3EG3A

Crystal structure of the n114a mutant of abl-sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
b'MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
molecule tags Transferase
source organism Homo sapiens
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
total genus 12
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg3A00
5I11A 2VWFA 4IIOA 2FEIA 5IHKA 2DYBA 4OMOA 4JJCA 4JPBW 1PRLC 2DX1A 1AWJA 1VYUA 4F17A 1WX6A 2SRCA 1NEGA 4J9DA 4RTVA 2KXDA 5HCKA 1ARKA 1WFWA 2DBKA 2B86A 2KRSA 1KFZA 2RMOA 3A98A 2KYMA 1ZX6A 1IO6A 1UJ0A 3UF4A 4OMNA 2O9VA 2PTKA 2FRYA 2HDAA 1SEMA 1YN8A 4Y92A 1UUEA 1MV3A 1E7OA 2AKKA 4HVUA 2J6OA 1Y57A 2RN8A 1TUDA 4GBQA 1GBRA 1M3BA 2DA9A 1OV3A 1UTIA 2EYZA 3VS5A 2DILA 2LJ1A 2PZ1A 3NGPA 1CKBA 1QWFA 1RLPC 2A08A 2J06A 2ROLA 3VS3A 3GBQA 3M0QA 1I07A 3VS6A 2RNAA 3ZL7C 2L3QA 2HEQA 2L0AA 4JJDA 2LCSA 2V1QA 4HVVA 4AFQC 4AFSC 2BZ8A 1NYGA 2JXBA 2LQNA 2LNHB 2A28A 1TUCA 3NMZC 1UHCA 2RQTA 2VKNA 2K7AA 2PNIA 2O2OA 1KJWA 1S1NA 1CKAA 1TG0A 1NYFA 2V1RA 3UA7A 2EYWA 1Z9ZA 1ZBJA 5L23A 2LZ6B 4D8DA 2BZYA 2DMOA 3RBBB 2GBQA 4LN2A 3TSWA 1X69A 1HJDA 1I0CA 2GNCA 2EPDA 1BBZA 4J9HA 1ZUKA 1K76A 1VYTA 2ESWA 2NUZA 1W6XA 1HD3A 3EG1A 2AZSA 2E5KA 1N5ZA 4K11A 4RTTA 4DEXA 2EGEA 2YDLA 2YUQA 1BB9A 4D8KA 2YUNA 1GRIA 2P4RA 4CC4B 2J05A 4CC2A 4HXJA 3M0TA 4ZNXA 2KE9A 3M0RA 1RUWA 1UJYA 1E6GA 1CSKA 1NLPC 4LUEA 1PRMC 2CH4W 1GBQA 2EVRA 2LP5A 2O31A 1NLOC 2DL3A 4AG1C 2L2PA 2OJ2A 3M0UA 4Z88A 1H3HA 1GFCA 4AFZC 4F14A 1SPKA 2JS0A 2I0NA 2KEAA 1H92A 5FWCA 3I35A 4RTUA 1AWXA 5GJVB 5IH2A 2EYYA 3KFVA 1G83A 1GCQC 2JMAA 1GCPA 2G6FX 1AWOA 5ECAA 2RQUA 4DEYA 5IHIA 4E6RA 2HBWA 1KIKA 2FPDA 1QCFA 1AZEA 1WXBA 1YCSB 3TVTA 1GCQA 2FPEA 2K2MA 1JQQA 2F2WA 3NHNA 1KSWA 4R0KA 3SEMA 1WXUA 3TSZA 1LCKA 1T0HA 4CC7A 4HVWA 2QDLA 1SSHA 3H41A 2DLPA 3VRYA 2C0OA 1JXOA 2RF0A 2KGTA 1WLPB 4ESRA 3C0CA 4J9EA 3SHWA 2AZVA 2ECZA 1U5SA 5IXBA 4M4ZA 1ZLMA 4Z8AA 4J9FA 1RI9A 2CSIA 3H0HA 1Z9QA 2DL5A 2CSQA 1U06A 2YSQA 3EHRA 3UATA 2D1XA 2KROA 2BTTA 4F16A 1H8KA 1JXMA 2CT3A 2C0IA 1AVZC 2KRMA 3PVLA 2EKHA 2ED0A 2DJQA 2X3WD 4J9BA 1WA7A 4OMQA 4A63B 2GQIA 1B07A 2D0NA 1JEGA 2YUPA 3H0IA 3U23A 1B3QA 4RTZA 1UFFA 2C0TA 3EGUA 1OOTA 1K1ZA 2M0YA 2JM9A 1Y0MA 2JS2A 3VRZA 1ZUYA 4EIKA 1YWOA 3VS7A 2KT8A 1ABQA 3QWYA 2EGAA 5I22A 3PVQA 2MCNA 4QT7A 1K9AA 4AG2C 1MUZA 1OPLA 2YUOA 1T3SA 1MV0B 2DE0X 2H8HA 2DL7A 1FYNA 2L3SA 1YP5A 2HSPA 2LJ0A 4JJBA 1AD5A 2AK5A 3UA6A 1BK2A 1V1CA 1XOVA 2DNUA 1AOJA 1G2BA 3QWXX 2FRWA 1M8MA 1NEBA 1VYVA 3IQLA 2M51A 2A37A 1VA7A 1GFDA 1YWPA 2K6DA 2RQWA 1K0SA 2MIOA 2VVKA 2F2VA 1EFNA 2CT4A 1QKXA 2JTEA 2O9SA 2X3XD 4J9GA 3R6NA 1W70A 4LE9A 1NG2A 2CDTA 1OPKA 1I1JA 2JMCA 3EG0A 4ORZA 3I5SA 4X1VA 4RTXA 3CQTA 3REBB 2F2XA 1U3OA 3M0SA 1PKSA 1WDXA 2DRKA 1UDLA 1GL5A 4HCKA 2DVJA 3M0PA 2J7IA 2KT1A 2IIMA 1JU5C 1PHTA 4GLMA 4RUGA 2DM1A 1K4US 2CUBA 1X27A 2NWMA 3VS1A 1UGVA 5EC7A 2HCKA 3VS2A 2CH4A 4IIMA 1ABOA 3PE0A 4KRTA 3VS0A 2ENMA 1SHGA 1X2QA 2K79A 2KNBB 2RQVA 4RTYA 1AZGB 3I9QA 2J6FA 3VS4A 2GTOA 1WI7A 3FJ5A 1WXTA 5FWBA 2KXCA 1WYXA 2KBTA 1AWWA 2LMJA 1QLYA 2ROTA 1X6GA 3EG3A 2O88A 3THKA 3NPFA 2GGRA 2JT4A 4OMPA 5GJWB 4CC3A 2LQWA 2FG0A 3EG2A 4JZ4A 2K9GA 2OAWA 1OEBA 2CREA 3JV3A 1SRMA 1ZUUA 1X2KA 2DF6A 2LJ3A 4J9CA 2EW3A 2K3BA 2CUDA 2ED1A 4LUDA 1M30A 2SEMA 2FO0A 3RNJA 2DRMA 1X6BA 1T0JA 1FMKA 3LH5A 3ULRB 1X43A 1WIEA 1E6HA 1K0XA 2JM8A 2W0ZA 5FW9A 4RTWA 1M27C 2MOXA 2J6KA 1UG1A 1ZSGA 1AEYA 1M3CA 2DL4A 2KYBA 1PNJA 1JO8A 2DBMA 2DL8A 1J3TA 1PWTA 2FPFA 2RPNA 1UE9A 3EHQA 4WCIA 1T3LA 1SRLA 3I5RA 5IXFA 2W10A 2EQIA 3H0FA 1QWEA 3O5ZA 1QKWA 4JZ3A 1HSQA 1SHFA 2XMFA 1M3AA 2GTJA 1PKTA 2RQRA 1BU1A 2KRNA 5IHNA 4OMLA 2EBPA 4AFUC 2D8HA 4LNPA 2EGCA 2KR3A 1RLQC 2ABLA 2YT6A 2AKLA 2BZXA 2JW4A 1UECA 3REAB 2EYXA 1W1FA 2A36A 2OI3A 4J9IA 2L3PA 2D8JA 4FSSA 1A0NB 2LX7A 1UHFA 4Z89A 1YNZA 4OMMA 1NM7A
chains in the Genus database with same CATH superfamily
2OTJA 2YXYA 2VWFA 4IIOA 5IHKA 3ME9A 2DYBA 2F5KA 1YITQ 4OMOA 2A3LA 4PJMA 3OY9A 1N9SA 4JJCA 4JPBW 4EMGA 2ZCFB 3PT9A 3RMQA 2IG0A 2SRCA 3EH1A 4PFPA 2KXDA 5HCKA 1WFWA 4M75G 2ZPBB 1B34A 1OQKA 2KYMA 4J6WA 1IO6A 1UJ0A 2M9UA 5KCOA 4OMNA 1QVFP 2FRYA 4EMKC 5D6XA 1VQ8T 1RL2A 3OYMA 4Y92A 3MJXA 2ATCB 2AKKA 1Y57A 2RN8A 1PD1A 3CMAQ 4O5VA 4M7DA 1XJWB 2CZ6B 1FX7A 3VS5A 1NPPA 1W2BP 2DILA 1M90U 2PZ1A 5GAOr 4XU2A 1K73C 5GANf 1VQPT 2A08A 3GBQA 5FLXE 5GMKe 3INZA 2DXUA 3CPWA 4OVAA 3L2UA 3HHTB 2JZ2A 4C8QE 3CCVT 3CCET 4JRPA 2LQNA 5GANe 4R56A 4C92E 3NTHA 2DEUA 1UHCA 5GAMd 2RQTA 1RABB 2K7AA 2PNIA 3V7RA 2DXCA 4OB1B 4FYWB 2E12A 5KYWB 1S72Q 2QQ9A 1YJ9T 3CCQT 4E2FB 3M5AA 5L23A 2M0OA 3JCMb 3V7SA 4M78D 1V76A 2GBQA 4PJJA 5GAMh 1I0CA 2DKGA 3LYIA 4NL3A 3CCMQ 1M90R 2GNCA 1H3ZA 3FDRA 1K76A 2ESWA 2NUZA 4XTYA 1W6XA 1Y71A 1LVKA 1BI3A 3HRTA 2E5KA 4K11A 2YDLA 3LX7A 1O75A 2VYTA 3CBOA 4JS5A 2J05A 3A1PA 4DOVA 3QKJA 4LUEA 2CH4W 1K8AR 4EPCA 4DA4A 4C8QD 2QXFA 4AG1C 2LRQA 1GFCA 2COYA 1VQPA 4MDWA 4F14A 3CCUQ 2JS0A 2PVOB 3OYGA 4UC4A 2DJZA 3TU4K 1VQLT 2X35A 2R58A 2DYIA 3OQ5A 2RJDA 1G83A 2XG8D 2DTOA 2NUPB 4OF1A 4MZMA 1SKUB 1UEBA 2RQUA 4E6RA 2HBWA 1YCSB 4A53A 4Y91A 3TVTA 5IAYA 1W2BS 5KYYA 1NPRA 4BDZA 1WJRA 3FEOA 3NHNA 4R0KA 3SEMA 1MNEA 1N9RA 1QVGP 1T0HA 2YHTA 4XTWA 1D1AA 2DIQA 1K9MC 2L3RA 2EQKA 1FWZA 2DLPA 3LGFA 1YI2T 4BB7A 3CMET 5I2MA 4HT9A 3QBYA 3C0CA 4A4GA 4J9EA 3CPWP 2CZ7B 2AZVA 4OMFB 1R0CB 2BE9B 5IXBA 3RMSA 4JS4A 1R77A 1Z9QA 3BW1A 2YSQA 2DTHA 3UATA 2D1XA 2BTTA 4M75E 1KQSP 2KRMA 2WSFE 4N0AA 2A7YA 1M1FA 4FW2A 2X3WD 4A63B 2GQIA 1B07A 3LLRA 4ME7A 2CS7A 1UGSB 3X26B 3QYHB 1BYMA 1UFFA 3EGUA 2HQXA 1OOTA 3S3NA 1Y0MA 1Q81U 5GAOn 3M58A 2EGAA 5I22A 1X75C 2O01E 2XDDA 4C0DC 1RAGB 4QT7A 2QA4T 4M7DG 1IZ6A 4OB0B 4OGEA 4MZTA 3E1SA 3JB9J 3EFRA 3M59A 4Z02A 1VOMA 1MV0B 3LH0A 3D7SB 4KGZB 3AT1B 1BIBA 1BK2A 4KUDK 1KQ2A 2DNUA 3SWNA 4M75A 1VQ5A 4AMCA 3UT1A 3F70A 1YJWQ 4J6YA 3X20B 2RK1A 1KC8R 3GF5A 2M51A 1NE8A 3L42A 1MHNA 1VA7A 2FVUA 1GFDA 1HYOA 2K6DA 2PUOB 2RQWA 4RCCA 1YITA 2E70A 3JCMg 1XNIA 3O8VA 2P0KA 2G3RA 3LWHA 3HPWA 4E7KA 1D0XA 1WQWA 1VQ6Q 2JMCA 1FMVA 3OYIA 2E10A 4C0DB 2E3IA 4X1VA 5KH6A 1U1TA 3REBB 4M78C 3M0SA 4JRKA 1PKSA 1WDXA 2RI5A 3LGLA 3E9GA 