;  1MMG A;  3CBO A;  2JUF A;  4C92 B;  1YJN T;  1Q82 C;  1W2B A;  3OW2 S;  5A0G A;  1WHK A;  2D0Q B;  1QMC A;  1BCO A;  1W6X A;  2E12 A;  1C0M A;  4ZGE B;  1M2V B;  2NYS A;  4LNP A;  3QZ5 B;  2KNB B;  4RG8 A;  3V7R A;  3JB9 H;  3M53 A;  3P8H A;  1S72 A;  1Y71 A;  1WNL A;  4V2S A;  4JRK A;  2GFU A;  3ZFJ A;  3HPW A;  8AT1 B;  1LCK A;  3OYN A;  3FRN A;  2F5T X;  1PM3 A;  2OI3 A;  3CC7 Q;  2DX1 A;  4M4Z A;  2SEM A;  1Q7Y U;  3RKW A;  5GAN d;  2DK3 A;  5HCK A;  3TCJ A;  1EFN A;  1WFW A;  2CZ1 B;  4XK8 E;  1T3S A;  5KCO A;  3H0H A;  1OI1 A;  2J6K A;  4XTV A;  3DLM A;  2K5L A;  4P5N A;  1TUC A;  2DO3 A;  5CIU A;  2BKD N;  1IB8 A;  1OX8 A;  3GF5 A;  4F04 B;  2DBK A;  5DLO A;  2PUK B;  5KYX A;  2EFI A;  2PTK A;  2Y4X A;  3EG9 B;  3M56 A;  2VGN A;  1UJ0 A;  3CPW P;  1AWO A;  1RAH B;  4FM4 B;  1VYV A;  4WF2 A;  3KFV A;  3WVD B;  1KQ1 A;  4J9G A;  4JJN K;  3D7S B;  1VQK A;  2KY9 A;  2KRN A;  4FU6 A;  1OX9 A;  3CCL T;  2BZ8 A;  1KC8 C;  4LUD A;  3C12 A;  2IVW A;  3NPF A;  3EGU A;  4OMN A;  4QQ6 A;  1UB4 A;  4LUE A;  3I55 Q;  4M7A G;  1YIJ T;  1TU0 B;  1K0X A;  1GFC A;  2EQK A;  4QVZ A;  4XU2 A;  3G7Z A;  2X4W A;  5KE2 A;  1VQM Q;  1G2B A;  1GBR A;  1AT1 B;  1Q86 R;  1RLQ C;  1M27 C;  1SHG A;  1OU8 A;  3CCV A;  1NJI R;  2KYM A;  4DEY A;  3JB9 I;  1WI7 A;  1M3A A;  4J9B A;  4J9E A;  5I22 A;  1AZG B;  5HK0 A;  1M1F A;  3MEA A;  1NG2 A;  5LJ5 d;  1E6G A;  1NLP C;  3EGD A;  3TQ7 P;  1HSQ A;  3PNW C;  5GMK j;  1QKW A;  3LGF A;  2QQB A;  1ZA2 B;  1UGV A;  3WXM B;  1K0S A;  4C0Z A;  3CCQ T;  4JZ3 A;  3DB3 A;  4FL6 A;  3VV0 A;  2FB7 A;  1JEG A;  5IXF A;  1G8X A;  2V8K A;  3OS2 A;  3JCM c;  3E1S A;  4KUL A;  1I81 A;  5KYU A;  1X43 A;  4X1V A;  1SKU B;  1NPP A;  1VQP T;  1M1K C;  4M7A A;  2W0Z A;  1G3Y A;  4C8Q C;  2O4X B;  5GMK i;  4KT0 E;  1BI1 A;  4M7D A;  2LRQ A;  5I2M A;  4F17 A;  1BI2 A;  1K8A C;  3OYL A;  1YWO A;  1JQQ A;  1FMV A;  1M90 C;  1IRE B;  4GBQ A;  4HVU A;  3I5R A;  1B34 A;  4QW2 A;  4M78 C;  2ZGW A;  2FZC B;  3OYI A;  2DBM A;  3CC4 A;  3E2U A;  4M78 F;  5GAN 8;  4C5G A;  2MYS A;  3TRE A;  4PLL A;  5CQX A;  1MV3 A;  4M77 C;  2EGA A;  1OUL A;  2LX9 A;  4PKC C;  1ZUU A;  1W2B S;  3ULR B;  4N4I A;  2YUP A;  2DL8 A;  5LJ3 e;  1E7O A;  1HJD A;  3U23 A;  5GAM g;  2JW4 A;  5FU6 C;  3M58 A;  3V7C A;  4M7D E;  3I35 A;  3CCQ Q;  2QDY B;  2ZCF B;  3TSZ A;  5A0D