3EG0A

Crystal structure of the n114t mutant of abl-sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSTYITPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
total genus 12
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg0A00
1Z9ZA 1CKAA 1S1NA 2IIMA 5GJWB 2K9GA 2J6OA 2KEAA 2CUBA 4HVWA 1AZGB 1MUZA 1PKTA 2L3SA 4Y92A 2EGAA 1X43A 1RI9A 1ZUYA 2EVRA 2RQUA 4HVUA 5GJVB 1IO6A 2CUDA 1HD3A 5HCKA 3TSZA 2VVKA 2CH4A 1I07A 1YN8A 3H41A 4LN2A 3VS2A 1GFCA 4F16A 4FSSA 1M27C 2KR3A 2C0IA 2B86A 1FMKA 1YP5A 3EG1A 2DLPA 2JM8A 3EHRA 1AWJA 3H0FA 3EHQA 1UE9A 2KGTA 4F17A 3VS0A 2A08A 2LJ1A 1MV3A 2F2WA 2LNHB 1BB9A 1B07A 1UJYA 2O9VA 1WDXA 4Z8AA 2JS2A 1G83A 2JW4A 4OMQA 5I22A 1UECA 2XMFA 2YUQA 4AFZC 1JEGA 2ENMA 2ROTA 2RQVA 1JXMA 1QLYA 4J9DA 3NGPA 1QKWA 2J7IA 2YSQA 2FG0A 2YUPA 2DJQA 4AFSC 1AVZC 1PNJA 2J06A 2DL4A 1PRMC 1WXUA 3REBB 3UA6A 1VYUA 4AFQC 2EYZA 1UHFA 4E6RA 2FRYA 4Z89A 1I1JA 4KRTA 2RNAA 2JT4A 2AZSA 2OJ2A 2LQWA 4GLMA 1ZLMA 1AD5A 1UHCA 1GFDA 1ABQA 1W1FA 3UA7A 4IIMA 4RTUA 1QWEA 2EYWA 1SRLA 3UF4A 2M0YA 1HSQA 3QWYA 1NLPC 3M0TA 1YWPA 3I5RA 1SRMA 2GBQA 5I11A 2GNCA 1KSWA 3EGUA 2NUZA 2DNUA 4D8DA 1RLQC 1TG0A 1WA7A 3H0IA 4HCKA 1CSKA 2V1QA 1KIKA 1WXBA 1JXOA 4Z88A 3VS5A 1GBRA 2DVJA 2RQWA 1JQQA 1WI7A 1N5ZA 1WIEA 1ZSGA 2L3PA 1AWWA 1NYFA 1X6BA 2HSPA 1NM7A 2RMOA 4DEYA 2A37A 1X2QA 4J9HA 2CSIA 2KNBB 2JMAA 1GCQC 2EKHA 3GBQA 3M0PA 1K1ZA 2YUOA 1M3BA 2F2XA 2LMJA 4RUGA 2G6FX 1A0NB 1WX6A 5ECAA 2BZ8A 1YCSB 4A63B 2FEIA 1T0HA 2HCKA 1UGVA 2W10A 2LJ3A 2MCNA 1W6XA 2QDLA 2YT6A 2LP5A 2A28A 2O2OA 3M0SA 1SEMA 5EC7A 3RNJA 3H0HA 4WCIA 1QKXA 1WXTA 1T3LA 4JJCA 1PRLC 1H3HA 1NG2A 2VWFA 2CH4W 2RN8A 2JTEA 4OMMA 1B3QA 1KFZA 2FRWA 2YDLA 2ROLA 1PHTA 1T0JA 2EGCA 2SEMA 3VS1A 1OPLA 2C0TA 4EIKA 1Y57A 4IIOA 2KRNA 2HDAA 4RTTA 2ED0A 2LJ0A 2RPNA 5IHKA 2LX7A 1VYVA 1GL5A 1K9AA 1UJ0A 2AKLA 2KE9A 2K3BA 2KT8A 1E6HA 2DRMA 1X6GA 2D8JA 2DX1A 3M0QA 4R0KA 4LE9A 4J9FA 2LQNA 1X27A 2EYYA 4CC3A 2JS0A 2DM1A 1YWOA 3PE0A 3REAB 5IHNA 5L23A 2L2PA 2ESWA 1UUEA 2KYBA 1VA7A 1GCPA 1XOVA 5IHIA 4CC7A 3TVTA 1BK2A 2KXDA 2ABLA 3I9QA 1J3TA 2YUNA 1E7OA 3U23A 1I0CA 1HJDA 1SPKA 2E5KA 5IH2A 2KROA 1V1CA 1EFNA 2KRMA 2X3XD 1SSHA 1BBZA 3TSWA 1SHGA 2AZVA 1QWFA 1AEYA 2DL3A 2FPFA 4ESRA 2K7AA 1U3OA 2A36A 4JPBW 3NHNA 2JXBA 4OMOA 1K0XA 4AG1C 2O88A 3VS3A 3QWXX 4J9EA 3M0UA 4LUDA 2KBTA 4RTVA 1UDLA 1JU5C 1WFWA 3VS7A 2M51A 3KFVA 4ZNXA 1H92A 2BTTA 2CT4A 2RQRA 2SRCA 2W0ZA 4JJBA 2K6DA 1TUCA 3JV3A 1RUWA 2RF0A 3VRYA 2DL8A 2ED1A 2LCSA 2GQIA 2V1RA 1ZUKA 2OAWA 1X69A 2J6FA 3M0RA 3UATA 2EGEA 1E6GA 2KYMA 2CT3A 3O5ZA 1OPKA 2OI3A 3SEMA 1K76A 2KRSA 2C0OA 2CDTA 2EW3A 4AG2C 2FPEA 4OMLA 2FO0A 5IXFA 3R6NA 2RQTA 1NLOC 2L3QA 1ARKA 4JZ4A 1RLPC 1GCQA 2L0AA 2LZ6B 1WYXA 1X2KA 2NWMA 4ORZA 2KT1A 1K0SA 2D1XA 4HXJA 2DILA 1CKBA 1NEGA 2DF6A 2DRKA 1JO8A 2GTOA 3CQTA 1K4US 1QCFA 2PZ1A 1G2BA 1GRIA 2CREA 1U5SA 5FWBA 3RBBB 3VS4A 5IXBA 4CC4B 1M30A 1H8KA 2PTKA 2DE0X 2CSQA 2O31A 1PKSA 2DBMA 1AOJA 2MIOA 4OMNA 3A98A 1NYGA 3C0CA 1M3AA 2HEQA 2EPDA 1UG1A 2DBKA 2J6KA 1TUDA 3SHWA 2DMOA 2H8HA 2BZXA 3NMZC 1ABOA 4RTXA 2X3WD 1OOTA 4LUEA 1MV0B 1ZBJA 2EQIA 4RTWA 3EG2A 2VKNA 4RTZA 3VRZA 2GTJA 2K79A 4JZ3A 1VYTA 1GBQA 1Y0MA 1SHFA 1NEBA 1WLPB 4RTYA 2AK5A 2EBPA 2PNIA 1PWTA 4J9IA 2FPDA 4X1VA 3PVLA 2JMCA 3ZL7C 4DEXA 2I0NA 3PVQA 3EG0A 4CC2A 1W70A 1LCKA 4K11A 5FW9A 4GBQA 1KJWA 2EYXA 2J05A 1ZUUA 2KXCA 2ECZA 1AWXA 1YNZA 1OV3A 1T3SA 2D0NA 1UTIA 2F2VA 2JM9A 2DA9A 1U06A 3FJ5A 1FYNA 2DL5A 4JJDA 2DL7A 4J9BA 2K2MA 3VS6A 1AZEA 3IQLA 3THKA 4QT7A 3I5SA 1OEBA 1M8MA 2O9SA 4AFUC 2D8HA 1ZX6A 4OMPA 1BU1A 2GGRA 3EG3A 1UFFA 3I35A 4J9GA 2BZYA 2HBWA 3NPFA 2AKKA 1AWOA 4M4ZA 3LH5A 4J9CA 4LNPA 2DYBA 2P4RA 5FWCA 3ULRB 2MOXA 4D8KA 1Z9QA 4F14A 1M3CA 4HVVA
chains in the Genus database with same CATH superfamily
1NPRA 1WHKA 1Z9ZA 1CKAA 1XTDA 1KQ1A 2KEAA 2CUBA 2FZCB 5FROA 1OU8A 1QVGS 4M7DC 4HVWA 4QVCA 1YIJT 3OYHA 4M7AC 5HCKA 5LJ5d 3TSZA 3OMGA 4C92F 1K8AU 4HCCA 3HSBA 1I07A 4M75G 3P8BB 1YN8A 3H41A 1GFCA 4F16A 2ZPHB 3QO3A 2L3RA 2PVGB 2RHUA 2DLPA 5LJ3g 3RMQA 4QW2A 4BUGA 2JM8A 3CCSQ 2XDBA 1VQNA 2KGTA 4D6WA 2A08A 2XD0A 3CC4T 3L42A 2EFIA 1BB9A 4MMKA 2JW4A 4OMQA 1UECA 2YUQA 2DFUA 4J5YA 3CCRA 1KQSS 1EZZB 1WPYA 1VQ6T 3HRTA 2YSQA 4QVDA 2D6FA 1YJWA 2YUPA 4AFSC 3OYEA 4XU0A 4XTXA 3OYAA 3REBB 3CCVT 3UA6A 3HTRA 1UEBA 1I1JA 3CC4A 1VQKT 1N9RA 2JT4A 4OF1A 4NS5A 3SWNC 1ZHIA 3C95A 2LQWA 3MPUB 4E7HA 2LT4A 3PMIA 1FWZA 2YRVA 1YJWQ 3UA7A 2KMTA 4IIMA 5CR2A 5GAMg 1U1TA 1V76A 1YJ9A 1ZQ1A 3CXCA 4A4HA 1YJNQ 1IB8A 4E7ZA 5J26A 1HSQA 4HKEA 2MWPA 1SRMA 3OYBA 2E64A 4JS4A 5D6WA 3TCJA 4PJOG 3BDUA 3EAEA 4XK8E 2QGGA 1KIKA 1CSKA 1WXBA 2LCCA 3MHXA 4C8QA 4FYVB 1QCNA 1WI7A 3OYFA 5KYYB 3JB9H 2PUKB 5I2SA 1M2VB 3L1AA 1X2QA 3CCVA 1QP3A 2KNBB 3DLLA 1K8AC 1GCQC 3JCMV 2HD0A 4NL3A 2F2XA 2K5FA 3G71Q 3KUFA 1S72Q 2OTLA 2BZ8A 1X75C 1Y96A 3GLXA 1H3ZA 3X28B 2HCKA 2KY9A 2RH2A 2W10A 2M02A 2LJ3A 2MCNA 1W6XA 1P92A 1M1KU 3SWNA 3RNJA 1WXTA 3ER0A 1NG2A 4OVAA 4EMHA 1VQLT 3JCMW 2KI7A 2P4TA 3CD6T 3RKXA 3F70A 2ZPEB 4KH1B 3A8MB 3META 3ME9A 2MAMA 1C6VX 1OPLA 2R5MA 4EMKB 4KUIA 2C0TA 5KYXA 4EIKA 4IIOA 1YJNA 1ZBXA 2KRNA 1JJ2A 2RI2A 5IHKA 2O4XA 2LTOA 3QZ9B 1K9AA 4LDXA 2KE9A 1V29B 2K3BA 1YBYA 2DEUA 2KT8A 5GAMd 4JRPA 2DRMA 2G3RA 2X4JA 3M0QA 2V26A 3CMEQ 4TVRA 4M75C 2EYYA 2K3XA 1KK7A 2JS0A 3VV0A 1NJIU 2QQSA 3TU4K 2HKNA 3PIPA 4ELYC 2EWNA 1GCPA 1XOVA 4A54A 2XI9A 4HA8A 4A4KA 4CC7A 1I4K1 4CRIA 1TSFA 2QAZA 5GMKh 4P5NA 4C5HA 4MZTA 1E7OA 1I0CA 2RJDA 4PJOD 4IURA 2CZ0B 3OS5A 5IH2A 2DD4A 1D0XA 4E7IA 1TH7A 3CCRQ 2Z0WA 2X3XD 2CYZB 1BBZA 1M8VA 1U3OA 2DXCA 2LCLA 3RIRA 4IKFA 5DY9A 3WVDB 4JRIA 4RCBA 3QWXX 1WFWA 1YI2T 2M51A 4ZNXA 4PJOF 5J3BA 5FRNA 1RAGB 4F04B 2MK5A 3OQ5A 1IHWA 2K6DA 1TUCA 1D1AA 3JV3A 3EG9A 1RUWA 1N8RU 4EPCA 4F7UB 2RHZA 4PLLA 4C0FA 4YTLA 4KGVB 2A7YA 4ANJA 3JCMJ 2GQIA 3CCSA 1ZUKA 4BI3A 5DM7R 3X26B 4XTUA 2C0OA 5GAMj 2FO0A 5GMKi 5IXFA 3G6ET 1WQ7A 1K73C 4JZ4A 3UPUA 2AT1B 4M77F 1YCYA 2BUDA 1UB4A 1M90C 2FVUA 2DERA 4M75E 1YHQQ 2D1XA 1OYXA 1WHHA 4EMGA 2P0KA 3CBPA 2K5IA 5KCOA 2PUOB 2E12A 2DRKA 2LT1A 3CXCP 1BYMA 4N0AA 3G6EQ 2PZ1A 1G2BA 1GRIA 4PKCC 5IXBA 2DEQA 