3EG3A

Crystal structure of the n114a mutant of abl-sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
total genus 12
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg3A00
1BBZA 4J9CA 1K0SA 4DEXA 2YSQA 1IO6A 2LJ1A 4F16A 2AZSA 1GBQA 4AFSC 4Z89A 1AZGB 2KT1A 3C0CA 3THKA 2AKLA 1GRIA 1OEBA 4HVVA 2JM9A 2LJ0A 5FWCA 2K6DA 2FPEA 3UF4A 2P4RA 3VRYA 5FW9A 4J9DA 3EHQA 2DVJA 1GFCA 1ZBJA 4AG1C 1SSHA 2LQWA 2L3QA 3VS7A 2D1XA 2DBKA 2NWMA 5IHKA 2E5KA 2OAWA 1ZUKA 2YUQA 3GBQA 2JMCA 4GBQA 2EVRA 1WFWA 3UATA 2OJ2A 2XMFA 1QCFA 2LP5A 3REBB 3TVTA 3H0IA 3M0SA 1SRLA 2KXCA 1YCSB 4AFZC 1M30A 1NLOC 2HCKA 4OMNA 1MV3A 4AFUC 1XOVA 1S1NA 1NEBA 2LJ3A 1SRMA 1E6HA 2DL5A 2KNBB 2KROA 3QWXX 1X6GA 2DNUA 4RTYA 3I5SA 2JT4A 4JPBW 2FRWA 2BZ8A 4OMPA 3ULRB 1ZUYA 2QDLA 4RUGA 1GFDA 1ZUUA 2YDLA 1B3QA 1BK2A 1UE9A 1K9AA 2EGAA 1YWOA 4OMQA 3RBBB 1M3BA 1OPKA 1GCQC 2A28A 2FEIA 2CDTA 1JQQA 5IHIA 1Y0MA 1AZEA 4Y92A 3VS2A 1WLPB 2DL7A 2O31A 1HJDA 1NYFA 1AOJA 2BTTA 2KEAA 1JXOA 2F2VA 2CH4W 3I5RA 1M8MA 1Z9ZA 2CT4A 2JS0A 2RQRA 2K7AA 1I1JA 1NEGA 2SRCA 2DE0X 1WX6A 2W0ZA 1I0CA 4ORZA 2D0NA 2RQTA 4F14A 4QT7A 5IH2A 4HVWA 3U23A 1M3AA 1UG1A 4Z8AA 3UA7A 1X2KA 2EYWA 1UTIA 1GCPA 2RQUA 4ESRA 2DM1A 2D8HA 4J9EA 1NYGA 4RTUA 1K1ZA 1CKAA 4X1VA 1AWXA 1PRMC 2VVKA 2ED0A 4F17A 1JU5C 1WXBA 2AK5A 2K79A 2FRYA 3EG1A 1WXTA 4JJDA 2L3PA 2LMJA 2AKKA 2KYMA 1ABQA 2JTEA 5GJWB 1UHFA 1VYTA 1J3TA 2CSQA 2EKHA 1E7OA 2FPFA 2YUOA 3EG3A 3VS3A 2ECZA 1JEGA 1G2BA 1X43A 4EIKA 3H41A 2W10A 4E6RA 2KR3A 1T3SA 2RN8A 2KT8A 2DL3A 2ESWA 1H92A 2JW4A 4KRTA 1QWEA 2ABLA 2EGEA 2EQIA 1SPKA 5GJVB 3PVQA 1H3HA 3TSWA 1QKWA 2ROTA 2HEQA 1UJYA 2DYBA 1T0HA 4AG2C 1W1FA 2LQNA 4LN2A 1UUEA 2EGCA 5HCKA 2EYYA 2PTKA 2CUBA 2D8JA 2M0YA 2YT6A 1AWWA 1GL5A 3LH5A 2JS2A 1VYVA 2DLPA 1RLPC 1SHGA 1LCKA 2EYXA 4OMLA 4IIMA 4A63B 2KRNA 2RPNA 1BB9A 1NG2A 1VYUA 1AWJA 2GQIA 2FG0A 2G6FX 2MCNA 4FSSA 4OMMA 4J9HA 4JZ3A 2DX1A 4RTXA 4JZ4A 2X3XD 2KRMA 2ROLA 3M0RA 1PKSA 3PE0A 1A0NB 3H0HA 1UECA 2J05A 2EBPA 2DJQA 4RTTA 3I35A 3VRZA 4JJCA 1AEYA 3SEMA 1BU1A 1WA7A 2LZ6B 3TSZA 2KE9A 2C0OA 3FJ5A 3NMZC 3KFVA 2CUDA 2DILA 1K4US 2JM8A 1T3LA 1CKBA 1CSKA 1M27C 1MUZA 1QLYA 4M4ZA 1U5SA 1U3OA 2PNIA 2B86A 4HCKA 3I9QA 1UDLA 4D8KA 2GGRA 4IIOA 1KJWA 2CT3A 2J6FA 1FMKA 1OV3A 2EYZA 1AVZC 2BZYA 1Z9QA 2DA9A 2F2XA 4LE9A 2J6KA 1SHFA 2JXBA 2O9SA 1UHCA 2I0NA 5ECAA 3VS1A 4RTVA 3IQLA 4Z88A 2J7IA 4J9GA 2EW3A 5IXBA 2DL8A 3ZL7C 3EGUA 1X27A 1OPLA 2OI3A 4ZNXA 2HBWA 1K76A 4RTWA 3RNJA 2L2PA 1PHTA 2GTJA 2KYBA 2FPDA 1UFFA 3EG2A 2IIMA 3UA6A 2MIOA 1JO8A 1T0JA 4GLMA 2KXDA 3O5ZA 4R0KA 1WXUA 4WCIA 1K0XA 1TUDA 1SEMA 1GCQA 4LUEA 1RLQC 1TUCA 1X69A 2VKNA 1W6XA 2J6OA 2DF6A 4LNPA 1ABOA 2KGTA 5FWBA 