A;  5KYY B;  2LQN A;  2L8D A;  3INZ A;  3CCR T;  2OTJ T;  4X9C A;  2F2W A;  4E7S A;  4JS4 A;  2QTX A;  3RIR A;  4RTV A;  1K9M C;  2MIO A;  1K1Z A;  3G71 Q;  3BY7 A;  1YNZ A;  3QWY A;  3CPW A;  4QKU A;  2E5Q A;  2DFU A;  3CCR A;  1NPR A;  1YBY A;  3UA7 A;  2DXB A;  2GBQ A;  2EYQ A;  2MK5 A;  2X3X D;  3M9Q A;  1VQL T;  3CME Q;  4CC2 A;  3JCM X;  5KH6 A;  4DOW A;  4IUP A;  4DBF A;  1FYN A;  3OS1 A;  4OVA A;  5HKC A;  4BI3 A;  4JJC A;  4JRP A;  2VUB A;  5CKE A;  4EIK A;  2FZK B;  2FPD A;  2KSS A;  3HL8 A;  4RUG A;  3FIF A;  1M4Z A;  4MZT A;  2DTH A;  1VQ6 Q;  2COZ A;  2ZZD A;  1X6B A;  1MUZ A;  4PFP A;  5GAM d;  4ZNX A;  4XU3 A;  1FMK A;  1ZBJ A;  2DE0 X;  3H41 A;  4IKF A;  1QCN A;  3UDC A;  4EMK B;  2RJE A;  4HXJ A;  5FWB A;  3QYG B;  2RQR A;  3A8L B;  2L3P A;  3CCM A;  3H6Z A;  3R6N A;  1D3B A;  4BY6 C;  1VQN Q;  3OMG A;  2JJ9 A;  3GP8 A;  1PKT A;  1M30 A;  2GQI A;  1PHT A;  3ME9 A;  1IO6 A;  1SHF A;  1D0Y A;  4M77 A;  1VQ5 Q;  5GAN 5;  5KYU B;  3KBG A;  3MP6 A;  2FEI A;  3RMS A;  1TWB A;  2DRM A;  2YUO A;  1SEM A;  2LNH B;  2EJ9 A;  1QLY A;  1R0C B;  1X75 C;  1VUB A;  3CC2 T;  4BD3 A;  2DA9 A;  1QP2 A;  1K76 A;  4E7H A;  1VQP Q;  1JBM A;  1K73 U;  4F16 A;  2L89 A;  4C8Q F;  2QYZ A;  1QVG P;  3V7S A;  2KE9 A;  4R55 A;  2HBW A;  2VV5 A;  3OQ5 A;  3I56 Q;  3WVE B;  1BCM A;  2GTJ A;  2MCN A;  1WX6 A;  2DZC A;  1JJ2 A;  1VQK T;  1M90 R;  1Y7X A;  1NYF A;  2A3L A;  3FLG A;  5LJ5 g;  3OYF A;  5CO7 A;  4C92 D;  4JRQ A;  4L5G A;  1OPK A;  2GCX A;  1MMA A;  3SWN B;  1I0C A;  1BI0 A;  4N0A C;  4Q5W A;  2YUN A;  3TSW A;  4RTY A;  2CSQ A;  3L2U A;  2O31 A;  4JLI A;  3VS1 A;  3LYI A;  4WTO B;  1UE9 A;  5AYF A;  2ECZ A;  2L0A A;  4J8O A;  4XTU A;  2EQI A;  4PL6 A;  3CCS T;  5CR2 A;  4OB3 B;  2Y90 A;  4QVC A;  5LJ5 f;  1YJW A;  1VOM A;  2YXY A;  4ZN3 A;  2M0Y A;  2GFA A;  1BKB A;  2PVD B;  3SEM A;  3L2Z A;  1FMW A;  1RI9 A;  4E7I A;  4BE0 A;  3MEU A;  3LX7 A;  3CBM A;  3QDF A;  4CC7 A;  1TTH B;  2NWM A;  1KJW A;  2QGG A;  4FYX B;  3QZ9 B;  2YUQ A;  4BE2 A;  5GAN j;  1BBZ A;  3CC4 Q;  1M2V A;  2LT1 A;  3JB9 J;  1YHQ A;  4PJO E;  2CP6 A;  1Q7Y C;  3S6W A;  1JU5 C;  3UPU A;  1D0Z A;  3LWH A;  2COY A;  5GAN g;  2EPD A;  1KQS S;  5FRM A;  3T9N A;  2GGR A;  2LDM A;  2K6D A;  1H3Z A;  2ED0 A;  1T3L A;  4ORZ A;  2X9H A;  4F14 A;  2CSI A;  1S1N A;  3VYG A;  2E3I A;  