4LD6A 1M30A 2GFUA 1H8KA 1QMCA 4LDYA 1ACMB 2O31A 1U8RA 2RI3A 2DBMA 4M77C 1MHNA 1AOJA 3KXTA 1R0CB 2M1HA 2JN0A 1NYGA 5GAN6 2HEQA 1M1GA 2J6KA 3SDZA 1K73R 3C94A 2DMOA 1WHLA 2BZXA 1K9MU 2A3LA 2FZGB 1ABOA 4EMKC 4RTXA 3VYGA 2EQIA 2JOYA 3PMTA 3S3OA 3EG2A 1KD1R 1VQ6Q 4RTZA 3T9NA 1GXIE 4BE1A 4M77G 1I5OB 3PIOA 3P8DA 2JTFA 1SHFA 1NEBA 4RTYA 2AK5A 3QBYA 3E2UA 2PNIA 1PWTA 1WQWA 2E10A 4X1VA 3PVQA 3LGFA 3EG0A 4CC2A 5DLQE 1LCKA 4C5EA 3OYNA 1VQ4T 4GBQA 1KJWA 2J05A 2CKKA 1OV3A 2V8KA 1T3SA 1UTIA 1VQ9Q 1B34A 1PD1A 3RDVA 3RR6A 3JCMh 2YHTA 4BI4A 1NE8A 3OMCA 4QT7A 4M7DD 5J39A 2HBPA 4DOVA 2DTOA 1BI3A 2QK0A 5LJ5e 3D7SB 4A53A 5C0MA 3I35A 1MNDA 2AKKA 1VQ8Q 4M4ZA 2DYBA 3J80E 1MMNA 2NLUA 6AT1B 3I55A 4F14A 1M3CA 2QXFA 1S1NA 1NBEB 2IIMA 4JRKA 2DXBA 2PU9B 2OTLT 2M0OA 1IZ6A 3J81E 1MUZA 1PKTA 4PFPA 2EGAA 2EVRA 1HD3A 1ZSZA 1DJ7B 4M77B 2CH4A 5AYFA 2VUBA 3HRUA 4LN2A 3CC7Q 1MNEA 1VQ7A 2E4HA 5A0GA 1YP5A 1IREB 1YIJA 5KE3A 1AWJA 2X4WA 3JB9G 4HCZA 1UE9A 2WACA 1B07A 1RAFB 2O9VA 4WTOB 2RB6A 1WDXA 8AT1B 1B7TA 2IVWA 5I22A 2F5KA 4AFZC 1JEGA 1WGSA 2XU8A 4FT2A 3P8HA 2RQVA 2FB7A 3HP9A 1JXMA 1QLYA 1M1KR 1FXXA 3JCMX 2FG0A 2VXEA 4KULA 1JRIA 4B9WA 5GAN4 2DL4A 4ZGDB 1VQLA 3C4SA 5KYWA 3A5ZB 1I5LA 1VOMA 1QP2A 1UHFA 2EYZA 5CKDA 1VQPA 2E1HA 2M9UA 4KRTA 3QDRB 4IUVA 1VQKA 5GANh 5LJ3d 2KQWA 3V8JA 2FYKA 1N6AA 2K2VA 1KHIA 2CP2A 2QEXQ 4OB1B 5CKEA 2EYQA 1W1FA 2D9TA 2XKOC 2EYWA 2X51A 3JCMc 1OQKA 2M0YA 1VUBA 2QQRA 5FLXE 1FMVA 3QWYA 3CCLT 1YWPA 3I5RA 1FMWA 3AHUA 1KQSA 4PNOA 1NJIR 5KYUA 5I11A 3EFOB 2HQHA 4HT9A 3EGUA 1O9SA 3NTKA 2DYIA 4F7UG 2DNUA 4KGXB 4LDVA 1TG0A 2LQ8A 2V1QA 2LQKA 2X4YA 3TREA 1YIJQ 4C8QG 1JQQA 2RHYA 1RL2A 3SD4A 5HKCA 3CC7A 2L3PA 1AWWA 1X6BA 2RMOA 1NM7A 4PJOA 4J9HA 2CSIA 3OYMA 2JMAA 2AHJB 2MMPA 2E3IA 3EGDA 4ZGEB 1TOVA 3V7SA 1K1ZA 3M56A 1A0NB 1IRXA 2OTJT 5CK9A 2NUTA 2ZPBB 1T0HA 2NYSA 2MYSA 4BI8B 2YT6A 4AT1B 5EC7A 1SEMA 4WCIA 3M53A 1VQ8A 3S3NA 1EX4A 1T3LA 2QQBA 4JJCA 4XU2A 4C5GA 3ZBDA 1H3HA 1XNIA 4M78F 5CCAA 1VQ4A 2CH4W 1WZOA 2RN8A 2JTEA 2FHDA 1B3QA 1WHJA 2FRWA 4JUVA 2ROLA 2EGCA 2SEMA 3URGA 3H9NA 1D0ZA 4KBMB 2LX7A 4ZGJB 4C0ZA 2KDSA 5GAMf 1W4SA 2K4YA 5D6YA 2DX1A 2RD1A 3LWHA 1X27A 1KQSP 3RMSA 4FT4A 3I56T 4MDWA 1EIFA 2FL7A 3H8ZA 3OYGA 3OYJA 2JZ2A 3PE0A 3JB9F 5L23A 2F5TX 1VA7A 5IHIA 4RCCA 3FJPA 1BK2A 2KXDA 3CMAA 3I9QA 1RADB 3LW5E 1UGPB 1HJDA 1SPKA 2QEXA 2E5KA 5KYYA 4MZPA 4OB0B 1V1CA 3H6ZA 2KRMA 1VQKQ 1OU9A 1SSHA 4ATOA 1VQPQ 2DL3A 5CQYA 1JJ2S 2K7AA 3NHNA 2DETA 3VUBA 1QW1A 1NPPA 4AG1C 2O88A 5LJ5h 1YJNT 1Q86R 1MGQA 3CBMA 1JU5C 1M4ZA 3VS7A 3CEYA 3CMAT 2PVOB 4FW2A 2I2LA 1Y96B 2CP5A 2JTMA 3A8OB 1TWBA 4L6V5 2RQRA 1YITQ 4PJNA 3MCAB 1C1AA 3G4SQ 2VASA 4PJLA 2VB6A 5GAMe 3CC7T 4ZN1A 4PJOB 4JLIA 5GMKl 2DL8A 3QHSA 3S3MA 1M1KC 2J6FA 3UATA 3LWIA 3CCQA 2YRCA 2KYMA 3HFNA 2CP6A 3JCMP 2KRSA 3M5AA 3I55Q 5CQXA 5LJ3e 2CDTA 2EW3A 2O4XB 1OX8A 4Q5WA 3R6NA 4BE0A 3CCLA 2GFAA 2CP7A 1OX9A 3MEVA 4O5VA 5FRMA 1GCQA 1FX7A 4B6MA 2OX7A 1Q86C 2H3JA 4EDUA 2CZ7B 3CCQT 1K0SA 2QYZA 4BB7A 4X34A 3VUZA 1VQNT 5GAOm 4V2SA 2ZPGB 3CQTA 4PK4A 4NOYA 3SB2A 4R55A 5FU6B 3JB9I 3VS4A 5FWBA 3L2VA 1NJIC 4QKUA 5CKBA 2PTKA 3HHTB 2CSQA 5GAN7 4M7DE 2YWWA 1WJRA 4FYYB 2R5AA 3HPWA 5LJ3f 3EFSA 4XTWA 4E47A 3A98A 4QQ6A 2VGMA 1UG1A 2DBKA 1QQJA 3BDLA 5LJ5g 5GANg 3PFSA 3SHWA 3GP8A 2RA2A 2ZCFB 3DKMA 4FL6A 2CS7A 4LUEA 2BE9B 2EKOA 2VKNA 3VRZA 3X25B 4PJMA 1GBQA 3EG9B 3SFMA 4J6XA 2WSFE 2JJ9A 2JMCA 3CBOA 1VQ6A 3ZL7C 3GOXA 3MEUA 3TEEA 1BI2A 3OSSC 3V8LA 3X24B 2BIVA 3I56A 3MKDA 2KXCA 3RUXA 3JSCA 4CI0C 2QTVA 2D0NA 5M9OA 5GMKj 1G5VA 1FYNA 3CCUA 2QQAA 4AMCA 3VS6A 2HNIA 2QASA 3IQLA 3THKA 2HL5C 4OMPA 2GGRA 1G3SA 1YITT 3OSVA 3QKJA 2HBWA 2GF7A 3NPFA 3KBGA 3RERA 4J6YA 1AWOA 1ZSZC 1M5Q1 1SG5A 1TTHB 1IXDA 1WJSA 4M7AA 4A4GA 4OGEA 3J7AF 3QYHB 3HFOA 4II1A 2DPPB 5FWCA 5D7UA 2MOXA 4D8KA 2EIFA 3L2ZA 2HL3A 1Z9QA 2K5LA 4J7FA 4HVVA 1QVGP 5GJWB 2K9GA 2J6OA 2ZGWA 2COWA 3L2RA 2CZ1B 3M58A 5C6SA 1AZGB 4Y92A 1X43A 1RI9A 4M78G 2RQUA 5GJVB 3CC2A 1IO6A 3CCVQ 2CUDA 2VVKA 1K73U 2IG0A 5GAOr 3DB4A 3VS2A 2DXTA 2XDDA 4FSSA 2DJZA 3TQ7P 3ZFJA 2C0IA 2QG9B 4RKUE 3UT1A 1KD1U 3EHRA 3H0FA 4C8QC 2F2WA 2D0QB 2LNHB 4DQ2A 1LVKA 1UJYA 4LD9K 2DAQA 4Z8AA 5I21A 4RG8A 1RAIB 2JS2A 1G83A 5FU7C 2R57A 2ENMA 1YJ9Q 1D0YA 3CPWS 1X01A 4E7KA 2DO3A 3GF5A 3NGPA 2J7IA 3CCJQ 1Q81R 4OB3B 1D1BA 1KC8U 1AVZC 1BIAA 3QJYA 4QQGA 2J06A 1PRMC 1WXUA 1Q7YU 1VYUA 3EGXB 3RKWA 4N0AC 2DVEA 2FRYA 4C8QF 1Y71A 4M7AD 3JCMd 2KSSA 2QA4Q 2CZ6B 3CMEA 2AZSA 1UGSB 4L59A 4Y28E 1MMDA 4GLMA 1Q82R 1UHCA 1UGRB 1GFDA 1ABQA 4C8QB 4RTUA 3M54A 3BFMA 1VQ5T 1S72T 3UF4A 1ZA2B 3QPHA 1NLPC 3M0TA 3CC2T 3OYIA 3EH1A 3JRZA 3OB9A 2X9HA 4R56A 2NUZA 3N5BB 4M7AF 3QYGB 4D8DA 5L8RE 1RLQC 4BD3A 1WA7A 3H0IA 4HCKA 2RK1A 1JXOA 5I2MA 1N9SA 2DVJA 2RQWA 4M7DB 3JCMe 4O6JA 1N5ZA 3VKIA 1ZSGA 1NYFA 4XQ3A 2HSPA 4FU6A 2A37A 4LDWA 3CC2Q 4BE2A 2L5QA 2K3YA 4JJNK 2EKHA 3M0PA 4DBRA 2NUPB 3OBWA 1M2OA 3OY9A 3G4ST 3CCJT 4RUGA 1VIFA 2G6FX 4BDYA 2IPOB 4C92A 4C8QE 3OS2A 2FEIA 3AT1B 4M78B 1MMGA 1K9MR 4RMOA 1VQMQ 1R77A 2MI6A 2QDLA 1VQMA 4MDXA 2LP5A 2A28A 1LOJA 2HSEB 3MP8A 1QKXA 3OW2A 2MWOA 2OTLQ 1PRLC 3RESA 5A2QE 4OMMA 1G3WA 2KK4A 2V8IA 5KYWB 2YDLA 1PHTA 2EJGA 4PFZA 1HYOA 2CP0A 5GAN3 1PCXA 1Q81C 2COYA 1Y57A 1M9SA 2XIDA 4RTTA 1RACB 2OAUA 1GL5A 3SWNB 5GAMh 2AKLA 5CAIA 2HMAA 3I56Q 4XTYA 1X6GA 2PVDB 2LQNA 4CC3A 2QA4A 4ME7A 2EQKA 4XAXB 3CC4Q 2A0FB 1D3BB 1YI2Q 1YWOA 4KGZB 2DTHA 8ATCB 1VQOQ 2L2PA 1I81A 2ESWA 4E2FB 1KC8C 4FSXA 1VQ7T 3QIIA 3OYKA 2ABLA 5CVIA 2YUNA 4BACA 3G7ZA 1ZSZB 2KROA 3GPLA 2RM4A 4M75A 4OP0A 5LL6S 1VQOA 2E6NA 1QWFA 2FPFA 3VJPA 2V8JA 2A36A 2JUFA 4JPBW 4HCBA 4F7UA 1BKBA 3WXMB 3HKSA 4UC4A 2XHCA 1K0XA 2MF2A 2R58A 3VS3A 4J9EA 1G3YA 2LC4A 4E7SA 4LUDA 2DK3A 2KBTA 4QVZA 2GQVA 3CCJA 1KQ2A 1UDLA 4KT0E 3E9FA 2WSCE 4M7AE 1M90R 1H92A 5CKFA 2X35A 3QUIA 1KC8R 2BTTA 2CT4A 2SRCA 4JJBA 3PNWC 3C12A 2CGHA 1RAEB 5CO7A 3VRYA 5GAOl 1D09B 2YLBA 2X4XA 4C92G 4X9DA 2ED1A 2LCSA 2KVQG 3PGGA 3MJXA 2V1RA 2DD5A 1O75A 2DZCA 1X69A 3LH0A 3OYLA 1E6GA 2CT3A 1OPKA 2OI3A 4F7UF 3OYYA 2VV5A 5GANe 3MP6A 2YRDA 4AG2C 3QG1A 2LVMA 3QJ6A 2RQTA 1JB0E 1S72A 3CCQQ 3G71A 3JCMg 2L0AA 2ZAEA 