2DRKA 1UDLA 4F7UE 1GL5A 1G3TA 4C5GA 4C92D 4HCCA 3CCQA 4RUGA 1Q86U 1D0YA 3VUBA 3SD4A 1U8RA 2NWMA 5GAN2 2YRCA 5KE2A 1UGVA 4IIMA 2ENMA 3M4YA 3GP8A 2K79A 4RTYA 1G3SA 4PJOE 3I9QA 1TWBA 5DY9A 5GANg 1M1GA 1WI7A 3FJ5A 4M77A 5FWBA 4TVRA 2KXCA 3JCMW 1QP3A 1WYXA 2RJEA 2LMJA 1QLYA 2P0QA 1VQOA 2QGGA 3PGGA 2AHJB 3THKA 3SDZA 2DEQA 4M77F 2JT4A 3L2RA 5GJWB 1I4K1 2RHUA 1Y96B 3QPHA 1VQLQ 1VQMA 3OSVA 1ZUUA 2EAYA 2RJCA 5GAN5 2K3BA 1WHKA 2ED1A 1OZ2A 2EQJA 3QZ9B 3ASKA 4J5YA 4B6MA 1N8RR 4HCZA 3RNJA 5CKFA 1T0JA 2DPPB 1PD0A 1K8AC 2HZYA 5A0LA 3ULRB 4M7DE 1JRIA 1TU0B 1G5VA 5FU6C 3CD6Q 2JM8A 3CXCA 1QQJA 1M27C 3J80E 4ATOA 1MNDA 4JDSA 2J6KA 1VQ5Q 1ZSGA 4E7LA 4C92B 2XI9A 2KMTA 2O4XB 5KYNA 2D6FA 1R8OB 1PWTA 2RPNA 1SRLA 2KVQG 1M1KR 2VXEA 4IUTA 4FSXA 1KQSS 2Y4YA 2QTVA 4BE1A 2ZGWA 4X9CA 4A54A 1MMDA 1Q82U 2D8HA 3WXMB 1BCOA 2EGCA 2LQ8A 1KD1R 1RLQC 3OMCA 2HD0A 1YBYA 2K2VA 1UECA 4C92A 2OI3A 2D8JA 4FSSA 3JCMV 1A0NB 2I2LA 5LJ5e 4Z89A 4PJLA 3AHUA 2FEIA 4C92C 2RHIA 1M4ZA 2E6NA 3A8GB 2LTOA 5CVIA 1AWJA 4F17A 2E5QA 4M77D 4RTVA 4BY6B 3LWIA 2EJFA 3A98A 4Y28E 1ZBXA 3UF4A 3PNWC 2HDAA 3A8LB 1UGRB 2OTJQ 1E7OA 4HVUA 1U1SA 1TUDA 4GBQA 4C0FA 1M3BA 1UTIA 4KUIA 3HKSA 3JCMc 4RG2A 3ZFJA 3X24B 3NGPA 1QWFA 2LT1A 1RLPC 2EJ9A 1WGSA 3VS3A 2RH2A 3M0QA 4M75C 1YJWT 5D6YA 4HCBA 2HEQA 2L0AA 2LCSA 2F1LA 2HKNA 2FZCB 4HVVA 1KC8C 2BZ8A 1NYGA 5GMKl 3KXTA 2LNHB 2XDPA 4M7AB 2A28A 1TUCA 3CXCS 1YHQA 1M2OA 2ZAEA 1BI0A 4PK4A 3UA7A 3CCJQ 3A5ZB 2DIGA 3OSSC 1BI1A 3E2UA 3PIOA 3C94A 2LZ6B 1WNLA 4F7UG 5GAN3 3QJYA 3OYKA 1YHQQ 1HJDA 2EWNA 2DVEA 2EPDA 4J9HA 4QW2A 4XTUA 5LJ5d 1VYTA 1O9SA 3GPLA 1OX8A 3EG1A 3ZBDA 3HL8A 2YWWA 1N5ZA 3OMGA 2YUQA 1GRIA 2QGFB 5CKBA 4O6JA 3MHXA 4HXJA 3CC7A 1IREB 3M0TA 3CD6T 1C6VX 2RI3A 5GANh 3L2WA 1E6GA 2KSSA 1CSKA 1YIJQ 1PRMC 4PFZA 3S3OA 1Q81C 3JCMe 3CCMT 1D09B 1OI1A 2LP5A 4F7UB 3M57A 2XKOC 3V7CA 2NUPA 3M0UA 1VQOT 4ZN3A 1SPKA 2I0NA 3FC3A 2IPOB 5FWCA 2D0QB 1I81A 4XAXB 1AWXA 2RO0A 5IH2A 1WZOA 2EYYA 3JB9D 2GF7A 3KFVA 3EAEA 2YRDA 1GCPA 4FL6A 1AWOA 8ATCB 4DEYA 2FPDA 4QVCA 1OZ3A 4PL6A 2CP7A 3JB9G 3OW2P 2FPEA 5KYWA 2CZ0B 2F2WA 4Q5WA 5CKDA 3JCMh 2HNIA 1LOJA 2KDSA 4BE0A 1KSWA 1WXUA 3TSZA 1LCKA 3X25B 1VQ7T 3RUXA 3J7AF 4CC7A 4MZPA 4VUBA 3HRUA 2QDLA 1SSHA 2WSCE 3MO8A 1KD1U 3VRYA 2DFUA 2C0OA 1JXOA 3QYGB 1JJ2A 2KGTA 2Y4XA 4LDXA 3SHWA 3T9NA 3VKIA 3DKMA 4PJNA 1PG5B 1U5SA 2RM4A 4Z8AA 1N6AA 1RI9A 5LJ3j 1K8AU 1U06A 3EHRA 3H9NA 1EX4A 1ZA1B 3WVDB 3JB9H 3HFNA 4KT0E 1Q7YR 4OB2B 4IUVA 2XICA 1M5Q1 3G71Q 4LDVA 2CT3A 1VQ8A 1XTDA 3HP9A 2EKHA 2X51A 4M7DC 1BKBA 2ED0A 4RKUE 2X4WA 4ZN1A 2QASA 2D0NA 2YUPA 1B3QA 4L5GA 5CK9A 4XTXA 1UB4A 4L59A 2OTLQ 2JS2A 5L8RE 1ZUYA 4EIKA 1YWOA 3VS7A 2KT8A 2DD5A 4N4IA 1D1CA 4FYYB 2B8AA 3C4SA 2MCNA 3CBMA 2EFIA 5GAMf 2MYSA 3NFCA 1OPLA 2E1HA 2CP2A 2YLCA 2DE0X 2VB6A 2H8HA 2DL7A 2RB6A 3P8HA 2QK0A 2HSPA 5CQXA 3CCSA 4JJBA 3VYGA 1AD5A 2EYQA 3P8DA 3CMEQ 1UGQB 5GMKh 1V1CA 1XOVA 4MDXA 1AOJA 3N5BB 2RA2A 1K9MR 1G2BA 3A8MB 3SFMA 1S72A 3EGDB 1NJIC 1NEBA 1TXQA 1GXIE 2OAUA 1Q7YU 4DBHA 2VVKA 4WF2A 2RHYA 5AT1B 3QG1A 1D1BA 2Z0WA 1BIAA 1EFNA 2CT4A 1QKXA 3V8LA 2L5QA 1VQ4T 2O9SA 2X3XD 1C1AA 4J9GA 1WHMA 1NBEB 1W70A 2NUTA 2WACA 1NG2A 1OPKA 1I1JA 5CKEA 3M4GA 4R55A 4BI4A 2HBPA 2K57A 4ZTJA 4B9WA 2CP6A 4HCKA 3M0PA 2IIMA 1JU5C 3DLMA 1PHTA 4GLMA 1K4US 2NLUA 2CUBA 3OYJA 3E19A 3PMTA 1X27A 4GY5A 5EC7A 4QVZA 1PC0A 1ABOA 3VS0A 1JJ2P 1X2QA 2KNBB 1VQLA 3FB9A 2J6FA 2RI2A 2YLBA 2GTOA 3OYHA 3EG3A 3OB9A 3RR6A 2HSEB 3NPFA 2LCCA 3SB2A 1QVGA 4OMPA 3CC2T 2LQWA 1C0MA 2M02A 4JZ4A 3HSBA 3M53A 4PFOA 2CREA 2LJ3A 4J9CA 1VIFA 2EW3A 4LUDA 2K3XA 1M30A 2SEMA 3G4SA 2FO0A 2ZPEB 4D6WA 2JJ9A 1M90C 1FMKA 2QQRA 3LH5A 4J7FA 2O4XA 4AT1B 3CMEA 1K0XA 4XTVA 2MOXA 5C6SA 1AEYA 4M7AE 1HXDA 4J83A 1VQ9A 5J39A 3I55Q 1ZA2B 1PNJA 1JO8A 3A8OB 2DL8A 1EZZB 2MAMA 3MPUB 3O5ZA 4M75D 1QKWA 4JZ3A 3SWNB 1SHFA 4WTOB 2RQRA 5IHNA 4OMLA 2EBPA 5FU6B 4FU6A 1VQPQ 2HL3A 3MP6A 2QI2A 4BI3A 3CCEQ 5I2SA 2YT6A 3OYNA 2BZXA 2JW4A 3MP1A 3REAB 4DBQA 2A36A 5HY6A 1Q86C 2XD0A 1OU9A 3FIFA 3DLLA 3BDLA 3CCUT 2MMPA 4FCYA 2H3JA 3JCMP 2R57A 4C0GA 4JLIA 2R5AA 3CEYA 1DJ7B 5LL6S 1Q95G 1KHCA 1PRLC 2DZ9A 5CO7A 4C0ZA 1WX6A 1NEGA 5A2QE 2RD1A 3G6EA 4M7DD 4B9XA 1YI2A 4HA8A 5KYUA 1VQ7Q 2B86A 1RI0A 2KRSA 2RMOA 3OYEA 3CCJT 1VQNA 1QVFA 3CCUA 2X9HA 4JJNK 4OGCA 1YN8A 1Q82R 3VUZA 2J6OA 1KD1C 2VUBA 3KBGA 1GBRA 5GAN6 2PVGB 3GLXA 2FHDA 1M1KU 2EYZA 1IRXA 1YCYA 2MF2A 4KH1B 2X4XA 1CKBA 1N27A 2J06A 1K73U 1IHVA 4BDYA 3ZL7C 1YFNA 2LQKA 4IUQA 2HQHA 2L3QA 2X4JA 4JJDA 5CAIA 3QZ5B 2V1QA 4M78A 2EQUA 3QDRB 3FRNA 4AFSC 1G3YA 3OYBA 4E7HA 3JB9F 2JXBA 4KH0B 3DB3A 2CGHA 5M9OA 3JCMQ 3C12A 1S1NA 5KYYB 1CKAA 1TG0A 1NYFA 2V1RA 2FB7A 2XHCA 1JJ2S 3QHSA 4X9DA 3TCJA 1Z9ZA 1YIJT 3QIIA 9ATCB 4J6XA 3QXEB 4D8DA 2DMOA 3EFOA 3RBBB 1PM3A 2OTJT 1RACB 5GMKj 3DB4A 1RAEB 1PCXA 2F5TX 5HK0A 1QMCA 2ZPGB 1OYXA 3P8BB 2P4TA 3H8ZA 1BBZA 3HTRA 2QQAA 2HQEA 3OYLA 3CC2A 3QDFA 3BY7A 1EIFA 3MEVA 4C8QA 5GANj 2AZSA 4KGXB 1BCMA 4M78E 4RTTA 4DEXA 5GAN8 3CCJA 4BE2A 1QVGS 1BB9A 1QCOA 3VV0A 4CC4B 2P4RA 2COZA 4CC2A 2QEXA 1RADB 3G6EQ 5CIUA 4M7AC 4XU0A 1G3WA 1GBQA 4F04B 3MCAB 5CKHA 1BI2A 2EVRA 2BIVA 1Y7XA 4M78F 3VYHB 4ELYC 4PJOG 3M9QA 4M7AA 1H3HA 5LJ5f 1TOVA 1YJ9Q 4AFZC 2D9TA 4LD6A 3I35A 5KE3A 5KYUB 4MMLA 2VASA 3BDUA 2RJFA 3RIRA 1N8RC 4ZGEB 5DM7R 3GIBA 2JMAA 2DO3A 1ACMB 4M7AG 4E47A 5LJ5g 3CCRA 5IHIA 2FZGB 2LT4A 2M1HA 4PJOA 1KIKA 1KQSA 3JCMX 2BE7D 3I56Q 3S3MA 1VQ5T 2ZPHB 4M7DB 3CPFA 2FYKA 4BUGA 2C06A 1TS9A 5D6WA 2MWPA 1AT1B 3WVEB 3G4SQ 2FL7A 1D3BA 4C8QG 1JBMA 3M55A 3RKWA 3H41A 2V8JA 2V26A 4M77C 4QQ6A 4V2SA 3VJPA 3RKXA 4ZTFA 4PNOA 1WLPB 2K4YA 4ESRA 3GOXA 3PTAA 2ECZA 3CCMA 5GAOp 2GCXA 4A4HA 3OYFA 3OS1A 4J9FA 2CSIA 3H0HA 1VQKT 4FIBA 4C8QC 2VC8A 1S72T 1H8KA 1JXMA 2C0IA 1AVZC 3PVLA 3V8JA 4F7UF 3CPWS 2DJQA 4M78G 2HMAA 4OMQA 1VQ6T 2KK4A 1JEGA 3CCVQ 3A8HB 4XK8E 3H0IA 1IXDA 2C0TA 1OULA 1K9MU 3L2ZA 2JM9A 2JVVA 4M7AD 1M8VA 2E4HA 5LJ3f 3VRZA 2HAXA 2JNGA 2QYZA 3MEUA 4E7SA 1ABQA 4N4GA 3QWYA 3FLGA 3L1AA 3G4ST 1Q82C 2K5IA 2QQSA 4KBMB 4FW1A 1LPLA 3CCRT 1MUZA 2VXFA 2YUOA 1AHJB 3CMAT 4P5NA 1YHQT 1ZQ1A 1WHHA 2L3SA 6AT1B 2LJ0A 1QVFS 2AK5A 2LVMA 1LNXA 