2VYT A;  4N0A A;  4B9X A;  2LJ0 A;  1EZZ B;  2M51 A;  1VQ4 Q;  3BE3 A;  1GBQ A;  1KC8 U;  1H92 A;  2MF2 A;  2J05 A;  5GJW B;  3OW2 A;  2D9T A;  2A08 A;  4KH0 B;  2EQU A;  1N27 A;  4PK4 A;  4ANJ A;  1ZSZ C;  2XID A;  2LQ8 A;  4AFU C;  2HQX A;  5CKH A;  2FG0 A;  2RJF A;  4FW1 A;  4OB1 B;  1OZ2 A;  1MMN A;  5D6W A;  1YCY A;  1DJ7 B;  5A0L A;  2KI7 A;  3X20 B;  2YDL A;  2RHI A;  4E7K A;  4Y28 E;  1KD1 R;  3EFO B;  3VS6 A;  2R5A A;  2M02 A;  3ZBD A;  3P8B B;  3RKX A;  2ZAE A;  3QG1 A;  5LJ3 g;  3CME T;  3G71 A;  3URG A;  5FRN A;  3CD6 A;  2CUD A;  1E6H A;  1VQ7 A;  2H3E B;  5C0M A;  4DQ2 A;  2HQH A;  3EAE A;  4VUB A;  1NEG A;  4XU0 A;  3KXT A;  5GAN h;  3CCS Q;  5FU7 B;  2ZPI B;  3VS5 A;  3EGX B;  5A2Q E;  4N4G A;  2GF7 A;  2LJ1 A;  2QEX T;  2DXC A;  1Q82 R;  3AT1 B;  5GAO r;  4HT8 A;  2DL3 A;  2HDA A;  1TSF A;  3L1A A;  5AT1 B;  3JAM E;  2M0O A;  4L59 A;  4C5I A;  2MOX A;  3NMZ C;  2MAM A;  4MML A;  5CKF A;  5EG2 A;  2XKO C;  3I55 T;  5ECA A;  2DTO A;  4GY5 A;  1Q81 C;  2LCL A;  4FSX A;  5LJ3 j;  2XIC A;  1W2B P;  4LDW A;  1WHJ A;  1H8K A;  2F69 A;  3G6E A;  3MHX A;  2AZS A;  2P0Q A;  3VS0 A;  5KYX B;  2IG0 A;  4FCY A;  1YN8 A;  2O01 E;  1GFD A;  4IUT A;  3JCM Q;  2AKL A;  4C8Q B;  3CCM T;  1KQ2 A;  3SWN A;  4A4K A;  1XJW B;  2E41 A;  2JOY A;  3BDU A;  3P8D A;  3DKM A;  4CC3 A;  1RAG B;  4KGV B;  3CCJ A;  3PFS A;  5LJ5 e;  1QVG A;  2CYZ B;  1LJO A;  3PE0 A;  3SB2 A;  5IH2 A;  3JCM h;  2KYB A;  2KT1 A;  3JCM f;  1PRM C;  3C0C A;  4WCI A;  4LD6 A;  1KD1 C;  5GAN 4;  2EYY A;  1VQ5 T;  4D6W A;  2L3Q A;  2RI2 A;  4OB2 B;  4KGX B;  1ARK A;  3OMC A;  1M3C A;  5D7U A;  2YSQ A;  2R5M A;  1GXI E;  3H0F A;  4OMM A;  3RKY A;  2R57 A;  1VQO T;  5IN1 A;  4FYW B;  2ZPF B;  1K73 R;  3OY9 A;  1HYO A;  1G3W A;  3FB9 A;  4UC4 A;  1UGR B;  2D0N A;  3R6O A;  4E7Z A;  4BDZ A;  2BUD A;  1OPL A;  3UT1 A;  1ABO A;  2ED1 A;  3LLR A;  3CCU T;  2QAZ A;  1B07 A;  1D09 B;  2JXB A;  3JRZ A;  4M7A E;  4HT9 A;  1G5V A;  1PG5 B;  2HZY A;  1RAF B;  2KMT A;  1TOV A;  5HK3 A;  4M75 C;  1UFF A;  1YJ9 A;  2PQW A;  1X6O A;  3S3O A;  4Y91 A;  2NUT A;  1GCP A;  4PJJ A;  1RAC B;  1M1K U;  3LH0 A;  2RM4 A;  5CKD A;  4J7F A;  3EFS A;  1XTD A;  5J39 A;  3Q1J A;  2X51 A;  4IUV A;  4XTW A;  3M55 A;  3OYY A;  2EJF A;  4C92 A;  2DTI A;  4O5V A;  4D8K A;  2QK0 A;  4CC4 B;  3S3M A;  2MMP A;  3CMA T;  