1X2KA 2O01E 5GANf 2NWMA 2QI2A 4M7DF 4ORZA 3JB9J 2KT1A 2VYTA 2DILA 4IUUA 3PTAA 3CMET 2K57A 4C92C 3GNGA 1AT1B 1BCMA 2LX9A 2DF6A 1LPLA 2GTOA 4C0DB 2E65A 1N27A 2CREA 1U5SA 3RBBB 4CC4B 3S6WA 1H641 2EQUA 2DE0X 3L2QA 4QQDA 3CD6Q 3LX7A 4OMNA 1W2BP 3CCRT 3CCUQ 4J83A 1TUDA 2ZPIB 3E19A 5GAOq 4J8OA 4HT8A 1VQOT 2XICA 1WHGA 3UDCA 1OOTA 2KAFA 1ZBJA 1WJQA 4RTWA 1Y7XA 2XDPA 2RHIA 2K79A 1VYTA 4J7IA 3OS1A 3G71T 4FYWB 1WLPB 2DKGA 2DIGA 2EBPA 2E3HA 4J9IA 3OA6A 4OMFB 4ZN3A 5AT1B 3PVLA 4DEXA 1VQ5A 2I0NA 2F69A 1UGQB 4K11A 4BY6B 1RABB 3A1PA 2LRQA 2EYXA 1PSFA 3QDFA 1ZUUA 5GAOp 1Q81U 4J6WA 1YNZA 2B8AA 1NZ9A 2F2VA 5A0LA 1U06A 3FJ5A 3NTIA 4C92E 4JJDA 4M77D 3CCET 2DL7A 4FIBA 1AZEA 3ASKA 1LJOA 1HXDA 3I5SA 5KYXB 5HY6A 2O9SA 3X20B 1VQNQ 1ZX6A 1BU1A 3EG3A 1TXQA 5GMKe 3A8GB 5GMKm 9ATCB 1M2VA 4M77A 3LH5A 1M1FA 1YHQT 4LNPA 1RAAB 4M7DA 1LNXA 7AT1B 3ULRB 5D6XA 1QVPA 3NTHA 5IAYA 4Y91A 5KH6A 5GAN2 3HRSA 3WVEB 3QZ5B 1YFNA 2L3SA 1IGUA 5A0DA 4HVUA 1ZUYA 3G4SA 4PFOA 1R8OB 4IUTA 4NL2A 1M27C 2KR3A 2B86A 1FMKA 1W2BA 3EFRA 3EG1A 3JB9D 1JBMA 1KG1A 2BE7D 2EQJA 5KYUB 1XJWB 3EHQA 4F17A 3VS0A 2LJ1A 3FB9A 1MV3A 5GAOn 4DOWA 2XMFA 1RAHB 3CCEQ 3BE3A 3VU3C 3CCMQ 1Q86U 2ROTA 2OTJA 1PC0A 4J9DA 3L2WA 4N4HA 5FU7B 1N8RC 1QKWA 1C0MA 2RJCA 5IT9E 4KH0B 2AIRB 2DJQA 4FM4B 1PNJA 1QVGA 5LJ3h 4M75F 4BY6C 4MZMA 3R6OA 4XTVA 3M57A 4M78C 4AFQC 4DBQA 4E6RA 3EGDB 4Z89A 1VQ9T 4GY5A 2MPXC 1U1SA 2RNAA 1VQLQ 2OJ2A 2Y4YA 1ZLMA 1AD5A 2CP3A 2DIQA 2QQ9A 3LGLA 1QWEA 1BI1A 2ATCB 3CMAQ 4JS5A 3M4GA 3HL8A 2OTJQ 1SRLA 2RJEA 4M7AB 4JDSA 1WHMA 2EJFA 3QSUA 2NUPA 2FZKB 2GBQA 2DXUA 4C0DC 4X9CA 2GNCA 2COZA 3CPWA 1KSWA 2C06A 5HK0A 1HK9A 1VQ4Q 4PJOE 4ZTFA 1I8FA 2LNVA 1IHVA 3FEOA 5CKHA 4Z88A 3UWNA 3VS5A 5KYNA 1K8AR 1GBRA 3I55T 1VQPT 5KCHA 2BKDN 1WIEA 2HQXA 4N4IA 4LXCA 1G8XA 4DEYA 4XU3A 1JJ2P 1PSEA 3MEWA 2EQMA 3GBQA 5FU6C 2YUOA 1M3BA 2LMJA 1K9MC 3A8LB 1D1CA 2VGNA 1WX6A 5ECAA 4M75B 1SSFA 3FDRA 1YCSB 4A63B 3O8VA 3CXCS 3CCLQ 1KD1C 2P0QA 1UGVA 2Y4XA 3CCST 3CPFA 2O2OA 3M0SA 4C92D 3H0HA 4PL6A 3EH2A 3VYHB 2P84A 2VWFA 1Q7YR 3OYDA 1KFZA 3EGXA 2EAYA 1PD0A 3FC3A 4RG2A 3QXEB 1T0JA 5GAN8 4VUBA 1BCOA 3VS1A 1YITA 1TUGB 1OZ2A 3V7RA 2DTIA 2HDAA 2ED0A 2LJ0A 2RPNA 1VYVA 2E70A 1UJ0A 4A4FA 3V8KA 1E6HA 1VQMT 2JNGA 3CCMT 2D8JA 1OULA 4R0KA 4LE9A 4J9FA 3Q1JA 2DM1A 4M78E 3M9QA 3REAB 5IHNA 1UUEA 2KYBA 2P0PA 3INZA 3TVTA 4DBFA 4GLKA 4PLIA 3OW2S 3M55A 1R0BG 1J3TA 3ZEHA 2ZZDA 3U23A 2HAXA 3JAME 1PG5B 1WNLA 1Y07A 3E1SA 4IUQA 1EFNA 4JLGA 3CCEA 2QA4T 4OB2B 3TSWA 1SHGA 2AZVA 1X6OA 4XTZA 3OYCA 1AEYA 4ESRA 1BIBA 1VIEA 4JRQA 2JXBA 3FLGA 4OMOA 2RI5A 2WSEE 1Q7YC 3M0UA 3DB3A 4RTVA 4E7JA 2NUTB 2RJFA 4DA4A 3KFVA 4M78A 3G6EA 1YJ9T 4M7DG 3PT9A 4MMLA 4PJOC 2Y90A 3L2UA 2W0ZA 1PM3A 2RF0A 4N4GA 3CCUT 4E7LA 2M16A 3EFOA 2L89A 2OAWA 3MO8A 4A4EA 2RK2A 2YXYA 3M0RA 3OBYA 2EGEA 3O5ZA 2E6ZA 4M7AG 3SEMA 1K76A 4PJJA 2FPEA 4OMLA 5LJ5f 3FIFA 1IGQA 1NLOC 1Q82C 2L3QA 3NFCA 1ARKA 3BW1A 5IN1A 3FRNA 1RLPC 2LZ6B 1OI1A 5KE2A 2QGFB 1WYXA 2VXFA 3RKYA 2VC8A 1BI0A 3MEAA 4HXJA 1CKBA 5EG2A 1VQ8T 1NEGA 2LDMA 2HQEA 1Q82U 1VQ9A 3M59A 2RO0A 1JO8A 4F7UE 1K4US 2XK0A 1QCFA 2EJ9A 2QDYB 4FYXB 3OW2P 4DBHA 3JCMb 5LJ3j 2E5QA 1PKSA 2DZ9A 4M77E 3JCMf 1XQHA 2MIOA 1RI0A 2QTXA 2HZYA 3C0CA 3DLMA 1M3AA 5LJ5j 4M78D 1AHJB 2EPDA 3MP1A 5GANj 2H8HA 3LYIA 3NMZC 2ZPFB 2L8DA 4B9XA 2X3WD 4LDUA 1MV0B 1M90U 4EMKA 2YLCA 1VQ5Q 4ELZC 2QEXT 5GAN5 2GTJA 2GCXA 4FW1A 4JZ3A 4C92B 1QVFP 1OZ3A 1Y0MA 4WF2A 1Q95G 4L5GA 1N8RR 1SF9A 1YJWT 3V7CA 4KUDK 1YI2A 2F1LA 2FPDA 3CD6A 2XG8D 4C0GA 2RHXA 4M75D 1W70A 4Z02A 5FW9A 2E41A 1B34B 4XU1A 2ECZA 1AWXA 3CCMA 3BY7A 1MMAA 2JM9A 2H3EB 1TU0B 2DA9A 3GNFB 1F1BB 3LLRA 1KHCA 5HK3A 2DL5A 4J9BA 2K2MA 4FCYA 4OGCA 2HKQB 1YHQA 1QVFS 4C5IA 1ZA1B 1OEBA 1W2BS 1M8MA 4AFUC 3G1JA 2D8HA 5GANd 1UFFA 2PQWA 4C8QD 1TS9A 4J9GA 2BZYA 3E9GA 4ZTJA 3M4YA 1D3BA 4IUPA 1SKUB 1QVFA 5CIUA 3GIBA 2JVVA 1VQ7Q 4J9CA 3CPWP 1G3TA 4BDZA 3JCMQ 2P4RA 3A8HB 3OS0A 5DLOA 1QCOA
chains in the Genus database with same CATH topology
1Z9ZA 1CKAA 1S1NA 2IIMA 5GJWB 2K9GA 2J6OA 2KEAA 2CUBA 4HVWA 1AZGB 1MUZA 1PKTA 2L3SA 4Y92A 2EGAA 1X43A 1RI9A 1ZUYA 2EVRA 2RQUA 4HVUA 5GJVB 1IO6A 2CUDA 1HD3A 5HCKA 3TSZA 2VVKA 2CH4A 1I07A 1YN8A 3H41A 4LN2A 3VS2A 1GFCA 4F16A 4FSSA 1M27C 2KR3A 2C0IA 2B86A 1FMKA 1YP5A 3EG1A 2DLPA 2JM8A 3EHRA 1AWJA 3H0FA 3EHQA 1UE9A 2KGTA 4F17A 3VS0A 2A08A 2LJ1A 1MV3A 2F2WA 2LNHB 1BB9A 1B07A 1UJYA 2O9VA 1WDXA 4Z8AA 2JS2A 1G83A 2JW4A 4OMQA 5I22A 1UECA 2XMFA 2YUQA 4AFZC 1JEGA 2ENMA 2ROTA 2RQVA 1JXMA 1QLYA 4J9DA 3NGPA 1QKWA 2J7IA 2YSQA 2FG0A 2YUPA 2DJQA 4AFSC 1AVZC 1PNJA 2J06A 2DL4A 1PRMC 1WXUA 3REBB 3UA6A 1VYUA 4AFQC 2EYZA 1UHFA 4E6RA 2FRYA 4Z89A 1I1JA 4KRTA 2RNAA 2JT4A 2AZSA 2OJ2A 2LQWA 4GLMA 1ZLMA 1AD5A 1UHCA 1GFDA 1ABQA 1W1FA 3UA7A 4IIMA 4RTUA 1QWEA 2EYWA 1SRLA 3UF4A 2M0YA 1HSQA 3QWYA 1NLPC 3M0TA 1YWPA 3I5RA 1SRMA 2GBQA 5I11A 2GNCA 1KSWA 3EGUA 2NUZA 2DNUA 4D8DA 1RLQC 1TG0A 1WA7A 3H0IA 4HCKA 1CSKA 2V1QA 1KIKA 1WXBA 1JXOA 4Z88A 3VS5A 1GBRA 2DVJA 2RQWA 1JQQA 1WI7A 1N5ZA 1WIEA 1ZSGA 2L3PA 1AWWA 1NYFA 1X6BA 2HSPA 1NM7A 2RMOA 4DEYA 2A37A 1X2QA 4J9HA 2CSIA 2KNBB 2JMAA 1GCQC 2EKHA 3GBQA 3M0PA 1K1ZA 2YUOA 1M3BA 2F2XA 2LMJA 4RUGA 2G6FX 1A0NB 1WX6A 5ECAA 2BZ8A 1YCSB 4A63B 2FEIA 1T0HA 2HCKA 1UGVA 2W10A 2LJ3A 2MCNA 1W6XA 2QDLA 2YT6A 2LP5A 2A28A 2O2OA 3M0SA 1SEMA 5EC7A 3RNJA 3H0HA 4WCIA 1QKXA 1WXTA 1T3LA 4JJCA 1PRLC 1H3HA 1NG2A 2VWFA 2CH4W 2RN8A 2JTEA 4OMMA 1B3QA 1KFZA 2FRWA 2YDLA 2ROLA 1PHTA 1T0JA 2EGCA 2SEMA 3VS1A 1OPLA 2C0TA 4EIKA 1Y57A 4IIOA 2KRNA 2HDAA 4RTTA 2ED0A 2LJ0A 2RPNA 5IHKA 2LX7A 1VYVA 1GL5A 1K9AA 1UJ0A 2AKLA 2KE9A 2K3BA 2KT8A 1E6HA 2DRMA 1X6GA 2D8JA 2DX1A 3M0QA 4R0KA 4LE9A 4J9FA 2LQNA 1X27A 2EYYA 4CC3A 2JS0A 2DM1A 1YWOA 3PE0A 3REAB 5IHNA 5L23A 2L2PA 2ESWA 1UUEA 2KYBA 1VA7A 1GCPA 1XOVA 5IHIA 4CC7A 3TVTA 1BK2A 2KXDA 2ABLA 3I9QA 1J3TA 2YUNA 1E7OA 3U23A 1I0CA 1HJDA 1SPKA 2E5KA 5IH2A 2KROA 1V1CA 1EFNA 2KRMA 2X3XD 1SSHA 1BBZA 3TSWA 1SHGA 2AZVA 1QWFA 1AEYA 2DL3A 2FPFA 4ESRA 2K7AA 1U3OA 2A36A 4JPBW 3NHNA 2JXBA 4OMOA 1K0XA 4AG1C 2O88A 3VS3A 3QWXX 4J9EA 3M0UA 4LUDA 2KBTA 4RTVA 1UDLA 1JU5C 1WFWA 