3EG3A

Crystal structure of the n114a mutant of abl-sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 12
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg3A00
1GFDA 2JMCA 2DA9A 1WA7A 2K3BA 4WCIA 1Y57A 2EW3A 3I9QA 2CT4A 1K76A 3VRZA 3I35A 2FRYA 1ZUYA 2KR3A 1AWWA 1UJ0A 4E6RA 1BBZA 1MUZA 1VYTA 1UG1A 2ROTA 3TSWA 2P4RA 1M3AA 1SSHA 3FJ5A 3NMZC 2EYYA 2D8JA 2JM8A 4J9IA 2AK5A 3LH5A 1UGVA 2DJQA 3SHWA 3EGUA 1ZSGA 3EG0A 3M0TA 2CREA 1OOTA 2C0OA 3VS5A 1H92A 1VA7A 1RUWA 1GCQC 1WIEA 1ZLMA 1GL5A 2AKLA 1T0JA 3NGPA 2DNUA 2ED0A 3VS1A 2XMFA 4Z88A 1PHTA 1E6HA 2DLPA 1W70A 1PKTA 1WDXA 1UUEA 2BZXA 2D8HA 2HSPA 2DM1A 2FPDA 1NEBA 4KRTA 4Z8AA 2LNHB 5IHIA 3PVQA 4RTTA 4HVUA 4D8KA 3O5ZA 3UA6A 1W6XA 1UE9A 2JS2A 2EKHA 2LMJA 2L3QA 2KRSA 1U3OA 2GNCA 3RBBB 3NPFA 3REAB 3H41A 3EHQA 2L3SA 1H3HA 1Z9ZA 4X1VA 2B86A 3IQLA 4RTVA 1TG0A 2YUPA 3C0CA 3CQTA 2OI3A 2JXBA 4LUDA 1RLQC 1NYFA 1QCFA 4M4ZA 1KSWA 4FSSA 1E6GA 3M0RA 1I0CA 2DILA 2YUOA 4J9EA 4ZNXA 2ROLA 2MIOA 2CSQA 2K6DA 4LNPA 2CUDA 3TSZA 1WXUA 2JMAA 2RQUA 4D8DA 2HCKA 5ECAA 1RI9A 1QKWA 4CC2A 1QKXA 5IXBA 2ABLA 2EPDA 2C0IA 1JO8A 1AWJA 2DVJA 2KROA 2LZ6B 2K9GA 4ORZA 5EC7A 2D1XA 2KXCA 2GTOA 2A08A 2OAWA 3VS7A 2YT6A 2NUZA 3NHNA 1X2KA 3EHRA 2CDTA 1NYGA 2RQRA 5IXFA 2GGRA 4JJCA 2EYZA 2EYWA 3UF4A 1ARKA 3VS2A 2I0NA 1G2BA 4IIOA 2LQNA 2VVKA 4J9FA 1X27A 2LX7A 2OJ2A 5IH2A 4LN2A 2DRKA 1UJYA 2FPEA 2J6OA 5IHNA 1KJWA 1WFWA 1TUCA 2RQTA 2V1RA 2O9SA 4J9DA 1YN8A 3A98A 4AFQC 2A37A 2DL7A 2KRNA 2DL3A 2KBTA 2ENMA 1JU5C 1AZEA 1V1CA 2PNIA 4K11A 1HJDA 3VS3A 4F17A 1U06A 3JV3A 4AG2C 2J05A 2V1QA 2LJ1A 5IHKA 1WX6A 1JXMA 4OMMA 3H0FA 2HEQA 1KIKA 4GLMA 4AFZC 1ABOA 1QWEA 4J9CA 1UECA 1AZGB 2VKNA 2SRCA 3UA7A 2F2VA 3VS0A 4CC7A 4GBQA 2M0YA 4J9BA 4OMLA 1YNZA 4JPBW 3ULRB 2FRWA 4RTYA 2RQWA 1AEYA 1GFCA 1WYXA 4J9HA 4HVVA 2W0ZA 2D0NA 4CC4B 3PE0A 2CH4A 2KNBB 2NWMA 2A28A 4RTXA 5FW9A 4CC3A 2DF6A 2EYXA 1RLPC 1SPKA 1I1JA 1YWPA 1JXOA 1TUDA 5GJVB 1ABQA 3I5SA 2DBMA 2F2WA 1M3CA 1OV3A 1K0SA 3VS4A 3VRYA 2JW4A 2O2OA 4F16A 4LUEA 1AD5A 2ESWA 2KYMA 1AOJA 1K9AA 1T3SA 2LQWA 2RPNA 1AWXA 2EGAA 1QWFA 2DMOA 2CUBA 2LJ0A 2H8HA 1X6BA 1IO6A 1VYUA 1BK2A 2O88A 1PNJA 2MOXA 3PVLA 1SRMA 2CT3A 2DE0X 2MCNA 2YUQA 2FO0A 1Z9QA 2LCSA 2AKKA 3M0PA 2CH4W 3QWXX 1A0NB 1OPKA 4RTZA 5HCKA 2HBWA 4OMPA 2KXDA 1NEGA 4A63B 2EGEA 1H8KA 2KYBA 1K0XA 1QLYA 2J6KA 4QT7A 2EVRA 1BB9A 4R0KA 2L0AA 1NG2A 1T0HA 1T3LA 2K7AA 1YP5A 2L3PA 3VS6A 2ECZA 3EG1A 2BZYA 1CKAA 1GCQA 1UFFA 2BZ8A 1GCPA 2EGCA 2HDAA 1NLPC 1YWOA 1HSQA 1GBQA 2IIMA 1E7OA 3H0IA 2VWFA 2EQIA 1ZUKA 3H0HA 3ZL7C 2A36A 2X3WD 2O9VA 4AFUC 2PTKA 4EIKA 4JZ3A 2K2MA 1S1NA 2E5KA 4J9GA 1MV3A 1PKSA 5GJWB 4HCKA 1K4US 2SEMA 1X6GA 4AFSC 3GBQA 1M30A 3I5RA 5FWCA 3REBB 1MV0B 2GBQA 5I11A 1SRLA 1SHFA 3UATA 2RF0A 1OPLA 1ZUUA 1WXBA 3RNJA 1PRMC 2KRMA 4AG1C 1AVZC 5L23A 1WLPB 3M0UA 1M3BA 3R6NA 1X43A 4OMNA 2J6FA 1N5ZA 2KE9A 4IIMA 2KEAA 2DL4A 1UDLA 3SEMA 1M8MA 2YSQA 4LE9A 2LP5A 2RMOA 1J3TA 2FG0A 3QWYA 1B07A 1EFNA 4JJDA 2W10A 1YCSB 1WXTA 4Z89A 4HXJA 1U5SA 2DL8A 1FMKA 1X2QA 2BTTA 1SHGA 2G6FX 4ESRA 1Y0MA 2EBPA 3M0QA 3KFVA 1CSKA 1M27C 1ZBJA 1KFZA 2GQIA 1JEGA 2QDLA 3EG3A 1BU1A 2DBKA 1NM7A 5I22A 2PZ1A 2F2XA 2JTEA 5FWBA 4DEXA 1FYNA 3TVTA 2YDLA 2RN8A 1GBRA 1AWOA 2DL5A 1JQQA 2RNAA 1I07A 2ED1A 4HVWA 2GTJA 2J7IA 4RTUA 4F14A 2AZVA 1ZX6A 4DEYA 1K1ZA 3U23A 2JT4A 2YUNA 1UTIA 2DYBA 1PWTA 2JS0A 2JM9A 4JJBA 1GRIA 1UHFA 4OMQA 1W1FA 2DX1A 4Y92A 3EG2A 2O31A 2RQVA 4JZ4A 4RUGA 2CSIA 3M0SA 2LJ3A 2KGTA 2KT8A 2L2PA 1X69A 1PRLC 2M51A 1OEBA 2AZSA 1G83A 2C0TA 4OMOA 1HD3A 2K79A 2FPFA 2FEIA 1XOVA 3THKA 1WI7A 2KT1A 1UHCA 2J06A 1B3QA 1SEMA 1VYVA 1CKBA 1NLOC 4RTWA 1LCKA 2X3XD 2DRMA
chains in the Genus database with same CATH superfamily
3L2WA 2P84A 4LDWA 1QVFS 1ZBXA 4OGCA 3LWIA 1OULA 5HKCA 5KYUA 2JTFA 3JRZA 4QQGA 3FRNA 2ZPBB 1K76A 2MPXC 1OX9A 4C8QA 2RI5A 3UPUA 1G5VA 2FRYA 2QQ9A 3PMTA 2CP2A 2DYIA 3MKDA 3OYIA 5A0DA 3FJ5A 2EYQA 3NMZC 2GFUA 2JM8A 3M56A 3G71A 5LJ3j 3LH5A 1XJWB 1VQ5A 1M4ZA 2M02A 1VQMT 1ZSGA 4B9WA 2RO0A 1YBYA 1RACB 3CCJT 2DNUA 2DAQA 2E64A 1OZ2A 1R0CB 2CZ7B 1E6HA 2DLPA 3M57A 1W70A 3DKMA 4J6YA 1LPLA 4QVCA 1UUEA 2D8HA 2FPDA 4KRTA 2MWPA 5IHIA 4RTTA 4DOVA 5KYWB 4D8KA 3CD6A 2CGHA 1KD1C 1UE9A 2AT1B 3HFOA 4J8OA 1Q7YR 2JS2A 3JB9F 2P0PA 3X28B 1K8AR 1SSFA 5LJ5g 4E2FB 5KCHA 2CKKA 3UWNA 1EZZB 4RTVA 2IVWA 2YUPA 3OQ5A 1N8RU 4TVRA 2JXBA 3RUXA 4M4ZA 1I0CA 3ZEHA 3CC7A 4JRKA 4ZNXA 2ROLA 4QVZA 4PJOG 4L6V5 2RJDA 1N8RC 4LNPA 1M2VB 1ZHIA 2CS7A 2F5KA 2L5QA 3TSZA 2RQUA 4M75G 1JJ2P 1H3ZA 1QKXA 3CMET 4IURA 5DLOA 2ABLA 3JCMc 4NL2A 2KROA 2K9GA 1M1KR 2GTOA 1M2VA 2A08A 1W2BP 3MEVA 3UT1A 3NHNA 4FYVB 2CDTA 1WNLA 4PJOD 5LJ3h 4QVDA 2FVUA 1G2BA 4IIOA 4PNOA 2CZ0B 1YJ9A 3QYGB 1X27A 2LX7A 1FXXA 5IH2A 3HPWA 1UJYA 2QA4A 1VQ8T 4RKUE 3INZA 2FL7A 2JJ9A 1PG5B 1YJ9Q 2V1RA 1TUCA 1TH7A 3C94A 3CPWS 1S72T 4ZTFA 2M1HA 2KRNA 4Q5WA 3D7SB 2BE7D 3CCVQ 1JU5C 1V1CA 1TS9A 2PNIA 2ZGWA 4K11A 3EH2A 1HJDA 2GF7A 4FT4A 1BYMA 3EGDA 1QCNA 4F7UG 2QTXA 1K73R 1Y71A 4OVAA 3QPHA 5IHKA 1WX6A 3C95A 3CCET 1JXMA 4OMMA 2LC4A 4ELZC 4Z02A 2QEXQ 4GLMA 3RESA 1FX7A 4AFZC 1Y7XA 1VQLQ 4II1A 2KQWA 3CCMQ 1HXDA 3VKIA 2GFAA 2K57A 3QYHB 2FHDA 1UGPB 4JJNK 1YFNA 3EFSA 1YNZA 1PCXA 2A7YA 4RTYA 2VV5A 5FU7B 4C0DB 1WYXA 4X9CA 2ZPEB 1QMCA 4J9HA 1VQMA 2WSEE 1RAGB 2D0NA 3HKSA 3P8BB 2HZYA 2XD0A 3PT9A 2KNBB 2A28A 3CC4T 4RTXA 5FW9A 1W2BA 2KAFA 1SF9A 1JXOA 4E7LA 3I5SA 2DBMA 5GMKl 2QGFB 2F2WA 2JZ2A 3O8VA 3VJPA 3I55A 3VRYA 4KUIA 2JW4A 2PVGB 3LYIA 1VQ4T 1AOJA 2RPNA 1TXQA 1QWFA 2CUBA 1VQ6T 2LTOA 1IO6A 2MMPA 5LJ3d 5KYYB 2MOXA 3PVLA 2CT3A 2CP0A 4M77B 2FO0A 4RMOA 2AKKA 2CH4W 3GLXA 1A0NB 5HCKA 1BKBA 6AT1B 1NBEB 5GAN6 2XHCA 5KYYA 4BE1A 1H8KA 2KYBA 3CXCS 4PL6A 4M77A 1QLYA 2EVRA 1Q81R 1BB9A 1N27A 1NG2A 3CPFA 1D3BB 4QKUA 1D1CA 3EG9B 3R6OA 1D09B 2DJZA 4FSXA 4OB1B 1UFFA 2EGCA 3CC2A 2HNIA 1YWOA 4IUVA 2DERA 1GBQA 4OP0A 1D3BA 1Y96B 2VASA 3EG9A 5CKBA 4F04B 4IUQA 1I5LA 3RDVA 2M0OA 3CC2Q 1EX4A 1YIJQ 4EIKA 2K2MA 3MP1A 2E5KA 5FLXE 1PKSA 3RKWA 2OTJA 3E1SA 5CIUA 1Y96A 4DBFA 4M78G 3GNFB 4C8QG 1M30A 3H9NA 5FWCA 2KMTA 1X01A 4PJJA 3X24B 1SRLA 4M7DC 3QUIA 2RF0A 1OPLA 1BCOA 