2HKN A;  2ZPG B;  5I11 A;  1MMD A;  4C92 G;  3CC4 T;  1RAI B;  4C92 F;  2D6F A;  2NUP A;  2A28 A;  3SFM A;  1NJI U;  2VC8 A;  4EMK C;  5L23 A;  4M77 E;  1N9S A;  1YJ9 Q;  3EHR A;  2COW A;  3C94 A;  1VQN A;  1M8M A;  2FRY A;  2DVE A;  4M78 A;  2FO0 A;  3G1J A;  2DL7 A;  1K73 C;  1QWE A;  4B6M A;  4MDX A;  1N8R U;  2RQT A;  2QQR A;  3RER A;  4J6W A;  2AKK A;  3RBB B;  4M77 F;  3OB9 A;  4IUR A;  4LD9 K;  4M77 D;  1VQK Q;  2CDT A;  2HKQ B;  5KE3 A;  3NTK A;  2VVK A;  4OGE A;  2DD5 A;  2JN0 A;  3OBY A;  2V8J A;  2HBP A;  2PUO B;  2CZ6 B;  1OEB A;  2RI3 A;  3G4S A;  5FRO A;  3EFR A;  2DKG A;  1RUW A;  2HAX A;  1R77 A;  1MGQ A;  1AWJ A;  1VQL Q;  2XDD A;  2DYB A;  1VA7 A;  1YHQ Q;  2HL3 A;  5GAN 7;  2DVJ A;  2XK0 A;  1ZUY A;  4TVR A;  2OJ2 A;  1KIK A;  1LPL A;  3LGL A;  4R56 A;  3NTI A;  1Y07 A;  4RCC A;  3EH1 A;  3JB9 D;  1YFN A;  1N9R A;  2CP7 A;  1VQ6 A;  2D8J A;  1VQ4 T;  3L2W A;  5GAN 3;  3M0Q A;  4RKU E;  2V1R A;  4M7A D;  1MHN A;  2J06 A;  4HCC A;  4M7A F;  2JM8 A;  2X4X A;  1WA7 A;  2YRC A;  4IUQ A;  1AOJ A;  1N6A A;  3CPW S;  2DYI A;  2JNG A;  3M0S A;  3EGD B;  1UEC A;  3JCM W;  1K8A R;  1IHW A;  1FWZ A;  3IQL A;  2F5K A;  3A8M B;  3CQT A;  4Z88 A;  5IHN A;  3QDR B;  1BU1 A;  2FHD A;  2ABL A;  3CCU Q;  4PJO A;  1LVK A;  2V8I A;  2PVO B;  2DPP B;  1SRL A;  3V8J A;  1H3H A;  5CKB A;  2LP5 A;  5GMK m;  4L6V 5;  2QQ9 A;  2C0T A;  2CP2 A;  2DD4 A;  4AT1 B;  3QYH B;  4Z02 A;  1WHM A;  3G4S Q;  2ZPE B;  4M75 A;  4C5H A;  1XQH A;  1I5L A;  1B3Q A;  4RTU A;  2HNI A;  2CUB A;  2C06 A;  1Y96 A;  3HRS A;  1WLP B;  1GRI A;  4C8Q G;  2YRD A;  4E7J A;  3QPH A;  2QQA A;  1YI2 A;  4J6Y A;  4AFS C;  1JJ2 S;  3QKJ A;  2MWP A;  3O5Z A;  3NHN A;  1KFZ A;  1UGS B;  1X6G A;  1H64 1;  2VWF A;  1VQ9 Q;  1U5S A;  1TUG B;  3LW5 E;  4PNO A;  4PJM A;  1YIT T;  4FSS A;  1C6V X;  4ELY C;  3S3N A;  4J9H A;  1WQW A;  1Q86 U;  5GMK l;  3M57 A;  2AK5 A;  2LMJ A;  3CCL Q;  1QCO A;  3CCU A;  5L8R E;  1OV3 A;  1WYX A;  3EFO A;  2C0O A;  2RO0 A;  5I21 A;  4C92 E;  5GAM e;  1QKX A;  2KRM A;  3VKI A;  5GMK e;  4A54 A;  4AFZ C;  4ZGD B;  1TH7 A;  9ATC B;  1PRL C;  1VQ8 A;  1B34 B;  1T0J A;  4EMG A;  3M4Y A;  5LJ3 d;  1AEY A;  3QUI A;  4K11 A;  1KQS P;  1W70 A;  5LL6 S;  3GLX A;  1Q95 G;  5I2S A;  1YCS B;  2KXC A;  1TS9 A;  1KG1 A;  1RAB B;  2CS7 A;  2RB6 A;  4HKE A;  3A5Z B;  1JXO