3VS7A 2M51A 3KFVA 4ZNXA 1H92A 2BTTA 2CT4A 2RQRA 2SRCA 2W0ZA 4JJBA 2K6DA 1TUCA 3JV3A 1RUWA 2RF0A 3VRYA 2DL8A 2ED1A 2LCSA 2GQIA 2V1RA 1ZUKA 2OAWA 1X69A 2J6FA 3M0RA 3UATA 2EGEA 1E6GA 2KYMA 2CT3A 3O5ZA 1OPKA 2OI3A 3SEMA 1K76A 2KRSA 2C0OA 2CDTA 2EW3A 4AG2C 2FPEA 4OMLA 2FO0A 5IXFA 3R6NA 2RQTA 1NLOC 2L3QA 1ARKA 4JZ4A 1RLPC 1GCQA 2L0AA 2LZ6B 1WYXA 1X2KA 2NWMA 4ORZA 2KT1A 1K0SA 2D1XA 4HXJA 2DILA 1CKBA 1NEGA 2DF6A 2DRKA 1JO8A 2GTOA 3CQTA 1K4US 1QCFA 2PZ1A 1G2BA 1GRIA 2CREA 1U5SA 5FWBA 3RBBB 3VS4A 5IXBA 4CC4B 1M30A 1H8KA 2PTKA 2DE0X 2CSQA 2O31A 1PKSA 2DBMA 1AOJA 2MIOA 4OMNA 3A98A 1NYGA 3C0CA 1M3AA 2HEQA 2EPDA 1UG1A 2DBKA 2J6KA 1TUDA 3SHWA 2DMOA 2H8HA 2BZXA 3NMZC 1ABOA 4RTXA 2X3WD 1OOTA 4LUEA 1MV0B 1ZBJA 2EQIA 4RTWA 3EG2A 2VKNA 4RTZA 3VRZA 2GTJA 2K79A 4JZ3A 1VYTA 1GBQA 1Y0MA 1SHFA 1NEBA 1WLPB 4RTYA 2AK5A 2EBPA 2PNIA 1PWTA 4J9IA 2FPDA 4X1VA 3PVLA 2JMCA 3ZL7C 4DEXA 2I0NA 3PVQA 3EG0A 4CC2A 1W70A 1LCKA 4K11A 5FW9A 4GBQA 1KJWA 2EYXA 2J05A 1ZUUA 2KXCA 2ECZA 1AWXA 1YNZA 1OV3A 1T3SA 2D0NA 1UTIA 2F2VA 2JM9A 2DA9A 1U06A 3FJ5A 1FYNA 2DL5A 4JJDA 2DL7A 4J9BA 2K2MA 3VS6A 1AZEA 3IQLA 3THKA 4QT7A 3I5SA 1OEBA 1M8MA 2O9SA 4AFUC 2D8HA 1ZX6A 4OMPA 1BU1A 2GGRA 3EG3A 1UFFA 3I35A 4J9GA 2BZYA 2HBWA 3NPFA 2AKKA 1AWOA 4M4ZA 3LH5A 4J9CA 4LNPA 2DYBA 2P4RA 5FWCA 3ULRB 2MOXA 4D8KA 1Z9QA 4F14A 1M3CA 4HVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9Z A;  1CKA A;  1S1N A;  2IIM A;  5GJW B;  2K9G A;  2J6O A;  2KEA A;  2CUB A;  4HVW A;  1AZG B;  1MUZ A;  1PKT A;  2L3S A;  4Y92 A;  2EGA A;  1X43 A;  1RI9 A;  1ZUY A;  2EVR A;  2RQU A;  4HVU A;  5GJV B;  1IO6 A;  2CUD A;  1HD3 A;  5HCK A;  3TSZ A;  2VVK A;  2CH4 A;  1I07 A;  1YN8 A;  3H41 A;  4LN2 A;  3VS2 A;  1GFC A;  4F16 A;  4FSS A;  1M27 C;  2KR3 A;  2C0I A;  2B86 A;  1FMK A;  1YP5 A;  3EG1 A;  2DLP A;  2JM8 A;  3EHR A;  1AWJ A;  3H0F A;  3EHQ A;  1UE9 A;  2KGT A;  4F17 A;  3VS0 A;  2A08 A;  2LJ1 A;  1MV3 A;  2F2W A;  2LNH B;  1BB9 A;  1B07 A;  1UJY A;  2O9V A;  1WDX A;  4Z8A A;  2JS2 A;  1G83 A;  2JW4 A;  4OMQ A;  5I22 A;  1UEC A;  2XMF A;  2YUQ A;  4AFZ C;  1JEG A;  2ENM A;  2ROT A;  2RQV A;  1JXM A;  1QLY A;  4J9D A;  3NGP A;  1QKW A;  2J7I A;  2YSQ A;  2FG0 A;  2YUP A;  2DJQ A;  4AFS C;  1AVZ C;  1PNJ A;  2J06 A;  2DL4 A;  1PRM C;  1WXU A;  3REB B;  3UA6 A;  1VYU A;  4AFQ C;  2EYZ A;  1UHF A;  4E6R A;  2FRY A;  4Z89 A;  1I1J A;  4KRT A;  2RNA A;  2JT4 A;  2AZS A;  2OJ2 A;  2LQW A;  4GLM A;  1ZLM A;  1AD5 A;  1UHC A;  1GFD A;  1ABQ A;  1W1F A;  3UA7 A;  4IIM A;  4RTU A;  1QWE A;  2EYW A;  1SRL A;  3UF4 A;  2M0Y A;  1HSQ A;  3QWY A;  1NLP C;  3M0T A;  1YWP A;  3I5R A;  1SRM A;  2GBQ A;  5I11 A;  2GNC A;  1KSW A;  3EGU A;  2NUZ A;  2DNU A;  4D8D A;  1RLQ C;  1TG0 A;  1WA7 A;  3H0I A;  4HCK A;  1CSK A;  2V1Q A;  1KIK A;  1WXB A;  1JXO A;  4Z88 A;  3VS5 A;  1GBR A;  2DVJ A;  2RQW A;  1JQQ A;  1WI7 A;  1N5Z A;  1WIE A;  1ZSG A;  2L3P A;  1AWW A;  1NYF A;  1X6B A;  2HSP A;  1NM7 A;  2RMO A;  4DEY A;  2A37 A;  1X2Q A;  4J9H A;  2CSI A;  2KNB B;  2JMA A;  1GCQ C;  2EKH A;  3GBQ A;  3M0P A;  1K1Z A;  2YUO A;  1M3B A;  2F2X A;  2LMJ A;  4RUG A;  2G6F X;  1A0N B;  1WX6 A;  5ECA A;  2BZ8 A;  1YCS B;  4A63 B;  2FEI A;  1T0H A;  2HCK A;  1UGV A;  2W10 A;  2LJ3 A;  2MCN A;  1W6X A;  2QDL A;  2YT6 A;  2LP5 A;  2A28 A;  2O2O A;  3M0S A;  1SEM A;  5EC7 A;  3RNJ A;  3H0H A;  4WCI A;  1QKX A;  1WXT A;  1T3L A;  4JJC A;  1PRL C;  1H3H A;  1NG2 A;  2VWF A;  2CH4 W;  2RN8 A;  2JTE A;  4OMM A;  1B3Q A;  1KFZ A;  2FRW A;  2YDL A;  2ROL A;  1PHT A;  1T0J A;  2EGC A;  2SEM A;  3VS1 A;  1OPL A;  2C0T A;  4EIK A;  1Y57 A;  4IIO A;  2KRN A;  2HDA A;  4RTT A;  2ED0 A;  2LJ0 A;  2RPN A;  5IHK A;  2LX7 A;  1VYV A;  1GL5 A;  1K9A A;  1UJ0 A;  2AKL A;  2KE9 A;  2K3B A;  2KT8 A;  1E6H A;  2DRM A;  1X6G A;  2D8J A;  2DX1 A;  3M0Q A;  4R0K A;  4LE9 A;  4J9F A;  2LQN A;  1X27 A;  2EYY A;  4CC3 A;  2JS0 A;  2DM1 A;  1YWO A;  3PE0 A;  3REA B;  5IHN A;  5L23 A;  2L2P A;  2ESW A;  1UUE A;  2KYB A;  1VA7 A;  1GCP A;  1XOV A;  5IHI A;  4CC7 A;  3TVT A;  1BK2 A;  2KXD A;  2ABL A;  3I9Q A;  1J3T A;  2YUN A;  1E7O A;  3U23 A;  1I0C A;  1HJD A;  1SPK A;  2E5K A;  5IH2 A;  2KRO A;  1V1C A;  1EFN A;  2KRM A;  2X3X D;  1SSH A;  1BBZ A;  3TSW A;  1SHG A;  2AZV A;  1QWF A;  1AEY A;  2DL3 A;  2FPF A;  4ESR A;  2K7A A;  1U3O A;  2A36 A;  4JPB W;  3NHN A;  2JXB A;  4OMO A;  1K0X A;  4AG1 C;  2O88 A;  3VS3 A;  3QWX X;  4J9E A;  3M0U A;  4LUD A;  2KBT A;  4RTV A;  1UDL A;  1JU5 C;  1WFW A;  3VS7 A;  2M51 A;  3KFV A;  4ZNX A;  1H92 A;  2BTT A;  2CT4 A;  2RQR A;  2SRC A;  2W0Z A;  4JJB A;  2K6D A;  1TUC A;  3JV3 A;  1RUW A;  2RF0 A;  3VRY A;  2DL8 A;  2ED1 A;  2LCS A;  2GQI A;  2V1R A;  1ZUK A;  2OAW A;  1X69 A;  2J6F A;  3M0R A;  3UAT A;  2EGE A;  1E6G A;  2KYM A;  2CT3 A;  3O5Z A;  1OPK A;  2OI3 A;  3SEM A;  1K76 A;  2KRS A;  2C0O A;  2CDT A;  2EW3 A;  4AG2 C;  2FPE A;  4OML A;  2FO0 A;  5IXF A;  3R6N A;  2RQT A;  1NLO C;  2L3Q A;  1ARK A;  4JZ4 A;  1RLP C;  1GCQ A;  2L0A A;  2LZ6 B;  1WYX A;  1X2K A;  2NWM A;  4ORZ A;  2KT1 A;  1K0S A;  2D1X A;  4HXJ A;  2DIL A;  1CKB A;  1NEG A;  2DF6 A;  2DRK A;  1JO8 A;  2GTO A;  3CQT A;  1K4U S;  1QCF A;  2PZ1 A;  1G2B A;  1GRI A;  2CRE A;  1U5S A;  5FWB A;  3RBB B;  3VS4 A;  5IXB A;  4CC4 B;  1M30 A;  1H8K A;  2PTK A;  2DE0 X;  2CSQ A;  2O31 A;  1PKS A;  2DBM A;  1AOJ A;  2MIO A;  4OMN A;  3A98 A;  1NYG A;  3C0C A;  1M3A A;  2HEQ A;  2EPD A;  1UG1 A;  2DBK A;  2J6K A;  1TUD A;  3SHW A;  2DMO A;  2H8H A;  2BZX A;  3NMZ C;  1ABO A;  4RTX A;  2X3W D;  1OOT A;  4LUE A;  1MV0 B;  1ZBJ A;  2EQI A;  4RTW A;  3EG2 A;  2VKN A;  4RTZ A;  3VRZ A;  2GTJ A;  2K79 A;  4JZ3 A;  1VYT A;  1GBQ A;  1Y0M A;  1SHF A;  1NEB A;  1WLP B;  4RTY A;  2AK5 A;  2EBP A;  2PNI A;  1PWT A;  4J9I A;  2FPD A;  4X1V A;  3PVL A;  2JMC A;  3ZL7 C;  4DEX A;  2I0N A;  3PVQ A;  3EG0 A;  4CC2 A;  1W70 A;  1LCK A;  4K11 A;  5FW9 A;  4GBQ A;  1KJW A;  2EYX A;  2J05 A;  1ZUU A;  2KXC A;  2ECZ A;  1AWX A;  1YNZ A;  1OV3 A;  1T3S A;  2D0N A;  1UTI A;  2F2V A;  2JM9 A;  2DA9 A;  1U06 A;  3FJ5 A;  1FYN A;  2DL5 A;  4JJD A;  2DL7 A;  4J9B A;  2K2M A;  3VS6 A;  1AZE A;  3IQL A;  3THK A;  4QT7 A;  3I5S A;  1OEB A;  1M8M A;  2O9S A;  4AFU C;  2D8H A;  1ZX6 A;  4OMP A;  1BU1 A;  2GGR A;  3EG3 A;  1UFF A;  3I35 A;  4J9G A;  2BZY A;  2HBW A;  3NPF A;  2AKK A;  1AWO A;  4M4Z A;  3LH5 A;  4J9C A;  4LNP A;  2DYB A;  2P4R A;  5FWC A;  3ULR B;  2MOX A;  4D8K A;  1Z9Q A;  4F14 A;  1M3C A;  4HVV A; 