1NZ9A 1Q86U 1PRMC 4IKFA 2R58A 2RD1A 1VQNA 2KRMA 4FW2A 2YLBA 3M0UA 3R6NA 1S72A 4AT1B 2KE9A 2HQXA 3META 4M78D 3QO3A 3ER0A 1UDLA 4JRQA 3SEMA 1J3TA 1BIBA 4J6XA 3CCLT 2W10A 2XDPA 4HXJA 1X2QA 1FMWA 4A4FA 2G6FX 4ESRA 3TCJA 1KFZA 4C92A 3CCEA 1MMNA 4FW1A 1TU0B 3OYGA 4DA4A 4LDXA 1PD1A 1I4K1 3OYDA 3HTRA 3LX7A 2YDLA 2X35A 3URGA 3OBYA 4PJOF 2DL5A 2P4TA 2RNAA 5CVIA 2M9UA 2QI2A 2H3JA 1I07A 1D1BA 4M75F 3JB9D 3S3OA 2FYKA 2JNGA 3NTHA 2GTJA 2J7IA 4RTUA 3CCUQ 4BY6B 1QVPA 3MEWA 3T9NA 1R77A 2DYBA 4PJOE 1UB4A 4OMQA 3QJYA 1W1FA 4N0AA 4Y92A 2KI7A 2O31A 3EH1A 4M75E 5GAMf 2KVQG 5KE2A 1YITQ 4J7FA 1X69A 2M51A 2AZSA 2C0TA 3G71T 4E7JA 1YHQQ 1B3QA 4R55A 1CKBA 1NLOC 2E6ZA 2Z0WA 1G8XA 1Q82R 2DK3A 2JMCA 2DVEA 2DXTA 2H3EB 3OYYA 2CP5A 4WCIA 3CCSA 5DM7R 1Y57A 2EW3A 3MHXA 2E5QA 3VRZA 2YRCA 4JRIA 3JB9I 3I35A 1UJ0A 3KXTA 1BBZA 1WJQA 4BB7A 2ROTA 3TSWA 1ZQ1A 5A0GA 2LT1A 1RAHB 1W2BS 2HD0A 2AK5A 3PFSA 3SHWA 1NJIR 3AHUA 3QHSA 3EG0A 1H641 1OOTA 2X4XA 3QG1A 3I56Q 1H92A 2K5FA 2XU8A 1GCQC 4E7KA 1GL5A 2AKLA 3NGPA 3G1JA 3LWHA 4KGVB 2XIDA 2BZXA 3J81E 3CC7T 3NFCA 2QDYB 2LNHB 1IXDA 2X4JA 4UC4A 1AT1B 2EWNA 2PQWA 4X9DA 1YCYA 2GCXA 4C5GA 1MMAA 1ZA1B 4QQ6A 3NTKA 3TU4K 4HT9A 2KRSA 2GNCA 3RBBB 4XTVA 3OSSC 3H41A 4L5GA 4M7AC 4OB2B 2P0QA 4RG8A 3RMQA 1VQOQ 3BY7A 4MZTA 4ATOA 1BIAA 1V76A 3P8DA 3FDRA 1RAEB 1YJ9T 2LCCA 4EPCA 2OI3A 1RLQC 1NYFA 2K3YA 1QCFA 4FSSA 3WXMB 4J9EA 2CSQA 2GQVA 2QA4T 1WGSA 1BI1A 3WVDB 2CYZB 1RL2A 5ECAA 3TEEA 3G4SA 1QKWA 2COZA 4C0DC 5IXBA 3QDRB 2WSFE 1JO8A 5EC7A 2D1XA 2KXCA 4M7DB 5GAOm 1D0XA 1VQKQ 2OAWA 5CKEA 5GAOq 2M16A 5A0LA 3ME9A 1X2KA 1NYGA 2RQRA 5GMKj 1ARKA 4EDUA 4M7DA 2P0KA 2VVKA 5LJ5e 3QDFA 4E47A 3CCMT 1N9SA 2D9TA 1VQ9Q 2X4YA 5GAN2 2J6OA 3JCMf 4M77G 1M1GA 2RQTA 2O9SA 4J9DA 5LJ5j 4M78F 4M77C 4C8QF 4AFQC 2A37A 2RJEA 1BI3A 4OF1A 2MYSA 1AZEA 5CQYA 1KHCA 1QCOA 5GAN4 4CI0C 1OZ3A 3VS3A 5GAMg 1RADB 4M78E 1U06A 3JV3A 4C8QE 2L8DA 4AG2C 4E7SA 3EFRA 2VXEA 3M4GA 3VYGA 2QQBA 5D6YA 4XTYA 2NYSA 3X25B 1WHHA 3GPLA 3H0FA 5C0MA 1KQ2A 1KIKA 5A2QE 5KE3A 1KD1U 1ABOA 1QWEA 2F1LA 3AT1B 4MZMA 3OYHA 1AZGB 3I55T 4HCCA 2DZ9A 2SRCA 3A8LB 2DETA 1XTDA 3G6EQ 2YRDA 4BDZA 2VXFA 5GANe 4VUBA 4FM4B 1GFCA 3RERA 4HVVA 5LL6S 3OYCA 5GAOn 3PE0A 2RK2A 5FRMA 4JDSA 3SDZA 3JB9H 2CH4A 2NWMA 1D0YA 2DF6A 1M90R 3NTIA 1RLPC 1G3SA 1YWPA 2EAYA 1U1SA 2DD5A 2ZCFB 4ZTJA 2RHXA 1VQ7Q 1TWBA 1M3CA 1OV3A 1UGRB 3OMCA 3VS4A 3LW5E 5GMKh 4LUEA 2ESWA 1Q95G 1K9AA 3HFNA 2LQWA 2DEUA 2EGAA 2HQEA 2BKDN 1N6AA 3CC2T 1VYUA 3S6WA 2PVDB 2ZAEA 2DXUA 4C92C 2O88A 1F1BB 1K8AU 4XAXB 1Z9QA 1Q7YC 2X4WA 2XKOC 1WZOA 1NEGA 4FYWB 3CCRA 3DB3A 5LJ5h 1K8AC 2OTJT 2RK1A 4M75D 5KYNA 2DTOA 3CCRQ 1MMDA 3PTAA 3EAEA 2JTMA 5GAN7 2VGMA 2JOYA 5GANg 5GAN8 2ZPFB 4ZGEB 1VQNT 2E12A 1WQ7A 3CCVA 4E7IA 2BZ8A 1GCQA 4N0AC 1GCPA 1NLPC 2E65A 1HSQA 3M53A 4BY6C 2IIMA 4EMHA 3EGDB 1M1KU 1YI2Q 2VWFA 3H0HA 1AHJB 3ZL7C 2O9VA 3FIFA 1FMVA 4JZ3A 1M1KC 2QEXA 4M7AB 1X6GA 3GBQA 3PIPA 1VQLA 3CCMA 5I2MA 3E19A 4Y91A 5GAOp 3PNWC 3RNJA 4M7AA 3QXEB 5D6XA 2LDMA 4AG1C 1MGQA 2XI9A 4J7IA 4OMNA 1UGSB 5EG2A 3FB9A 4IIMA 3MJXA 3DLLA 1KQ1A 2O4XB 3S3NA 2KY9A 4LE9A 3QKJA 3QWYA 3JCMg 3QZ5B 3FJPA 5CK9A 1YCSB 5J3BA 2BIVA 2HSEB 4Z89A 4DBRA 1U5SA 7AT1B 1FMKA 2O4XA 3RR6A 1K73U 4KH1B 3KFVA 1YHQT 3A8MB 2CP3A 3OS2A 1K73C 5I22A 2PZ1A 4ZN1A 3BFMA 2F2XA 2JTEA 5FWBA 1RI0A 1VUBA 4DBHA 4OMFB 1JQQA 5DY9A 3DLMA 3L42A 3DB4A 5LJ5d 5FRNA 4LDYA 3CCST 2HL3A 4HVWA 4F14A 4PK4A 4XTUA 3CCQA 5I21A 2EFIA 1PWTA 2JM9A 1GRIA 1SG5A 4PKCC 2DX1A 2HKNA 4BACA 3EG2A 2NUPA 4JZ4A 4RUGA 3HRTA 2CSIA 1D1AA 2LJ3A 2NLUA 2KGTA 4MDXA 5HY6A 3CCQQ 4NL3A 1XNIA 2QYZA 2FEIA 2HMAA 2KT1A 1UHCA 2CZ1B 2J06A 1SEMA 3OYAA 2DFUA 4R56A 1GFDA 4FYXB 1YIJA 4BI3A 3JCMQ 1WA7A 2K3BA 2MAMA 2RI3A 4JLIA 2DKGA 5CAIA 3MEAA 3I9QA 2CT4A 3EFOB 4C5IA 4PFZA 2Y4YA 4NOYA 1ZUYA 4JRPA 1Q86R 1LOJA 4M7DG 1VYTA 1I81A 1UG1A 1Q81U 2P4RA 2QTVA 1SSHA 3EFOA 3OS5A 2EYYA 2D8JA 2HAXA 8ATCB 1UGVA 2O01E 2DJQA 2QQRA 4C0GA 3E9GA 1Q81C 5I2SA 4C0ZA 3OYFA 3M0TA 2CREA 3SD4A 1QW1A 1RUWA 3LGLA 2RA2A 2AHJB 3OSVA 4FCYA 2A0FB 3CMAA 4PLIA 4C8QD 1T0JA 5C6SA 3VS1A 2XMFA 1WDXA 4C92B 1C6VX 4J6WA 2HSPA 4BE2A 2DM1A 3CMAQ 4Z8AA 4EMGA 1QVFA 2FZGB 3PVQA 2LVMA 2OTLA 4IUTA 3G4ST 1VQ8Q 4KUDK 1KC8R 2L3QA 3L2RA 1U3OA 1VIEA 3ZFJA 3REAB 8AT1B 2OTLQ 3EHQA 1H3HA 3CCUA 4KBMB 1YJWQ 5KH6A 2K4YA 2B86A 4N4GA 2VGNA 2KDSA 4PJOA 1O75A 3C0CA 3OS1A 1YITA 2EIFA 1E6GA 3VYHB 2YUOA 1VQPQ 2DIGA 4ZGJB 2MIOA 4O5VA 1K9MR 2K6DA 4XK8E 1G3YA 2CUDA 1YHQA 2K5IA 2JMAA 4CRIA 4CC2A 2DEQA 2C0IA 2DVJA 2LZ6B 3C4SA 3MP8A 1WPYA 3VS7A 2YT6A 3EHRA 1JBMA 2QAZA 5IXFA 4JJCA 2DIQA 2EYWA 2I0NA 1Y07A 2LQNA 3SFMA 4AMCA 1EIFA 1WHGA 2BUDA 3G6ET 2OJ2A 2RI2A 4LN2A 2DRKA 1M5Q1 5GAOr 1UGQB 3CBPA 4C0FA 1KG1A 5IHNA 4DBQA 1ACMB 1QP3A 2LT4A 2MK5A 2E70A 2QQSA 1LJOA 3ASKA 3JCMW 4XTXA 4F7UF 4E7ZA 3I56A 1VQ4Q 2DL7A 3V7RA 2DL3A 1ZA2B 2ENMA 2PUOB 2RHUA 1VQ6Q 2RJCA 3L2QA 1Q82U 2EJGA 2RHIA 2R57A 4F17A 4F7UE 3MEUA 5LJ3f 2DTIA 2J05A 3E9FA 1UEBA 5FU6B 2LJ1A 4J83A 1Q82C 4XU0A 2HEQA 4PFOA 2FB7A 1KHIA 2RB6A 4A4GA 2IPOB 1B34B 2F2VA 3PMIA 5J26A 3VS0A 3LGFA 4J9BA 4OMLA 2DXCA 4JPBW 3ULRB 1MHNA 1NJIU 4M7AG 2FRWA 2KSSA 2RQWA 1AEYA 1VQOA 1IHVA 1B34A 5L8RE 4CC4B 2VC8A 4IUUA 3A8OB 3CCRT 1NJIC 4FT2A 5HK0A 5M9OA 4CC3A 2EYXA 1MMGA 4KULA 1OYXA 1I1JA 2XG8D 1TUDA 5GAMe 5GJVB 4LD9K 1HYOA 1ABQA 4LDUA 1NE8A 4XTWA 3A1PA 2MF2A 1AD5A 1T3SA 3GNGA 2MI6A 3CCVT 3JCMb 2A3LA 1BCMA 2LJ0A 1VQKA 1X6BA 4HCBA 2CZ6B 5AT1B 1RAIB 3A5ZB 1BK2A 5GAMj 3HRSA 2MCNA 2DE0X 3V8JA 2YUQA 3A8GB 2LCSA 1PM3A 3QWXX 1QVGA 1OPKA 4RTZA 2HBWA 4OMPA 2KXDA 4XU1A 1DJ7B 5D6WA 2PU9B 1G3TA 5CCAA 2QEXT 3CCLQ 2EGEA 1VQ9A 2J6KA 3H8ZA 2V8KA 1M8VA 4QQDA 1VQLT 3S3MA 4R0KA 3QSUA 1LNXA 2K7AA 2LQ8A 1YJNQ 2L3PA 2PUKB 4Y28E 4BDYA 4M78B 4EMKC 3EG1A 1IRXA 2BZYA 2QXFA 2VB6A 4B9XA 3M4YA 2HDAA 1M2OA 1X75C 4M7DF 2WSCE 2RHYA 4ZN3A 3H0IA 3J80E 2ZPHB 1ZUKA 4JLGA 4M78A 5LJ3e 2X3WD 4DQ2A 4B6MA 4M7DE 2DZCA 1KD1R 4J9GA 4M77D 5GJWB 1MNEA 4HCKA 1PSFA 4HCZA 4OB0B 1QP2A 2G3RA 4BE0A 5I11A 4WTOB 3UATA 3WVEB 2XDBA 2OX7A 1ZUUA 3G6EA 1WXBA 3RIRA 2EQMA 2V8JA 5FROA 3M55A 3G71Q 3CXCA 2DO3A 1M3BA 3BDLA 2J6FA 1VQ5Q 1N5ZA 