1PRLC 1M3CA 1OOTA 2A37A 2RQVA 1ZX6A 5L23A 2YUNA 4CC7A 1HD3A 1QKXA 3H0FA 2A08A 2K9GA 3EG0A 2DBMA 4RTZA 4HXJA 1U06A 3VS0A 4LUDA 2A36A 1WYXA 2HSPA 1W70A 2GNCA 1QWFA 1E6GA 2F2WA 1X6BA 2V1RA 4AFQC 2PZ1A 1RI9A 1KIKA 3VS4A 2K3BA 1PKTA 1G83A 2H8HA 3A98A 3R6NA 2K2MA 1ZSGA 2DRMA 2FO0A 2GTOA 2LCSA 1TG0A 3M0PA 2KRSA 3VS5A 2BZXA 2MOXA 1NM7A 2RMOA 1H8KA 2SEMA 1JXMA 2CH4A 2KBTA 2RF0A 2EPDA 2LX7A 2L3SA 1WIEA 1PWTA 1X2QA 2C0IA 1GBRA 1RUWA 1YN8A 2GBQA 1V1CA 1ARKA 3M0QA 2NUZA 3PVLA 5EC7A 1AWOA 3M0TA 5I11A 4CC4B 1KFZA 2LNHB 1I07A 2DL4A 4CC3A 1AD5A 1MV0B 3NGPA 2DMOA 3QWYA 3SHWA 2X3WD 1YNZA 2O88A 2CREA 1B07A 1UGVA 2VWFA 5I22A 1PNJA 2ENMA 2J06A 2M51A 2O9VA 2AZVA 1UJ0A 3NPFA 4CC2A 1WDXA 4K11A 1YWPA 5IXFA 3NHNA 1YP5A 1VA7A 1KSWA 1N5ZA 2RNAA 2ED1A 3CQTA 1ZLMA 4DEYA 3JV3A 1Y57A 1FYNA 2L0AA 3EHRA 5IHNA 1EFNA 1HSQA 1WI7A 2C0TA 4J9FA 3REAB 2YUPA 4HVUA 2RQWA 3M0UA 3VS6A 2JMAA 1NLPC 4J9IA 4JJBA 4J9BA 4D8DA 2DRKA 2CSIA 4OMOA 2V1QA 2O2OA 2HDAA
chains in the Genus database with same CATH superfamily
1BBZA 1K0SA 4DEXA 2FL7A 3CCMA 4F16A 2R5AA 3C0CA 4PJLA 4M75D 1XJWB 1OEBA 2JM9A 2QTVA 1TSFA 2MI6A 3M57A 5GMKl 1PD0A 5KYXA 5FW9A 2QXFA 4J9DA 1YBYA 1GFCA 1QVGP 4ELZC 4CRIA 2QG9B 2E5KA 2OAWA 2QK0A 3CCSQ 1RAIB 2DETA 4QVCA 2EVRA 2QQAA 3UATA 1Q81R 3NFCA 1UGPB 2DIQA 3CBPA 4KBMB 3FC3A 2NUPA 3MPUB 2HCKA 4OMNA 1K9MC 2XHCA 4BDZA 1S1NA 1NEBA 4RCBA 1G3SA 2LJ3A 2VXEA 4J6XA 1SRMA 1VQ4T 2JN0A 3PFSA 4LD6A 5CO7A 4F04B 3QWXX 1X01A 5KYUB 1N6AA 3WVEB 5GANd 2JT4A 4JPBW 5KYYA 4XK8E 2CZ0B 4OMPA 4NS5A 1I5LA 3EGDB 5A0GA 2EJFA 3RKWA 2DXBA 1ZUYA 1M1KR 3META 4V2SA 3AHUA 4C92B 3MCAB 4R56A 1BK2A 1G3WA 1AHJB 1QCNA 1YI2A 4OMQA 3L1AA 1YJWT 1GCQC 2A28A 2FEIA 1YI2T 5IHIA 1AZEA 4Y92A 3OS0A 3VS2A 4M7DA 5LJ3h 2L3RA 3CCVT 2O31A 1HJDA 1NYFA 1TS9A 2KEAA 3CCUA 3OYIA 1OQKA 1JXOA 3CC7A 5D7UA 4FYYB 4FYVB 2XU8A 2CT4A 3VYGA 3HSBA 1SSFA 2H3JA 4PKCC 2PVGB 1NEGA 4JRIA 4PFPA 1M90R 1RAAB 3PT9A 1SG5A 3UPUA 3I55Q 2X9HA 2D0NA 2RQTA 1QVFA 4C8QA 2VGNA 1S72T 3L2QA 4FSXA 2CP7A 1M3AA 1VQ6Q 2F5KA 2EWNA 1G5VA 1X2KA 4C0GA 3MP1A 2DTHA 4D6WA 4FU6A 1TOVA 2D8HA 1NYGA 2FZCB 3CD6Q 3OW2P 2VVKA 1Q82R 2ED0A 3M59A 4F17A 1I5OB 2P0PA 1JU5C 2OTLA 1RAFB 2FRYA 3EG1A 4L59A 3L2WA 1IHWA 1UEBA 4JJDA 2D9TA 2E6ZA 1C6VX 1BCMA 1Y96B 3OS1A 3OYMA 1ZBXA 4C92E 1VYTA 2CSQA 4P5NA 1K8AU 4QKUA 2YUOA 4KH0B 3EG3A 2CP6A 1JEGA 4JRKA 1WHKA 4EIKA 3H41A 3WVDB 2W10A 4OB0B 4E6RA 4IUVA 3E19A 4KRTA 5CKEA 3QZ5B 3URGA 1BYMA 1JJ2P 2EQIA 4O5VA 1NE8A 1H3HA 3E9GA 4PJOB 2MF2A 3QO3A 4M77B 4AG2C 2QTXA 3S3NA 3G6ET 1OU9A 3DKMA 1EZZB 1I4K1 4LN2A 5HCKA 2PUOB 2CUBA 2D8JA 2M0YA 2PTKA 2YLBA 1WJQA 2OAUA 1VYVA 1RLPC 1SHGA 2GCXA 2LX9A 3CMAT 4IIMA 1YJ9A 2RPNA 2Y90A 