A;  1U3O A;  3EGX A;  1R0B G;  2GNC A;  2LQK A;  3PT9 A;  4PJL A;  2L3S A;  1KC8 R;  2GQV A;  1Q82 U;  3N5B B;  4XAX B;  4PJO C;  3REB B;  1O75 A;  1QQJ A;  4FIB A;  4PLI A;  2YRV A;  5KYY A;  1MV0 B;  3GPL A;  2O9V A;  3TU4 K;  1X69 A;  4GLM A;  4OF1 A;  3OA6 A;  4BE1 A;  3GNF B;  3X25 B;  2RQW A;  4M7D C;  5DLQ E;  4QT7 A;  3JB9 G;  3MP8 A;  4J9D A;  1QP3 A;  2XU8 A;  1U1T A;  2R58 A;  3PIO A;  5EC7 A;  4R0K A;  4RTW A;  2DL5 A;  3OYM A;  3CCQ A;  4NOY A;  2OTL T;  4ME7 A;  2QA4 A;  2CZ0 B;  2MWO A;  1KD1 U;  4PJO B;  3EHQ A;  3EG0 A;  1VYT A;  1C1A A;  2DAQ A;  3JSC A;  3V8K A;  4BB7 A;  2DIG A;  3BFM A;  3CXC S;  1NEB A;  1LOJ A;  1K4U S;  2BE9 B;  1ZSG A;  2KT8 A;  2CZ7 B;  4BUG A;  2HEQ A;  5C6S A;  4Z8A A;  3RDV A;  2SRC A;  2PZ1 A;  2E3H A;  1VQM T;  2PNI A;  5LJ3 h;  3MET A;  5GAO p;  1ZQ1 A;  5D6Y A;  3LH5 A;  2L5Q A;  2QA4 T;  4C5E A;  4ELZ C;  4CI0 C;  3OYC A;  2EKO A;  1LNX A;  3MEW A;  1PD0 A;  4PFZ A;  3SHW A;  1RL2 A;  4C0D B;  2BE7 D;  2RI5 A;  4LDX A;  3CD6 T;  1IZ6 A;  4MMK A;  3FC3 A;  4XQ3 A;  3LWI A;  2M1H A;  2F1L A;  2KAF A;  2JT4 A;  4LXC A;  1G3S A;  1VIF A;  2LTO A;  2OTJ Q;  1YI2 Q;  3CCR Q;  3OBW A;  1QW1 A;  4E6R A;  4JJB A;  1HD3 A;  2A37 A;  2M16 A;  1Y0M A;  2LZ6 B;  5GMK h;  4II1 A;  2YT6 A;  3VJP A;  2F2X A;  1VQL A;  4EMK A;  3I5S A;  3HKS A;  4RTZ A;  2RHY A;  3AHU A;  3A98 A;  2CKK A;  4M78 E;  4A63 B;  2EBP A;  2K3X A;  1BIA A;  1KHI A;  2E6Z A;  1VQ8 T;  4EDU A;  2RHU A;  3UAT A;  2IPO B;  3VS2 A;  1IXD A;  2OTJ A;  2DXU A;  1RAE B;  1T0H A;  4HCB A;  3EG2 A;  4J6X A;  2K5F A;  2YHT A;  1UHF A;  1SF9 A;  2QG9 B;  5KCH A;  5KYW A;  3RES A;  1A0N B;  4M7D F;  2DXT A;  2ROL A;  1PNJ A;  2Z0W A;  3F70 A;  1PKS A;  2KQW A;  5IHK A;  2DIQ A;  3VUB A;  2EVR A;  3CC7 A;  5DM7 R;  1VQ5 A;  3VUZ A;  3SD4 A;  3TEE A;  4A4H A;  1QWF A;  1KHC A;  2AIR B;  2LX7 A;  1U1S A;  3H8Z A;  1NZ9 A;  4ATO A;  1S72 Q;  4M78 B;  5GAM j;  5J26 A;  2XHC A;  4KUI A;  2WSC E;  2KR3 A;  2AZV A;  2ZPH B;  5GAN e;  2OAU A;  2QEX Q;  2DZ9 A;  4OGC A;  2YLC A;  4A4E A;  6AT1 B;  2FL7 A;  2HSE B;  3CCE Q;  3JB9 F;  4A4F A;  2ROT A;  2LT4 A;  1W1F A;  4HA8 A;  5J3B A;  1JJ2 P;  2QGF B;  1Z9Q A;  1I5O B;  2MPX C;  4LN2 A;  3UWN A;  2KRS A;  2FPE A;  4NL2 A;  3OYK A;  4BAC A;  3HTR A;  4XTX A;  3FJP A;  2RQV A;  3J80 E;  1IHV A;  1UHC A;  1QVP