#chains in the Genus database with same CATH topology
 1NPR A;  1WHK A;  1Z9Z A;  1CKA A;  1XTD A;  1KQ1 A;  2KEA A;  2CUB A;  2FZC B;  5FRO A;  1OU8 A;  1QVG S;  4M7D C;  4HVW A;  4QVC A;  1YIJ T;  3OYH A;  4M7A C;  5HCK A;  5LJ5 d;  3TSZ A;  3OMG A;  4C92 F;  1K8A U;  4HCC A;  3HSB A;  1I07 A;  4M75 G;  3P8B B;  1YN8 A;  3H41 A;  1GFC A;  4F16 A;  2ZPH B;  3QO3 A;  2L3R A;  2PVG B;  2RHU A;  2DLP A;  5LJ3 g;  3RMQ A;  4QW2 A;  4BUG A;  2JM8 A;  3CCS Q;  2XDB A;  1VQN A;  2KGT A;  4D6W A;  2A08 A;  2XD0 A;  3CC4 T;  3L42 A;  2EFI A;  1BB9 A;  4MMK A;  2JW4 A;  4OMQ A;  1UEC A;  2YUQ A;  2DFU A;  4J5Y A;  3CCR A;  1KQS S;  1EZZ B;  1WPY A;  1VQ6 T;  3HRT A;  2YSQ A;  4QVD A;  2D6F A;  1YJW A;  2YUP A;  4AFS C;  3OYE A;  4XU0 A;  4XTX A;  3OYA A;  3REB B;  3CCV T;  3UA6 A;  3HTR A;  1UEB A;  1I1J A;  3CC4 A;  1VQK T;  1N9R A;  2JT4 A;  4OF1 A;  4NS5 A;  3SWN C;  1ZHI A;  3C95 A;  2LQW A;  3MPU B;  4E7H A;  2LT4 A;  3PMI A;  1FWZ A;  2YRV A;  1YJW Q;  3UA7 A;  2KMT A;  4IIM A;  5CR2 A;  5GAM g;  1U1T A;  1V76 A;  1YJ9 A;  1ZQ1 A;  3CXC A;  4A4H A;  1YJN Q;  1IB8 A;  4E7Z A;  5J26 A;  1HSQ A;  4HKE A;  2MWP A;  1SRM A;  3OYB A;  2E64 A;  4JS4 A;  5D6W A;  3TCJ A;  4PJO G;  3BDU A;  3EAE A;  4XK8 E;  2QGG A;  1KIK A;  1CSK A;  1WXB A;  2LCC A;  3MHX A;  4C8Q A;  4FYV B;  1QCN A;  1WI7 A;  3OYF A;  5KYY B;  3JB9 H;  2PUK B;  5I2S A;  1M2V B;  3L1A A;  1X2Q A;  3CCV A;  1QP3 A;  2KNB B;  3DLL A;  1K8A C;  1GCQ C;  3JCM V;  2HD0 A;  4NL3 A;  2F2X A;  2K5F A;  3G71 Q;  3KUF A;  1S72 Q;  2OTL A;  2BZ8 A;  1X75 C;  1Y96 A;  3GLX A;  1H3Z A;  3X28 B;  2HCK A;  2KY9 A;  2RH2 A;  2W10 A;  2M02 A;  2LJ3 A;  2MCN A;  1W6X A;  1P92 A;  1M1K U;  3SWN A;  3RNJ A;  1WXT A;  3ER0 A;  1NG2 A;  4OVA A;  4EMH A;  1VQL T;  3JCM W;  2KI7 A;  2P4T A;  3CD6 T;  3RKX A;  3F70 A;  2ZPE B;  4KH1 B;  3A8M B;  3MET A;  3ME9 A;  2MAM A;  1C6V X;  1OPL A;  2R5M A;  4EMK B;  4KUI A;  2C0T A;  5KYX A;  4EIK A;  4IIO A;  1YJN A;  1ZBX A;  2KRN A;  1JJ2 A;  2RI2 A;  5IHK A;  2O4X A;  2LTO A;  3QZ9 B;  1K9A A;  4LDX A;  2KE9 A;  1V29 B;  2K3B A;  1YBY A;  2DEU A;  2KT8 A;  5GAM d;  4JRP A;  2DRM A;  2G3R A;  2X4J A;  3M0Q A;  2V26 A;  3CME Q;  4TVR A;  4M75 C;  2EYY A;  2K3X A;  1KK7 A;  2JS0 A;  3VV0 A;  1NJI U;  2QQS A;  3TU4 K;  2HKN A;  3PIP A;  4ELY C;  2EWN A;  1GCP A;  1XOV A;  4A54 A;  2XI9 A;  4HA8 A;  4A4K A;  4CC7 A;  1I4K 1;  4CRI A;  1TSF A;  2QAZ A;  5GMK h;  4P5N A;  4C5H A;  4MZT A;  1E7O A;  1I0C A;  2RJD A;  4PJO D;  4IUR A;  2CZ0 B;  3OS5 A;  5IH2 A;  2DD4 A;  1D0X A;  4E7I A;  1TH7 A;  3CCR Q;  2Z0W A;  2X3X D;  2CYZ B;  1BBZ A;  1M8V A;  1U3O A;  2DXC A;  2LCL A;  3RIR A;  4IKF A;  5DY9 A;  3WVD B;  4JRI A;  4RCB A;  3QWX X;  1WFW A;  1YI2 T;  2M51 A;  4ZNX A;  4PJO F;  5J3B A;  5FRN A;  1RAG B;  4F04 B;  2MK5 A;  3OQ5 A;  1IHW A;  2K6D A;  1TUC A;  1D1A A;  3JV3 A;  3EG9 A;  1RUW A;  1N8R U;  4EPC A;  4F7U B;  2RHZ A;  4PLL A;  4C0F A;  4YTL A;  4KGV B;  2A7Y A;  4ANJ A;  3JCM J;  2GQI A;  3CCS A;  1ZUK A;  4BI3 A;  5DM7 R;  3X26 B;  4XTU A;  2C0O A;  5GAM j;  2FO0 A;  5GMK i;  5IXF A;  3G6E T;  1WQ7 A;  1K73 C;  4JZ4 A;  3UPU A;  2AT1 B;  4M77 F;  1YCY A;  2BUD A;  1UB4 A;  1M90 C;  2FVU A;  2DER A;  4M75 E;  1YHQ Q;  2D1X A;  1OYX A;  1WHH A;  4EMG A;  2P0K A;  3CBP A;  2K5I A;  5KCO A;  2PUO B;  2E12 A;  2DRK A;  2LT1 A;  3CXC P;  1BYM A;  4N0A A;  3G6E Q;  2PZ1 A;  1G2B A;  1GRI A;  4PKC C;  5IXB A;  2DEQ A;  4LD6 A;  1M30 A;  2GFU A;  1H8K A;  1QMC A;  4LDY A;  1ACM B;  2O31 A;  1U8R A;  2RI3 A;  2DBM A;  4M77 C;  1MHN A;  1AOJ A;  3KXT A;  1R0C B;  2M1H A;  2JN0 A;  1NYG A;  5GAN 6;  2HEQ A;  1M1G A;  2J6K A;  3SDZ A;  1K73 R;  3C94 A;  2DMO A;  1WHL A;  2BZX A;  1K9M U;  2A3L A;  2FZG B;  1ABO A;  4EMK C;  4RTX A;  3VYG A;  2EQI A;  2JOY A;  3PMT A;  3S3O A;  3EG2 A;  1KD1 R;  1VQ6 Q;  4RTZ A;  3T9N A;  1GXI E;  4BE1 A;  4M77 G;  1I5O B;  3PIO A;  3P8D A;  2JTF A;  1SHF A;  1NEB A;  4RTY A;  2AK5 A;  3QBY A;  3E2U A;  2PNI A;  1PWT A;  1WQW A;  2E10 A;  4X1V A;  3PVQ A;  3LGF A;  3EG0 A;  4CC2 A;  5DLQ E;  1LCK A;  4C5E A;  3OYN A;  1VQ4 T;  4GBQ A;  1KJW A;  2J05 A;  2CKK A;  1OV3 A;  2V8K A;  1T3S A;  1UTI A;  1VQ9 Q;  1B34 A;  1PD1 A;  3RDV A;  3RR6 A;  3JCM h;  2YHT A;  4BI4 A;  1NE8 A;  3OMC A;  4QT7 A;  4M7D D;  5J39 A;  2HBP A;  4DOV A;  2DTO A;  1BI3 A;  2QK0 A;  5LJ5 e;  3D7S B;  4A53 A;  5C0M A;  3I35 A;  1MND A;  2AKK A;  1VQ8 Q;  4M4Z A;  2DYB A;  3J80 E;  1MMN A;  2NLU A;  6AT1 B;  3I55 A;  4F14 A;  1M3C A;  2QXF A;  1S1N A;  1NBE B;  2IIM A;  4JRK A;  2DXB A;  2PU9 B;  2OTL T;  2M0O A;  1IZ6 A;  3J81 E;  1MUZ A;  1PKT A;  4PFP A;  2EGA A;  2EVR A;  1HD3 A;  1ZSZ A;  1DJ7 B;  4M77 B;  2CH4 A;  5AYF A;  2VUB A;  3HRU A;  4LN2 A;  3CC7 Q;  1MNE A;  1VQ7 A;  2E4H A;  5A0G A;  1YP5 A;  1IRE B;  1YIJ A;  5KE3 A;  1AWJ A;  2X4W A;  3JB9 G;  4HCZ A;  1UE9 A;  2WAC A;  1B07 A;  1RAF B;  2O9V A;  4WTO B;  2RB6 A;  1WDX A;  8AT1 B;  1B7T A;  2IVW A;  5I22 A;  2F5K A;  4AFZ C;  1JEG A;  1WGS A;  2XU8 A;  4FT2 A;  3P8H A;  2RQV A;  2FB7 A;  3HP9 A;  1JXM A;  1QLY A;  1M1K R;  1FXX A;  3JCM X;  2FG0 A;  2VXE A;  4KUL A;  1JRI A;  4B9W A;  5GAN 4;  2DL4 A;  4ZGD B;  1VQL A;  3C4S A;  5KYW A;  3A5Z B;  1I5L A;  1VOM A;  1QP2 A;  1UHF A;  2EYZ A;  5CKD A;  1VQP A;  2E1H A;  2M9U A;  4KRT A;  3QDR B;  4IUV A;  1VQK A;  5GAN h;  5LJ3 d;  2KQW A;  3V8J A;  2FYK A;  1N6A A;  2K2V A;  1KHI A;  2CP2 A;  2QEX Q;  4OB1 B;  5CKE