1VQNQ 4E7ZA 3JRZA 1F1BB 5D7UA 5GAMe 3OA6A 3QWXX 4GLKA 2QA4Q 3GNGA 3KUFA 2VGMA 3PFSA 2A37A 4M7DF 1HK9A 1YWPA 1K0SA 4N4HA 2LX9A 2F2VA 3G71T 3CCSQ 2JTEA 3R6NA 5GMKi 4RMOA 1WJQA 1XQHA 2GFAA 4QQGA 2XK0A 3CCEA 2QDYB 4RTXA 3QUIA 2MK5A 4N0AC 1M1KC 1OU8A 4M75F 4CI0C 2LDMA 3EG9B 3OYYA 2EIFA 2CZ1B 4LDYA 3CXCP 2DM1A 5HK3A 1Y96A 2L8DA 1KK7A 3VS1A 2HCKA 5CQYA 5J26A 3TQ7P 2RK2A 1SHGA 2K5LA 2RQVA 1AZGB 3V8KA 3VS4A 1WXTA 1TSFA 4C5HA 1X6GA 2RHZA 5I21A 2QA4A 3X28B 5IN1A 2QEXQ 1K73R 5C0MA 3OS5A 4PJOF 4EMKB 3EGDA 2OAWA 1OEBA 3JV3A 3PMIA 1ZHIA 1SRMA 1G8XA 1X2KA 2DF6A 2CP5A 5FU7B 2YRVA 3OBWA 1RAHB 4BY6C 1R0BG 1X6BA 4QQDA 2CYZB 2PQWA 5KYXA 1SSFA 2GQVA 1QP2A 4PLIA 3R6OA 2JOYA 3JCMd 5A0DA 5DLOA 3CC7T 2LC4A 5FW9A 1YJWA 3G6ET 1NJIU 5GANd 1UG1A 1QW1A 1RAAB 1I5OB 1M3CA 3LW5E 1WJSA 2FZKB 2KYBA 5GAN7 1J3TA 5LJ5j 1UE9A 4C92F 3EHQA 1FXXA 1T3LA 3I5RA 5IXFA 2EQIA 3H0FA 1QWEA 2V8KA 1UGPB 3EGXA 3ER0A 4EDUA 2QAZA 3UDCA 1M3AA 1BU1A 4AFUC 4LXCA 5GAN4 2KY9A 3HRSA 2ABLA 3META 4FYVB 2EYXA 4J9IA 3CCVA 2QG9B 1V29B 2LX7A 3NTKA 1IB8A 4BACA 1NM7A 5I11A 3TEEA 3CC7Q 1VQKQ 4DOWA 2QTXA 1W2BA 2PVDB 1YIJA 2DX1A 1VYUA 3CD6A 1QVPA 4J9DA 4IUUA 3UPUA 1ZSZA 1ARKA 4KGVB 2DBKA 2R5MA 1VQ4Q 4ANJA 1VQOQ 1KFZA 4XQ3A 5HKCA 4HKEA 1FMWA 1ZX6A 2O9VA 2PTKA 2GFUA 1VUBA 1SEMA 2COWA 1KHIA 1WHLA 4OB3B 1ZSZC 1UUEA 1MV3A 1W4SA 3CCQQ 1D0ZA 1WHJA 2DA9A 1OV3A 3HFOA 3H6ZA 5LJ5h 2K3YA 2LJ1A 2EJGA 4JUVA 2PUKB 2ROLA 2DD4A 1I07A 3VS6A 2RNAA 4BD3A 5CR2A 3JCMJ 3GNFB 4JRQA 1WHGA 4M7AF 1P92A 4FM4B 4YTLA 3I55A 4AFQC 4J8OA 3JCMf 2CP0A 1WQ7A 1QCNA 1VQ8Q 2K5FA 3L2QA 3NMZC 3CC4T 3CCLQ 2VKNA 2O2OA 1KJWA 4XTZA 3RKYA 4QVDA 1MGQA 2EYWA 2ZPIB 5AYFA 1VQMT 1ZBJA 2BZYA 4PJOB 1WPYA 4LN2A 3TSWA 1M2VB 1X69A 3EH2A 2E64A 3OYDA 1ZUKA 4DBFA 4OP0A 3CBPA 3MKDA 3OW2A 1HD3A 1MMNA 4LD9K 4PJOC 2EGEA 1M9SA 4D8KA 2YUNA 4E7IA 2ZPFB 3MEAA 2JUFA 3S6WA 4ZNXA 2KE9A 3M0RA 2Y90A 1IGQA 1RUWA 1UJYA 1NLPC 2DTIA 4JRIA 1PSEA 2O31A 1NLOC 1TH7A 2DL3A 2L2PA 2OJ2A 2DK3A 4Z88A 1B7TA 2HKQB 3I56T 2KEAA 1H92A 4C8QB 2RHXA 4RTUA 5GJVB 2JTFA 1MMAA 1TTHB 5LJ3g 5KCHA 3MP8A 1GCQC 3QJ6A 1JB0E 5FRNA 2G6FX 5FRMA 4C8QF 5ECAA 1VQKA 4XU3A 1QCFA 1AZEA 2ZZDA 8AT1B 1WXBA 3FJPA 2PU9B 1GCQA 2K2MA 2EKOA 3URGA 1JQQA 1YI2Q 2P84A 2DETA 2MPXC 1VIEA 2E6ZA 4NL2A 4RG8A 1YJNQ 2DERA 1KG1A 5LJ3e 4M77E 1Q7YC 3CCLA 2IVWA 1NJIR 4L6V5 2KI7A 4HVWA 1D3BB 1Q86R 2AT1B 4FT2A 4C5EA 2RF0A 2XU8A 3OBYA 2DXBA 1N8RU 5A0GA 3Q1JA 1VQMQ 4IKFA 2E41A 4F7UA 4M4ZA 1ZLMA 4A4KA 2X4YA 4BI8B 2H3EB 2DL5A 7AT1B 2CSQA 2OTLA 4CRIA 2KROA 4F16A 3RDVA 3OS0A 3G7ZA 1VQNT 4J9BA 1WA7A 3CCRQ 1KC8U 3L2VA 1RAIB 3U23A 4RTZA 3I56A 2A0FB 4LDWA 1K1ZA 2M0YA 4DBRA 1IGUA 1X6OA 1VQ9Q 3VU3C 4A4EA 3OS2A 3G71A 3TREA 1YJNA 4IUPA 2BUDA 3PVQA 2HL5C 5GAOm 3EFOB 4RCBA 1K9AA 4FT4A 4AG2C 1T3SA 3BE3A 3JSCA 1SF9A 2MI6A 1FYNA 2OTLT 1YP5A 1VQ4A 2NYSA 1KQ1A 2LCLA 3UA6A 3EGXB 2AIRB 1YITT 1I5LA 5LJ3d 5GMKm 2FRWA 1M8MA 1VYVA 2XIDA 2WSEE 3IQLA 2KQWA 2DZCA 1M2VA 2MIOA 1OX9A 4PJOD 5FU7C 1VQ9T 2L89A 3CC4Q 3CCLT 2EQMA 3C95A 4J7IA 2V8IA 3CC2Q 2XDBA 4C92G 4LE9A 2CDTA 3EG0A 2E65A 4ORZA 3RESA 4IURA 3I5SA 3CQTA 3OYCA 3OYAA 2F2XA 4PKCC 1U3OA 4MMKA 2CP3A 5GAMg 2LNVA 2VV5A 2DVJA 4M78B 2J7IA 2KT1A 3M54A 3CMAA 4ZGJB 4HT8A 3QO3A 2JTMA 3MEWA 1MMGA 2VGNA 5J3BA 3NTIA 4JLGA 3VS2A 1TUGB 2CH4A 3ZEHA 1X01A 3PE0A 4KRTA 3JB9I 3BFMA 1SG5A 4KULA 5GAOl 1VQ7A 3QSUA 3UWNA 2E3HA 4FYXB 2KBTA 5GAOq 3OW2S 1AWWA 5IT9E 2ROTA 2O88A 4XU1A 1RAFB 5GAMj 1I8FA 2GGRA 1Y07A 3CCST 1LJOA 2F69A 4CC3A 5KYXB 4C5IA 4X34A 2P0PA 1YJNT 2FG0A 1B34B 3EG2A 3PIPA 4EMHA 2K9GA 1ZSZB 5CCAA 5LJ3h 4LDUA 3EG9A 3CC4A 2QEXT 2CUDA 2QQBA 2DRMA 4ELZC 1Q81R 4NS5A 3E9FA 3I55T 1X43A 1WIEA 4II1A 1E6HA 2W0ZA 3EFSA 3G1JA 4RTWA 4M77G 2DL4A 4E7JA 1H641 2DBMA 2FPFA 2KAFA 5FROA 2CKKA 4WCIA 1PSFA 2W10A 2BKDN 4QKUA 2DAQA 4ZGDB 4M75B 1HSQA 2XMFA 2JN0A 2GTJA 1PKTA 2KRNA 5EG2A 4EMKA 3RERA 4A4FA 1VQ6A 3SWNC 2OX7A 3M56A 4PLLA 1YJ9A 4LNPA 2NUTB 2KR3A 3J81E 1IHWA 2AKLA 2MWOA 4DQ2A 3JAME 1W1FA 2M16A 4NOYA 1NZ9A 2L3PA 2DXTA 4M77B 1UHFA 5DLQE 1YNZA 4OMMA
chains in the Genus database with same CATH topology
5I11A 2VWFA 4IIOA 2FEIA 5IHKA 2DYBA 4OMOA 4JJCA 4JPBW 1PRLC 2DX1A 1AWJA 1VYUA 4F17A 1WX6A 2SRCA 1NEGA 4J9DA 4RTVA 2KXDA 5HCKA 1ARKA 1WFWA 2DBKA 2B86A 2KRSA 1KFZA 2RMOA 3A98A 2KYMA 1ZX6A 1IO6A 1UJ0A 3UF4A 4OMNA 2O9VA 2PTKA 2FRYA 2HDAA 1SEMA 1YN8A 4Y92A 1UUEA 1MV3A 1E7OA 2AKKA 4HVUA 2J6OA 1Y57A 2RN8A 1TUDA 4GBQA 1GBRA 1M3BA 2DA9A 1OV3A 1UTIA 2EYZA 3VS5A 2DILA 2LJ1A 2PZ1A 3NGPA 1CKBA 1QWFA 1RLPC 2A08A 2J06A 2ROLA 3VS3A 3GBQA 3M0QA 1I07A 3VS6A 2RNAA 3ZL7C 2L3QA 2HEQA 2L0AA 4JJDA 2LCSA 2V1QA 4HVVA 4AFQC 4AFSC 2BZ8A 1NYGA 2JXBA 2LQNA 2LNHB 2A28A 1TUCA 3NMZC 1UHCA 2RQTA 2VKNA 2K7AA 2PNIA 2O2OA 1KJWA 1S1NA 1CKAA 1TG0A 1NYFA 2V1RA 3UA7A 2EYWA 1Z9ZA 1ZBJA 5L23A 2LZ6B 4D8DA 2BZYA 2DMOA 3RBBB 2GBQA 4LN2A 3TSWA 1X69A 1HJDA 1I0CA 2GNCA 2EPDA 1BBZA 4J9HA 1ZUKA 1K76A 1VYTA 2ESWA 2NUZA 1W6XA 1HD3A 3EG1A 2AZSA 2E5KA 1N5ZA 4K11A 4RTTA 4DEXA 2EGEA 2YDLA 2YUQA 1BB9A 4D8KA 2YUNA 1GRIA 2P4RA 4CC4B 2J05A 4CC2A 4HXJA 3M0TA 4ZNXA 2KE9A 3M0RA 1RUWA 1UJYA 1E6GA 1CSKA 1NLPC 4LUEA 1PRMC 2CH4W 1GBQA 2EVRA 2LP5A 2O31A 1NLOC 2DL3A 4AG1C 2L2PA 2OJ2A 3M0UA 4Z88A 1H3HA 1GFCA 4AFZC 4F14A 1SPKA 2JS0A 2I0NA 2KEAA 1H92A 5FWCA 3I35A 4RTUA 1AWXA 5GJVB 5IH2A 2EYYA 3KFVA 1G83A 1GCQC 2JMAA 1GCPA 2G6FX 1AWOA 5ECAA 2RQUA 4DEYA 5IHIA 4E6RA 2HBWA 1KIKA 2FPDA 1QCFA 1AZEA 1WXBA 1YCSB 3TVTA 1GCQA 2FPEA 2K2MA 1JQQA 2F2WA 3NHNA 1KSWA 4R0KA 3SEMA 1WXUA 3TSZA 1LCKA 1T0HA 4CC7A 4HVWA 2QDLA 1SSHA 3H41A 2DLPA 3VRYA 2C0OA 1JXOA 2RF0A 2KGTA 1WLPB 4ESRA 3C0CA 4J9EA 3SHWA 2AZVA 2ECZA 1U5SA 5IXBA 4M4ZA 1ZLMA 4Z8AA 4J9FA 1RI9A 2CSIA 3H0HA 1Z9QA 2DL5A 2CSQA 1U06A 2YSQA 3EHRA 3UATA 2D1XA 2KROA 2BTTA 4F16A 1H8KA 1JXMA 2CT3A 2C0IA 1AVZC 2KRMA 3PVLA 2EKHA 2ED0A 2DJQA 2X3WD 4J9BA 1WA7A 4OMQA 4A63B 2GQIA 1B07A 2D0NA 1JEGA 2YUPA 3H0IA 3U23A 1B3QA 4RTZA 1UFFA 2C0TA 3EGUA 1OOTA 1K1ZA 2M0YA 2JM9A 1Y0MA 2JS2A 3VRZA 1ZUYA 4EIKA 1YWOA 3VS7A 2KT8A 1ABQA 3QWYA 2EGAA 5I22A 3PVQA 2MCNA 4QT7A 1K9AA 4AG2C 1MUZA 1OPLA 2YUOA 1T3SA 1MV0B 2DE0X 2H8HA 2DL7A 1FYNA 2L3SA 1YP5A 2HSPA 2LJ0A 