A;  4J5Y A;  2EYX A;  4ZGJ B;  2E10 A;  1WXT A;  2RQU A;  5FW9 A;  1X01 A;  3V8L A;  4JPB W;  3HHT B;  1W4S A;  2M9U A;  3KUF A;  2B8A A;  4M75 G;  1F1B B;  2VXF A;  2E65 A;  1X27 A;  3A8G B;  2K79 A;  3QII A;  4F7U B;  1IRX A;  3OSS C;  4IIM A;  1JB0 E;  2VXE A;  2EJG A;  1AWW A;  1MNE A;  3VU3 C;  3JCM e;  1I4K 1;  2EW3 A;  5GAN 6;  1Z9Z A;  2ATC B;  1PC0 A;  2K9G A;  3JCM V;  2DLP A;  1PWT A;  3M0U A;  1CKA A;  4Z89 A;  2KRO A;  3CD6 Q;  2DL4 A;  3GNG A;  1VQ4 A;  2FPF A;  1VQ9 A;  1KSW A;  2DMO A;  2RD1 A;  4M78 D;  5KYW B;  3HSB A;  3M59 A;  4E7L A;  4EMH A;  4MDW A;  2H3J A;  4J9C A;  2KVQ G;  3CXC A;  3RMQ A;  1JRI A;  2CGH A;  5LJ3 f;  3OYJ A;  2K2M A;  3CMA Q;  2J6O A;  2XDP A;  2KXD A;  1RAA B;  1AD5 A;  2CT3 A;  3RNJ A;  1D1C A;  4GLK A;  3NGP A;  4E47 A;  3M0R A;  4AG2 C;  2RF0 A;  3G6E T;  4M77 G;  3L2Q A;  1M8V A;  2E70 A;  2IIM A;  2HSP A;  2C0I A;  5CVI A;  1Y96 B;  2CRE A;  1Q86 C;  2DM1 A;  2H8H A;  3I55 A;  2RK1 A;  4AFQ C;  2NLU A;  4N4H A;  2PVG B;  3CCE T;  2D8H A;  1TG0 A;  1VIE A;  1N8R R;  2VKN A;  1QVG S;  2O9S A;  2RMO A;  3HFO A;  1GL5 A;  4DA4 A;  1QCF A;  3ZEH A;  2CP3 A;  5IAY A;  1Y57 A;  4M78 G;  1ABQ A;  2ESW A;  3CCV Q;  4NL3 A;  3G6E Q;  1BYM A;  1YJN A;  3J7A F;  1BI3 A;  2HCK A;  2W10 A;  1R8O B;  4QVD A;  2JTM A;  1SPK A;  2JM9 A;  1VQ7 T;  3PVQ A;  4NS5 A;  3THK A;  2G3R A;  4DBR A;  2QQS A;  3QWX X;  1HK9 A;  3HRT A;  4YTL A;  1NM7 A;  2LJ3 A;  2P0P A;  2DET A;  1RLP C;  3E19 A;  2EQJ A;  2VB6 A;  3JCM d;  5KYN A;  3RUX A;  2RN8 A;  3O8V A;  3QBY A;  1YJW T;  1EIF A;  2KDS A;  3QHS A;  4CRI A;  3CCS A;  4Y92 A;  3QJY A;  2OTL Q;  4OP0 A;  3VRZ A;  2CH4 A;  3L42 A;  1ZSZ B;  1G83 A;  3M0T A;  4QQG A;  1NE8 A;  4FW2 A;  4M75 B;  4X34 A;  3CCM Q;  1UG1 A;  2LCC A;  3JV3 A;  4M75 F;  1RAD B;  1VQO Q;  3ER0 A;  4RTX A;  2BIV A;  1D3B B;  1SG5 A;  4J7I A; 
#chains in the Genus database with same CATH homology
 3GBQ A;  1QKX A;  2KRM A;  4AFZ C;  2LJ0 A;  1W6X A;  1PRL C;  1T0J A;  2M51 A;  4LNP A;  1AEY A;  4K11 A;  1GBQ A;  1W70 A;  2KNB B;  1H92 A;  2G6F X;  1K9A A;  2J05 A;  2X3W D;  5GJW B;  1YCS B;  2A08 A;  4JJD A;  2KXC A;  1LCK A;  4AFU C;  2OI3 A;  2FG0 A;  1JXO A;  1U3O A;  2GNC A;  2DX1 A;  1XOV A;  4M4Z A;  2SEM A;  2L3S A;  4HCK A;  2B86 A;  2YDL A;  2O2O A;  3REB B;  5HCK A;  1EFN A;  2I0N A;  