2LT4A 3G1JA 5GAN4 2X4YA 5GAN8 1BB9A 2OTJQ 3EFSA 4XU1A 4N0AA 4OMMA 3LWIA 2E5QA 4XTZA 2DX1A 3CC4A 3QHSA 2M1HA 4B6MA 3P8HA 2NUPB 1VQKT 1YI2Q 2EBPA 2ZCFB 4IUQA 4JJCA 5AT1B 1KQ2A 3OA6A 1BU1A 2LZ6B 4J8OA 2KE9A 4M7AB 2C0OA 3FJ5A 5LJ3f 2KI7A 2HL3A 2DILA 1H641 1U1TA 2VC8A 3G4ST 1PCXA 3OYBA 1O9SA 1T3LA 1CKBA 1M27C 2CS7A 5LJ5h 5A2QE 4J83A 2VGMA 3SD4A 2M0OA 5CK9A 2B86A 2CP0A 1UDLA 4IIOA 1VQ7T 1KJWA 2CT3A 4KGZB 1FMKA 1AVZC 4M7AF 2HMAA 5GANj 2K57A 2F2XA 4DBHA 2JXBA 4EMKB 4J5YA 1S72Q 4RTVA 3JCMd 2E3HA 4X34A 2LQ8A 5IXBA 3EGUA 1X27A 3MEUA 4RMOA 2AHJB 4RTWA 2DD5A 2E1HA 3SFMA 2KYBA 1MMNA 2E4HA 2FPDA 3EG2A 3CD6A 1FXXA 2DIGA 1D3BA 3O5ZA 1K0XA 1TUDA 3EGXA 1UGQB 2IPOB 5GAOm 4M78G 2VKNA 4C92G 4ZGJB 3QZ9B 4IUUA 1VQ8Q 2KGTA 3JCMg 3G6EQ 1PRLC 1M3CA 1OOTA 2M16A 3CPWA 2LDMA 2A0FB 2KSSA 1R0BG 2F1LA 1HD3A 3FRNA 1VQ5T 3EH1A 3HKSA 4C8QB 2DBMA 1ZHIA 2BIVA 4PFOA 2A36A 2I2LA 2V8IA 5GAN2 1E6GA 1F1BB 2EQMA 4C0DB 3E9FA 1RI9A 3A8LB 4J7FA 3VS4A 3AT1B 1G83A 2H8HA 4OF1A 3A98A 2QA4A 2GTOA 2LCSA 1WZOA 1TG0A 3M0PA 1VQKQ 1WHMA 4KH1B 1WHHA 3GIBA 3BFMA 3TCJA 1UGSB 1RL2A 2CH4A 3TEEA 2RF0A 1PM3A 2EPDA 2LX7A 4XU3A 3QG1A 1PWTA 1X2QA 1WHLA 1GBRA 2VUBA 4PL6A 2VV5A 4C92A 3V8LA 3M0TA 5I11A 4MDWA 2XKOC 1RAHB 5GAN3 4IURA 4PJJA 4CC3A 3RMQA 1B34B 2DMOA 3CCUQ 1VQOA 2O88A 2X3WD 2QDYB 3CC7Q 5I22A 3LW5E 5A0DA 4C5HA 1WDXA 2EKOA 4K11A 4LXCA 1YWPA 2KY9A 1VA7A 4TVRA 1ZLMA 3A8HB 1IXDA 3EHRA 4JS5A 4C8QD 2P0KA 1HSQA 1TH7A 3EG9A 3CCST 4JLGA 2C0TA 1MHNA 2QQ9A 3REAB 3M54A 4IKFA 1VQ7Q 5L8RE 1VIEA 3M0UA 1R0CB 1Q82U 5D6XA 2G3RA 2JMAA 2KK4A 4D8DA 2CSIA 3FB9A 3VJPA 3KBGA 1VQ8A 2BUDA 4ATOA 5FLXE 1M1FA 3VKIA 2DYIA 1RACB 2E64A 3TQ7P 1IO6A 1X75C 1C1AA 1U8RA 3CC2A 2KT1A 1Y07A 3SWNC 3JRZA 2AKLA 5CKDA 3RUXA 1VQ5Q 4HVVA 3CCLQ 4KUDK 2FPEA 1QCOA 3VRYA 4M7DF 5GANh 2QA4T 4ZTFA 1OX8A 5GAMj 4M78F 4FL6A 1ZBJA 5CVIA 5LJ5e 5FRNA 1SSHA 2LQWA 5IHKA 1XTDA 1ZUKA 1PSEA 5D6YA 1WFWA 2AIRB 3JCMP 5GANg 2MWPA 4LDXA 4C0ZA 4PNOA 4N4IA 4HT9A 1NLOC 1XOVA 3OS2A 3KXTA 1I81A 1Q81C 5AYFA 1E6HA 2DL5A 3DLMA 1VQLT 2KNBB 3HRSA 1WPYA 4XTWA 2QAZA 1M9SA 1K73C 4RTYA 3QPHA 2K3YA 3CCUT 1UGRB 4A4EA 5IAYA 4M78C 3CC7T 4ZGDB 4MMLA 2ZPIB 2LCCA 2ZAEA 3ULRB 1JBMA 4BI3A 1YJNQ 4BE0A 2ZPHB 2YDLA 3GPLA 4M7AA 1K9AA 2DEQA 2RJDA 1YWOA 1JQQA 5GAOp 4L5GA 3DB3A 1G8XA 1Y7XA 2E3IA 3CCEQ 3LH0A 2DEUA 1ZSZA 5LJ5d 5KYUA 1LOJA 2DTOA 4M7DD 3ME9A 2EJGA 1Q86C 4BACA 1FMVA 2CH4W 1NPRA 2YHTA 1M8MA 5CR2A 2JS0A 4C5GA 3OYJA 2K7AA 2RH2A 4ZTJA 1M4ZA 3EFOB 1YHQT 4R55A 3MEVA 3CCLA 4FM4B 2E6NA 3CCJQ 3CCLT 3F70A 2RJCA 2MPXC 5IH2A 4HVWA 3U23A 1NJIU 1ZA2B 4NL3A 4PJOC 2DM1A 1KQSP 3NTIA 1RAGB 4J9EA 1BI1A 1SF9A 4X1VA 3EH2A 3D7SB 5CAIA 1WXBA 2K79A 2FZKB 1WXTA 