2ZPIB 2VYTA 2DL4A 4DOWA 1WHJA 1M8MA 1VIFA 1WJRA 2RMOA 5CR2A 1N8RR 1EFNA 3HL8A 3CCQT 2YHTA 4HT8A 4A4HA 2L89A 1WHKA 2DL8A 4HKEA 1SHGA 5GAMh 2EBPA 1VQ7A 3HRUA 5GANj 1NPRA 1JEGA 2QDLA 3EG3A 4XTZA 4MMKA 2DBKA 3OYLA 4ELYC 1FWZA 4GY5A 4DEXA 4V2SA 1OU8A 3CD6Q 5KYWA 1FYNA 3TVTA 2NUTB 4C92G 5LJ3g 2RN8A 1Q7YU 1JRIA 2EQKA 3GIBA 1I8FA 1RAAB 5GAOl 1YIJT 4JS5A 2E3HA 2ED1A 4O6JA 2NUTA 2AZVA 3RKYA 5KCOA 2JT4A 2YUNA 1UTIA 4X34A 2FZKB 2JS0A 3CEYA 3ZBDA 1M90U 1O9SA 2RQVA 4C92D 4OB3B 5GMKm 4A4EA 2L2PA 1LVKA 3JCMe 1PRLC 4OMOA 1OEBA 1HD3A 4PJOC 1WHMA 3CC7Q 2FPFA 1M90C 2CP6A 3JSCA 3Q1JA 3THKA 1G3WA 1WI7A 4M75C 3L2UA 1KQSP 3GOXA 4RTWA 1LCKA 1BI2A 2X3XD 3VU3C 1YI2A 3QJ6A 2DRMA 1X6OA 4FL6A 1OU9A 2DA9A 2Y4XA 1IHWA 3M58A 3CMAT 1HK9A 2LX9A 2IG0A 3A8HB 3M54A 2DXBA 2E4HA 2EQUA 3OYMA 3MO8A 9ATCB 2KR3A 1PD0A 1M1FA 2K2VA 1AWWA 2WACA 4E6RA 1MUZA 3EGXB 2CP7A 2JUFA 5CQXA 4MZPA 5CKDA 3KUFA 3JCMP 1M3AA 3OA6A 2OTLT 4MMLA 1YJWT 4J9IA 1U8RA 2QA4Q 3EGXA 3EGUA 3E2UA 3N5BB 2XDDA 3CBMA 3VUBA 2C0OA 3VS5A 3CCUT 3OYJA 5GANh 3HHTB 3M9QA 4C5EA 1VA7A 1TSFA 1WIEA 1ZLMA 1BI0A 5CO7A 5GAMd 1VQPT 2ED0A 3SWNC 4Z88A 4M7AF 4FYYB 1PHTA 2E10A 3QIIA 1PKTA 1YITT 5D7UA 1QVGS 1NEBA 2LNVA 4M7AE 1V29B 4HVUA 3OW2P 3O5ZA 1IGUA 1IGQA 3UA6A 1W6XA 3L2VA 2EKHA 2LMJA 2MWOA 4MDWA 1TOVA 1ZSZC 3NPFA 2D0QB 1JJ2A 2L3SA 1Z9ZA 4X1VA 5FU6C 1TTHB 4EMKB 2ZZDA 3IQLA 1TG0A 1VQMQ 3CCJA 1KQSA 3QBYA 3MCAB 3HSBA 2NUPB 3CQTA 4PFPA 1QVFP 4LUDA 1KSWA 3M0RA 4JUVA 4WF2A 1SKUB 1C0MA 4XU2A 2DILA 4EMKA 3JCMh 3CCJQ 3SB2A 1WXUA 4D8DA 2HCKA 3JB9J 1RI9A 3PIOA 5IT9E 4KH0B 3V8KA 3I55Q 2F5TX 3JCMV 2EPDA 3I56T 2YRVA 1AWJA 4ORZA 2RH2A 4IUPA 4BI4A 4A4KA 2NUZA 4XU3A 4M77F 2DD4A 3OB9A 2QK0A 2GGRA 2PVOB 4LDVA 3OS0A 2EYZA 2EJ9A 1R8OB 4RG2A 3OYNA 3UF4A 3VS2A 4PLLA 1WQWA 3GF5A 2YXYA 4J9FA 4M77E 2FPEA 1OI1A 2I2LA 4LXCA 1KJWA 1PC0A 1WFWA 2COWA 5GANd 3CMEA 1YN8A 3A98A 3KBGA 3F70A 1WJSA 3MP6A 2AIRB 2KBTA 3OW2A 1VQOT 3LH0A 3OYEA 2QGGA 3CMEQ 2K5LA 4KT0E 5CKHA 4M7DD 1N9RA 1OX8A 2V1QA 1R0BG 4ZGDB 2VUBA 3J7AF 2ATCB 2OTJQ 4M78C 4N4HA 2K3XA 4C8QC 4J9CA 2R5AA 3C12A 1VQ8A 1UECA 2E41A 2VKNA 1IB8A 3UA7A 4CC7A 3M5AA 4GBQA 2M0YA 1Q86C 5GMKi 1VQKT 4A54A 1YJWA 1VQNQ 4PJOB 4A53A 4KGXB 2W0ZA 1S72Q 2LQKA 5J39A 5AYFA 2RJFA 4M75B 2XK0A 4C92F 3JCMd 1VQ9T 3JB9G 1VQPA 1YJNT 1SPKA 5CKFA 3LLRA 3TQ7P 2X51A 3RMSA 4M75A 3GP8A 4P5NA 3M59A 4C92E 1D0ZA 1K0SA 1PSEA 1W4SA 2O2OA 3P8HA 4F16A 3CCEQ 2KYMA 3FC3A 2KK4A 4C5HA 1AWXA 2HKQB 2DMOA 1KC8U 2H8HA 2HL5C 4ANJA 3TREA 1PNJA 1SRMA 4PJLA 3V7CA 3CPWP 2E6NA 1U1TA 3M0PA 5IN1A 4QW2A 2LRQA 1KC8C 2YLCA 4A63B 4OGEA 3VV0A 3MPUB 3CC4A 1K0XA 2LCLA 2EKOA 4QT7A 4YTLA 4BUGA 1VOMA 2L0AA 3OY9A 1T0HA 1T3LA 1VQ5T 5GAN5 3CC4Q 3SWNB 1K9MU 1P92A 1YP5A 3UDCA 3VS6A 3L1AA 1VQ4A 2COYA 4F7UB 2ECZA 3JAME 1I5OB 5KYXB 1CKAA 2QASA 3OYKA 1VQ6A 1OQKA 1QVGP 2RHZA 1K9MC 3SWNA 4E7HA 5IAYA 1E7OA 2EQIA 2A36A 4F7UA 1KK7A 3BE3A 5KYXA 1M9SA 3PGGA 4AFUC 2PTKA 1XQHA 3CBOA 3BW1A 4PJMA 3VUZA 1S1NA 3CCSQ 5LJ5f 1ZSZB 1JJ2S 1MV3A 4GLKA 1K4US 2SEMA 4AFSC 1VQ7T 1WHLA 3JCMJ 3CD6T 3I5RA 3REBB 1MV0B 2GBQA 1KQSS 1NPPA 1SHFA 2ZPGB 3QZ9B 3G7ZA 1ZSZA 2QQAA 2JVVA 2F69A 1IZ6A 1AVZC 5L23A 1WLPB 4N4IA 2HQHA 5DLQE 1X43A 1MNDA 4FIBA 4L59A 2JN0A 2XICA 2FZCB 2KEAA 4BI8B 2YSQA 2LP5A 3FEOA 1RAFB 2FG0A 3RKXA 4JS4A 1B07A 2QG9B 1B7TA 4JJDA 4J5YA 3V8LA 2EQJA 1WXTA 2R5MA 2L3RA 2BTTA 3BDUA 3CPWA 2OAUA 1Y0MA 3M0QA 1CSKA 1QQJA 5HK3A 1M27C 1ZBJA 2DTHA 2D6FA 2GQIA 2DPPB 2E1HA 1TUGB 2C06A 1JB0E 1BU1A 1RABB 3CXCP 4M7AD 1NM7A 3HP9A 2YWWA 1C1AA 3X26B 4RCCA 1YI2T 1GXIE 5GANf 1GBRA 3X20B 1AWOA 3OMGA 1IREB 3L2ZA 3FLGA 2X9HA 4XQ3A 2EJFA 2RM4A 4D6WA 2HBPA 4PJNA 4KGZB 4RCBA 4BD3A 5GAN3 3CCLA 1ZX6A 4DEYA 1K1ZA 3U23A 3H6ZA 4JJBA 3OW2S 1UHFA 4HA8A 2V26A 4FU6A 3M0SA 1YJNA 2KT8A 2Y90A 5GMKe 4NS5A 5FU7C 1G83A 4ME7A 3OBWA 3JCMX 2K79A 2B8AA 3V7SA 1XOVA 5KYUB 2V8IA 3OYBA 1VYVA 2BE9B 4LD6A 3G4SQ 2E3IA 4C8QB
chains in the Genus database with same CATH topology
1GFDA 2JMCA 2DA9A 1WA7A 2K3BA 4WCIA 1Y57A 2EW3A 3I9QA 2CT4A 1K76A 3VRZA 3I35A 2FRYA 1ZUYA 2KR3A 1AWWA 1UJ0A 4E6RA 1BBZA 1MUZA 1VYTA 1UG1A 2ROTA 3TSWA 2P4RA 1M3AA 1SSHA 3FJ5A 3NMZC 2EYYA 2D8JA 2JM8A 4J9IA 2AK5A 3LH5A 1UGVA 2DJQA 3SHWA 3EGUA 1ZSGA 3EG0A 3M0TA 2CREA 1OOTA 2C0OA 3VS5A 1H92A 1VA7A 1RUWA 1GCQC 1WIEA 1ZLMA 1GL5A 2AKLA 1T0JA 3NGPA 2DNUA 2ED0A 3VS1A 2XMFA 4Z88A 1PHTA 1E6HA 2DLPA 1W70A 1PKTA 1WDXA 1UUEA 2BZXA 2D8HA 2HSPA 2DM1A 2FPDA 1NEBA 4KRTA 4Z8AA 2LNHB 5IHIA 3PVQA 4RTTA 4HVUA 4D8KA 3O5ZA 3UA6A 1W6XA 1UE9A 2JS2A 2EKHA 2LMJA 2L3QA 2KRSA 1U3OA 2GNCA 3RBBB 3NPFA 3REAB 3H41A 3EHQA 2L3SA 1H3HA 1Z9ZA 4X1VA 2B86A 3IQLA 4RTVA 1TG0A 2YUPA 3C0CA 3CQTA 2OI3A 2JXBA 4LUDA 1RLQC 1NYFA 1QCFA 4M4ZA 1KSWA 4FSSA 1E6GA 3M0RA 1I0CA 2DILA 2YUOA 4J9EA 4ZNXA 2ROLA 2MIOA 2CSQA 2K6DA 4LNPA 2CUDA 3TSZA 1WXUA 2JMAA 2RQUA 4D8DA 2HCKA 5ECAA 1RI9A 1QKWA 4CC2A 1QKXA 5IXBA 2ABLA 2EPDA 2C0IA 1JO8A 1AWJA 2DVJA 2KROA 2LZ6B 2K9GA 4ORZA 5EC7A 2D1XA 2KXCA 2GTOA 2A08A 2OAWA 3VS7A 2YT6A 2NUZA 3NHNA 1X2KA 3EHRA 2CDTA 1NYGA 2RQRA 5IXFA 2GGRA 4JJCA 2EYZA 2EYWA 3UF4A 1ARKA 3VS2A 2I0NA 1G2BA 4IIOA 2LQNA 2VVKA 4J9FA 1X27A 2LX7A 2OJ2A 5IH2A 4LN2A 2DRKA 1UJYA 2FPEA 2J6OA 5IHNA 1KJWA 1WFWA 1TUCA 2RQTA 2V1RA 2O9SA 4J9DA 1YN8A 3A98A 4AFQC 2A37A 2DL7A 2KRNA 2DL3A 2KBTA 2ENMA 1JU5C 1AZEA 1V1CA 2PNIA 4K11A 1HJDA 3VS3A 4F17A 1U06A 3JV3A 4AG2C 2J05A 2V1QA 2LJ1A 5IHKA 1WX6A 1JXMA 4OMMA 3H0FA 2HEQA 1KIKA 4GLMA 4AFZC 1ABOA 1QWEA 4J9CA 1UECA 1AZGB 2VKNA 2SRCA 3UA7A 2F2VA 3VS0A 4CC7A 4GBQA 2M0YA 4J9BA 4OMLA 1YNZA 4JPBW 3ULRB 2FRWA 4RTYA 2RQWA 1AEYA 1GFCA 1WYXA 4J9HA 4HVVA 2W0ZA 2D0NA 4CC4B 3PE0A 2CH4A 2KNBB 2NWMA 2A28A 4RTXA 5FW9A 4CC3A 2DF6A 2EYXA 1RLPC 1SPKA 1I1JA 1YWPA 1JXOA 1TUDA 5GJVB 1ABQA 3I5SA 2DBMA 2F2WA 1M3CA 1OV3A 1K0SA 3VS4A 3VRYA 2JW4A 2O2OA 4F16A 4LUEA 1AD5A 2ESWA 2KYMA 1AOJA 1K9AA 1T3SA 2LQWA 2RPNA 1AWXA 2EGAA 1QWFA 2DMOA 2CUBA 2LJ0A 2H8HA 1X6BA 1IO6A 1VYUA 1BK2A 2O88A 1PNJA 2MOXA 3PVLA 1SRMA 2CT3A 2DE0X 2MCNA 2YUQA 2FO0A 1Z9QA 2LCSA 2AKKA 3M0PA 2CH4W 3QWXX 1A0NB 1OPKA 4RTZA 5HCKA 2HBWA 4OMPA 2KXDA 1NEGA 4A63B 2EGEA 1H8KA 2KYBA 1K0XA 1QLYA 2J6KA 