4JJBA 1AD5A 2AK5A 3UA6A 1BK2A 1V1CA 1XOVA 2DNUA 1AOJA 1G2BA 3QWXX 2FRWA 1M8MA 1NEBA 1VYVA 3IQLA 2M51A 2A37A 1VA7A 1GFDA 1YWPA 2K6DA 2RQWA 1K0SA 2MIOA 2VVKA 2F2VA 1EFNA 2CT4A 1QKXA 2JTEA 2O9SA 2X3XD 4J9GA 3R6NA 1W70A 4LE9A 1NG2A 2CDTA 1OPKA 1I1JA 2JMCA 3EG0A 4ORZA 3I5SA 4X1VA 4RTXA 3CQTA 3REBB 2F2XA 1U3OA 3M0SA 1PKSA 1WDXA 2DRKA 1UDLA 1GL5A 4HCKA 2DVJA 3M0PA 2J7IA 2KT1A 2IIMA 1JU5C 1PHTA 4GLMA 4RUGA 2DM1A 1K4US 2CUBA 1X27A 2NWMA 3VS1A 1UGVA 5EC7A 2HCKA 3VS2A 2CH4A 4IIMA 1ABOA 3PE0A 4KRTA 3VS0A 2ENMA 1SHGA 1X2QA 2K79A 2KNBB 2RQVA 4RTYA 1AZGB 3I9QA 2J6FA 3VS4A 2GTOA 1WI7A 3FJ5A 1WXTA 5FWBA 2KXCA 1WYXA 2KBTA 1AWWA 2LMJA 1QLYA 2ROTA 1X6GA 3EG3A 2O88A 3THKA 3NPFA 2GGRA 2JT4A 4OMPA 5GJWB 4CC3A 2LQWA 2FG0A 3EG2A 4JZ4A 2K9GA 2OAWA 1OEBA 2CREA 3JV3A 1SRMA 1ZUUA 1X2KA 2DF6A 2LJ3A 4J9CA 2EW3A 2K3BA 2CUDA 2ED1A 4LUDA 1M30A 2SEMA 2FO0A 3RNJA 2DRMA 1X6BA 1T0JA 1FMKA 3LH5A 3ULRB 1X43A 1WIEA 1E6HA 1K0XA 2JM8A 2W0ZA 5FW9A 4RTWA 1M27C 2MOXA 2J6KA 1UG1A 1ZSGA 1AEYA 1M3CA 2DL4A 2KYBA 1PNJA 1JO8A 2DBMA 2DL8A 1J3TA 1PWTA 2FPFA 2RPNA 1UE9A 3EHQA 4WCIA 1T3LA 1SRLA 3I5RA 5IXFA 2W10A 2EQIA 3H0FA 1QWEA 3O5ZA 1QKWA 4JZ3A 1HSQA 1SHFA 2XMFA 1M3AA 2GTJA 1PKTA 2RQRA 1BU1A 2KRNA 5IHNA 4OMLA 2EBPA 4AFUC 2D8HA 4LNPA 2EGCA 2KR3A 1RLQC 2ABLA 2YT6A 2AKLA 2BZXA 2JW4A 1UECA 3REAB 2EYXA 1W1FA 2A36A 2OI3A 4J9IA 2L3PA 2D8JA 4FSSA 1A0NB 2LX7A 1UHFA 4Z89A 1YNZA 4OMMA 1NM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I11 A;  2VWF A;  4IIO A;  2FEI A;  5IHK A;  2DYB A;  4OMO A;  4JJC A;  4JPB W;  1PRL C;  2DX1 A;  1AWJ A;  1VYU A;  4F17 A;  1WX6 A;  2SRC A;  1NEG A;  4J9D A;  4RTV A;  2KXD A;  5HCK A;  1ARK A;  1WFW A;  2DBK A;  2B86 A;  2KRS A;  1KFZ A;  2RMO A;  3A98 A;  2KYM A;  1ZX6 A;  1IO6 A;  1UJ0 A;  3UF4 A;  4OMN A;  2O9V A;  2PTK A;  2FRY A;  2HDA A;  1SEM A;  1YN8 A;  4Y92 A;  1UUE A;  1MV3 A;  1E7O A;  2AKK A;  4HVU A;  2J6O A;  1Y57 A;  2RN8 A;  1TUD A;  4GBQ A;  1GBR A;  1M3B A;  2DA9 A;  1OV3 A;  1UTI A;  2EYZ A;  3VS5 A;  2DIL A;  2LJ1 A;  2PZ1 A;  3NGP A;  1CKB A;  1QWF A;  1RLP C;  2A08 A;  2J06 A;  2ROL A;  3VS3 A;  3GBQ A;  3M0Q A;  1I07 A;  3VS6 A;  2RNA A;  3ZL7 C;  2L3Q A;  2HEQ A;  2L0A A;  4JJD A;  2LCS A;  2V1Q A;  4HVV A;  4AFQ C;  4AFS C;  2BZ8 A;  1NYG A;  2JXB A;  2LQN A;  2LNH B;  2A28 A;  1TUC A;  3NMZ C;  1UHC A;  2RQT A;  2VKN A;  2K7A A;  2PNI A;  2O2O A;  1KJW A;  1S1N A;  1CKA A;  1TG0 A;  1NYF A;  2V1R A;  3UA7 A;  2EYW A;  1Z9Z A;  1ZBJ A;  5L23 A;  2LZ6 B;  4D8D A;  2BZY A;  2DMO A;  3RBB B;  2GBQ A;  4LN2 A;  3TSW A;  1X69 A;  1HJD A;  1I0C A;  2GNC A;  2EPD A;  1BBZ A;  4J9H A;  1ZUK A;  1K76 A;  1VYT A;  2ESW A;  2NUZ A;  1W6X A;  1HD3 A;  3EG1 A;  2AZS A;  2E5K A;  1N5Z A;  4K11 A;  4RTT A;  4DEX A;  2EGE A;  2YDL A;  2YUQ A;  1BB9 A;  4D8K A;  2YUN A;  1GRI A;  2P4R A;  4CC4 B;  2J05 A;  4CC2 A;  4HXJ A;  3M0T A;  4ZNX A;  2KE9 A;  3M0R A;  1RUW A;  1UJY A;  1E6G A;  1CSK A;  1NLP C;  4LUE A;  1PRM C;  2CH4 W;  1GBQ A;  2EVR A;  2LP5 A;  2O31 A;  1NLO C;  2DL3 A;  4AG1 C;  2L2P A;  2OJ2 A;  3M0U A;  4Z88 A;  1H3H A;  1GFC A;  4AFZ C;  4F14 A;  1SPK A;  2JS0 A;  2I0N A;  2KEA A;  1H92 A;  5FWC A;  3I35 A;  4RTU A;  1AWX A;  5GJV B;  5IH2 A;  2EYY A;  3KFV A;  1G83 A;  1GCQ C;  2JMA A;  1GCP A;  2G6F X;  1AWO A;  5ECA A;  2RQU A;  4DEY A;  5IHI A;  4E6R A;  2HBW A;  1KIK A;  2FPD A;  1QCF A;  1AZE A;  1WXB A;  1YCS B;  3TVT A;  1GCQ A;  2FPE A;  2K2M A;  1JQQ A;  2F2W A;  3NHN A;  1KSW A;  4R0K A;  3SEM A;  1WXU A;  3TSZ A;  1LCK A;  1T0H A;  4CC7 A;  4HVW A;  2QDL A;  1SSH A;  3H41 A;  2DLP A;  3VRY A;  2C0O A;  1JXO A;  2RF0 A;  2KGT A;  1WLP B;  4ESR A;  3C0C A;  4J9E A;  3SHW A;  2AZV A;  2ECZ A;  1U5S A;  5IXB A;  4M4Z A;  1ZLM A;  4Z8A A;  4J9F A;  1RI9 A;  2CSI A;  3H0H A;  1Z9Q A;  2DL5 A;  2CSQ A;  1U06 A;  2YSQ A;  3EHR A;  3UAT A;  2D1X A;  2KRO A;  2BTT A;  4F16 A;  1H8K A;  1JXM A;  2CT3 A;  2C0I A;  1AVZ C;  2KRM A;  3PVL A;  2EKH A;  2ED0 A;  2DJQ A;  2X3W D;  4J9B A;  1WA7 A;  4OMQ A;  4A63 B;  2GQI A;  1B07 A;  2D0N A;  1JEG A;  2YUP A;  3H0I A;  3U23 A;  1B3Q A;  4RTZ A;  1UFF A;  2C0T A;  3EGU A;  1OOT A;  1K1Z A;  2M0Y A;  2JM9 A;  1Y0M A;  2JS2 A;  3VRZ A;  1ZUY A;  4EIK A;  1YWO A;  3VS7 A;  2KT8 A;  1ABQ A;  3QWY A;  2EGA A;  5I22 A;  3PVQ A;  2MCN A;  4QT7 A;  1K9A A;  4AG2 C;  1MUZ A;  1OPL A;  2YUO A;  1T3S A;  1MV0 B;  2DE0 X;  2H8H A;  2DL7 A;  1FYN A;  2L3S A;  1YP5 A;  2HSP A;  2LJ0 A;  4JJB A;  1AD5 A;  2AK5 A;  3UA6 A;  1BK2 A;  1V1C A;  1XOV A;  2DNU A;  1AOJ A;  1G2B A;  3QWX X;  2FRW A;  1M8M A;  1NEB A;  1VYV A;  3IQL A;  2M51 A;  2A37 A;  1VA7 A;  1GFD A;  1YWP A;  2K6D A;  2RQW A;  1K0S A;  2MIO A;  2VVK A;  2F2V A;  1EFN A;  2CT4 A;  1QKX A;  2JTE A;  2O9S A;  2X3X D;  4J9G A;  3R6N A;  1W70 A;  4LE9 A;  1NG2 A;  2CDT A;  1OPK A;  1I1J A;  2JMC A;  3EG0 A;  4ORZ A;  3I5S A;  4X1V A;  4RTX A;  3CQT A;  3REB B;  2F2X A;  1U3O A;  3M0S A;  1PKS A;  1WDX A;  2DRK A;  1UDL A;  1GL5 A;  4HCK A;  2DVJ A;  3M0P A;  2J7I A;  2KT1 A;  2IIM A;  1JU5 C;  1PHT A;  4GLM A;  4RUG A;  2DM1 A;  1K4U S;  2CUB A;  1X27 A;  2NWM A;  3VS1 A;  1UGV A;  5EC7 A;  2HCK A;  3VS2 A;  2CH4 A;  4IIM A;  1ABO A;  3PE0 A;  4KRT A;  3VS0 A;  2ENM A;  1SHG A;  1X2Q A;  2K79 A;  2KNB B;  2RQV A;  4RTY A;  1AZG B;  3I9Q A;  2J6F A;  3VS4 A;  2GTO A;  1WI7 A;  3FJ5 A;  1WXT A;  5FWB A;  2KXC A;  1WYX A;  2KBT A;  1AWW A;  2LMJ A;  1QLY A;  2ROT A;  1X6G A;  3EG3 A;  2O88 A;  3THK A;  3NPF A;  2GGR A;  2JT4 A;  4OMP A;  5GJW B;  4CC3 A;  2LQW A;  2FG0 A;  3EG2 A;  4JZ4 A;  2K9G A;  2OAW A;  1OEB A;  2CRE A;  3JV3 A;  1SRM A;  1ZUU A;  1X2K A;  2DF6 A;  2LJ3 A;  4J9C A;  2EW3 A;  2K3B A;  2CUD A;  2ED1 A;  4LUD A;  1M30 A;  2SEM A;  2FO0 A;  3RNJ A;  2DRM A;  1X6B A;  1T0J A;  1FMK A;  3LH5 A;  3ULR B;  1X43 A;  1WIE A;  1E6H A;  1K0X A;  2JM8 A;  2W0Z A;  5FW9 A;  4RTW A;  1M27 C;  2MOX A;  2J6K A;  1UG1 A;  1ZSG A;  1AEY A;  1M3C A;  2DL4 A;  2KYB A;  1PNJ A;  1JO8 A;  2DBM A;  2DL8 A;  1J3T A;  1PWT A;  2FPF A;  2RPN A;  1UE9 A;  3EHQ A;  4WCI A;  1T3L A;  1SRL A;  3I5R A;  5IXF A;  2W10 A;  2EQI A;  3H0F A;  1QWE A;  3O5Z A;  1QKW A;  4JZ3 A;  1HSQ A;  1SHF A;  2XMF A;  1M3A A;  2GTJ A;  1PKT A;  2RQR A;  1BU1 A;  2KRN A;  5IHN A;  4OML A;  2EBP A;  4AFU C;  2D8H A;  4LNP A;  2EGC A;  2KR3 A;  1RLQ C;  2ABL A;  2YT6 A;  2AKL A;  2BZX A;  2JW4 A;  1UEC A;  3REA B;  2EYX A;  1W1F A;  2A36 A;  2OI3 A;  4J9I A;  2L3P A;  2D8J A;  4FSS A;  1A0N B;  2LX7 A;  1UHF A;  4Z89 A;  1YNZ A;  4OMM A;  1NM7 A; 