2L3PA 2E65A 2RK2A 4IUTA 4EPCA 2XD0A 2L5QA 1MNDA 3CPFA 2NUTA 4C92D 3G6EA 9ATCB 2EKHA 3BW1A 3RESA 5KYYB 3E2UA 3L2UA 1D1BA 3OYEA 1K73U 2HKNA 3CXCP 4QQGA 3TREA 2KR3A 5J39A 2RN8A 1D0YA 4GLKA 2DL3A 1YJ9T 4PJMA 2EGEA 2V26A 1SPKA 3V7SA 4PFZA 3TSWA 2HBPA 2O01E 2XDBA 5GAN7 4MMKA 4BY6C 2DYBA 1T0HA 3HTRA 1BIBA 3UDCA 3JB9F 1PD1A 1VIFA 3CCEA 4PJOD 7AT1B 1VQPT 1GL5A 1WHGA 2O4XB 1XNIA 3LH5A 4KGVB 1M5Q1 4II1A 2OX7A 5DY9A 2KRNA 3SDZA 4M78B 4DQ2A 2EJ9A 3CPWP 1VQ9Q 4BE2A 4M7DB 1NG2A 2BKDN 3HP9A 2MMPA 5CCAA 2MCNA 1K9MR 4E7KA 4O6JA 2KRMA 3LWHA 1PKSA 2RB6A 5FU6B 2XICA 2J05A 3CCET 3J81E 3I35A 4N4HA 3VRZA 2JVVA 1WA7A 3JB9H 5LJ3d 2COYA 2IG0A 4MZMA 1QLYA 1MMGA 1D09B 4OVAA 1K73R 3JCMc 3FIFA 5I2SA 2EIFA 4HKEA 5KYWA 3JB9I 4JS4A 4HCKA 4D8KA 1OULA 2GGRA 4XAXB 1YHQQ 2DKGA 3BE3A 3OSVA 2QQRA 1W2BS 2JTMA 1Z9QA 1SHFA 2O9SA 1UHCA 4QQDA 2P84A 5ECAA 4YTLA 4Z88A 2DXUA 1WJSA 4M75A 2A7YA 1H3ZA 4ZNXA 2HBWA 4OGCA 3SB2A 2L2PA 1WHJA 2PVDB 4EDUA 5LL6S 5LJ3e 2LVMA 3UA6A 1FMWA 4GLMA 5KCOA 2KXDA 5M9OA 1OU8A 3CBMA 4R0KA 1WXUA 1ZQ1A 1TUCA 1X69A 1W6XA 2J6OA 2GQVA 3QJ6A 3X25B 3EFRA 1ABOA 5KYXB 3OY9A 2K5IA 2A37A 4XTXA 1ZX6A 1NJIC 2AT1B 2YUNA 4CC7A 1W4SA 3H0FA 2A08A 3EG0A 1YJ9Q 1U06A 4LUDA 1O75A 4M75E 5HK3A 1FWZA 2GNCA 3UWNA 2HD0A 3A1PA 3UT1A 2ZPFB 2PZ1A 1TXQA 2GF7A 4ZN1A 4M77E 4QVDA 3R6NA 1IGUA 4EMKA 2NLUA 2KDSA 3GOXA 3HPWA 2MOXA 2P4TA 3CD6T 4BE1A 1H8KA 2SEMA 3CCQT 1VQOT 4C8QG 1WIEA 1C0MA 1VQ9T 1V1CA 1AWOA 1HYOA 3M0QA 3HRTA 3V7RA 5GMKm 3TU4K 1IGQA 2L89A 3RMSA 4M7AD 4C0DC 3DLLA 1UGVA 2VWFA 2E12A 3M9QA 2COWA 4C5IA 1NBEB 1OX9A 1UJ0A 4X9DA 4M77F 3M56A 3MJXA 3HFNA 3NHNA 1YP5A 1LNXA 3I56T 3JV3A 5CKBA 1Y57A 1FYNA 5J3BA 1N8RC 2HNIA 4FT4A 2YUPA 4HVUA 3CC2T 2RI2A 2RQWA 3VS6A 1QVPA 1BI3A 4J9IA 2DRKA 4OMOA 3CXCA 1VQ4A 2LRQA 4JUVA 1ACMB 2RM4A 2YSQA 4L6V5 4LDUA 1M2VA 2AZSA 5KCHA 1GBQA 3CCRQ 1AZGB 2QEXT 1VQLQ 4RG2A 4BB7A 1GRIA 3L2VA 4C0FA 3I56A 5FWCA 2CP5A 4J6WA 3JCMW 1M90U 3JCMV 3EHQA 3L2ZA 3ASKA 2FVUA 2L3QA 2D1XA 2DBKA 5GAMd 3GBQA 1RAEB 2RHYA 2JMCA 1OYXA 4M7AC 4UC4A 1BI0A 3G4SQ 1QW1A 2OJ2A 4DOWA 1QCFA 2YWWA 2LP5A 5DLQE 3TVTA 3H0IA 3M0SA 1SRLA 1GXIE 2R58A 1YCSB 2O4XA 3OYFA 2QEXA 3ER0A 1ZSZC 2B8AA 3OYCA 4AFUC 1R8OB 5LJ5f 4PJOF 1Q7YU 4J7IA 3PIOA 1MMAA 4QQ6A 4ELYC 2EYQA 2KROA 3MEWA 2XIDA 1TUGB 4E47A 4Q5WA 1VQ6A 1X6GA 3JCMe 3NTHA 3QIIA 2RK1A 2HL5C 3I5SA 2DPPB 1N8RR 5KYWB 4M75C 2RHUA 4RUGA 3CCVA 4HT8A 1RABB 2E10A 1B3QA 1UE9A 3V8JA 1K8AC 1MNEA 3QUIA 4M77C 4JRQA 2WSCE 5HY6A 2HQHA 1JRIA 2CDTA 4HCCA 1Y0MA 3A5ZB 2CKKA 4M78D 2DL7A 1WGSA 4BI4A 1KD1C 1R77A 1AOJA 2H3EB 3M4YA 2F2VA 3JCMQ 1OI1A 1QVFP 4AMCA 4C8QE 2YRDA 3ZFJA 1YHQA 5KYNA 2SRCA 8AT1B 2DE0X 3CEYA 4IUPA 3J7AF 1VQLA 1WX6A 