4QT7A 2EVRA 1BB9A 4R0KA 2L0AA 1NG2A 1T0HA 1T3LA 2K7AA 1YP5A 2L3PA 3VS6A 2ECZA 3EG1A 2BZYA 1CKAA 1GCQA 1UFFA 2BZ8A 1GCPA 2EGCA 2HDAA 1NLPC 1YWOA 1HSQA 1GBQA 2IIMA 1E7OA 3H0IA 2VWFA 2EQIA 1ZUKA 3H0HA 3ZL7C 2A36A 2X3WD 2O9VA 4AFUC 2PTKA 4EIKA 4JZ3A 2K2MA 1S1NA 2E5KA 4J9GA 1MV3A 1PKSA 5GJWB 4HCKA 1K4US 2SEMA 1X6GA 4AFSC 3GBQA 1M30A 3I5RA 5FWCA 3REBB 1MV0B 2GBQA 5I11A 1SRLA 1SHFA 3UATA 2RF0A 1OPLA 1ZUUA 1WXBA 3RNJA 1PRMC 2KRMA 4AG1C 1AVZC 5L23A 1WLPB 3M0UA 1M3BA 3R6NA 1X43A 4OMNA 2J6FA 1N5ZA 2KE9A 4IIMA 2KEAA 2DL4A 1UDLA 3SEMA 1M8MA 2YSQA 4LE9A 2LP5A 2RMOA 1J3TA 2FG0A 3QWYA 1B07A 1EFNA 4JJDA 2W10A 1YCSB 1WXTA 4Z89A 4HXJA 1U5SA 2DL8A 1FMKA 1X2QA 2BTTA 1SHGA 2G6FX 4ESRA 1Y0MA 2EBPA 3M0QA 3KFVA 1CSKA 1M27C 1ZBJA 1KFZA 2GQIA 1JEGA 2QDLA 3EG3A 1BU1A 2DBKA 1NM7A 5I22A 2PZ1A 2F2XA 2JTEA 5FWBA 4DEXA 1FYNA 3TVTA 2YDLA 2RN8A 1GBRA 1AWOA 2DL5A 1JQQA 2RNAA 1I07A 2ED1A 4HVWA 2GTJA 2J7IA 4RTUA 4F14A 2AZVA 1ZX6A 4DEYA 1K1ZA 3U23A 2JT4A 2YUNA 1UTIA 2DYBA 1PWTA 2JS0A 2JM9A 4JJBA 1GRIA 1UHFA 4OMQA 1W1FA 2DX1A 4Y92A 3EG2A 2O31A 2RQVA 4JZ4A 4RUGA 2CSIA 3M0SA 2LJ3A 2KGTA 2KT8A 2L2PA 1X69A 1PRLC 2M51A 1OEBA 2AZSA 1G83A 2C0TA 4OMOA 1HD3A 2K79A 2FPFA 2FEIA 1XOVA 3THKA 1WI7A 2KT1A 1UHCA 2J06A 1B3QA 1SEMA 1VYVA 1CKBA 1NLOC 4RTWA 1LCKA 2X3XD 2DRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFD A;  2JMC A;  2DA9 A;  1WA7 A;  2K3B A;  4WCI A;  1Y57 A;  2EW3 A;  3I9Q A;  2CT4 A;  1K76 A;  3VRZ A;  3I35 A;  2FRY A;  1ZUY A;  2KR3 A;  1AWW A;  1UJ0 A;  4E6R A;  1BBZ A;  1MUZ A;  1VYT A;  1UG1 A;  2ROT A;  3TSW A;  2P4R A;  1M3A A;  1SSH A;  3FJ5 A;  3NMZ C;  2EYY A;  2D8J A;  2JM8 A;  4J9I A;  2AK5 A;  3LH5 A;  1UGV A;  2DJQ A;  3SHW A;  3EGU A;  1ZSG A;  3EG0 A;  3M0T A;  2CRE A;  1OOT A;  2C0O A;  3VS5 A;  1H92 A;  1VA7 A;  1RUW A;  1GCQ C;  1WIE A;  1ZLM A;  1GL5 A;  2AKL A;  1T0J A;  3NGP A;  2DNU A;  2ED0 A;  3VS1 A;  2XMF A;  4Z88 A;  1PHT A;  1E6H A;  2DLP A;  1W70 A;  1PKT A;  1WDX A;  1UUE A;  2BZX A;  2D8H A;  2HSP A;  2DM1 A;  2FPD A;  1NEB A;  4KRT A;  4Z8A A;  2LNH B;  5IHI A;  3PVQ A;  4RTT A;  4HVU A;  4D8K A;  3O5Z A;  3UA6 A;  1W6X A;  1UE9 A;  2JS2 A;  2EKH A;  2LMJ A;  2L3Q A;  2KRS A;  1U3O A;  2GNC A;  3RBB B;  3NPF A;  3REA B;  3H41 A;  3EHQ A;  2L3S A;  1H3H A;  1Z9Z A;  4X1V A;  2B86 A;  3IQL A;  4RTV A;  1TG0 A;  2YUP A;  3C0C A;  3CQT A;  2OI3 A;  2JXB A;  4LUD A;  1RLQ C;  1NYF A;  1QCF A;  4M4Z A;  1KSW A;  4FSS A;  1E6G A;  3M0R A;  1I0C A;  2DIL A;  2YUO A;  4J9E A;  4ZNX A;  2ROL A;  2MIO A;  2CSQ A;  2K6D A;  4LNP A;  2CUD A;  3TSZ A;  1WXU A;  2JMA A;  2RQU A;  4D8D A;  2HCK A;  5ECA A;  1RI9 A;  1QKW A;  4CC2 A;  1QKX A;  5IXB A;  2ABL A;  2EPD A;  2C0I A;  1JO8 A;  1AWJ A;  2DVJ A;  2KRO A;  2LZ6 B;  2K9G A;  4ORZ A;  5EC7 A;  2D1X A;  2KXC A;  2GTO A;  2A08 A;  2OAW A;  3VS7 A;  2YT6 A;  2NUZ A;  3NHN A;  1X2K A;  3EHR A;  2CDT A;  1NYG A;  2RQR A;  5IXF A;  2GGR A;  4JJC A;  2EYZ A;  2EYW A;  3UF4 A;  1ARK A;  3VS2 A;  2I0N A;  1G2B A;  4IIO A;  2LQN A;  2VVK A;  4J9F A;  1X27 A;  2LX7 A;  2OJ2 A;  5IH2 A;  4LN2 A;  2DRK A;  1UJY A;  2FPE A;  2J6O A;  5IHN A;  1KJW A;  1WFW A;  1TUC A;  2RQT A;  2V1R A;  2O9S A;  4J9D A;  1YN8 A;  3A98 A;  4AFQ C;  2A37 A;  2DL7 A;  2KRN A;  2DL3 A;  2KBT A;  2ENM A;  1JU5 C;  1AZE A;  1V1C A;  2PNI A;  4K11 A;  1HJD A;  3VS3 A;  4F17 A;  1U06 A;  3JV3 A;  4AG2 C;  2J05 A;  2V1Q A;  2LJ1 A;  5IHK A;  1WX6 A;  1JXM A;  4OMM A;  3H0F A;  2HEQ A;  1KIK A;  4GLM A;  4AFZ C;  1ABO A;  1QWE A;  4J9C A;  1UEC A;  1AZG B;  2VKN A;  2SRC A;  3UA7 A;  2F2V A;  3VS0 A;  4CC7 A;  4GBQ A;  2M0Y A;  4J9B A;  4OML A;  1YNZ A;  4JPB W;  3ULR B;  2FRW A;  4RTY A;  2RQW A;  1AEY A;  1GFC A;  1WYX A;  4J9H A;  4HVV A;  2W0Z A;  2D0N A;  4CC4 B;  3PE0 A;  2CH4 A;  2KNB B;  2NWM A;  2A28 A;  4RTX A;  5FW9 A;  4CC3 A;  2DF6 A;  2EYX A;  1RLP C;  1SPK A;  1I1J A;  1YWP A;  1JXO A;  1TUD A;  5GJV B;  1ABQ A;  3I5S A;  2DBM A;  2F2W A;  1M3C A;  1OV3 A;  1K0S A;  3VS4 A;  3VRY A;  2JW4 A;  2O2O A;  4F16 A;  4LUE A;  1AD5 A;  2ESW A;  2KYM A;  1AOJ A;  1K9A A;  1T3S A;  2LQW A;  2RPN A;  1AWX A;  2EGA A;  1QWF A;  2DMO A;  2CUB A;  2LJ0 A;  2H8H A;  1X6B A;  1IO6 A;  1VYU A;  1BK2 A;  2O88 A;  1PNJ A;  2MOX A;  3PVL A;  1SRM A;  2CT3 A;  2DE0 X;  2MCN A;  2YUQ A;  2FO0 A;  1Z9Q A;  2LCS A;  2AKK A;  3M0P A;  2CH4 W;  3QWX X;  1A0N B;  1OPK A;  4RTZ A;  5HCK A;  2HBW A;  4OMP A;  2KXD A;  1NEG A;  4A63 B;  2EGE A;  1H8K A;  2KYB A;  1K0X A;  1QLY A;  2J6K A;  4QT7 A;  2EVR A;  1BB9 A;  4R0K A;  2L0A A;  1NG2 A;  1T0H A;  1T3L A;  2K7A A;  1YP5 A;  2L3P A;  3VS6 A;  2ECZ A;  3EG1 A;  2BZY A;  1CKA A;  1GCQ A;  1UFF A;  2BZ8 A;  1GCP A;  2EGC A;  2HDA A;  1NLP C;  1YWO A;  1HSQ A;  1GBQ A;  2IIM A;  1E7O A;  3H0I A;  2VWF A;  2EQI A;  1ZUK A;  3H0H A;  3ZL7 C;  2A36 A;  2X3W D;  2O9V A;  4AFU C;  2PTK A;  4EIK A;  4JZ3 A;  2K2M A;  1S1N A;  2E5K A;  4J9G A;  1MV3 A;  1PKS A;  5GJW B;  4HCK A;  1K4U S;  2SEM A;  1X6G A;  4AFS C;  3GBQ A;  1M30 A;  3I5R A;  5FWC A;  3REB B;  1MV0 B;  2GBQ A;  5I11 A;  1SRL A;  1SHF A;  3UAT A;  2RF0 A;  1OPL A;  1ZUU A;  1WXB A;  3RNJ A;  1PRM C;  2KRM A;  4AG1 C;  1AVZ C;  5L23 A;  1WLP B;  3M0U A;  1M3B A;  3R6N A;  1X43 A;  4OMN A;  2J6F A;  1N5Z A;  2KE9 A;  4IIM A;  2KEA A;  2DL4 A;  1UDL A;  3SEM A;  1M8M A;  2YSQ A;  4LE9 A;  2LP5 A;  2RMO A;  1J3T A;  2FG0 A;  3QWY A;  1B07 A;  1EFN A;  4JJD A;  2W10 A;  1YCS B;  1WXT A;  4Z89 A;  4HXJ A;  1U5S A;  2DL8 A;  1FMK A;  1X2Q A;  2BTT A;  1SHG A;  2G6F X;  4ESR A;  1Y0M A;  2EBP A;  3M0Q A;  3KFV A;  1CSK A;  1M27 C;  1ZBJ A;  1KFZ A;  2GQI A;  1JEG A;  2QDL A;  3EG3 A;  1BU1 A;  2DBK A;  1NM7 A;  5I22 A;  2PZ1 A;  2F2X A;  2JTE A;  5FWB A;  4DEX A;  1FYN A;  3TVT A;  2YDL A;  2RN8 A;  1GBR A;  1AWO A;  2DL5 A;  1JQQ A;  2RNA A;  1I07 A;  2ED1 A;  4HVW A;  2GTJ A;  2J7I A;  4RTU A;  4F14 A;  2AZV A;  1ZX6 A;  4DEY A;  1K1Z A;  3U23 A;  2JT4 A;  2YUN A;  1UTI A;  2DYB A;  1PWT A;  2JS0 A;  2JM9 A;  4JJB A;  1GRI A;  1UHF A;  4OMQ A;  1W1F A;  2DX1 A;  4Y92 A;  3EG2 A;  2O31 A;  2RQV A;  4JZ4 A;  4RUG A;  2CSI A;  3M0S A;  2LJ3 A;  2KGT A;  2KT8 A;  2L2P A;  1X69 A;  1PRL C;  2M51 A;  1OEB A;  2AZS A;  1G83 A;  2C0T A;  4OMO A;  1HD3 A;  2K79 A;  2FPF A;  2FEI A;  1XOV A;  3THK A;  1WI7 A;  2KT1 A;  1UHC A;  2J06 A;  1B3Q A;  1SEM A;  1VYV A;  1CKB A;  1NLO C;  4RTW A;  1LCK A;  2X3X D;  2DRM A; 