#chains in the Genus database with same CATH topology
 2OTJ A;  2YXY A;  2VWF A;  4IIO A;  5IHK A;  3ME9 A;  2DYB A;  2F5K A;  1YIT Q;  4OMO A;  2A3L A;  4PJM A;  3OY9 A;  1N9S A;  4JJC A;  4JPB W;  4EMG A;  2ZCF B;  3PT9 A;  3RMQ A;  2IG0 A;  2SRC A;  3EH1 A;  4PFP A;  2KXD A;  5HCK A;  1WFW A;  4M75 G;  2ZPB B;  1B34 A;  1OQK A;  2KYM A;  4J6W A;  1IO6 A;  1UJ0 A;  2M9U A;  5KCO A;  4OMN A;  1QVF P;  2FRY A;  4EMK C;  5D6X A;  1VQ8 T;  1RL2 A;  3OYM A;  4Y92 A;  3MJX A;  2ATC B;  2AKK A;  1Y57 A;  2RN8 A;  1PD1 A;  3CMA Q;  4O5V A;  4M7D A;  1XJW B;  2CZ6 B;  1FX7 A;  3VS5 A;  1NPP A;  1W2B P;  2DIL A;  1M90 U;  2PZ1 A;  5GAO r;  4XU2 A;  1K73 C;  5GAN f;  1VQP T;  2A08 A;  3GBQ A;  5FLX E;  5GMK e;  3INZ A;  2DXU A;  3CPW A;  4OVA A;  3L2U A;  3HHT B;  2JZ2 A;  4C8Q E;  3CCV T;  3CCE T;  4JRP A;  2LQN A;  5GAN e;  4R56 A;  4C92 E;  3NTH A;  2DEU A;  1UHC A;  5GAM d;  2RQT A;  1RAB B;  2K7A A;  2PNI A;  3V7R A;  2DXC A;  4OB1 B;  4FYW B;  2E12 A;  5KYW B;  1S72 Q;  2QQ9 A;  1YJ9 T;  3CCQ T;  4E2F B;  3M5A A;  5L23 A;  2M0O A;  3JCM b;  3V7S A;  4M78 D;  1V76 A;  2GBQ A;  4PJJ A;  5GAM h;  1I0C A;  2DKG A;  3LYI A;  4NL3 A;  3CCM Q;  1M90 R;  2GNC A;  1H3Z A;  3FDR A;  1K76 A;  2ESW A;  2NUZ A;  4XTY A;  1W6X A;  1Y71 A;  1LVK A;  1BI3 A;  3HRT A;  2E5K A;  4K11 A;  2YDL A;  3LX7 A;  1O75 A;  2VYT A;  3CBO A;  4JS5 A;  2J05 A;  3A1P A;  4DOV A;  3QKJ A;  4LUE A;  2CH4 W;  1K8A R;  4EPC A;  4DA4 A;  4C8Q D;  2QXF A;  4AG1 C;  2LRQ A;  1GFC A;  2COY A;  1VQP A;  4MDW A;  4F14 A;  3CCU Q;  2JS0 A;  2PVO B;  3OYG A;  4UC4 A;  2DJZ A;  3TU4 K;  1VQL T;  2X35 A;  2R58 A;  2DYI A;  3OQ5 A;  2RJD A;  1G83 A;  2XG8 D;  2DTO A;  2NUP B;  4OF1 A;  4MZM A;  1SKU B;  1UEB A;  2RQU A;  4E6R A;  2HBW A;  1YCS B;  4A53 A;  4Y91 A;  3TVT A;  5IAY A;  1W2B S;  5KYY A;  1NPR A;  4BDZ A;  1WJR A;  3FEO A;  3NHN A;  4R0K A;  3SEM A;  1MNE A;  1N9R A;  1QVG P;  1T0H A;  2YHT A;  4XTW A;  1D1A A;  2DIQ A;  1K9M C;  2L3R A;  2EQK A;  1FWZ A;  2DLP A;  3LGF A;  1YI2 T;  4BB7 A;  3CME T;  5I2M A;  4HT9 A;  3QBY A;  3C0C A;  4A4G A;  4J9E A;  3CPW P;  2CZ7 B;  2AZV A;  4OMF B;  1R0C B;  2BE9 B;  5IXB A;  3RMS A;  4JS4 A;  1R77 A;  1Z9Q A;  3BW1 A;  2YSQ A;  2DTH A;  3UAT A;  2D1X A;  2BTT A;  4M75 E;  1KQS P;  2KRM A;  2WSF E;  4N0A A;  2A7Y A;  1M1F A;  4FW2 A;  2X3W D;  4A63 B;  2GQI A;  1B07 A;  3LLR A;  4ME7 A;  2CS7 A;  1UGS B;  3X26 B;  3QYH B;  1BYM A;  1UFF A;  3EGU A;  2HQX A;  1OOT A;  3S3N A;  1Y0M A;  1Q81 U;  5GAO n;  3M58 A;  2EGA A;  5I22 A;  1X75 C;  2O01 E;  2XDD A;  4C0D C;  1RAG B;  4QT7 A;  2QA4 T;  4M7D G;  1IZ6 A;  4OB0 B;  4OGE A;  4MZT A;  3E1S A;  3JB9 J;  3EFR A;  3M59 A;  4Z02 A;  1VOM A;  1MV0 B;  3LH0 A;  3D7S B;  4KGZ B;  3AT1 B;  1BIB A;  1BK2 A;  4KUD K;  1KQ2 A;  2DNU A;  3SWN A;  4M75 A;  1VQ5 A;  4AMC A;  3UT1 A;  3F70 A;  1YJW Q;  4J6Y A;  3X20 B;  2RK1 A;  1KC8 R;  3GF5 A;  2M51 A;  1NE8 A;  3L42 A;  1MHN A;  1VA7 A;  2FVU A;  1GFD A;  1HYO A;  2K6D A;  2PUO B;  2RQW A;  4RCC A;  1YIT A;  2E70 A;  3JCM g;  1XNI A;  3O8V A;  2P0K A;  2G3R A;  3LWH A;  3HPW A;  4E7K A;  1D0X A;  1WQW A;  1VQ6 Q;  2JMC A;  1FMV A;  3OYI A;  2E10 A;  4C0D B;  2E3I A;  4X1V A;  5KH6 A;  1U1T A;  3REB B;  4M78 C;  3M0S A;  4JRK A;  1PKS A;  1WDX A;  2RI5 A;  3LGL A;  3E9G A;  2DRK A;  1UDL A;  4F7U E;  1GL5 A;  1G3T A;  4C5G A;  4C92 D;  4HCC A;  3CCQ A;  4RUG A;  1Q86 U;  1D0Y A;  3VUB A;  3SD4 A;  1U8R A;  2NWM A;  5GAN 2;  2YRC A;  5KE2 A;  1UGV A;  4IIM A;  2ENM A;  3M4Y A;  3GP8 A;  2K79 A;  4RTY A;  1G3S A;  4PJO E;  3I9Q A;  1TWB A;  5DY9 A;  5GAN g;  1M1G A;  1WI7 A;  3FJ5 A;  4M77 A;  5FWB A;  4TVR A;  2KXC A;  3JCM W;  1QP3 A;  1WYX A;  2RJE A;  2LMJ A;  1QLY A;  2P0Q A;  1VQO A;  2QGG A;  3PGG A;  2AHJ B;  3THK A;  3SDZ A;  2DEQ A;  4M77 F;  2JT4 A;  3L2R A;  5GJW B;  1I4K 1;  2RHU A;  1Y96 B;  3QPH A;  1VQL Q;  1VQM A;  3OSV A;  1ZUU A;  2EAY A;  2RJC A;  5GAN 5;  2K3B A;  1WHK A;  2ED1 A;  1OZ2 A;  2EQJ A;  3QZ9 B;  3ASK A;  4J5Y A;  4B6M A;  1N8R R;  4HCZ A;  3RNJ A;  5CKF A;  1T0J A;  2DPP B;  1PD0 A;  1K8A C;  2HZY A;  5A0L A;  3ULR B;  4M7D E;  1JRI A;  1TU0 B;  1G5V A;  5FU6 C;  3CD6 Q;  2JM8 A;  3CXC A;  1QQJ A;  1M27 C;  3J80 E;  4ATO A;  1MND A;  4JDS A;  2J6K A;  1VQ5 Q;  1ZSG A;  4E7L A;  4C92 B;  2XI9 A;  2KMT A;  2O4X B;  5KYN A;  2D6F A;  1R8O B;  1PWT A;  2RPN A;  1SRL A;  2KVQ G;  1M1K R;  2VXE A;  4IUT A;  4FSX A;  1KQS S;  2Y4Y A;  2QTV A;  4BE1 A;  2ZGW A;  4X9C A;  4A54 A;  1MMD A;  1Q82 U;  2D8H A;  3WXM B;  1BCO A;  2EGC A;  2LQ8 A;  1KD1 R;  1RLQ C;  3OMC A;  2HD0 A;  1YBY A;  2K2V A;  1UEC A;  4C92 A;  2OI3 A;  2D8J A;  4FSS A;  3JCM V;  1A0N B;  2I2L A;  5LJ5 e;  4Z89 A;  4PJL A;  3AHU A;  2FEI A;  4C92 C;  2RHI A;  1M4Z A;  2E6N A;  3A8G B;  2LTO A;  5CVI A;  1AWJ A;  4F17 A;  2E5Q A;  4M77 D;  4RTV A;  4BY6 B;  3LWI A;  2EJF A;  3A98 A;  4Y28 E;  1ZBX A;  3UF4 A;  3PNW C;  2HDA A;  3A8L B;  1UGR B;  2OTJ Q;  1E7O A;  4HVU A;  1U1S A;  1TUD A;  4GBQ A;  4C0F A;  1M3B A;  1UTI A;  4KUI A;  3HKS A;  3JCM c;  4RG2 A;  3ZFJ A;  3X24 B;  3NGP A;  1QWF A;  2LT1 A;  1RLP C;  2EJ9 A;  1WGS A;  3VS3 A;  2RH2 A;  3M0Q A;  4M75 C;  1YJW T;  5D6Y A;  4HCB A;  2HEQ A;  2L0A A;  2LCS A;  2F1L A;  2HKN A;  2FZC B;  4HVV A;  1KC8 C;  2BZ8 A;  1NYG A;  5GMK l;  3KXT A;  2LNH B;  2XDP A;  4M7A B;  2A28 A;  1TUC A;  3CXC S;  1YHQ A;  1M2O A;  2ZAE A;  1BI0 A;  