3CMEA 1I0CA 2NYSA 4ORZA 3CCRT 3I56Q 5CQXA 2LTOA 4HCBA 1IHVA 3OMCA 5FROA 1OZ2A 3DB4A 4QT7A 6AT1B 3VYHB 4M78E 1VQNQ 3UA7A 3OYNA 4FW1A 4LD9K 2EYWA 1GCPA 4ESRA 1YIJT 4N4GA 2GFUA 3LLRA 4RTUA 5C6SA 1K1ZA 3A8GB 1CKAA 1D0XA 2WSEE 3J80E 2ZPBB 2YXYA 1B34A 3ZEHA 2QEXQ 1HXDA 4XU0A 1YITQ 1VQPQ 3CCRA 2KYMA 5GMKj 1J3TA 3E1SA 3VS3A 3BDLA 5FU7C 1G2BA 1X43A 2DD4A 2VYTA 3GP8A 2LCLA 1M1GA 5A0LA 2DO3A 5C0MA 1D1CA 3BY7A 3H6ZA 3PNWC 3P8BB 3HHTB 2KQWA 3L42A 1JB0E 5GJVB 3PVQA 4E7IA 2Z0WA 1Q7YC 1BI2A 1VQMT 3CPWS 2ROTA 2WACA 4EMGA 3WXMB 4PJOE 2EGCA 2EYYA 2YT6A 1S72A 1AWWA 2HQXA 4F7UF 4OB1B 1LCKA 1KD1R 5CQYA 2EYXA 4OMLA 2YRVA 5GANe 1KQSS 1YFNA 3SWNA 4CI0C 5LJ3g 1VYUA 4FIBA 1AWJA 3OYGA 2G6FX 4J9HA 2X51A 4GY5A 3M0RA 5D6WA 1YCYA 1A0NB 3H0HA 1BCOA 1UECA 3P8DA 1AEYA 2LQKA 5GAMf 3NMZC 1IRXA 2CUDA 4C92F 2DXCA 2ATCB 3QYGB 2PQWA 1K4US 2CP3A 1U1SA 1CSKA 3OYHA 4F7UE 4PJNA 2ZZDA 2JOYA 1U5SA 2PNIA 1UB4A 2RA2A 3I9QA 2K5LA 1KHIA 3L2RA 2J6FA 4E7ZA 1DJ7B 2EYZA 3JSCA 1YITT 4QVZA 3LX7A 1WJRA 2BZYA 4M77G 2J6KA 1VOMA 1Q86U 2I0NA 5GAOn 3M55A 2J7IA 3KUFA 4J9GA 2A3LA 3OS5A 5IN1A 2DL8A 1YIJQ 4B9XA 1OPLA 2OI3A 1Y96A 1KQSA 2FHDA 3M58A 3QYHB 1VQ9A 3EFOA 3QBYA 2LC4A 2EFIA 3S6WA 4MZTA 2MIOA 1JO8A 1D1AA 1T0JA 1NJIR 1W2BP 2Y4XA 1V29B 4B9WA 5GAOl 4WCIA 4Y91A 3PTAA 1YJWQ 2RHIA 2DK3A 1GCQA 3CBOA 4LUEA 1RLQC 1PC0A 2VB6A 3CCQQ 4F7UB 1VQOQ 1JJ2A 4VUBA 2ZPEB 2RQVA 2R5MA 1QVGS 3JCMX 3VV0A 3CCMQ 3PMTA 5DLOA 2K9GA 2M9UA 5GMKh 2WSFE 4RTZA 4ZN3A 4HXJA 3VS0A 1VQMA 1WYXA 3A8MB 1XQHA 2DERA 3EG9B 2V1RA 4AFQC 3I55T 3CCJT 2EAYA 2K3BA 4BY6B 1PKTA 1KK7A 2XI9A 5DM7R 3JCMb 2FO0A 2VASA 2CZ6B 1KD1U 1KC8U 1M1KU 1NM7A 2KBTA 3JCMJ 2EQJA 2L3SA 1MGQA 5CKFA 1G3TA 3CC2Q 3QXEB 3V7CA 1LVKA 2C0IA 1RUWA 1Y71A 3M4GA 3C12A 1VQ5A 1ARKA 5EC7A 2LNHB 1RI0A 3EGDA 2MYSA 4WTOB 4WF2A 3QWYA 2FZGB 4ZGEB 5KE2A 2M51A 2X4XA 3NPFA 2DAQA 3JB9G 3RKYA 2KMTA 4XU2A 4EMKC 1V76A 1B7TA 2RNAA 2JZ2A 2ED1A 3CQTA 1LPLA 1QVGA 4M7DE 4JLIA 5IHNA 1QP2A 2HSEB 1BIAA 3OQ5A 2RHZA 3OYYA 3JB9D 4LDYA 2YRCA 4NOYA 1NLPC 2QI2A 4JJBA 2V8KA 1TWBA 2V1QA 2O2OA 2HDAA 4J9CA 1QP3A 2YLCA 3CMAQ 2R57A 2LJ1A 4AFSC 4Z89A 3FLGA 3THKA 2OTJT 3HRUA 4Z02A 2LJ0A 3EGXB 2K6DA 4RKUE 5I21A 3UF4A 1N9SA 2P4RA 3BDUA 4N0AC 2XK0A 3RERA 2CZ1B 3S3MA 2RI5A 5J26A 4A4GA 2PVOB 1ZSZB 2DVJA 4A53A 4AG1C 3QSUA 1M2OA 2K4YA 3VS7A 4XTUA 2NWMA 1IB8A 2JNGA 2YUQA 5GMKe 4GBQA 3CCQA 1D3BB 2DZCA 2DZ9A 2NUTB 2QGGA 2XMFA 3REBB 2OTLQ 3CCMT 2KXCA 4AFZC 1M30A 3GNFB 2VXFA 1MV3A 1IZ6A 4XQ3A 3C94A 1QQJA 8ATCB 3EAEA 1WQ7A 1TTHB 3FJPA 1PG5B 5GAMh 2DNUA 3JCMf 3VUZA 3OSSC 1N8RU 4RG8A 2COZA 1KHCA 2DTIA 2FRWA 2BZ8A 3S3OA 4BI8B 4OMFB 2QDLA 1GFDA 2BE9B 1ZUUA 4LDWA 5KH6A 4KULA 1QMCA 3C95A 2L8DA 