A;  2EYQ A;  1W1F A;  2D9T A;  2XKO C;  2EYW A;  2X51 A;  3JCM c;  1OQK A;  2M0Y A;  1VUB A;  2QQR A;  5FLX E;  1FMV A;  3QWY A;  3CCL T;  1YWP A;  3I5R A;  1FMW A;  3AHU A;  1KQS A;  4PNO A;  1NJI R;  5KYU A;  5I11 A;  3EFO B;  2HQH A;  4HT9 A;  3EGU A;  1O9S A;  3NTK A;  2DYI A;  4F7U G;  2DNU A;  4KGX B;  4LDV A;  1TG0 A;  2LQ8 A;  2V1Q A;  2LQK A;  2X4Y A;  3TRE A;  1YIJ Q;  4C8Q G;  1JQQ A;  2RHY A;  1RL2 A;  3SD4 A;  5HKC A;  3CC7 A;  2L3P A;  1AWW A;  1X6B A;  2RMO A;  1NM7 A;  4PJO A;  4J9H A;  2CSI A;  3OYM A;  2JMA A;  2AHJ B;  2MMP A;  2E3I A;  3EGD A;  4ZGE B;  1TOV A;  3V7S A;  1K1Z A;  3M56 A;  1A0N B;  1IRX A;  2OTJ T;  5CK9 A;  2NUT A;  2ZPB B;  1T0H A;  2NYS A;  2MYS A;  4BI8 B;  2YT6 A;  4AT1 B;  5EC7 A;  1SEM A;  4WCI A;  3M53 A;  1VQ8 A;  3S3N A;  1EX4 A;  1T3L A;  2QQB A;  4JJC A;  4XU2 A;  4C5G A;  3ZBD A;  1H3H A;  1XNI A;  4M78 F;  5CCA A;  1VQ4 A;  2CH4 W;  1WZO A;  2RN8 A;  2JTE A;  2FHD A;  1B3Q A;  1WHJ A;  2FRW A;  4JUV A;  2ROL A;  2EGC A;  2SEM A;  3URG A;  3H9N A;  1D0Z A;  4KBM B;  2LX7 A;  4ZGJ B;  4C0Z A;  2KDS A;  5GAM f;  1W4S A;  2K4Y A;  5D6Y A;  2DX1 A;  2RD1 A;  3LWH A;  1X27 A;  1KQS P;  3RMS A;  4FT4 A;  3I56 T;  4MDW A;  1EIF A;  2FL7 A;  3H8Z A;  3OYG A;  3OYJ A;  2JZ2 A;  3PE0 A;  3JB9 F;  5L23 A;  2F5T X;  1VA7 A;  5IHI A;  4RCC A;  3FJP A;  1BK2 A;  2KXD A;  3CMA A;  3I9Q A;  1RAD B;  3LW5 E;  1UGP B;  1HJD A;  1SPK A;  2QEX A;  2E5K A;  5KYY A;  4MZP A;  4OB0 B;  1V1C A;  3H6Z A;  2KRM A;  1VQK Q;  1OU9 A;  1SSH A;  4ATO A;  1VQP Q;  2DL3 A;  5CQY A;  1JJ2 S;  2K7A A;  3NHN A;  2DET A;  3VUB A;  1QW1 A;  1NPP A;  4AG1 C;  2O88 A;  5LJ5 h;  1YJN T;  1Q86 R;  1MGQ A;  3CBM A;  1JU5 C;  1M4Z A;  3VS7 A;  3CEY A;  3CMA T;  2PVO B;  4FW2 A;  2I2L A;  1Y96 B;  2CP5 A;  2JTM A;  3A8O B;  1TWB A;  4L6V 5;  2RQR A;  1YIT Q;  4PJN A;  3MCA B;  1C1A A;  3G4S Q;  2VAS A;  4PJL A;  2VB6 A;  5GAM e;  3CC7 T;  4ZN1 A;  4PJO B;  4JLI A;  5GMK l;  2DL8 A;  3QHS A;  3S3M A;  1M1K C;  2J6F A;  3UAT A;  3LWI A;  3CCQ A;  2YRC A;  2KYM A;  3HFN A;  2CP6 A;  3JCM P;  2KRS A;  3M5A A;  3I55 Q;  5CQX A;  5LJ3 e;  2CDT A;  2EW3 A;  2O4X B;  1OX8 A;  4Q5W A;  3R6N A;  4BE0 A;  3CCL A;  2GFA A;  2CP7 A;  1OX9 A;  3MEV A;  4O5V A;  5FRM A;  1GCQ A;  1FX7 A;  4B6M A;  2OX7 A;  1Q86 C;  2H3J A;  4EDU A;  2CZ7 B;  3CCQ T;  1K0S A;  2QYZ A;  4BB7 A;  4X34 A;  3VUZ A;  1VQN T;  5GAO m;  4V2S A;  2ZPG B;  3CQT A;  4PK4 A;  4NOY A;  3SB2 A;  4R55 A;  5FU6 B;  3JB9 I;  3VS4 A;  5FWB A;  3L2V A;  1NJI C;  4QKU A;  5CKB A;  2PTK A;  3HHT B;  2CSQ A;  5GAN 7;  4M7D E;  2YWW A;  1WJR A;  4FYY B;  2R5A A;  3HPW A;  5LJ3 f;  3EFS A;  4XTW A;  4E47 A;  3A98 A;  4QQ6 A;  2VGM A;  1UG1 A;  2DBK A;  1QQJ A;  3BDL A;  5LJ5 g;  5GAN g;  3PFS A;  3SHW A;  3GP8 A;  2RA2 A;  2ZCF B;  3DKM A;  4FL6 A;  2CS7 A;  4LUE A;  2BE9 B;  2EKO A;  2VKN A;  3VRZ A;  3X25 B;  4PJM A;  1GBQ A;  3EG9 B;  3SFM A;  4J6X A;  2WSF E;  2JJ9 A;  2JMC A;  3CBO A;  1VQ6 A;  3ZL7 C;  3GOX A;  3MEU A;  3TEE A;  1BI2 A;  3OSS C;  3V8L A;  3X24 B;  2BIV A;  3I56 A;  3MKD A;  2KXC A;  3RUX A;  3JSC A;  4CI0 C;  2QTV A;  2D0N A;  5M9O A;  5GMK j;  1G5V A;  1FYN A;  3CCU A;  2QQA A;  4AMC A;  3VS6 A;  2HNI A;  2QAS A;  3IQL A;  3THK A;  2HL5 C;  4OMP A;  2GGR A;  1G3S A;  1YIT T;  3OSV A;  3QKJ A;  2HBW A;  2GF7 A;  3NPF A;  3KBG A;  3RER A;  4J6Y A;  1AWO A;  1ZSZ C;  1M5Q 1;  1SG5 A;  1TTH B;  1IXD A;  1WJS A;  4M7A A;  4A4G A;  4OGE A;  3J7A F;  3QYH B;  3HFO A;  4II1 A;  2DPP B;  5FWC A;  5D7U A;  2MOX A;  4D8K A;  2EIF A;  3L2Z A;  2HL3 A;  1Z9Q A;  2K5L A;  4J7F A;  4HVV A;  1QVG P;  5GJW B;  2K9G A;  2J6O A;  2ZGW A;  2COW A;  3L2R A;  2CZ1 B;  3M58 A;  5C6S A;  1AZG B;  4Y92 A;  1X43 A;  1RI9 A;  4M78 G;  2RQU A;  5GJV B;  3CC2 A;  1IO6 A;  3CCV Q;  2CUD A;  2VVK A;  1K73 U;  2IG0 A;  5GAO r;  3DB4 A;  3VS2 A;  2DXT A;  2XDD A;  4FSS A;  2DJZ A;  3TQ7 P;  3ZFJ A;  2C0I A;  2QG9 B;  4RKU E;  3UT1 A;  1KD1 U;  3EHR A;  3H0F A;  4C8Q C;  2F2W A;  2D0Q B;  2LNH B;  4DQ2 A;  1LVK A;  1UJY A;  4LD9 K;  2DAQ A;  4Z8A A;  5I21 A;  4RG8 A;  1RAI B;  2JS2 A;  1G83 A;  5FU7 C;  2R57 A;  2ENM A;  1YJ9 Q;  1D0Y A;  3CPW S;  1X01 A;  4E7K A;  2DO3 A;  3GF5 A;  3NGP A;  2J7I A;  3CCJ Q;  1Q81 R;  4OB3 B;  1D1B A;  1KC8 U;  1AVZ C;  1BIA A;  3QJY A;  4QQG A;  2J06 A;  1PRM C;  1WXU A;  1Q7Y U;  1VYU A;  3EGX B;  3RKW A;  4N0A C;  2DVE A;  2FRY A;  4C8Q F;  1Y71 A;  4M7A D;  3JCM d;  2KSS A;  2QA4 Q;  2CZ6 B;  3CME A;  2AZS A;  1UGS B;  4L59 A;  4Y28 E;  1MMD A;  4GLM A;  1Q82 R;  1UHC A;  1UGR B;  1GFD A;  1ABQ A;  4C8Q B;  4RTU A;  3M54 A;  3BFM A;  1VQ5 T;  1S72 T;  3UF4 A;  1ZA2 B;  3QPH A;  1NLP C;  3M0T A;  3CC2 T;  3OYI A;  3EH1 A;  3JRZ A;  3OB9 A;  2X9H A;  4R56 A;  2NUZ A;  3N5B B;  4M7A F;  3QYG B;  4D8D A;  5L8R E;  1RLQ C;  4BD3 A;  1WA7 A;  3H0I A;  4HCK A;  2RK1 A;  1JXO A;  5I2M A;  1N9S A;  2DVJ A;  2RQW A;  4M7D B;  3JCM e;  4O6J A;  1N5Z A;  3VKI A;  1ZSG A;  1NYF A;  4XQ3 A;  2HSP A;  4FU6 A;  2A37 A;  4LDW A;  3CC2 Q;  4BE2 A;  2L5Q A;  2K3Y A;  4JJN K;  2EKH A;  3M0P A;  4DBR A;  2NUP B;  3OBW A;  1M2O A;  3OY9 A;  3G4S T;  3CCJ T;  4RUG A;  1VIF A;  2G6F X;  4BDY A;  2IPO B;  4C92 A;  4C8Q E;  3OS2 A;  2FEI A;  3AT1 B;  4M78 B;  1MMG A;  1K9M R;  4RMO A;  1VQM Q;  1R77 A;  2MI6 A;  2QDL A;  1VQM A;  4MDX A;  2LP5 A;  2A28 A;  1LOJ A;  2HSE B;  3MP8 A;  1QKX A;  3OW2 A;  2MWO A;  2OTL Q;  1PRL C;  3RES A;  5A2Q E;  4OMM A;  1G3W A;  2KK4 A;  2V8I A;  5KYW B;  2YDL A;  1PHT A;  2EJG A;  4PFZ A;  1HYO A;  2CP0 A;  5GAN 3;  1PCX A;  1Q81 C;  2COY A;  1Y57 A;  1M9S A;  2XID A;  4RTT A;  1RAC B;  2OAU A;  1GL5 A;  3SWN B;  5GAM h;  2AKL A;  5CAI A;  2HMA A;  3I56 Q;  4XTY A;  1X6G A;  2PVD B;  2LQN A;  4CC3 A;  2QA4 A;  4ME7 A;  2EQK A;  4XAX B;  3CC4 Q;  2A0F B;  1D3B B;  1YI2 Q;  1YWO A;  4KGZ B;  2DTH A;  8ATC B;  1VQO Q;  2L2P A;  1I81 A;  2ESW A;  4E2F B;  1KC8 C;  4FSX A;  1VQ7 T;  3QII A;  