2QDL A;  1WFW A;  3VS6 A;  1T3S A;  1MV0 B;  4DEX A;  2O9V A;  3H0H A;  1X69 A;  2J6K A;  3EG3 A;  2DF6 A;  4GLM A;  1TUC A;  2RQW A;  2CT4 A;  4QT7 A;  2CUD A;  1E6H A;  4J9D A;  2DBK A;  5EC7 A;  1NEG A;  4KRT A;  1JO8 A;  2PTK A;  4R0K A;  4RTW A;  2DL5 A;  2BTT A;  2JTE A;  1UJ0 A;  1AWO A;  2JS2 A;  1VYV A;  3VS5 A;  3KFV A;  4J9G A;  2KBT A;  3EHQ A;  3EG0 A;  1VYT A;  2LJ1 A;  1AWX A;  2KRN A;  2DL3 A;  1NEB A;  4HVW A;  2BZ8 A;  2HDA A;  1K4U S;  1ZSG A;  2KT8 A;  4LUD A;  3NPF A;  2XMF A;  3EGU A;  4OMN A;  2HEQ A;  2MOX A;  3NMZ C;  4LUE A;  5GJV B;  4Z8A A;  2SRC A;  2PZ1 A;  1K0X A;  1GFC A;  1OOT A;  5ECA A;  2PNI A;  1G2B A;  1GBR A;  3LH5 A;  1RLQ C;  1YP5 A;  1M27 C;  1H8K A;  1SHG A;  2AZS A;  3VS0 A;  2KYM A;  4DEY A;  1WI7 A;  1YN8 A;  1GFD A;  1M3A A;  4J9B A;  4J9E A;  5I22 A;  3SHW A;  1AZG B;  2AKL A;  1NG2 A;  1E6G A;  1NLP C;  2FRW A;  2J6F A;  1HSQ A;  2NUZ A;  1QKW A;  4D8D A;  1VYU A;  4JZ4 A;  4OMO A;  1UGV A;  1K0S A;  4JZ3 A;  2JT4 A;  4CC3 A;  1JEG A;  5IXF A;  2F2V A;  1UJY A;  2A36 A;  2ENM A;  4E6R A;  4JJB A;  3PE0 A;  1HD3 A;  1X43 A;  4X1V A;  2A37 A;  5IH2 A;  2KYB A;  2KT1 A;  1Y0M A;  2W0Z A;  2LZ6 B;  1PRM C;  2J7I A;  3C0C A;  4WCI A;  4F17 A;  1ZUK A;  1YWO A;  2EYY A;  2YT6 A;  1JQQ A;  2F2X A;  3I5S A;  2K7A A;  2L3Q A;  4RTZ A;  3TVT A;  3VRY A;  1V1C A;  4GBQ A;  4HVU A;  3REA B;  1ARK A;  1M3C A;  2LCS A;  3I5R A;  2YSQ A;  3A98 A;  4A63 B;  3H0F A;  4OMM A;  2EBP A;  1AVZ C;  2DBM A;  4OMP A;  1ZX6 A;  1AZE A;  4RTT A;  2D0N A;  3UAT A;  1MV3 A;  3VS2 A;  2EGA A;  3FJ5 A;  1T0H A;  1ZUU A;  3ULR B;  3EG2 A;  1OPL A;  2DL8 A;  1ABO A;  2ED1 A;  2YUP A;  1UHF A;  1E7O A;  1HJD A;  2EGC A;  1A0N B;  1B07 A;  2JXB A;  3I9Q A;  3U23 A;  2ROL A;  1PNJ A;  1PKS A;  2JW4 A;  5IHK A;  3I35 A;  2EVR A;  3TSZ A;  1CKB A;  2EGE A;  2LQN A;  1QWF A;  1UFF A;  2RNA A;  2CH4 W;  2LX7 A;  5IHI A;  1GCP A;  2F2W A;  4RTV A;  2MIO A;  2KR3 A;  2AZV A;  3VS4 A;  1K1Z A;  1YNZ A;  3QWY A;  1JXM A;  3UA7 A;  2GBQ A;  4OMQ A;  2X3X D;  4D8K A;  4CC2 A;  4CC4 B;  2DNU A;  2ROT A;  1W1F A;  5I11 A;  1FYN A;  1WDX A;  1NLO C;  1Z9Q A;  2DRK A;  4LN2 A;  2A28 A;  2KRS A;  4JJC A;  2FPE A;  4EIK A;  1SRM A;  5L23 A;  2FPD A;  2LQW A;  3EHR A;  4RUG A;  1NYG A;  2L2P A;  2RQV A;  1M8M A;  2FRY A;  2EYW A;  1UHC A;  2FO0 A;  