4PK4 A;  3UA7 A;  3CCJ Q;  3A5Z B;  2DIG A;  3OSS C;  1BI1 A;  3E2U A;  3PIO A;  3C94 A;  2LZ6 B;  1WNL A;  4F7U G;  5GAN 3;  3QJY A;  3OYK A;  1YHQ Q;  1HJD A;  2EWN A;  2DVE A;  2EPD A;  4J9H A;  4QW2 A;  4XTU A;  5LJ5 d;  1VYT A;  1O9S A;  3GPL A;  1OX8 A;  3EG1 A;  3ZBD A;  3HL8 A;  2YWW A;  1N5Z A;  3OMG A;  2YUQ A;  1GRI A;  2QGF B;  5CKB A;  4O6J A;  3MHX A;  4HXJ A;  3CC7 A;  1IRE B;  3M0T A;  3CD6 T;  1C6V X;  2RI3 A;  5GAN h;  3L2W A;  1E6G A;  2KSS A;  1CSK A;  1YIJ Q;  1PRM C;  4PFZ A;  3S3O A;  1Q81 C;  3JCM e;  3CCM T;  1D09 B;  1OI1 A;  2LP5 A;  4F7U B;  3M57 A;  2XKO C;  3V7C A;  2NUP A;  3M0U A;  1VQO T;  4ZN3 A;  1SPK A;  2I0N A;  3FC3 A;  2IPO B;  5FWC A;  2D0Q B;  1I81 A;  4XAX B;  1AWX A;  2RO0 A;  5IH2 A;  1WZO A;  2EYY A;  3JB9 D;  2GF7 A;  3KFV A;  3EAE A;  2YRD A;  1GCP A;  4FL6 A;  1AWO A;  8ATC B;  4DEY A;  2FPD A;  4QVC A;  1OZ3 A;  4PL6 A;  2CP7 A;  3JB9 G;  3OW2 P;  2FPE A;  5KYW A;  2CZ0 B;  2F2W A;  4Q5W A;  5CKD A;  3JCM h;  2HNI A;  1LOJ A;  2KDS A;  4BE0 A;  1KSW A;  1WXU A;  3TSZ A;  1LCK A;  3X25 B;  1VQ7 T;  3RUX A;  3J7A F;  4CC7 A;  4MZP A;  4VUB A;  3HRU A;  2QDL A;  1SSH A;  2WSC E;  3MO8 A;  1KD1 U;  3VRY A;  2DFU A;  2C0O A;  1JXO A;  3QYG B;  1JJ2 A;  2KGT A;  2Y4X A;  4LDX A;  3SHW A;  3T9N A;  3VKI A;  3DKM A;  4PJN A;  1PG5 B;  1U5S A;  2RM4 A;  4Z8A A;  1N6A A;  1RI9 A;  5LJ3 j;  1K8A U;  1U06 A;  3EHR A;  3H9N A;  1EX4 A;  1ZA1 B;  3WVD B;  3JB9 H;  3HFN A;  4KT0 E;  1Q7Y R;  4OB2 B;  4IUV A;  2XIC A;  1M5Q 1;  3G71 Q;  4LDV A;  2CT3 A;  1VQ8 A;  1XTD A;  3HP9 A;  2EKH A;  2X51 A;  4M7D C;  1BKB A;  2ED0 A;  4RKU E;  2X4W A;  4ZN1 A;  2QAS A;  2D0N A;  2YUP A;  1B3Q A;  4L5G A;  5CK9 A;  4XTX A;  1UB4 A;  4L59 A;  2OTL Q;  2JS2 A;  5L8R E;  1ZUY A;  4EIK A;  1YWO A;  3VS7 A;  2KT8 A;  2DD5 A;  4N4I A;  1D1C A;  4FYY B;  2B8A A;  3C4S A;  2MCN A;  3CBM A;  2EFI A;  5GAM f;  2MYS A;  3NFC A;  1OPL A;  2E1H A;  2CP2 A;  2YLC A;  2DE0 X;  2VB6 A;  2H8H A;  2DL7 A;  2RB6 A;  3P8H A;  2QK0 A;  2HSP A;  5CQX A;  3CCS A;  4JJB A;  3VYG A;  1AD5 A;  2EYQ A;  3P8D A;  3CME Q;  1UGQ B;  5GMK h;  1V1C A;  1XOV A;  4MDX A;  1AOJ A;  3N5B B;  2RA2 A;  1K9M R;  1G2B A;  3A8M B;  3SFM A;  1S72 A;  3EGD B;  1NJI C;  1NEB A;  1TXQ A;  1GXI E;  2OAU A;  1Q7Y U;  4DBH A;  2VVK A;  4WF2 A;  2RHY A;  5AT1 B;  3QG1 A;  1D1B A;  2Z0W A;  1BIA A;  1EFN A;  2CT4 A;  1QKX A;  3V8L A;  2L5Q A;  1VQ4 T;  2O9S A;  2X3X D;  1C1A A;  4J9G A;  1WHM A;  1NBE B;  1W70 A;  2NUT A;  2WAC A;  1NG2 A;  1OPK A;  1I1J A;  5CKE A;  3M4G A;  4R55 A;  4BI4 A;  2HBP A;  2K57 A;  4ZTJ A;  4B9W A;  2CP6 A;  4HCK A;  3M0P A;  2IIM A;  1JU5 C;  3DLM A;  1PHT A;  4GLM A;  1K4U S;  2NLU A;  2CUB A;  3OYJ A;  3E19 A;  3PMT A;  1X27 A;  4GY5 A;  5EC7 A;  4QVZ A;  1PC0 A;  1ABO A;  3VS0 A;  1JJ2 P;  1X2Q A;  2KNB B;  1VQL A;  3FB9 A;  2J6F A;  2RI2 A;  2YLB A;  2GTO A;  3OYH A;  3EG3 A;  3OB9 A;  3RR6 A;  2HSE B;  3NPF A;  2LCC A;  3SB2 A;  1QVG A;  4OMP A;  3CC2 T;  2LQW A;  1C0M A;  2M02 A;  4JZ4 A;  3HSB A;  3M53 A;  4PFO A;  2CRE A;  2LJ3 A;  4J9C A;  1VIF A;  2EW3 A;  4LUD A;  2K3X A;  1M30 A;  2SEM A;  3G4S A;  2FO0 A;  2ZPE B;  4D6W A;  2JJ9 A;  1M90 C;  1FMK A;  2QQR A;  3LH5 A;  4J7F A;  2O4X A;  4AT1 B;  3CME A;  1K0X A;  4XTV A;  2MOX A;  5C6S A;  1AEY A;  4M7A E;  1HXD A;  4J83 A;  1VQ9 A;  5J39 A;  3I55 Q;  1ZA2 B;  1PNJ A;  1JO8 A;  3A8O B;  2DL8 A;  1EZZ B;  2MAM A;  3MPU B;  3O5Z A;  4M75 D;  1QKW A;  4JZ3 A;  3SWN B;  1SHF A;  4WTO B;  2RQR A;  5IHN A;  4OML A;  2EBP A;  5FU6 B;  4FU6 A;  1VQP Q;  2HL3 A;  3MP6 A;  2QI2 A;  4BI3 A;  3CCE Q;  5I2S A;  2YT6 A;  3OYN A;  2BZX A;  2JW4 A;  3MP1 A;  3REA B;  4DBQ A;  2A36 A;  5HY6 A;  1Q86 C;  2XD0 A;  1OU9 A;  3FIF A;  3DLL A;  3BDL A;  3CCU T;  2MMP A;  4FCY A;  2H3J A;  3JCM P;  2R57 A;  4C0G A;  4JLI A;  2R5A A;  3CEY A;  1DJ7 B;  5LL6 S;  1Q95 G;  1KHC A;  1PRL C;  2DZ9 A;  5CO7 A;  4C0Z A;  1WX6 A;  1NEG A;  5A2Q E;  2RD1 A;  3G6E A;  4M7D D;  4B9X A;  1YI2 A;  4HA8 A;  5KYU A;  1VQ7 Q;  2B86 A;  1RI0 A;  2KRS A;  2RMO A;  3OYE A;  3CCJ T;  1VQN A;  1QVF A;  3CCU A;  2X9H A;  4JJN K;  4OGC A;  1YN8 A;  1Q82 R;  3VUZ A;  2J6O A;  1KD1 C;  2VUB A;  3KBG A;  1GBR A;  5GAN 6;  2PVG B;  3GLX A;  2FHD A;  1M1K U;  2EYZ A;  1IRX A;  1YCY A;  2MF2 A;  4KH1 B;  2X4X A;  1CKB A;  1N27 A;  2J06 A;  1K73 U;  1IHV A;  4BDY A;  3ZL7 C;  1YFN A;  2LQK A;  4IUQ A;  2HQH A;  2L3Q A;  2X4J A;  4JJD A;  5CAI A;  3QZ5 B;  2V1Q A;  4M78 A;  2EQU A;  3QDR B;  3FRN A;  4AFS C;  1G3Y A;  3OYB A;  4E7H A;  3JB9 F;  2JXB A;  4KH0 B;  3DB3 A;  2CGH A;  5M9O A;  3JCM Q;  3C12 A;  1S1N A;  5KYY B;  1CKA A;  1TG0 A;  1NYF A;  2V1R A;  2FB7 A;  2XHC A;  1JJ2 S;  3QHS A;  4X9D A;  3TCJ A;  1Z9Z A;  1YIJ T;  3QII A;  9ATC B;  4J6X A;  3QXE B;  4D8D A;  2DMO A;  3EFO A;  3RBB B;  1PM3 A;  2OTJ T;  1RAC B;  5GMK j;  3DB4 A;  1RAE B;  1PCX A;  2F5T X;  5HK0 A;  1QMC A;  2ZPG B;  1OYX A;  3P8B B;  2P4T A;  3H8Z A;  1BBZ A;  3HTR A;  2QQA A;  2HQE A;  3OYL A;  3CC2 A;  3QDF A;  3BY7 A;  1EIF A;  3MEV A;  4C8Q A;  5GAN j;  2AZS A;  4KGX B;  1BCM A;  4M78 E;  4RTT A;  4DEX A;  5GAN 8;  3CCJ A;  4BE2 A;  1QVG S;  1BB9 A;  1QCO A;  3VV0 A;  4CC4 B;  2P4R A;  2COZ A;  4CC2 A;  2QEX A;  1RAD B;  3G6E Q;  5CIU A;  4M7A C;  4XU0 A;  1G3W A;  1GBQ A;  4F04 B;  3MCA B;  5CKH A;  1BI2 A;  2EVR A;  2BIV A;  1Y7X A;  4M78 F;  3VYH B;  4ELY C;  4PJO G;  3M9Q A;  4M7A A;  1H3H A;  5LJ5 f;  1TOV A;  1YJ9 Q;  4AFZ C;  2D9T A;  4LD6 A;  3I35 A;  5KE3 A;  5KYU B;  4MML A;  2VAS A;  3BDU A;  2RJF A;  3RIR A;  1N8R C;  4ZGE B;  5DM7 R;  3GIB A;  2JMA A;  2DO3 A;  1ACM B;  4M7A G;  4E47 A;  5LJ5 g;  3CCR A;  5IHI A;  2FZG B;  2LT4 A;  2M1H A;  4PJO A;  1KIK A;  1KQS A;  3JCM X;  2BE7 D;  3I56 Q;  3S3M A;  1VQ5 T;  2ZPH B;  4M7D B;  3CPF A;  2FYK A;  4BUG A;  2C06 A;  1TS9 A;  5D6W A;  2MWP A;  1AT1 B;  3WVE B;  3G4S Q;  2FL7 A;  1D3B A;  4C8Q G;  1JBM A;  3M55 A;  3RKW A;  3H41 A;  