3OYK A;  2ABL A;  5CVI A;  2YUN A;  4BAC A;  3G7Z A;  1ZSZ B;  2KRO A;  3GPL A;  2RM4 A;  4M75 A;  4OP0 A;  5LL6 S;  1VQO A;  2E6N A;  1QWF A;  2FPF A;  3VJP A;  2V8J A;  2A36 A;  2JUF A;  4JPB W;  4HCB A;  4F7U A;  1BKB A;  3WXM B;  3HKS A;  4UC4 A;  2XHC A;  1K0X A;  2MF2 A;  2R58 A;  3VS3 A;  4J9E A;  1G3Y A;  2LC4 A;  4E7S A;  4LUD A;  2DK3 A;  2KBT A;  4QVZ A;  2GQV A;  3CCJ A;  1KQ2 A;  1UDL A;  4KT0 E;  3E9F A;  2WSC E;  4M7A E;  1M90 R;  1H92 A;  5CKF A;  2X35 A;  3QUI A;  1KC8 R;  2BTT A;  2CT4 A;  2SRC A;  4JJB A;  3PNW C;  3C12 A;  2CGH A;  1RAE B;  5CO7 A;  3VRY A;  5GAO l;  1D09 B;  2YLB A;  2X4X A;  4C92 G;  4X9D A;  2ED1 A;  2LCS A;  2KVQ G;  3PGG A;  3MJX A;  2V1R A;  2DD5 A;  1O75 A;  2DZC A;  1X69 A;  3LH0 A;  3OYL A;  1E6G A;  2CT3 A;  1OPK A;  2OI3 A;  4F7U F;  3OYY A;  2VV5 A;  5GAN e;  3MP6 A;  2YRD A;  4AG2 C;  3QG1 A;  2LVM A;  3QJ6 A;  2RQT A;  1JB0 E;  1S72 A;  3CCQ Q;  3G71 A;  3JCM g;  2L0A A;  2ZAE A;  1X2K A;  2O01 E;  5GAN f;  2NWM A;  2QI2 A;  4M7D F;  4ORZ A;  3JB9 J;  2KT1 A;  2VYT A;  2DIL A;  4IUU A;  3PTA A;  3CME T;  2K57 A;  4C92 C;  3GNG A;  1AT1 B;  1BCM A;  2LX9 A;  2DF6 A;  1LPL A;  2GTO A;  4C0D B;  2E65 A;  1N27 A;  2CRE A;  1U5S A;  3RBB B;  4CC4 B;  3S6W A;  1H64 1;  2EQU A;  2DE0 X;  3L2Q A;  4QQD A;  3CD6 Q;  3LX7 A;  4OMN A;  1W2B P;  3CCR T;  3CCU Q;  4J83 A;  1TUD A;  2ZPI B;  3E19 A;  5GAO q;  4J8O A;  4HT8 A;  1VQO T;  2XIC A;  1WHG A;  3UDC A;  1OOT A;  2KAF A;  1ZBJ A;  1WJQ A;  4RTW A;  1Y7X A;  2XDP A;  2RHI A;  2K79 A;  1VYT A;  4J7I A;  3OS1 A;  3G71 T;  4FYW B;  1WLP B;  2DKG A;  2DIG A;  2EBP A;  2E3H A;  4J9I A;  3OA6 A;  4OMF B;  4ZN3 A;  5AT1 B;  3PVL A;  4DEX A;  1VQ5 A;  2I0N A;  2F69 A;  1UGQ B;  4K11 A;  4BY6 B;  1RAB B;  3A1P A;  2LRQ A;  2EYX A;  1PSF A;  3QDF A;  1ZUU A;  5GAO p;  1Q81 U;  4J6W A;  1YNZ A;  2B8A A;  1NZ9 A;  2F2V A;  5A0L A;  1U06 A;  3FJ5 A;  3NTI A;  4C92 E;  4JJD A;  4M77 D;  3CCE T;  2DL7 A;  4FIB A;  1AZE A;  3ASK A;  1LJO A;  1HXD A;  3I5S A;  5KYX B;  5HY6 A;  2O9S A;  3X20 B;  1VQN Q;  1ZX6 A;  1BU1 A;  3EG3 A;  1TXQ A;  5GMK e;  3A8G B;  5GMK m;  9ATC B;  1M2V A;  4M77 A;  3LH5 A;  1M1F A;  1YHQ T;  4LNP A;  1RAA B;  4M7D A;  1LNX A;  7AT1 B;  3ULR B;  5D6X A;  1QVP A;  3NTH A;  5IAY A;  4Y91 A;  5KH6 A;  5GAN 2;  3HRS A;  3WVE B;  3QZ5 B;  1YFN A;  2L3S A;  1IGU A;  5A0D A;  4HVU A;  1ZUY A;  3G4S A;  4PFO A;  1R8O B;  4IUT A;  4NL2 A;  1M27 C;  2KR3 A;  2B86 A;  1FMK A;  1W2B A;  3EFR A;  3EG1 A;  3JB9 D;  1JBM A;  1KG1 A;  2BE7 D;  2EQJ A;  5KYU B;  1XJW B;  3EHQ A;  4F17 A;  3VS0 A;  2LJ1 A;  3FB9 A;  1MV3 A;  5GAO n;  4DOW A;  2XMF A;  1RAH B;  3CCE Q;  3BE3 A;  3VU3 C;  3CCM Q;  1Q86 U;  2ROT A;  2OTJ A;  1PC0 A;  4J9D A;  3L2W A;  4N4H A;  5FU7 B;  1N8R C;  1QKW A;  1C0M A;  2RJC A;  5IT9 E;  4KH0 B;  2AIR B;  2DJQ A;  4FM4 B;  1PNJ A;  1QVG A;  5LJ3 h;  4M75 F;  4BY6 C;  4MZM A;  3R6O A;  4XTV A;  3M57 A;  4M78 C;  4AFQ C;  4DBQ A;  4E6R A;  3EGD B;  4Z89 A;  1VQ9 T;  4GY5 A;  2MPX C;  1U1S A;  2RNA A;  1VQL Q;  2OJ2 A;  2Y4Y A;  1ZLM A;  1AD5 A;  2CP3 A;  2DIQ A;  2QQ9 A;  3LGL A;  1QWE A;  1BI1 A;  2ATC B;  3CMA Q;  4JS5 A;  3M4G A;  3HL8 A;  2OTJ Q;  1SRL A;  2RJE A;  4M7A B;  4JDS A;  1WHM A;  2EJF A;  3QSU A;  2NUP A;  2FZK B;  2GBQ A;  2DXU A;  4C0D C;  4X9C A;  2GNC A;  2COZ A;  3CPW A;  1KSW A;  2C06 A;  5HK0 A;  1HK9 A;  1VQ4 Q;  4PJO E;  4ZTF A;  1I8F A;  2LNV A;  1IHV A;  3FEO A;  5CKH A;  4Z88 A;  3UWN A;  3VS5 A;  5KYN A;  1K8A R;  1GBR A;  3I55 T;  1VQP T;  5KCH A;  2BKD N;  1WIE A;  2HQX A;  4N4I A;  4LXC A;  1G8X A;  4DEY A;  4XU3 A;  1JJ2 P;  1PSE A;  3MEW A;  2EQM A;  3GBQ A;  5FU6 C;  2YUO A;  1M3B A;  2LMJ A;  1K9M C;  3A8L B;  1D1C A;  2VGN A;  1WX6 A;  5ECA A;  4M75 B;  1SSF A;  3FDR A;  1YCS B;  4A63 B;  3O8V A;  3CXC S;  3CCL Q;  1KD1 C;  2P0Q A;  1UGV A;  2Y4X A;  3CCS T;  3CPF A;  2O2O A;  3M0S A;  4C92 D;  3H0H A;  4PL6 A;  3EH2 A;  3VYH B;  2P84 A;  2VWF A;  1Q7Y R;  3OYD A;  1KFZ A;  3EGX A;  2EAY A;  1PD0 A;  3FC3 A;  4RG2 A;  3QXE B;  1T0J A;  5GAN 8;  4VUB A;  1BCO A;  3VS1 A;  1YIT A;  1TUG B;  1OZ2 A;  3V7R A;  2DTI A;  2HDA A;  2ED0 A;  2LJ0 A;  2RPN A;  1VYV A;  2E70 A;  1UJ0 A;  4A4F A;  3V8K A;  1E6H A;  1VQM T;  2JNG A;  3CCM T;  2D8J A;  1OUL A;  4R0K A;  4LE9 A;  4J9F A;  3Q1J A;  2DM1 A;  4M78 E;  3M9Q A;  3REA B;  5IHN A;  1UUE A;  2KYB A;  2P0P A;  3INZ A;  3TVT A;  4DBF A;  4GLK A;  4PLI A;  3OW2 S;  3M55 A;  1R0B G;  1J3T A;  3ZEH A;  2ZZD A;  3U23 A;  2HAX A;  3JAM E;  1PG5 B;  1WNL A;  1Y07 A;  3E1S A;  4IUQ A;  1EFN A;  4JLG A;  3CCE A;  2QA4 T;  4OB2 B;  3TSW A;  1SHG A;  2AZV A;  1X6O A;  4XTZ A;  3OYC A;  1AEY A;  4ESR A;  1BIB A;  1VIE A;  4JRQ A;  2JXB A;  3FLG A;  4OMO A;  2RI5 A;  2WSE E;  1Q7Y C;  3M0U A;  3DB3 A;  4RTV A;  4E7J A;  2NUT B;  2RJF A;  4DA4 A;  3KFV A;  4M78 A;  3G6E A;  1YJ9 T;  4M7D G;  3PT9 A;  4MML A;  4PJO C;  2Y90 A;  3L2U A;  2W0Z A;  1PM3 A;  2RF0 A;  4N4G A;  3CCU T;  4E7L A;  2M16 A;  3EFO A;  2L89 A;  2OAW A;  3MO8 A;  4A4E A;  2RK2 A;  2YXY A;  3M0R A;  3OBY A;  2EGE A;  3O5Z A;  2E6Z A;  4M7A G;  3SEM A;  1K76 A;  4PJJ A;  2FPE A;  4OML A;  5LJ5 f;  3FIF A;  1IGQ A;  1NLO C;  1Q82 C;  2L3Q A;  3NFC A;  1ARK A;  3BW1 A;  5IN1 A;  3FRN A;  1RLP C;  2LZ6 B;  1OI1 A;  5KE2 A;  2QGF B;  1WYX A;  2VXF A;  3RKY A;  2VC8 A;  1BI0 A;  3MEA A;  4HXJ A;  1CKB A;  5EG2 A;  1VQ8 T;  1NEG A;  2LDM A;  2HQE A;  1Q82 U;  1VQ9 A;  3M59 A;  2RO0 A;  1JO8 A;  4F7U E;  1K4U S;  2XK0 A;  1QCF A;  2EJ9 A;  2QDY B;  4FYX B;  3OW2 P;  4DBH A;  3JCM b;  5LJ3 j;  2E5Q A;  1PKS A;  2DZ9 A;  4M77 E;  3JCM f;  1XQH A;  2MIO A;  1RI0 A;  2QTX A;  2HZY A;  3C0C A;  3DLM A;  1M3A A;  5LJ5 j;  4M78 D;  1AHJ B;  2EPD A;  3MP1 A;  5GAN j;  2H8H A;  3LYI A;  3NMZ C;  2ZPF B;  2L8D A;  4B9X A;  2X3W D;  4LDU A;  1MV0 B;  1M90 U;  4EMK A;  2YLC A;  1VQ5 Q;  4ELZ C;  2QEX T;  5GAN 5;  2GTJ A;  2GCX A;  4FW1 A;  4JZ3 A;  4C92 B;  1QVF P;  1OZ3 A;  1Y0M A;  4WF2 A;  1Q95 G;  4L5G A;  1N8R R;  1SF9 A;  1YJW T;  3V7C A;  4KUD K;  1YI2 A;  2F1L A;  2FPD A;  3CD6 A;  2XG8 D;  4C0G A;  2RHX A;  4M75 D;  1W70 A;  4Z02 A;  5FW9 A;  2E41 A;  1B34 B;  4XU1 A;  2ECZ A;  1AWX A;  3CCM A;  3BY7 A;  1MMA A;  2JM9 A;  2H3E B;  1TU0 B;  2DA9 A;  3GNF B;  1F1B B;  3LLR A;  1KHC A;  5HK3 A;  2DL5 A;  4J9B A;  2K2M A;  4FCY A;  4OGC A;  2HKQ B;  1YHQ A;  1QVF S;  4C5I A;  1ZA1 B;  1OEB A;  1W2B S;  1M8M A;  4AFU C;  3G1J A;  2D8H A;  5GAN d;  1UFF A;  2PQW A;  4C8Q D;  1TS9 A;  4J9G A;  2BZY A;  3E9G A;  4ZTJ A;  3M4Y A;  1D3B A;  4IUP A;  1SKU B;  1QVF A;  5CIU A;  3GIB A;  2JVV A;  1VQ7 Q;  4J9C A;  3CPW P;  1G3T A;  4BDZ A;  3JCM Q;  2P4R A;  3A8H B;  3OS0 A;  5DLO A;  1QCO A; 