2C06A 2K5FA 4DBQA 2EGAA 1Q7YR 3LGLA 3RBBB 1M3BA 3GNGA 3OYAA 1OPKA 4A4KA 4PLLA 2X35A 2FB7A 1YIJA 4ANJA 1WLPB 4M7AE 3HL8A 1M2VB 4E7SA 2EQUA 3ZBDA 1VUBA 2BTTA 5CIUA 1VQ4Q 2CZ7B 3I5RA 4DOVA 3QDFA 1Z9ZA 3QKJA 3RR6A 4X9CA 2RQRA 1KC8C 2RD1A 5IT9E 2DVEA 3MP6A 3CMET 1I1JA 2RHXA 4M7DG 2HQEA 3CC4Q 2W0ZA 4KUIA 4F14A 2RJEA 3C4SA 4PLIA 3G71Q 1TU0B 3QJYA 2MK5A 1UG1A 4Z8AA 4OB3B 5EG2A 3GLXA 1UTIA 1VQMQ 3M5AA 2RQUA 2K3XA 4NL2A 3X24B 1WNLA 3INZA 2M02A 2MWOA 1AWXA 1IREB 1PRMC 4M7DC 2DFUA 3CCVQ 2OTJA 1D0ZA 2AK5A 5HKCA 3CMAA 1KG1A 2FYKA 2RI3A 3PIPA 4FT2A 2CYZB 2LMJA 2AKKA 3O8VA 5FU7B 1ABQA 2JTEA 5GJWB 1UHFA 1EX4A 1E7OA 2FPFA 1M90C 3PMIA 1QVFS 2ECZA 1JJ2S 3OMGA 4C8QC 3N5BB 1T3SA 2KT8A 2ESWA 1H92A 5GMKi 1BKBA 2JW4A 1NZ9A 2DXTA 1QWEA 2ABLA 3T9NA 4C5EA 2D0QB 2OTLT 2PUKB 2Y4YA 4E7JA 1QKWA 3RKXA 2EQKA 3SWNB 2HEQA 1UJYA 3PGGA 1I8FA 3MKDA 1P92A 1W1FA 3JCMh 4A54A 2LQNA 2XDDA 4Y28E 2CGHA 2V8JA 2DJZA 1UUEA 1VQNA 4BD3A 2HZYA 2JS2A 2DLPA 3Q1JA 1KC8R 1HK9A 4A63B 4F7UG 2K2VA 4E2FB 3RDVA 1N27A 4M75G 5LJ5g 3MHXA 2GQIA 2FG0A 2JUFA 4FSSA 2QQSA 2X4WA 1YITA 4JZ3A 4RTXA 3CMEQ 4JZ4A 2X3XD 2HKQB 2ROLA 2E41A 2QA4Q 3PE0A 4JRPA 4LDVA 1W2BA 2JTFA 2XDPA 4RCCA 2DJQA 4RTTA 3G71A 1VQKA 2ZGWA 3SEMA 3OW2A 3TSZA 4M75B 3KFVA 2ZPGB 5LJ5j 2JM8A 4DBRA 2MAMA 1MUZA 2F5TX 5FU6C 4JDSA 4M4ZA 1KQ1A 2HAXA 1U3OA 4DBFA 3OW2S 3CC4T 1K8AR 1VQPA 1OV3A 2QQBA 2IVWA 3OBWA 3G4SA 3X28B 4LE9A 2DA9A 3G71T 3R6OA 2PU9B 4BDYA 4HCZA 3VS1A 3IQLA 4DA4A 3X20B 2EW3A 1Q86R 5GAOr 3JB9J 4M78A 3ZL7C 2KAFA 2CP2A 1K76A 2RO0A 1X6OA 3RNJA 1PHTA 1SKUB 2GTJA 2QASA 2QYZA 4OGEA 1YJNT 1UFFA 3H8ZA 2IIMA 4M77A 5FRMA 2LNVA 1N9RA 3QDRB 4C8QF 4E7LA 3CXCS 2X4JA 5GAN5 3OBYA 1SEMA 4FYXB 5I2MA 3M53A 3CCSA 4J6YA 4AT1B 2DF6A 4LNPA 5FWBA 1AT1B 4PK4A 5L23A 3CCJA 3NTKA 3A8OB 4MZPA 4OB2B 1QKXA 5GANf 1WQWA 3JAME 5CKHA 4BUGA 3OYKA 5GAMg 5KE3A 1EIFA 2HSPA 1W70A 4KT0E 4A4FA 1QWFA 2E70A 2F2WA 1X6BA 2JJ9A 1K9MU 4OP0A 1KIKA 2KVQG 4QW2A 1VQ7A 2GFAA 3LYIA 4XTVA 4EMHA 2K2MA 3HFOA 1ZSGA 1VQNT 2DRMA 1FX7A 1M8VA 2KRSA 3VS5A 2BZXA 4HA8A 5GAMe 2F69A 4PJOA 2RMOA 3OYLA 1JXMA 4M7AG 2QGFB 1VQ8T 3OYDA 3VUBA 1YN8A 5HK0A 1G3YA 3MP8A 2GBQA 2XG8D 4A4HA 2NUZA 3PVLA 2LT1A 4CC4B 4FYWB 3V8KA 1KFZA 2D6FA 5GAOq 3FEOA 1I07A 2DL4A 1YJWA 1AD5A 1MV0B 3NGPA 5GAN6 1MMDA 2RJFA 1OZ3A 3SHWA 1YNZA 3X26B 2CREA 1B07A 3FDRA 3MO8A 1PNJA 4E7HA 2ENMA 2J06A 3OB9A 2O9VA 2AZVA 1PSFA 4FW2A 4CC2A 3G7ZA 1LJOA 5IXFA 1YJNA 1Q95G 1Q81U 1RADB 1KSWA 3I55A 1N5ZA 4FCYA 2BE7D 4MDXA 3H9NA 1M1KC 4M75F 4DEYA 2L0AA 4JJNK 2P0QA 1EFNA 5LJ3j 4ME7A 3RIRA 4F7UA 1Q82C 1WI7A 3MEAA 4J9FA 1ZA1B 4XTYA 1VQ6T 4PJOG 3LGFA 4J9BA 1NPPA 3VU3C 4C92C 4M77D 3GF5A 4KGXB