2V8J A;  2V26 A;  4M77 C;  4QQ6 A;  4V2S A;  3VJP A;  3RKX A;  4ZTF A;  4PNO A;  1WLP B;  2K4Y A;  4ESR A;  3GOX A;  3PTA A;  2ECZ A;  3CCM A;  5GAO p;  2GCX A;  4A4H A;  3OYF A;  3OS1 A;  4J9F A;  2CSI A;  3H0H A;  1VQK T;  4FIB A;  4C8Q C;  2VC8 A;  1S72 T;  1H8K A;  1JXM A;  2C0I A;  1AVZ C;  3PVL A;  3V8J A;  4F7U F;  3CPW S;  2DJQ A;  4M78 G;  2HMA A;  4OMQ A;  1VQ6 T;  2KK4 A;  1JEG A;  3CCV Q;  3A8H B;  4XK8 E;  3H0I A;  1IXD A;  2C0T A;  1OUL A;  1K9M U;  3L2Z A;  2JM9 A;  2JVV A;  4M7A D;  1M8V A;  2E4H A;  5LJ3 f;  3VRZ A;  2HAX A;  2JNG A;  2QYZ A;  3MEU A;  4E7S A;  1ABQ A;  4N4G A;  3QWY A;  3FLG A;  3L1A A;  3G4S T;  1Q82 C;  2K5I A;  2QQS A;  4KBM B;  4FW1 A;  1LPL A;  3CCR T;  1MUZ A;  2VXF A;  2YUO A;  1AHJ B;  3CMA T;  4P5N A;  1YHQ T;  1ZQ1 A;  1WHH A;  2L3S A;  6AT1 B;  2LJ0 A;  1QVF S;  2AK5 A;  2LVM A;  1LNX A;  1VQN Q;  4E7Z A;  3JRZ A;  1F1B B;  5D7U A;  5GAM e;  3OA6 A;  3QWX X;  4GLK A;  2QA4 Q;  3GNG A;  3KUF A;  2VGM A;  3PFS A;  2A37 A;  4M7D F;  1HK9 A;  1YWP A;  1K0S A;  4N4H A;  2LX9 A;  2F2V A;  3G71 T;  3CCS Q;  2JTE A;  3R6N A;  5GMK i;  4RMO A;  1WJQ A;  1XQH A;  2GFA A;  4QQG A;  2XK0 A;  3CCE A;  2QDY B;  4RTX A;  3QUI A;  2MK5 A;  4N0A C;  1M1K C;  1OU8 A;  4M75 F;  4CI0 C;  2LDM A;  3EG9 B;  3OYY A;  2EIF A;  2CZ1 B;  4LDY A;  3CXC P;  2DM1 A;  5HK3 A;  1Y96 A;  2L8D A;  1KK7 A;  3VS1 A;  2HCK A;  5CQY A;  5J26 A;  3TQ7 P;  2RK2 A;  1SHG A;  2K5L A;  2RQV A;  1AZG B;  3V8K A;  3VS4 A;  1WXT A;  1TSF A;  4C5H A;  1X6G A;  2RHZ A;  5I21 A;  2QA4 A;  3X28 B;  5IN1 A;  2QEX Q;  1K73 R;  5C0M A;  3OS5 A;  4PJO F;  4EMK B;  3EGD A;  2OAW A;  1OEB A;  3JV3 A;  3PMI A;  1ZHI A;  1SRM A;  1G8X A;  1X2K A;  2DF6 A;  2CP5 A;  5FU7 B;  2YRV A;  3OBW A;  1RAH B;  4BY6 C;  1R0B G;  1X6B A;  4QQD A;  2CYZ B;  2PQW A;  5KYX A;  1SSF A;  2GQV A;  1QP2 A;  4PLI A;  3R6O A;  2JOY A;  3JCM d;  5A0D A;  5DLO A;  3CC7 T;  2LC4 A;  5FW9 A;  1YJW A;  3G6E T;  1NJI U;  5GAN d;  1UG1 A;  1QW1 A;  1RAA B;  1I5O B;  1M3C A;  3LW5 E;  1WJS A;  2FZK B;  2KYB A;  5GAN 7;  1J3T A;  5LJ5 j;  1UE9 A;  4C92 F;  3EHQ A;  1FXX A;  1T3L A;  3I5R A;  5IXF A;  2EQI A;  3H0F A;  1QWE A;  2V8K A;  1UGP B;  3EGX A;  3ER0 A;  4EDU A;  2QAZ A;  3UDC A;  1M3A A;  1BU1 A;  4AFU C;  4LXC A;  5GAN 4;  2KY9 A;  3HRS A;  2ABL A;  3MET A;  4FYV B;  2EYX A;  4J9I A;  3CCV A;  2QG9 B;  1V29 B;  2LX7 A;  3NTK A;  1IB8 A;  4BAC A;  1NM7 A;  5I11 A;  3TEE A;  3CC7 Q;  1VQK Q;  4DOW A;  2QTX A;  1W2B A;  2PVD B;  1YIJ A;  2DX1 A;  1VYU A;  3CD6 A;  1QVP A;  4J9D A;  4IUU A;  3UPU A;  1ZSZ A;  1ARK A;  4KGV B;  2DBK A;  2R5M A;  1VQ4 Q;  4ANJ A;  1VQO Q;  1KFZ A;  4XQ3 A;  5HKC A;  4HKE A;  1FMW A;  1ZX6 A;  2O9V A;  2PTK A;  2GFU A;  1VUB A;  1SEM A;  2COW A;  1KHI A;  1WHL A;  4OB3 B;  1ZSZ C;  1UUE A;  1MV3 A;  1W4S A;  3CCQ Q;  1D0Z A;  1WHJ A;  2DA9 A;  1OV3 A;  3HFO A;  3H6Z A;  5LJ5 h;  2K3Y A;  2LJ1 A;  2EJG A;  4JUV A;  2PUK B;  2ROL A;  2DD4 A;  1I07 A;  3VS6 A;  2RNA A;  4BD3 A;  5CR2 A;  3JCM J;  3GNF B;  4JRQ A;  1WHG A;  4M7A F;  1P92 A;  4FM4 B;  4YTL A;  3I55 A;  4AFQ C;  4J8O A;  3JCM f;  2CP0 A;  1WQ7 A;  1QCN A;  1VQ8 Q;  2K5F A;  3L2Q A;  3NMZ C;  3CC4 T;  3CCL Q;  2VKN A;  2O2O A;  1KJW A;  4XTZ A;  3RKY A;  4QVD A;  1MGQ A;  2EYW A;  2ZPI B;  5AYF A;  1VQM T;  1ZBJ A;  2BZY A;  4PJO B;  1WPY A;  4LN2 A;  3TSW A;  1M2V B;  1X69 A;  3EH2 A;  2E64 A;  3OYD A;  1ZUK A;  4DBF A;  4OP0 A;  3CBP A;  3MKD A;  3OW2 A;  1HD3 A;  1MMN A;  4LD9 K;  4PJO C;  2EGE A;  1M9S A;  4D8K A;  2YUN A;  4E7I A;  2ZPF B;  3MEA A;  2JUF A;  3S6W A;  4ZNX A;  2KE9 A;  3M0R A;  2Y90 A;  1IGQ A;  1RUW A;  1UJY A;  1NLP C;  2DTI A;  4JRI A;  1PSE A;  2O31 A;  1NLO C;  1TH7 A;  2DL3 A;  2L2P A;  2OJ2 A;  2DK3 A;  4Z88 A;  1B7T A;  2HKQ B;  3I56 T;  2KEA A;  1H92 A;  4C8Q B;  2RHX A;  4RTU A;  5GJV B;  2JTF A;  1MMA A;  1TTH B;  5LJ3 g;  5KCH A;  3MP8 A;  1GCQ C;  3QJ6 A;  1JB0 E;  5FRN A;  2G6F X;  5FRM A;  4C8Q F;  5ECA A;  1VQK A;  4XU3 A;  1QCF A;  1AZE A;  2ZZD A;  8AT1 B;  1WXB A;  3FJP A;  2PU9 B;  1GCQ A;  2K2M A;  2EKO A;  3URG A;  1JQQ A;  1YI2 Q;  2P84 A;  2DET A;  2MPX C;  1VIE A;  2E6Z A;  4NL2 A;  4RG8 A;  1YJN Q;  2DER A;  1KG1 A;  5LJ3 e;  4M77 E;  1Q7Y C;  3CCL A;  2IVW A;  1NJI R;  4L6V 5;  2KI7 A;  4HVW A;  1D3B B;  1Q86 R;  2AT1 B;  4FT2 A;  4C5E A;  2RF0 A;  2XU8 A;  3OBY A;  2DXB A;  1N8R U;  5A0G A;  3Q1J A;  1VQM Q;  4IKF A;  2E41 A;  4F7U A;  4M4Z A;  1ZLM A;  4A4K A;  2X4Y A;  4BI8 B;  2H3E B;  2DL5 A;  7AT1 B;  2CSQ A;  2OTL A;  4CRI A;  2KRO A;  4F16 A;  3RDV A;  3OS0 A;  3G7Z A;  1VQN T;  4J9B A;  1WA7 A;  3CCR Q;  1KC8 U;  3L2V A;  1RAI B;  3U23 A;  4RTZ A;  3I56 A;  2A0F B;  4LDW A;  1K1Z A;  2M0Y A;  4DBR A;  1IGU A;  1X6O A;  1VQ9 Q;  3VU3 C;  4A4E A;  3OS2 A;  3G71 A;  3TRE A;  1YJN A;  4IUP A;  2BUD A;  3PVQ A;  2HL5 C;  5GAO m;  3EFO B;  4RCB A;  1K9A A;  4FT4 A;  4AG2 C;  1T3S A;  3BE3 A;  3JSC A;  1SF9 A;  2MI6 A;  1FYN A;  2OTL T;  1YP5 A;  1VQ4 A;  2NYS A;  1KQ1 A;  2LCL A;  3UA6 A;  3EGX B;  2AIR B;  1YIT T;  1I5L A;  5LJ3 d;  5GMK m;  2FRW A;  1M8M A;  1VYV A;  2XID A;  2WSE E;  3IQL A;  2KQW A;  2DZC A;  1M2V A;  2MIO A;  1OX9 A;  4PJO D;  5FU7 C;  1VQ9 T;  2L89 A;  3CC4 Q;  3CCL T;  2EQM A;  3C95 A;  4J7I A;  2V8I A;  3CC2 Q;  2XDB A;  4C92 G;  4LE9 A;  2CDT A;  3EG0 A;  2E65 A;  4ORZ A;  3RES A;  4IUR A;  3I5S A;  3CQT A;  3OYC A;  3OYA A;  2F2X A;  4PKC C;  1U3O A;  4MMK A;  2CP3 A;  5GAM g;  2LNV A;  2VV5 A;  2DVJ A;  4M78 B;  2J7I A;  2KT1 A;  3M54 A;  3CMA A;  4ZGJ B;  4HT8 A;  3QO3 A;  2JTM A;  3MEW A;  1MMG A;  2VGN A;  5J3B A;  3NTI A;  4JLG A;  3VS2 A;  1TUG B;  2CH4 A;  3ZEH A;  1X01 A;  3PE0 A;  4KRT A;  3JB9 I;  3BFM A;  1SG5 A;  4KUL A;  5GAO l;  1VQ7 A;  3QSU A;  3UWN A;  2E3H A;  4FYX B;  2KBT A;  5GAO q;  3OW2 S;  1AWW A;  5IT9 E;  2ROT A;  2O88 A;  4XU1 A;  1RAF B;  5GAM j;  1I8F A;  2GGR A;  1Y07 A;  3CCS T;  1LJO A;  2F69 A;  4CC3 A;  5KYX B;  4C5I A;  4X34 A;  2P0P A;  1YJN T;  2FG0 A;  1B34 B;  3EG2 A;  3PIP A;  4EMH A;  2K9G A;  1ZSZ B;  5CCA A;  5LJ3 h;  4LDU A;  3EG9 A;  3CC4 A;  2QEX T;  2CUD A;  2QQB A;  2DRM A;  4ELZ C;  1Q81 R;  4NS5 A;  3E9F A;  3I55 T;  1X43 A;  1WIE A;  4II1 A;  1E6H A;  2W0Z A;  3EFS A;  3G1J A;  4RTW A;  4M77 G;  2DL4 A;  4E7J A;  1H64 1;  2DBM A;  2FPF A;  2KAF A;  5FRO A;  2CKK A;  4WCI A;  1PSF A;  2W10 A;  2BKD N;  4QKU A;  2DAQ A;  4ZGD B;  4M75 B;  1HSQ A;  2XMF A;  2JN0 A;  2GTJ A;  1PKT A;  2KRN A;  5EG2 A;  4EMK A;  3RER A;  4A4F A;  1VQ6 A;  3SWN C;  2OX7 A;  3M56 A;  4PLL A;  1YJ9 A;  4LNP A;  2NUT B;  2KR3 A;  3J81 E;  1IHW A;  2AKL A;  2MWO A;  4DQ2 A;  3JAM E;  1W1F A;  2M16 A;  4NOY A;  1NZ9 A;  2L3P A;  2DXT A;  4M77 B;  1UHF A;  5DLQ E;  1YNZ A;  4OMM A; 