#chains in the Genus database with same CATH topology
 3L2W A;  2P84 A;  4LDW A;  1QVF S;  1ZBX A;  4OGC A;  3LWI A;  1OUL A;  5HKC A;  5KYU A;  2JTF A;  3JRZ A;  4QQG A;  3FRN A;  2ZPB B;  1K76 A;  2MPX C;  1OX9 A;  4C8Q A;  2RI5 A;  3UPU A;  1G5V A;  2FRY A;  2QQ9 A;  3PMT A;  2CP2 A;  2DYI A;  3MKD A;  3OYI A;  5A0D A;  3FJ5 A;  2EYQ A;  3NMZ C;  2GFU A;  2JM8 A;  3M56 A;  3G71 A;  5LJ3 j;  3LH5 A;  1XJW B;  1VQ5 A;  1M4Z A;  2M02 A;  1VQM T;  1ZSG A;  4B9W A;  2RO0 A;  1YBY A;  1RAC B;  3CCJ T;  2DNU A;  2DAQ A;  2E64 A;  1OZ2 A;  1R0C B;  2CZ7 B;  1E6H A;  2DLP A;  3M57 A;  1W70 A;  3DKM A;  4J6Y A;  1LPL A;  4QVC A;  1UUE A;  2D8H A;  2FPD A;  4KRT A;  2MWP A;  5IHI A;  4RTT A;  4DOV A;  5KYW B;  4D8K A;  3CD6 A;  2CGH A;  1KD1 C;  1UE9 A;  2AT1 B;  3HFO A;  4J8O A;  1Q7Y R;  2JS2 A;  3JB9 F;  2P0P A;  3X28 B;  1K8A R;  1SSF A;  5LJ5 g;  4E2F B;  5KCH A;  2CKK A;  3UWN A;  1EZZ B;  4RTV A;  2IVW A;  2YUP A;  3OQ5 A;  1N8R U;  4TVR A;  2JXB A;  3RUX A;  4M4Z A;  1I0C A;  3ZEH A;  3CC7 A;  4JRK A;  4ZNX A;  2ROL A;  4QVZ A;  4PJO G;  4L6V 5;  2RJD A;  1N8R C;  4LNP A;  1M2V B;  1ZHI A;  2CS7 A;  2F5K A;  2L5Q A;  3TSZ A;  2RQU A;  4M75 G;  1JJ2 P;  1H3Z A;  1QKX A;  3CME T;  4IUR A;  5DLO A;  2ABL A;  3JCM c;  4NL2 A;  2KRO A;  2K9G A;  1M1K R;  2GTO A;  1M2V A;  2A08 A;  1W2B P;  3MEV A;  3UT1 A;  3NHN A;  4FYV B;  2CDT A;  1WNL A;  4PJO D;  5LJ3 h;  4QVD A;  2FVU A;  1G2B A;  4IIO A;  4PNO A;  2CZ0 B;  1YJ9 A;  3QYG B;  1X27 A;  2LX7 A;  1FXX A;  5IH2 A;  3HPW A;  1UJY A;  2QA4 A;  1VQ8 T;  4RKU E;  3INZ A;  2FL7 A;  2JJ9 A;  1PG5 B;  1YJ9 Q;  2V1R A;  1TUC A;  1TH7 A;  3C94 A;  3CPW S;  1S72 T;  4ZTF A;  2M1H A;  2KRN A;  4Q5W A;  3D7S B;  2BE7 D;  3CCV Q;  1JU5 C;  1V1C A;  1TS9 A;  2PNI A;  2ZGW A;  4K11 A;  3EH2 A;  1HJD A;  2GF7 A;  4FT4 A;  1BYM A;  3EGD A;  1QCN A;  4F7U G;  2QTX A;  1K73 R;  1Y71 A;  4OVA A;  3QPH A;  5IHK A;  1WX6 A;  3C95 A;  3CCE T;  1JXM A;  4OMM A;  2LC4 A;  4ELZ C;  4Z02 A;  2QEX Q;  4GLM A;  3RES A;  1FX7 A;  4AFZ C;  1Y7X A;  1VQL Q;  4II1 A;  2KQW A;  3CCM Q;  1HXD A;  3VKI A;  2GFA A;  2K57 A;  3QYH B;  2FHD A;  1UGP B;  4JJN K;  1YFN A;  3EFS A;  1YNZ A;  1PCX A;  2A7Y A;  4RTY A;  2VV5 A;  5FU7 B;  4C0D B;  1WYX A;  4X9C A;  2ZPE B;  1QMC A;  4J9H A;  1VQM A;  2WSE E;  1RAG B;  2D0N A;  3HKS A;  3P8B B;  2HZY A;  2XD0 A;  3PT9 A;  2KNB B;  2A28 A;  3CC4 T;  4RTX A;  5FW9 A;  1W2B A;  2KAF A;  1SF9 A;  1JXO A;  4E7L A;  3I5S A;  2DBM A;  5GMK l;  2QGF B;  2F2W A;  2JZ2 A;  3O8V A;  3VJP A;  3I55 A;  3VRY A;  4KUI A;  2JW4 A;  2PVG B;  3LYI A;  1VQ4 T;  1AOJ A;  2RPN A;  1TXQ A;  1QWF A;  2CUB A;  1VQ6 T;  2LTO A;  1IO6 A;  2MMP A;  5LJ3 d;  5KYY B;  2MOX A;  3PVL A;  2CT3 A;  2CP0 A;  4M77 B;  2FO0 A;  4RMO A;  2AKK A;  2CH4 W;  3GLX A;  1A0N B;  5HCK A;  1BKB A;  6AT1 B;  1NBE B;  5GAN 6;  2XHC A;  5KYY A;  4BE1 A;  1H8K A;  2KYB A;  3CXC S;  4PL6 A;  4M77 A;  1QLY A;  2EVR A;  1Q81 R;  1BB9 A;  1N27 A;  1NG2 A;  3CPF A;  1D3B B;  4QKU A;  1D1C A;  3EG9 B;  3R6O A;  1D09 B;  2DJZ A;  4FSX A;  4OB1 B;  1UFF A;  2EGC A;  3CC2 A;  2HNI A;  1YWO A;  4IUV A;  2DER A;  1GBQ A;  4OP0 A;  1D3B A;  1Y96 B;  2VAS A;  3EG9 A;  5CKB A;  4F04 B;  4IUQ A;  1I5L A;  3RDV A;  2M0O A;  3CC2 Q;  1EX4 A;  1YIJ Q;  4EIK A;  2K2M A;  3MP1 A;  2E5K A;  5FLX E;  1PKS A;  3RKW A;  2OTJ A;  3E1S A;  5CIU A;  1Y96 A;  4DBF A;  4M78 G;  3GNF B;  4C8Q G;  1M30 A;  3H9N A;  5FWC A;  2KMT A;  1X01 A;  4PJJ A;  3X24 B;  1SRL A;  4M7D C;  3QUI A;  2RF0 A;  1OPL A;  1BCO A;  1NZ9 A;  1Q86 U;  1PRM C;  4IKF A;  2R58 A;  2RD1 A;  1VQN A;  2KRM A;  4FW2 A;  2YLB A;  3M0U A;  3R6N A;  1S72 A;  4AT1 B;  2KE9 A;  2HQX A;  3MET A;  4M78 D;  3QO3 A;  3ER0 A;  1UDL A;  4JRQ A;  3SEM A;  1J3T A;  1BIB A;  4J6X A;  3CCL T;  2W10 A;  2XDP A;  4HXJ A;  1X2Q A;  1FMW A;  4A4F A;  2G6F X;  4ESR A;  3TCJ A;  1KFZ A;  4C92 A;  3CCE A;  1MMN A;  4FW1 A;  1TU0 B;  3OYG A;  4DA4 A;  4LDX A;  1PD1 A;  1I4K 1;  3OYD A;  3HTR A;  3LX7 A;  2YDL A;  2X35 A;  3URG A;  3OBY A;  4PJO F;  2DL5 A;  2P4T A;  2RNA A;  5CVI A;  2M9U A;  2QI2 A;  2H3J A;  1I07 A;  1D1B A;  4M75 F;  3JB9 D;  3S3O A;  2FYK A;  2JNG A;  3NTH A;  2GTJ A;  2J7I A;  4RTU A;  3CCU Q;  4BY6 B;  1QVP A;  3MEW A;  3T9N A;  1R77 A;  2DYB A;  4PJO E;  1UB4 A;  4OMQ A;  3QJY A;  1W1F A;  4N0A A;  4Y92 A;  2KI7 A;  2O31 A;  3EH1 A;  4M75 E;  5GAM f;  2KVQ G;  5KE2 A;  1YIT Q;  4J7F A;  1X69 A;  2M51 A;  2AZS A;  2C0T A;  3G71 T;  4E7J A;  1YHQ Q;  1B3Q A;  4R55 A;  1CKB A;  1NLO C;  2E6Z A;  2Z0W A;  1G8X A;  1Q82 R;  2DK3 A;  2JMC A;  2DVE A;  2DXT A;  2H3E B;  3OYY A;  2CP5 A;  4WCI A;  3CCS A;  5DM7 R;  1Y57 A;  2EW3 A;  3MHX A;  2E5Q A;  3VRZ A;  2YRC A;  4JRI A;  3JB9 I;  3I35 A;  1UJ0 A;  3KXT A;  1BBZ A;  1WJQ A;  4BB7 A;  2ROT A;  3TSW A;  1ZQ1 A;  5A0G A;  2LT1 A;  1RAH B;  1W2B S;  2HD0 A;  2AK5 A;  3PFS A;  3SHW A;  1NJI R;  3AHU A;  3QHS A;  3EG0 A;  1H64 1;  1OOT A;  2X4X A;  3QG1 A;  3I56 Q;  1H92 A;  2K5F A;  2XU8 A;  1GCQ C;  4E7K A;  1GL5 A;  2AKL A;  3NGP A;  3G1J A;  3LWH A;  4KGV B;  2XID A;  2BZX A;  3J81 E;  3CC7 T;  3NFC A;  2QDY B;  2LNH B;  1IXD A;  2X4J A;  4UC4 A;  1AT1 B;  2EWN A;  2PQW A;  4X9D A;  1YCY A;  2GCX A;  4C5G A;  1MMA A;  1ZA1 B;  4QQ6 A;  3NTK A;  3TU4 K;  4HT9 A;  2KRS A;  2GNC A;  3RBB B;  4XTV A;  3OSS C;  3H41 A;  4L5G A;  4M7A C;  4OB2 B;  2P0Q A;  4RG8 A;  3RMQ A;  1VQO Q;  3BY7 A;  4MZT A;  4ATO A;  1BIA A;  1V76 A;  3P8D A;  3FDR A;  1RAE