#chains in the Genus database with same CATH homology
 1Z9Z A;  1CKA A;  1S1N A;  2IIM A;  5GJW B;  2K9G A;  2J6O A;  2KEA A;  2CUB A;  4HVW A;  1AZG B;  1MUZ A;  1PKT A;  2L3S A;  4Y92 A;  2EGA A;  1X43 A;  1RI9 A;  1ZUY A;  2EVR A;  2RQU A;  4HVU A;  5GJV B;  1IO6 A;  2CUD A;  1HD3 A;  5HCK A;  3TSZ A;  2VVK A;  2CH4 A;  1I07 A;  1YN8 A;  3H41 A;  4LN2 A;  3VS2 A;  1GFC A;  4F16 A;  4FSS A;  1M27 C;  2KR3 A;  2C0I A;  2B86 A;  1FMK A;  1YP5 A;  3EG1 A;  2DLP A;  2JM8 A;  3EHR A;  1AWJ A;  3H0F A;  3EHQ A;  1UE9 A;  2KGT A;  4F17 A;  3VS0 A;  2A08 A;  2LJ1 A;  1MV3 A;  2F2W A;  2LNH B;  1BB9 A;  1B07 A;  1UJY A;  2O9V A;  1WDX A;  4Z8A A;  2JS2 A;  1G83 A;  2JW4 A;  4OMQ A;  5I22 A;  1UEC A;  2XMF A;  2YUQ A;  4AFZ C;  1JEG A;  2ENM A;  2ROT A;  2RQV A;  1JXM A;  1QLY A;  4J9D A;  3NGP A;  1QKW A;  2J7I A;  2YSQ A;  2FG0 A;  2YUP A;  2DJQ A;  4AFS C;  1AVZ C;  1PNJ A;  2J06 A;  2DL4 A;  1PRM C;  1WXU A;  3REB B;  3UA6 A;  1VYU A;  4AFQ C;  2EYZ A;  1UHF A;  4E6R A;  2FRY A;  4Z89 A;  1I1J A;  4KRT A;  2RNA A;  2JT4 A;  2AZS A;  2OJ2 A;  2LQW A;  4GLM A;  1ZLM A;  1AD5 A;  1UHC A;  1GFD A;  1ABQ A;  1W1F A;  3UA7 A;  4IIM A;  4RTU A;  1QWE A;  2EYW A;  1SRL A;  3UF4 A;  2M0Y A;  1HSQ A;  3QWY A;  1NLP C;  3M0T A;  1YWP A;  3I5R A;  1SRM A;  2GBQ A;  5I11 A;  2GNC A;  1KSW A;  3EGU A;  2NUZ A;  2DNU A;  4D8D A;  1RLQ C;  1TG0 A;  1WA7 A;  3H0I A;  4HCK A;  1CSK A;  2V1Q A;  1KIK A;  1WXB A;  1JXO A;  4Z88 A;  3VS5 A;  1GBR A;  2DVJ A;  2RQW A;  1JQQ A;  1WI7 A;  1N5Z A;  1WIE A;  1ZSG A;  2L3P A;  1AWW A;  1NYF A;  1X6B A;  2HSP A;  1NM7 A;  2RMO A;  4DEY A;  2A37 A;  1X2Q A;  4J9H A;  2CSI A;  2KNB B;  2JMA A;  1GCQ C;  2EKH A;  3GBQ A;  3M0P A;  1K1Z A;  2YUO A;  1M3B A;  2F2X A;  2LMJ A;  4RUG A;  2G6F X;  1A0N B;  1WX6 A;  5ECA A;  2BZ8 A;  1YCS B;  4A63 B;  2FEI A;  1T0H A;  2HCK A;  1UGV A;  2W10 A;  2LJ3 A;  2MCN A;  1W6X A;  2QDL A;  2YT6 A;  2LP5 A;  2A28 A;  2O2O A;  3M0S A;  1SEM A;  5EC7 A;  3RNJ A;  3H0H A;  4WCI A;  1QKX A;  1WXT A;  1T3L A;  4JJC A;  1PRL C;  1H3H A;  1NG2 A;  2VWF A;  2CH4 W;  2RN8 A;  2JTE A;  4OMM A;  1B3Q A;  1KFZ A;  2FRW A;  2YDL A;  2ROL A;  1PHT A;  1T0J A;  2EGC A;  2SEM A;  3VS1 A;  1OPL A;  2C0T A;  4EIK A;  1Y57 A;  4IIO A;  2KRN A;  2HDA A;  4RTT A;  2ED0 A;  2LJ0 A;  2RPN A;  5IHK A;  2LX7 A;  1VYV A;  1GL5 A;  1K9A A;  1UJ0 A;  2AKL A;  2KE9 A;  2K3B A;  2KT8 A;  1E6H A;  2DRM A;  1X6G A;  2D8J A;  2DX1 A;  3M0Q A;  4R0K A;  4LE9 A;  4J9F A;  2LQN A;  1X27 A;  2EYY A;  4CC3 A;  2JS0 A;  2DM1 A;  1YWO A;  3PE0 A;  3REA B;  5IHN A;  5L23 A;  2L2P A;  2ESW A;  1UUE A;  2KYB A;  1VA7 A;  1GCP A;  1XOV A;  5IHI A;  4CC7 A;  3TVT A;  1BK2 A;  2KXD A;  2ABL A;  3I9Q A;  1J3T A;  2YUN A;  1E7O A;  3U23 A;  1I0C A;  1HJD A;  1SPK A;  2E5K A;  5IH2 A;  2KRO A;  1V1C A;  1EFN A;  2KRM A;  2X3X D;  1SSH A;  1BBZ A;  3TSW A;  1SHG A;  2AZV A;  1QWF A;  1AEY A;  2DL3 A;  2FPF A;  4ESR A;  2K7A A;  1U3O A;  2A36 A;  4JPB W;  3NHN A;  2JXB A;  4OMO A;  1K0X A;  4AG1 C;  2O88 A;  3VS3 A;  3QWX X;  4J9E A;  3M0U A;  4LUD A;  2KBT A;  4RTV A;  1UDL A;  1JU5 C;  1WFW A;  3VS7 A;  2M51 A;  3KFV A;  4ZNX A;  1H92 A;  2BTT A;  2CT4 A;  2RQR A;  2SRC A;  2W0Z A;  4JJB A;  2K6D A;  1TUC A;  3JV3 A;  1RUW A;  2RF0 A;  3VRY A;  2DL8 A;  2ED1 A;  2LCS A;  2GQI A;  2V1R A;  1ZUK A;  2OAW A;  1X69 A;  2J6F A;  3M0R A;  3UAT A;  2EGE A;  1E6G A;  2KYM A;  2CT3 A;  3O5Z A;  1OPK A;  2OI3 A;  3SEM A;  1K76 A;  2KRS A;  2C0O A;  2CDT A;  2EW3 A;  4AG2 C;  2FPE A;  4OML A;  2FO0 A;  5IXF A;  3R6N A;  2RQT A;  1NLO C;  2L3Q A;  1ARK A;  4JZ4 A;  1RLP C;  1GCQ A;  2L0A A;  2LZ6 B;  1WYX A;  1X2K A;  2NWM A;  4ORZ A;  2KT1 A;  1K0S A;  2D1X A;  4HXJ A;  2DIL A;  1CKB A;  1NEG A;  2DF6 A;  2DRK A;  1JO8 A;  2GTO A;  3CQT A;  1K4U S;  1QCF A;  2PZ1 A;  1G2B A;  1GRI A;  2CRE A;  1U5S A;  5FWB A;  3RBB B;  3VS4 A;  5IXB A;  4CC4 B;  1M30 A;  1H8K A;  2PTK A;  2DE0 X;  2CSQ A;  2O31 A;  1PKS A;  2DBM A;  1AOJ A;  2MIO A;  4OMN A;  3A98 A;  1NYG A;  3C0C A;  1M3A A;  2HEQ A;  2EPD A;  1UG1 A;  2DBK A;  2J6K A;  1TUD A;  3SHW A;  2DMO A;  2H8H A;  2BZX A;  3NMZ C;  1ABO A;  4RTX A;  2X3W D;  1OOT A;  4LUE A;  1MV0 B;  1ZBJ A;  2EQI A;  4RTW A;  3EG2 A;  2VKN A;  4RTZ A;  3VRZ A;  2GTJ A;  2K79 A;  4JZ3 A;  1VYT A;  1GBQ A;  1Y0M A;  1SHF A;  1NEB A;  1WLP B;  4RTY A;  2AK5 A;  2EBP A;  2PNI A;  1PWT A;  4J9I A;  2FPD A;  4X1V A;  3PVL A;  2JMC A;  3ZL7 C;  4DEX A;  2I0N A;  3PVQ A;  3EG0 A;  4CC2 A;  1W70 A;  1LCK A;  4K11 A;  5FW9 A;  4GBQ A;  1KJW A;  2EYX A;  2J05 A;  1ZUU A;  2KXC A;  2ECZ A;  1AWX A;  1YNZ A;  1OV3 A;  1T3S A;  2D0N A;  1UTI A;  2F2V A;  2JM9 A;  2DA9 A;  1U06 A;  3FJ5 A;  1FYN A;  2DL5 A;  4JJD A;  2DL7 A;  4J9B A;  2K2M A;  3VS6 A;  1AZE A;  3IQL A;  3THK A;  4QT7 A;  3I5S A;  1OEB A;  1M8M A;  2O9S A;  4AFU C;  2D8H A;  1ZX6 A;  4OMP A;  1BU1 A;  2GGR A;  3EG3 A;  1UFF A;  3I35 A;  4J9G A;  2BZY A;  2HBW A;  3NPF A;  2AKK A;  1AWO A;  4M4Z A;  3LH5 A;  4J9C A;  4LNP A;  2DYB A;  2P4R A;  5FWC A;  3ULR B;  2MOX A;  4D8K A;  1Z9Q A;  4F14 A;  1M3C A;  4HVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...