#chains in the Genus database with same CATH homology
 5I11 A;  2VWF A;  4IIO A;  2FEI A;  5IHK A;  2DYB A;  4OMO A;  4JJC A;  4JPB W;  1PRL C;  2DX1 A;  1AWJ A;  1VYU A;  4F17 A;  1WX6 A;  2SRC A;  1NEG A;  4J9D A;  4RTV A;  2KXD A;  5HCK A;  1ARK A;  1WFW A;  2DBK A;  2B86 A;  2KRS A;  1KFZ A;  2RMO A;  3A98 A;  2KYM A;  1ZX6 A;  1IO6 A;  1UJ0 A;  3UF4 A;  4OMN A;  2O9V A;  2PTK A;  2FRY A;  2HDA A;  1SEM A;  1YN8 A;  4Y92 A;  1UUE A;  1MV3 A;  1E7O A;  2AKK A;  4HVU A;  2J6O A;  1Y57 A;  2RN8 A;  1TUD A;  4GBQ A;  1GBR A;  1M3B A;  2DA9 A;  1OV3 A;  1UTI A;  2EYZ A;  3VS5 A;  2DIL A;  2LJ1 A;  2PZ1 A;  3NGP A;  1CKB A;  1QWF A;  1RLP C;  2A08 A;  2J06 A;  2ROL A;  3VS3 A;  3GBQ A;  3M0Q A;  1I07 A;  3VS6 A;  2RNA A;  3ZL7 C;  2L3Q A;  2HEQ A;  2L0A A;  4JJD A;  2LCS A;  2V1Q A;  4HVV A;  4AFQ C;  4AFS C;  2BZ8 A;  1NYG A;  2JXB A;  2LQN A;  2LNH B;  2A28 A;  1TUC A;  3NMZ C;  1UHC A;  2RQT A;  2VKN A;  2K7A A;  2PNI A;  2O2O A;  1KJW A;  1S1N A;  1CKA A;  1TG0 A;  1NYF A;  2V1R A;  3UA7 A;  2EYW A;  1Z9Z A;  1ZBJ A;  5L23 A;  2LZ6 B;  4D8D A;  2BZY A;  2DMO A;  3RBB B;  2GBQ A;  4LN2 A;  3TSW A;  1X69 A;  1HJD A;  1I0C A;  2GNC A;  2EPD A;  1BBZ A;  4J9H A;  1ZUK A;  1K76 A;  1VYT A;  2ESW A;  2NUZ A;  1W6X A;  1HD3 A;  3EG1 A;  2AZS A;  2E5K A;  1N5Z A;  4K11 A;  4RTT A;  4DEX A;  2EGE A;  2YDL A;  2YUQ A;  1BB9 A;  4D8K A;  2YUN A;  1GRI A;  2P4R A;  4CC4 B;  2J05 A;  4CC2 A;  4HXJ A;  3M0T A;  4ZNX A;  2KE9 A;  3M0R A;  1RUW A;  1UJY A;  1E6G A;  1CSK A;  1NLP C;  4LUE A;  1PRM C;  2CH4 W;  1GBQ A;  2EVR A;  2LP5 A;  2O31 A;  1NLO C;  2DL3 A;  4AG1 C;  2L2P A;  2OJ2 A;  3M0U A;  4Z88 A;  1H3H A;  1GFC A;  4AFZ C;  4F14 A;  1SPK A;  2JS0 A;  2I0N A;  2KEA A;  1H92 A;  5FWC A;  3I35 A;  4RTU A;  1AWX A;  5GJV B;  5IH2 A;  2EYY A;  3KFV A;  1G83 A;  1GCQ C;  2JMA A;  1GCP A;  2G6F X;  1AWO A;  5ECA A;  2RQU A;  4DEY A;  5IHI A;  4E6R A;  2HBW A;  1KIK A;  2FPD A;  1QCF A;  1AZE A;  1WXB A;  1YCS B;  3TVT A;  1GCQ A;  2FPE A;  2K2M A;  1JQQ A;  2F2W A;  3NHN A;  1KSW A;  4R0K A;  3SEM A;  1WXU A;  3TSZ A;  1LCK A;  1T0H A;  4CC7 A;  4HVW A;  2QDL A;  1SSH A;  3H41 A;  2DLP A;  3VRY A;  2C0O A;  1JXO A;  2RF0 A;  2KGT A;  1WLP B;  4ESR A;  3C0C A;  4J9E A;  3SHW A;  2AZV A;  2ECZ A;  1U5S A;  5IXB A;  4M4Z A;  1ZLM A;  4Z8A A;  4J9F A;  1RI9 A;  2CSI A;  3H0H A;  1Z9Q A;  2DL5 A;  2CSQ A;  1U06 A;  2YSQ A;  3EHR A;  3UAT A;  2D1X A;  2KRO A;  2BTT A;  4F16 A;  1H8K A;  1JXM A;  2CT3 A;  2C0I A;  1AVZ C;  2KRM A;  3PVL A;  2EKH A;  2ED0 A;  2DJQ A;  2X3W D;  4J9B A;  1WA7 A;  4OMQ A;  4A63 B;  2GQI A;  1B07 A;  2D0N A;  1JEG A;  2YUP A;  3H0I A;  3U23 A;  1B3Q A;  4RTZ A;  1UFF A;  2C0T A;  3EGU A;  1OOT A;  1K1Z A;  2M0Y A;  2JM9 A;  1Y0M A;  2JS2 A;  3VRZ A;  1ZUY A;  4EIK A;  1YWO A;  3VS7 A;  2KT8 A;  1ABQ A;  3QWY A;  2EGA A;  5I22 A;  3PVQ A;  2MCN A;  4QT7 A;  1K9A A;  4AG2 C;  1MUZ A;  1OPL A;  2YUO A;  1T3S A;  1MV0 B;  2DE0 X;  2H8H A;  2DL7 A;  1FYN A;  2L3S A;  1YP5 A;  2HSP A;  2LJ0 A;  4JJB A;  1AD5 A;  2AK5 A;  3UA6 A;  1BK2 A;  1V1C A;  1XOV A;  2DNU A;  1AOJ A;  1G2B A;  3QWX X;  2FRW A;  1M8M A;  1NEB A;  1VYV A;  3IQL A;  2M51 A;  2A37 A;  1VA7 A;  1GFD A;  1YWP A;  2K6D A;  2RQW A;  1K0S A;  2MIO A;  2VVK A;  2F2V A;  1EFN A;  2CT4 A;  1QKX A;  2JTE A;  2O9S A;  2X3X D;  4J9G A;  3R6N A;  1W70 A;  4LE9 A;  1NG2 A;  2CDT A;  1OPK A;  1I1J A;  2JMC A;  3EG0 A;  4ORZ A;  3I5S A;  4X1V A;  4RTX A;  3CQT A;  3REB B;  2F2X A;  1U3O A;  3M0S A;  1PKS A;  1WDX A;  2DRK A;  1UDL A;  1GL5 A;  4HCK A;  2DVJ A;  3M0P A;  2J7I A;  2KT1 A;  2IIM A;  1JU5 C;  1PHT A;  4GLM A;  4RUG A;  2DM1 A;  1K4U S;  2CUB A;  1X27 A;  2NWM A;  3VS1 A;  1UGV A;  5EC7 A;  2HCK A;  3VS2 A;  2CH4 A;  4IIM A;  1ABO A;  3PE0 A;  4KRT A;  3VS0 A;  2ENM A;  1SHG A;  1X2Q A;  2K79 A;  2KNB B;  2RQV A;  4RTY A;  1AZG B;  3I9Q A;  2J6F A;  3VS4 A;  2GTO A;  1WI7 A;  3FJ5 A;  1WXT A;  5FWB A;  2KXC A;  1WYX A;  2KBT A;  1AWW A;  2LMJ A;  1QLY A;  2ROT A;  1X6G A;  3EG3 A;  2O88 A;  3THK A;  3NPF A;  2GGR A;  2JT4 A;  4OMP A;  5GJW B;  4CC3 A;  2LQW A;  2FG0 A;  3EG2 A;  4JZ4 A;  2K9G A;  2OAW A;  1OEB A;  2CRE A;  3JV3 A;  1SRM A;  1ZUU A;  1X2K A;  2DF6 A;  2LJ3 A;  4J9C A;  2EW3 A;  2K3B A;  2CUD A;  2ED1 A;  4LUD A;  1M30 A;  2SEM A;  2FO0 A;  3RNJ A;  2DRM A;  1X6B A;  1T0J A;  1FMK A;  3LH5 A;  3ULR B;  1X43 A;  1WIE A;  1E6H A;  1K0X A;  2JM8 A;  2W0Z A;  5FW9 A;  4RTW A;  1M27 C;  2MOX A;  2J6K A;  1UG1 A;  1ZSG A;  1AEY A;  1M3C A;  2DL4 A;  2KYB A;  1PNJ A;  1JO8 A;  2DBM A;  2DL8 A;  1J3T A;  1PWT A;  2FPF A;  2RPN A;  1UE9 A;  3EHQ A;  4WCI A;  1T3L A;  1SRL A;  3I5R A;  5IXF A;  2W10 A;  2EQI A;  3H0F A;  1QWE A;  3O5Z A;  1QKW A;  4JZ3 A;  1HSQ A;  1SHF A;  2XMF A;  1M3A A;  2GTJ A;  1PKT A;  2RQR A;  1BU1 A;  2KRN A;  5IHN A;  4OML A;  2EBP A;  4AFU C;  2D8H A;  4LNP A;  2EGC A;  2KR3 A;  1RLQ C;  2ABL A;  2YT6 A;  2AKL A;  2BZX A;  2JW4 A;  1UEC A;  3REA B;  2EYX A;  1W1F A;  2A36 A;  2OI3 A;  4J9I A;  2L3P A;  2D8J A;  4FSS A;  1A0N B;  2LX7 A;  1UHF A;  4Z89 A;  1YNZ A;  4OMM A;  1NM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...