B;  1YJ9 T;  2LCC A;  4EPC A;  2OI3 A;  1RLQ C;  1NYF A;  2K3Y A;  1QCF A;  4FSS A;  3WXM B;  4J9E A;  2CSQ A;  2GQV A;  2QA4 T;  1WGS A;  1BI1 A;  3WVD B;  2CYZ B;  1RL2 A;  5ECA A;  3TEE A;  3G4S A;  1QKW A;  2COZ A;  4C0D C;  5IXB A;  3QDR B;  2WSF E;  1JO8 A;  5EC7 A;  2D1X A;  2KXC A;  4M7D B;  5GAO m;  1D0X A;  1VQK Q;  2OAW A;  5CKE A;  5GAO q;  2M16 A;  5A0L A;  3ME9 A;  1X2K A;  1NYG A;  2RQR A;  5GMK j;  1ARK A;  4EDU A;  4M7D A;  2P0K A;  2VVK A;  5LJ5 e;  3QDF A;  4E47 A;  3CCM T;  1N9S A;  2D9T A;  1VQ9 Q;  2X4Y A;  5GAN 2;  2J6O A;  3JCM f;  4M77 G;  1M1G A;  2RQT A;  2O9S A;  4J9D A;  5LJ5 j;  4M78 F;  4M77 C;  4C8Q F;  4AFQ C;  2A37 A;  2RJE A;  1BI3 A;  4OF1 A;  2MYS A;  1AZE A;  5CQY A;  1KHC A;  1QCO A;  5GAN 4;  4CI0 C;  1OZ3 A;  3VS3 A;  5GAM g;  1RAD B;  4M78 E;  1U06 A;  3JV3 A;  4C8Q E;  2L8D A;  4AG2 C;  4E7S A;  3EFR A;  2VXE A;  3M4G A;  3VYG A;  2QQB A;  5D6Y A;  4XTY A;  2NYS A;  3X25 B;  1WHH A;  3GPL A;  3H0F A;  5C0M A;  1KQ2 A;  1KIK A;  5A2Q E;  5KE3 A;  1KD1 U;  1ABO A;  1QWE A;  2F1L A;  3AT1 B;  4MZM A;  3OYH A;  1AZG B;  3I55 T;  4HCC A;  2DZ9 A;  2SRC A;  3A8L B;  2DET A;  1XTD A;  3G6E Q;  2YRD A;  4BDZ A;  2VXF A;  5GAN e;  4VUB A;  4FM4 B;  1GFC A;  3RER A;  4HVV A;  5LL6 S;  3OYC A;  5GAO n;  3PE0 A;  2RK2 A;  5FRM A;  4JDS A;  3SDZ A;  3JB9 H;  2CH4 A;  2NWM A;  1D0Y A;  2DF6 A;  1M90 R;  3NTI A;  1RLP C;  1G3S A;  1YWP A;  2EAY A;  1U1S A;  2DD5 A;  2ZCF B;  4ZTJ A;  2RHX A;  1VQ7 Q;  1TWB A;  1M3C A;  1OV3 A;  1UGR B;  3OMC A;  3VS4 A;  3LW5 E;  5GMK h;  4LUE A;  2ESW A;  1Q95 G;  1K9A A;  3HFN A;  2LQW A;  2DEU A;  2EGA A;  2HQE A;  2BKD N;  1N6A A;  3CC2 T;  1VYU A;  3S6W A;  2PVD B;  2ZAE A;  2DXU A;  4C92 C;  2O88 A;  1F1B B;  1K8A U;  4XAX B;  1Z9Q A;  1Q7Y C;  2X4W A;  2XKO C;  1WZO A;  1NEG A;  4FYW B;  3CCR A;  3DB3 A;  5LJ5 h;  1K8A C;  2OTJ T;  2RK1 A;  4M75 D;  5KYN A;  2DTO A;  3CCR Q;  1MMD A;  3PTA A;  3EAE A;  2JTM A;  5GAN 7;  2VGM A;  2JOY A;  5GAN g;  5GAN 8;  2ZPF B;  4ZGE B;  1VQN T;  2E12 A;  1WQ7 A;  3CCV A;  4E7I A;  2BZ8 A;  1GCQ A;  4N0A C;  1GCP A;  1NLP C;  2E65 A;  1HSQ A;  3M53 A;  4BY6 C;  2IIM A;  4EMH A;  3EGD B;  1M1K U;  1YI2 Q;  2VWF A;  3H0H A;  1AHJ B;  3ZL7 C;  2O9V A;  3FIF A;  1FMV A;  4JZ3 A;  1M1K C;  2QEX A;  4M7A B;  1X6G A;  3GBQ A;  3PIP A;  1VQL A;  3CCM A;  5I2M A;  3E19 A;  4Y91 A;  5GAO p;  3PNW C;  3RNJ A;  4M7A A;  3QXE B;  5D6X A;  2LDM A;  4AG1 C;  1MGQ A;  2XI9 A;  4J7I A;  4OMN A;  1UGS B;  5EG2 A;  3FB9 A;  4IIM A;  3MJX A;  3DLL A;  1KQ1 A;  2O4X B;  3S3N A;  2KY9 A;  4LE9 A;  3QKJ A;  3QWY A;  3JCM g;  3QZ5 B;  3FJP A;  5CK9 A;  1YCS B;  5J3B A;  2BIV A;  2HSE B;  4Z89 A;  4DBR A;  1U5S A;  7AT1 B;  1FMK A;  2O4X A;  3RR6 A;  1K73 U;  4KH1 B;  3KFV A;  1YHQ T;  3A8M B;  2CP3 A;  3OS2 A;  1K73 C;  5I22 A;  2PZ1 A;  4ZN1 A;  3BFM A;  2F2X A;  2JTE A;  5FWB A;  1RI0 A;  1VUB A;  4DBH A;  4OMF B;  1JQQ A;  5DY9 A;  3DLM A;  3L42 A;  3DB4 A;  5LJ5 d;  5FRN A;  4LDY A;  3CCS T;  2HL3 A;  4HVW A;  4F14 A;  4PK4 A;  4XTU A;  3CCQ A;  5I21 A;  2EFI A;  1PWT A;  2JM9 A;  1GRI A;  1SG5 A;  4PKC C;  2DX1 A;  2HKN A;  4BAC A;  3EG2 A;  2NUP A;  4JZ4 A;  4RUG A;  3HRT A;  2CSI A;  1D1A A;  2LJ3 A;  2NLU A;  2KGT A;  4MDX A;  5HY6 A;  3CCQ Q;  4NL3 A;  1XNI A;  2QYZ A;  2FEI A;  2HMA A;  2KT1 A;  1UHC A;  2CZ1 B;  2J06 A;  1SEM A;  3OYA A;  2DFU A;  4R56 A;  1GFD A;  4FYX B;  1YIJ A;  4BI3 A;  3JCM Q;  1WA7 A;  2K3B A;  2MAM A;  2RI3 A;  4JLI A;  2DKG A;  5CAI A;  3MEA A;  3I9Q A;  2CT4 A;  3EFO B;  4C5I A;  4PFZ A;  2Y4Y A;  4NOY A;  1ZUY A;  4JRP A;  1Q86 R;  1LOJ A;  4M7D G;  1VYT A;  1I81 A;  1UG1 A;  1Q81 U;  2P4R A;  2QTV A;  1SSH A;  3EFO A;  3OS5 A;  2EYY A;  2D8J A;  2HAX A;  8ATC B;  1UGV A;  2O01 E;  2DJQ A;  2QQR A;  4C0G A;  3E9G A;  1Q81 C;  5I2S A;  4C0Z A;  3OYF A;  3M0T A;  2CRE A;  3SD4 A;  1QW1 A;  1RUW A;  3LGL A;  2RA2 A;  2AHJ B;  3OSV A;  4FCY A;  2A0F B;  3CMA A;  4PLI A;  4C8Q D;  1T0J A;  5C6S A;  3VS1 A;  2XMF A;  1WDX A;  4C92 B;  1C6V X;  4J6W A;  2HSP A;  4BE2 A;  2DM1 A;  3CMA Q;  4Z8A A;  4EMG A;  1QVF A;  2FZG B;  3PVQ A;  2LVM A;  2OTL A;  4IUT A;  3G4S T;  1VQ8 Q;  4KUD K;  1KC8 R;  2L3Q A;  3L2R A;  1U3O A;  1VIE A;  3ZFJ A;  3REA B;  8AT1 B;  2OTL Q;  3EHQ A;  1H3H A;  3CCU A;  4KBM B;  1YJW Q;  5KH6 A;  2K4Y A;  2B86 A;  4N4G A;  2VGN A;  2KDS A;  4PJO A;  1O75 A;  3C0C A;  3OS1 A;  1YIT A;  2EIF A;  1E6G A;  3VYH B;  2YUO A;  1VQP Q;  2DIG A;  4ZGJ B;  2MIO A;  4O5V A;  1K9M R;  2K6D A;  4XK8 E;  1G3Y A;  2CUD A;  1YHQ A;  2K5I A;  2JMA A;  4CRI A;  4CC2 A;  2DEQ A;  2C0I A;  2DVJ A;  2LZ6 B;  3C4S A;  3MP8 A;  1WPY A;  3VS7 A;  2YT6 A;  3EHR A;  1JBM A;  2QAZ A;  5IXF A;  4JJC A;  2DIQ A;  2EYW A;  2I0N A;  1Y07 A;  2LQN A;  3SFM A;  4AMC A;  1EIF A;  1WHG A;  2BUD A;  3G6E T;  2OJ2 A;  2RI2 A;  4LN2 A;  2DRK A;  1M5Q 1;  5GAO r;  1UGQ B;  3CBP A;  4C0F A;  1KG1 A;  5IHN A;  4DBQ A;  1ACM B;  1QP3 A;  2LT4 A;  2MK5 A;  2E70 A;  2QQS A;  1LJO A;  3ASK A;  3JCM W;  4XTX A;  4F7U F;  4E7Z A;  3I56 A;  1VQ4 Q;  2DL7 A;  3V7R A;  2DL3 A;  1ZA2 B;  2ENM A;  2PUO B;  2RHU A;  1VQ6 Q;  2RJC A;  3L2Q A;  1Q82 U;  2EJG A;  2RHI A;  2R57 A;  4F17 A;  4F7U E;  3MEU A;  5LJ3 f;  2DTI A;  2J05 A;  3E9F A;  1UEB A;  5FU6 B;  2LJ1 A;  4J83 A;  1Q82 C;  4XU0 A;  2HEQ A;  4PFO A;  2FB7 A;  1KHI A;  2RB6 A;  4A4G A;  2IPO B;  1B34 B;  2F2V A;  3PMI A;  5J26 A;  3VS0 A;  3LGF A;  4J9B A;  4OML A;  2DXC A;  4JPB W;  3ULR B;  1MHN A;  1NJI U;  4M7A G;  2FRW A;  2KSS A;  2RQW A;  1AEY A;  1VQO A;  1IHV A;  1B34 A;  5L8R E;  4CC4 B;  2VC8 A;  4IUU A;  3A8O B;  3CCR T;  1NJI C;  4FT2 A;  5HK0 A;  5M9O A;  4CC3 A;  2EYX A;  1MMG A;  4KUL A;  1OYX A;  1I1J A;  2XG8 D;  1TUD A;  5GAM e;  5GJV B;  4LD9 K;  1HYO A;  1ABQ A;  4LDU A;  1NE8 A;  4XTW A;  3A1P A;  2MF2 A;  1AD5 A;  1T3S A;  3GNG A;  2MI6 A;  3CCV T;  3JCM b;  2A3L A;  1BCM A;  2LJ0 A;  1VQK A;  1X6B A;  