chains in the Genus database with same CATH topology
1BBZA 4J9CA 1K0SA 4DEXA 2YSQA 1IO6A 2LJ1A 4F16A 2AZSA 1GBQA 4AFSC 4Z89A 1AZGB 2KT1A 3C0CA 3THKA 2AKLA 1GRIA 1OEBA 4HVVA 2JM9A 2LJ0A 5FWCA 2K6DA 2FPEA 3UF4A 2P4RA 3VRYA 5FW9A 4J9DA 3EHQA 2DVJA 1GFCA 1ZBJA 4AG1C 1SSHA 2LQWA 2L3QA 3VS7A 2D1XA 2DBKA 2NWMA 5IHKA 2E5KA 2OAWA 1ZUKA 2YUQA 3GBQA 2JMCA 4GBQA 2EVRA 1WFWA 3UATA 2OJ2A 2XMFA 1QCFA 2LP5A 3REBB 3TVTA 3H0IA 3M0SA 1SRLA 2KXCA 1YCSB 4AFZC 1M30A 1NLOC 2HCKA 4OMNA 1MV3A 4AFUC 1XOVA 1S1NA 1NEBA 2LJ3A 1SRMA 1E6HA 2DL5A 2KNBB 2KROA 3QWXX 1X6GA 2DNUA 4RTYA 3I5SA 2JT4A 4JPBW 2FRWA 2BZ8A 4OMPA 3ULRB 1ZUYA 2QDLA 4RUGA 1GFDA 1ZUUA 2YDLA 1B3QA 1BK2A 1UE9A 1K9AA 2EGAA 1YWOA 4OMQA 3RBBB 1M3BA 1OPKA 1GCQC 2A28A 2FEIA 2CDTA 1JQQA 5IHIA 1Y0MA 1AZEA 4Y92A 3VS2A 1WLPB 2DL7A 2O31A 1HJDA 1NYFA 1AOJA 2BTTA 2KEAA 1JXOA 2F2VA 2CH4W 3I5RA 1M8MA 1Z9ZA 2CT4A 2JS0A 2RQRA 2K7AA 1I1JA 1NEGA 2SRCA 2DE0X 1WX6A 2W0ZA 1I0CA 4ORZA 2D0NA 2RQTA 4F14A 4QT7A 5IH2A 4HVWA 3U23A 1M3AA 1UG1A 4Z8AA 3UA7A 1X2KA 2EYWA 1UTIA 1GCPA 2RQUA 4ESRA 2DM1A 2D8HA 4J9EA 1NYGA 4RTUA 1K1ZA 1CKAA 4X1VA 1AWXA 1PRMC 2VVKA 2ED0A 4F17A 1JU5C 1WXBA 2AK5A 2K79A 2FRYA 3EG1A 1WXTA 4JJDA 2L3PA 2LMJA 2AKKA 2KYMA 1ABQA 2JTEA 5GJWB 1UHFA 1VYTA 1J3TA 2CSQA 2EKHA 1E7OA 2FPFA 2YUOA 3EG3A 3VS3A 2ECZA 1JEGA 1G2BA 1X43A 4EIKA 3H41A 2W10A 4E6RA 2KR3A 1T3SA 2RN8A 2KT8A 2DL3A 2ESWA 1H92A 2JW4A 4KRTA 1QWEA 2ABLA 2EGEA 2EQIA 1SPKA 5GJVB 3PVQA 1H3HA 3TSWA 1QKWA 2ROTA 2HEQA 1UJYA 2DYBA 1T0HA 4AG2C 1W1FA 2LQNA 4LN2A 1UUEA 2EGCA 5HCKA 2EYYA 2PTKA 2CUBA 2D8JA 2M0YA 2YT6A 1AWWA 1GL5A 3LH5A 2JS2A 1VYVA 2DLPA 1RLPC 1SHGA 1LCKA 2EYXA 4OMLA 4IIMA 4A63B 2KRNA 2RPNA 1BB9A 1NG2A 1VYUA 1AWJA 2GQIA 2FG0A 2G6FX 2MCNA 4FSSA 4OMMA 4J9HA 4JZ3A 2DX1A 4RTXA 4JZ4A 2X3XD 2KRMA 2ROLA 3M0RA 1PKSA 3PE0A 1A0NB 3H0HA 1UECA 2J05A 2EBPA 2DJQA 4RTTA 3I35A 3VRZA 4JJCA 1AEYA 3SEMA 1BU1A 1WA7A 2LZ6B 3TSZA 2KE9A 2C0OA 3FJ5A 3NMZC 3KFVA 2CUDA 2DILA 1K4US 2JM8A 1T3LA 1CKBA 1CSKA 1M27C 1MUZA 1QLYA 4M4ZA 1U5SA 1U3OA 2PNIA 2B86A 4HCKA 3I9QA 1UDLA 4D8KA 2GGRA 4IIOA 1KJWA 2CT3A 2J6FA 1FMKA 1OV3A 2EYZA 1AVZC 2BZYA 1Z9QA 2DA9A 2F2XA 4LE9A 2J6KA 1SHFA 2JXBA 2O9SA 1UHCA 2I0NA 5ECAA 3VS1A 4RTVA 3IQLA 4Z88A 2J7IA 4J9GA 2EW3A 5IXBA 2DL8A 3ZL7C 3EGUA 1X27A 1OPLA 2OI3A 4ZNXA 2HBWA 1K76A 4RTWA 3RNJA 2L2PA 1PHTA 2GTJA 2KYBA 2FPDA 1UFFA 3EG2A 2IIMA 3UA6A 2MIOA 1JO8A 1T0JA 4GLMA 2KXDA 3O5ZA 4R0KA 1WXUA 4WCIA 1K0XA 1TUDA 1SEMA 1GCQA 4LUEA 1RLQC 1TUCA 1X69A 2VKNA 1W6XA 2J6OA 2DF6A 4LNPA 1ABOA 2KGTA 5FWBA 1PRLC 1M3CA 1OOTA 2A37A 2RQVA 1ZX6A 5L23A 2YUNA 4CC7A 1HD3A 1QKXA 3H0FA 2A08A 2K9GA 3EG0A 2DBMA 4RTZA 4HXJA 1U06A 3VS0A 4LUDA 2A36A 1WYXA 2HSPA 1W70A 