2EYX A;  2V1Q A;  2DL7 A;  1X6B A;  1MUZ A;  1WXT A;  2RQU A;  5FW9 A;  4ZNX A;  4JPB W;  1WXB A;  1FMK A;  1QWE A;  1ZBJ A;  1X2Q A;  2RPN A;  2DE0 X;  3H41 A;  2RQT A;  1X27 A;  1WXU A;  2AKK A;  2KGT A;  3RBB B;  4HXJ A;  2K79 A;  5FWB A;  3VS3 A;  2CDT A;  2RQR A;  2L3P A;  2VVK A;  4IIM A;  5IXB A;  2JMC A;  4HVV A;  3R6N A;  1AWW A;  1I1J A;  1PKT A;  1M30 A;  2GQI A;  1PHT A;  1OEB A;  1SSH A;  2EKH A;  2EW3 A;  1IO6 A;  1RUW A;  1SHF A;  1Z9Z A;  1AWJ A;  1CSK A;  2K9G A;  2DLP A;  1PWT A;  3M0U A;  1CKA A;  4Z89 A;  2KRO A;  1BK2 A;  2DYB A;  2DL4 A;  1X2K A;  1VA7 A;  2FPF A;  1KSW A;  2DVJ A;  2DMO A;  2FEI A;  2DRM A;  1ZUY A;  2YUO A;  2OJ2 A;  1SEM A;  1KIK A;  3ZL7 C;  2LNH B;  1QLY A;  4J9C A;  2DA9 A;  1K76 A;  1GCQ C;  3UA6 A;  4F16 A;  2D8J A;  2K2M A;  3VS7 A;  3M0Q A;  2JS0 A;  1ZLM A;  2J6O A;  2V1R A;  3EG1 A;  2KXD A;  1TUD A;  2KE9 A;  2J06 A;  2BZY A;  2HBW A;  2JM8 A;  1AD5 A;  1WA7 A;  2CT3 A;  3M0P A;  1M3B A;  2GTJ A;  2MCN A;  3RNJ A;  1WX6 A;  1AOJ A;  1UTI A;  3NGP A;  3M0R A;  4AG2 C;  2RF0 A;  1NYF A;  2KEA A;  3M0S A;  2IIM A;  2HSP A;  2C0I A;  1UEC A;  2CRE A;  1OPK A;  2DM1 A;  3IQL A;  1I0C A;  2JMA A;  2H8H A;  3CQT A;  2YUN A;  4Z88 A;  4RTY A;  2CSQ A;  5IHN A;  3TSW A;  1BU1 A;  4AFQ C;  2O31 A;  2ABL A;  2D8H A;  2E5K A;  1TG0 A;  3VS1 A;  2VKN A;  1UE9 A;  2O9S A;  2RMO A;  1SRL A;  1H3H A;  1GL5 A;  3H0I A;  2ECZ A;  3UF4 A;  2L0A A;  2LP5 A;  1QCF A;  1Y57 A;  1I07 A;  2C0T A;  2EQI A;  1WIE A;  4IIO A;  1ABQ A;  2K3B A;  2DIL A;  2ESW A;  1BB9 A;  2BZX A;  2HCK A;  2P4R A;  2W10 A;  2M0Y A;  1SPK A;  1B3Q A;  4RTU A;  2JM9 A;  1UUE A;  3SEM A;  2CUB A;  3PVQ A;  1RI9 A;  3THK A;  1WLP B;  1GRI A;  4CC7 A;  2NWM A;  3QWX X;  1KJW A;  4AFS C;  1NM7 A;  2LJ3 A;  3PVL A;  1J3T A;  3O5Z A;  4AG1 C;  2YUQ A;  4J9I A;  1RLP C;  3NHN A;  1BBZ A;  1KFZ A;  2O88 A;  1X6G A;  2VWF A;  2RN8 A;  1UDL A;  1U5S A;  1N5Z A;  1GCQ A;  4OML A;  4FSS A;  1JU5 C;  4J9F A;  4Y92 A;  4J9H A;  3VRZ A;  1YWP A;  2CH4 A;  2OAW A;  2EPD A;  1U06 A;  1G83 A;  3M0T A;  5FWC A;  2D1X A;  2DJQ A;  2AK5 A;  2EYZ A;  2GGR A;  2K6D A;  2ED0 A;  2LMJ A;  1T3L A;  4ORZ A;  1UG1 A;  4ESR A;  3JV3 A;  2GTO A;  4LE9 A;  1OV3 A;  1WYX A;  4RTX A;  4F14 A;  2CSI A;  2C0O A;  1S1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...