4HCB A;  2CZ6 B;  5AT1 B;  1RAI B;  3A5Z B;  1BK2 A;  5GAM j;  3HRS A;  2MCN A;  2DE0 X;  3V8J A;  2YUQ A;  3A8G B;  2LCS A;  1PM3 A;  3QWX X;  1QVG A;  1OPK A;  4RTZ A;  2HBW A;  4OMP A;  2KXD A;  4XU1 A;  1DJ7 B;  5D6W A;  2PU9 B;  1G3T A;  5CCA A;  2QEX T;  3CCL Q;  2EGE A;  1VQ9 A;  2J6K A;  3H8Z A;  2V8K A;  1M8V A;  4QQD A;  1VQL T;  3S3M A;  4R0K A;  3QSU A;  1LNX A;  2K7A A;  2LQ8 A;  1YJN Q;  2L3P A;  2PUK B;  4Y28 E;  4BDY A;  4M78 B;  4EMK C;  3EG1 A;  1IRX A;  2BZY A;  2QXF A;  2VB6 A;  4B9X A;  3M4Y A;  2HDA A;  1M2O A;  1X75 C;  4M7D F;  2WSC E;  2RHY A;  4ZN3 A;  3H0I A;  3J80 E;  2ZPH B;  1ZUK A;  4JLG A;  4M78 A;  5LJ3 e;  2X3W D;  4DQ2 A;  4B6M A;  4M7D E;  2DZC A;  1KD1 R;  4J9G A;  4M77 D;  5GJW B;  1MNE A;  4HCK A;  1PSF A;  4HCZ A;  4OB0 B;  1QP2 A;  2G3R A;  4BE0 A;  5I11 A;  4WTO B;  3UAT A;  3WVE B;  2XDB A;  2OX7 A;  1ZUU A;  3G6E A;  1WXB A;  3RIR A;  2EQM A;  2V8J A;  5FRO A;  3M55 A;  3G71 Q;  3CXC A;  2DO3 A;  1M3B A;  3BDL A;  2J6F A;  1VQ5 Q;  1N5Z A;  2ZPI B;  2VYT A;  2DL4 A;  4DOW A;  1WHJ A;  1M8M A;  1VIF A;  1WJR A;  2RMO A;  5CR2 A;  1N8R R;  1EFN A;  3HL8 A;  3CCQ T;  2YHT A;  4HT8 A;  4A4H A;  2L89 A;  1WHK A;  2DL8 A;  4HKE A;  1SHG A;  5GAM h;  2EBP A;  1VQ7 A;  3HRU A;  5GAN j;  1NPR A;  1JEG A;  2QDL A;  3EG3 A;  4XTZ A;  4MMK A;  2DBK A;  3OYL A;  4ELY C;  1FWZ A;  4GY5 A;  4DEX A;  4V2S A;  1OU8 A;  3CD6 Q;  5KYW A;  1FYN A;  3TVT A;  2NUT B;  4C92 G;  5LJ3 g;  2RN8 A;  1Q7Y U;  1JRI A;  2EQK A;  3GIB A;  1I8F A;  1RAA B;  5GAO l;  1YIJ T;  4JS5 A;  2E3H A;  2ED1 A;  4O6J A;  2NUT A;  2AZV A;  3RKY A;  5KCO A;  2JT4 A;  2YUN A;  1UTI A;  4X34 A;  2FZK B;  2JS0 A;  3CEY A;  3ZBD A;  1M90 U;  1O9S A;  2RQV A;  4C92 D;  4OB3 B;  5GMK m;  4A4E A;  2L2P A;  1LVK A;  3JCM e;  1PRL C;  4OMO A;  1OEB A;  1HD3 A;  4PJO C;  1WHM A;  3CC7 Q;  2FPF A;  1M90 C;  2CP6 A;  3JSC A;  3Q1J A;  3THK A;  1G3W A;  1WI7 A;  4M75 C;  3L2U A;  1KQS P;  3GOX A;  4RTW A;  1LCK A;  1BI2 A;  2X3X D;  3VU3 C;  1YI2 A;  3QJ6 A;  2DRM A;  1X6O A;  4FL6 A;  1OU9 A;  2DA9 A;  2Y4X A;  1IHW A;  3M58 A;  3CMA T;  1HK9 A;  2LX9 A;  2IG0 A;  3A8H B;  3M54 A;  2DXB A;  2E4H A;  2EQU A;  3OYM A;  3MO8 A;  9ATC B;  2KR3 A;  1PD0 A;  1M1F A;  2K2V A;  1AWW A;  2WAC A;  4E6R A;  1MUZ A;  3EGX B;  2CP7 A;  2JUF A;  5CQX A;  4MZP A;  5CKD A;  3KUF A;  3JCM P;  1M3A A;  3OA6 A;  2OTL T;  4MML A;  1YJW T;  4J9I A;  1U8R A;  2QA4 Q;  3EGX A;  3EGU A;  3E2U A;  3N5B B;  2XDD A;  3CBM A;  3VUB A;  2C0O A;  3VS5 A;  3CCU T;  3OYJ A;  5GAN h;  3HHT B;  3M9Q A;  4C5E A;  1VA7 A;  1TSF A;  1WIE A;  1ZLM A;  1BI0 A;  5CO7 A;  5GAM d;  1VQP T;  2ED0 A;  3SWN C;  4Z88 A;  4M7A F;  4FYY B;  1PHT A;  2E10 A;  3QII A;  1PKT A;  1YIT T;  5D7U A;  1QVG S;  1NEB A;  2LNV A;  4M7A E;  1V29 B;  4HVU A;  3OW2 P;  3O5Z A;  1IGU A;  1IGQ A;  3UA6 A;  1W6X A;  3L2V A;  2EKH A;  2LMJ A;  2MWO A;  4MDW A;  1TOV A;  1ZSZ C;  3NPF A;  2D0Q B;  1JJ2 A;  2L3S A;  1Z9Z A;  4X1V A;  5FU6 C;  1TTH B;  4EMK B;  2ZZD A;  3IQL A;  1TG0 A;  1VQM Q;  3CCJ A;  1KQS A;  3QBY A;  3MCA B;  3HSB A;  2NUP B;  3CQT A;  4PFP A;  1QVF P;  4LUD A;  1KSW A;  3M0R A;  4JUV A;  4WF2 A;  1SKU B;  1C0M A;  4XU2 A;  2DIL A;  4EMK A;  3JCM h;  3CCJ Q;  3SB2 A;  1WXU A;  4D8D A;  2HCK A;  3JB9 J;  1RI9 A;  3PIO A;  5IT9 E;  4KH0 B;  3V8K A;  3I55 Q;  2F5T X;  3JCM V;  2EPD A;  3I56 T;  2YRV A;  1AWJ A;  4ORZ A;  2RH2 A;  4IUP A;  4BI4 A;  4A4K A;  2NUZ A;  4XU3 A;  4M77 F;  2DD4 A;  3OB9 A;  2QK0 A;  2GGR A;  2PVO B;  4LDV A;  3OS0 A;  2EYZ A;  2EJ9 A;  1R8O B;  4RG2 A;  3OYN A;  3UF4 A;  3VS2 A;  4PLL A;  1WQW A;  3GF5 A;  2YXY A;  4J9F A;  4M77 E;  2FPE A;  1OI1 A;  2I2L A;  4LXC A;  1KJW A;  1PC0 A;  1WFW A;  2COW A;  5GAN d;  3CME A;  1YN8 A;  3A98 A;  3KBG A;  3F70 A;  1WJS A;  3MP6 A;  2AIR B;  2KBT A;  3OW2 A;  1VQO T;  3LH0 A;  3OYE A;  2QGG A;  3CME Q;  2K5L A;  4KT0 E;  5CKH A;  4M7D D;  1N9R A;  1OX8 A;  2V1Q A;  1R0B G;  4ZGD B;  2VUB A;  3J7A F;  2ATC B;  2OTJ Q;  4M78 C;  4N4H A;  2K3X A;  4C8Q C;  4J9C A;  2R5A A;  3C12 A;  1VQ8 A;  1UEC A;  2E41 A;  2VKN A;  1IB8 A;  3UA7 A;  4CC7 A;  3M5A A;  4GBQ A;  2M0Y A;  1Q86 C;  5GMK i;  1VQK T;  4A54 A;  1YJW A;  1VQN Q;  4PJO B;  4A53 A;  4KGX B;  2W0Z A;  1S72 Q;  2LQK A;  5J39 A;  5AYF A;  2RJF A;  4M75 B;  2XK0 A;  4C92 F;  3JCM d;  1VQ9 T;  3JB9 G;  1VQP A;  1YJN T;  1SPK A;  5CKF A;  3LLR A;  3TQ7 P;  2X51 A;  3RMS A;  4M75 A;  3GP8 A;  4P5N A;  3M59 A;  4C92 E;  1D0Z A;  1K0S A;  1PSE A;  1W4S A;  2O2O A;  3P8H A;  4F16 A;  3CCE Q;  2KYM A;  3FC3 A;  2KK4 A;  4C5H A;  1AWX A;  2HKQ B;  2DMO A;  1KC8 U;  2H8H A;  2HL5 C;  4ANJ A;  3TRE A;  1PNJ A;  1SRM A;  4PJL A;  3V7C A;  3CPW P;  2E6N A;  1U1T A;  3M0P A;  5IN1 A;  4QW2 A;  2LRQ A;  1KC8 C;  2YLC A;  4A63 B;  4OGE A;  3VV0 A;  3MPU B;  3CC4 A;  1K0X A;  2LCL A;  2EKO A;  4QT7 A;  4YTL A;  4BUG A;  1VOM A;  2L0A A;  3OY9 A;  1T0H A;  1T3L A;  1VQ5 T;  5GAN 5;  3CC4 Q;  3SWN B;  1K9M U;  1P92 A;  1YP5 A;  3UDC A;  3VS6 A;  3L1A A;  1VQ4 A;  2COY A;  4F7U B;  2ECZ A;  3JAM E;  1I5O B;  5KYX B;  1CKA A;  2QAS A;  3OYK A;  1VQ6 A;  1OQK A;  1QVG P;  2RHZ A;  1K9M C;  3SWN A;  4E7H A;  5IAY A;  1E7O A;  2EQI A;  2A36 A;  4F7U A;  1KK7 A;  3BE3 A;  5KYX A;  1M9S A;  3PGG A;  4AFU C;  2PTK A;  1XQH A;  3CBO A;  3BW1 A;  4PJM A;  3VUZ A;  1S1N A;  3CCS Q;  5LJ5 f;  1ZSZ B;  1JJ2 S;  1MV3 A;  4GLK A;  1K4U S;  2SEM A;  4AFS C;  1VQ7 T;  1WHL A;  3JCM J;  3CD6 T;  3I5R A;  3REB B;  1MV0 B;  2GBQ A;  1KQS S;  1NPP A;  1SHF A;  2ZPG B;  3QZ9 B;  3G7Z A;  1ZSZ A;  2QQA A;  2JVV A;  2F69 A;  1IZ6 A;  1AVZ C;  5L23 A;  1WLP B;  4N4I A;  2HQH A;  5DLQ E;  1X43 A;  1MND A;  4FIB A;  4L59 A;  2JN0 A;  2XIC A;  2FZC B;  2KEA A;  4BI8 B;  2YSQ A;  2LP5 A;  3FEO A;  1RAF B;  2FG0 A;  3RKX A;  4JS4 A;  1B07 A;  2QG9 B;  1B7T A;  4JJD A;  4J5Y A;  3V8L A;  2EQJ A;  1WXT A;  2R5M A;  2L3R A;  2BTT A;  3BDU A;  3CPW A;  2OAU A;  1Y0M A;  3M0Q A;  1CSK A;  1QQJ A;  5HK3 A;  1M27 C;  1ZBJ A;  2DTH A;  2D6F A;  2GQI A;  2DPP B;  2E1H A;  1TUG B;  2C06 A;  1JB0 E;  1BU1 A;  1RAB B;  3CXC P;  4M7A D;  1NM7 A;  3HP9 A;  2YWW A;  1C1A A;  3X26 B;  4RCC A;  1YI2 T;  1GXI E;  5GAN f;  1GBR A;  3X20 B;  1AWO A;  3OMG A;  1IRE B;  3L2Z A;  3FLG A;  2X9H A;  4XQ3 A;  2EJF A;  2RM4 A;  4D6W A;  2HBP A;  4PJN A;  4KGZ B;  4RCB A;  4BD3 A;  5GAN 3;  3CCL A;  1ZX6 A;  4DEY A;  1K1Z A;  3U23 A;  3H6Z A;  4JJB A;  3OW2 S;  1UHF A;  4HA8 A;  2V26 A;  4FU6 A;  3M0S A;  1YJN A;  2KT8 A;  2Y90 A;  5GMK e;  4NS5 A;  5FU7 C;  1G83 A;  4ME7 A;  3OBW A;  3JCM X;  2K79 A;  2B8A A;  3V7S A;  1XOV A;  5KYU B;  2V8I A;  3OYB A;  1VYV A;  2BE9 B;  4LD6 A;  3G4S Q;  2E3I A;  4C8Q B; 
#chains in the Genus database with same CATH homology
 1GFD A;  2JMC A;  2DA9 A;  1WA7 A;  2K3B A;  4WCI A;  1Y57 A;  2EW3 A;  3I9Q A;  2CT4 A;  1K76 A;  3VRZ A;  3I35 A;  2FRY A;  1ZUY A;  2KR3 A;  1AWW A;  1UJ0 A;  4E6R A;  1BBZ A;  1MUZ A;  1VYT A;  1UG1 A;  2ROT A;  3TSW A;  2P4R A;  1M3A A;  1SSH A;  3FJ5 A;  3NMZ C;  2EYY A;  2D8J A;  2JM8 A;  4J9I A;  2AK5 A;  3LH5 A;  1UGV A;  2DJQ A;  3SHW A;  3EGU A;  1ZSG A;  3EG0 A;  3M0T A;  2CRE A;  1OOT A;  2C0O A;  3VS5 A;  1H92 A;  1VA7 A;  1RUW A;  1GCQ C;  1WIE A;  1ZLM A;  1GL5 A;  2AKL A;  1T0J A;  3NGP A;  2DNU A;  2ED0 A;  3VS1 A;  2XMF A;  4Z88 A;  1PHT A;  1E6H A;  2DLP A;  1W70 A;  1PKT A;  1WDX A;  1UUE A;  2BZX A;  2D8H A;  2HSP A;  2DM1 A;  2FPD A;  1NEB A;  4KRT A;  4Z8A A;  2LNH B;  5IHI A;  3PVQ A;  4RTT A;  4HVU A;  4D8K A;  3O5Z A;  3UA6 A;  1W6X A;  1UE9 A;  2JS2 A;  2EKH A;  2LMJ A;  2L3Q A;  2KRS A;  1U3O A;  2GNC A;  3RBB B;  3NPF A;  3REA B;  3H41 A;  3EHQ A;  2L3S A;  1H3H A;  1Z9Z A;  4X1V A;  2B86 A;  3IQL A;  4RTV A;  1TG0 A;  2YUP A;  3C0C A;  3CQT A;  2OI3 A;  2JXB A;  4LUD A;  1RLQ C;  1NYF A;  1QCF A;  4M4Z A;  1KSW A;  4FSS A;  1E6G A;  3M0R A;  1I0C A;  2DIL A;  2YUO A;  4J9E A;  4ZNX A;  2ROL A;  2MIO A;  2CSQ A;  2K6D A;  4LNP A;  2CUD A;  3TSZ A;  1WXU A;  2JMA A;  2RQU A;  4D8D A;  2HCK A;  5ECA A;  1RI9 A;  1QKW A;  4CC2 A;  1QKX A;  5IXB A;  2ABL A;  2EPD A;  2C0I A;  1JO8 A;  1AWJ A;  2DVJ A;  2KRO A;  2LZ6 B;  2K9G A;  4ORZ A;  5EC7 A;  2D1X A;  2KXC A;  2GTO A;  2A08 A;  2OAW A;  3VS7 A;  2YT6 A;  2NUZ A;  3NHN A;  1X2K A;  3EHR A;  2CDT A;  1NYG A;  2RQR A;  5IXF A;  2GGR A;  4JJC A;  2EYZ A;  2EYW A;  3UF4 A;  1ARK A;  3VS2 A;  2I0N A;  1G2B A;  4IIO A;  2LQN A;  2VVK A;  4J9F A;  1X27 A;  2LX7 A;  2OJ2 A;  5IH2 A;  4LN2 A;  2DRK A;  1UJY A;  2FPE A;  2J6O A;  5IHN A;  1KJW A;  1WFW A;  1TUC A;  2RQT A;  2V1R A;  2O9S A;  4J9D A;  1YN8 A;  3A98 A;  4AFQ C;  2A37 A;  2DL7 A;  2KRN A;  2DL3 A;  2KBT A;  2ENM A;  1JU5 C;  1AZE A;  1V1C A;  2PNI A;  4K11 A;  1HJD A;  3VS3 A;  4F17 A;  1U06 A;  3JV3 A;  4AG2 C;  2J05 A;  2V1Q A;  2LJ1 A;  5IHK A;  1WX6 A;  1JXM A;  4OMM A;  3H0F A;  2HEQ A;  1KIK A;  4GLM A;  4AFZ C;  1ABO A;  1QWE A;  4J9C A;  1UEC A;  1AZG B;  2VKN A;  2SRC A;  3UA7 A;  2F2V A;  3VS0 A;  4CC7 A;  4GBQ A;  2M0Y A;  4J9B A;  4OML A;  1YNZ A;  4JPB W;  3ULR B;  2FRW A;  4RTY A;  2RQW A;  1AEY A;  1GFC A;  1WYX A;  4J9H A;  4HVV A;  2W0Z A;  2D0N A;  4CC4 B;  3PE0 A;  2CH4 A;  2KNB B;  2NWM A;  2A28 A;  4RTX A;  5FW9 A;  4CC3 A;  2DF6 A;  2EYX A;  1RLP C;  1SPK A;  1I1J A;  1YWP A;  1JXO A;  1TUD A;  5GJV B;  1ABQ A;  3I5S A;  2DBM A;  2F2W A;  1M3C A;  1OV3 A;  1K0S A;  3VS4 A;  3VRY A;  2JW4 A;  2O2O A;  4F16 A;  4LUE A;  1AD5 A;  2ESW A;  2KYM A;  1AOJ A;  1K9A A;  1T3S A;  2LQW A;  2RPN A;  1AWX A;  2EGA A;  1QWF A;  2DMO A;  2CUB A;  2LJ0 A;  2H8H A;  1X6B A;  1IO6 A;  1VYU A;  1BK2 A;  2O88 A;  1PNJ A;  2MOX A;  3PVL A;  1SRM A;  2CT3 A;  2DE0 X;  2MCN A;  2YUQ A;  2FO0 A;  1Z9Q A;  2LCS A;  2AKK A;  3M0P A;  2CH4 W;  3QWX X;  1A0N B;  1OPK A;  4RTZ A;  5HCK A;  2HBW A;  4OMP A;  2KXD A;  1NEG A;  4A63 B;  2EGE A;  1H8K A;  2KYB A;  1K0X A;  1QLY A;  2J6K A;  4QT7 A;  2EVR A;  1BB9 A;  4R0K A;  2L0A A;  1NG2 A;  1T0H A;  1T3L A;  2K7A A;  1YP5 A;  2L3P A;  3VS6 A;  2ECZ A;  3EG1 A;  2BZY A;  1CKA A;  1GCQ A;  1UFF A;  2BZ8 A;  1GCP A;  2EGC A;  2HDA A;  1NLP C;  1YWO A;  1HSQ A;  1GBQ A;  2IIM A;  1E7O A;  3H0I A;  2VWF A;  2EQI A;  1ZUK A;  3H0H A;  3ZL7 C;  2A36 A;  2X3W D;  2O9V A;  4AFU C;  2PTK A;  4EIK A;  4JZ3 A;  2K2M A;  1S1N A;  2E5K A;  4J9G A;  1MV3 A;  1PKS A;  5GJW B;  4HCK A;  1K4U S;  2SEM A;  1X6G A;  4AFS C;  3GBQ A;  1M30 A;  3I5R A;  5FWC A;  3REB B;  1MV0 B;  2GBQ A;  5I11 A;  1SRL A;  1SHF A;  3UAT A;  2RF0 A;  1OPL A;  1ZUU A;  1WXB A;  3RNJ A;  1PRM C;  2KRM A;  4AG1 C;  1AVZ C;  5L23 A;  1WLP B;  3M0U A;  1M3B A;  3R6N A;  1X43 A;  4OMN A;  2J6F A;  1N5Z A;  2KE9 A;  4IIM A;  2KEA A;  2DL4 A;  1UDL A;  3SEM A;  1M8M A;  2YSQ A;  4LE9 A;  2LP5 A;  2RMO A;  1J3T A;  2FG0 A;  3QWY A;  1B07 A;  1EFN A;  4JJD A;  2W10 A;  1YCS B;  1WXT A;  4Z89 A;  4HXJ A;  1U5S A;  2DL8 A;  1FMK A;  1X2Q A;  2BTT A;  1SHG A;  2G6F X;  4ESR A;  1Y0M A;  2EBP A;  3M0Q A;  3KFV A;  1CSK A;  1M27 C;  1ZBJ A;  1KFZ A;  2GQI A;  1JEG A;  2QDL A;  3EG3 A;  1BU1 A;  2DBK A;  1NM7 A;  5I22 A;  2PZ1 A;  2F2X A;  2JTE A;  5FWB A;  4DEX A;  1FYN A;  3TVT A;  2YDL A;  2RN8 A;  1GBR A;  1AWO A;  2DL5 A;  1JQQ A;  2RNA A;  1I07 A;  2ED1 A;  4HVW A;  2GTJ A;  2J7I A;  4RTU A;  4F14 A;  2AZV A;  1ZX6 A;  4DEY A;  1K1Z A;  3U23 A;  2JT4 A;  2YUN A;  1UTI A;  2DYB A;  1PWT A;  2JS0 A;  2JM9 A;  4JJB A;  1GRI A;  1UHF A;  4OMQ A;  1W1F A;  2DX1 A;  4Y92 A;  3EG2 A;  2O31 A;  2RQV A;  4JZ4 A;  4RUG A;  2CSI A;  3M0S A;  2LJ3 A;  2KGT A;  2KT8 A;  2L2P A;  1X69 A;  1PRL C;  2M51 A;  1OEB A;  2AZS A;  1G83 A;  2C0T A;  4OMO A;  1HD3 A;  2K79 A;  2FPF A;  2FEI A;  1XOV A;  3THK A;  1WI7 A;  2KT1 A;  1UHC A;  2J06 A;  1B3Q A;  1SEM A;  1VYV A;  1CKB A;  1NLO C;  4RTW A;  1LCK A;  2X3X D;  2DRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...