2GNCA 1QWFA 1E6GA 2F2WA 1X6BA 2V1RA 4AFQC 2PZ1A 1RI9A 1KIKA 3VS4A 2K3BA 1PKTA 1G83A 2H8HA 3A98A 3R6NA 2K2MA 1ZSGA 2DRMA 2FO0A 2GTOA 2LCSA 1TG0A 3M0PA 2KRSA 3VS5A 2BZXA 2MOXA 1NM7A 2RMOA 1H8KA 2SEMA 1JXMA 2CH4A 2KBTA 2RF0A 2EPDA 2LX7A 2L3SA 1WIEA 1PWTA 1X2QA 2C0IA 1GBRA 1RUWA 1YN8A 2GBQA 1V1CA 1ARKA 3M0QA 2NUZA 3PVLA 5EC7A 1AWOA 3M0TA 5I11A 4CC4B 1KFZA 2LNHB 1I07A 2DL4A 4CC3A 1AD5A 1MV0B 3NGPA 2DMOA 3QWYA 3SHWA 2X3WD 1YNZA 2O88A 2CREA 1B07A 1UGVA 2VWFA 5I22A 1PNJA 2ENMA 2J06A 2M51A 2O9VA 2AZVA 1UJ0A 3NPFA 4CC2A 1WDXA 4K11A 1YWPA 5IXFA 3NHNA 1YP5A 1VA7A 1KSWA 1N5ZA 2RNAA 2ED1A 3CQTA 1ZLMA 4DEYA 3JV3A 1Y57A 1FYNA 2L0AA 3EHRA 5IHNA 1EFNA 1HSQA 1WI7A 2C0TA 4J9FA 3REAB 2YUPA 4HVUA 2RQWA 3M0UA 3VS6A 2JMAA 1NLPC 4J9IA 4JJBA 4J9BA 4D8DA 2DRKA 2CSIA 4OMOA 2V1QA 2O2OA 2HDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBZ A;  4J9C A;  1K0S A;  4DEX A;  2YSQ A;  1IO6 A;  2LJ1 A;  4F16 A;  2AZS A;  1GBQ A;  4AFS C;  4Z89 A;  1AZG B;  2KT1 A;  3C0C A;  3THK A;  2AKL A;  1GRI A;  1OEB A;  4HVV A;  2JM9 A;  2LJ0 A;  5FWC A;  2K6D A;  2FPE A;  3UF4 A;  2P4R A;  3VRY A;  5FW9 A;  4J9D A;  3EHQ A;  2DVJ A;  1GFC A;  1ZBJ A;  4AG1 C;  1SSH A;  2LQW A;  2L3Q A;  3VS7 A;  2D1X A;  2DBK A;  2NWM A;  5IHK A;  2E5K A;  2OAW A;  1ZUK A;  2YUQ A;  3GBQ A;  2JMC A;  4GBQ A;  2EVR A;  1WFW A;  3UAT A;  2OJ2 A;  2XMF A;  1QCF A;  2LP5 A;  3REB B;  3TVT A;  3H0I A;  3M0S A;  1SRL A;  2KXC A;  1YCS B;  4AFZ C;  1M30 A;  1NLO C;  2HCK A;  4OMN A;  1MV3 A;  4AFU C;  1XOV A;  1S1N A;  1NEB A;  2LJ3 A;  1SRM A;  1E6H A;  2DL5 A;  2KNB B;  2KRO A;  3QWX X;  1X6G A;  2DNU A;  4RTY A;  3I5S A;  2JT4 A;  4JPB W;  2FRW A;  2BZ8 A;  4OMP A;  3ULR B;  1ZUY A;  2QDL A;  4RUG A;  1GFD A;  1ZUU A;  2YDL A;  1B3Q A;  1BK2 A;  1UE9 A;  1K9A A;  2EGA A;  1YWO A;  4OMQ A;  3RBB B;  1M3B A;  1OPK A;  1GCQ C;  2A28 A;  2FEI A;  2CDT A;  1JQQ A;  5IHI A;  1Y0M A;  1AZE A;  4Y92 A;  3VS2 A;  1WLP B;  2DL7 A;  2O31 A;  1HJD A;  1NYF A;  1AOJ A;  2BTT A;  2KEA A;  1JXO A;  2F2V A;  2CH4 W;  3I5R A;  1M8M A;  1Z9Z A;  2CT4 A;  2JS0 A;  2RQR A;  2K7A A;  1I1J A;  1NEG A;  2SRC A;  2DE0 X;  1WX6 A;  2W0Z A;  1I0C A;  4ORZ A;  2D0N A;  2RQT A;  4F14 A;  4QT7 A;  5IH2 A;  4HVW A;  3U23 A;  1M3A A;  1UG1 A;  4Z8A A;  3UA7 A;  1X2K A;  2EYW A;  1UTI A;  1GCP A;  2RQU A;  4ESR A;  2DM1 A;  2D8H A;  4J9E A;  1NYG A;  4RTU A;  1K1Z A;  1CKA A;  4X1V A;  1AWX A;  1PRM C;  2VVK A;  2ED0 A;  4F17 A;  1JU5 C;  1WXB A;  2AK5 A;  2K79 A;  2FRY A;  3EG1 A;  1WXT A;  4JJD A;  2L3P A;  2LMJ A;  2AKK A;  2KYM A;  1ABQ A;  2JTE A;  5GJW B;  1UHF A;  1VYT A;  1J3T A;  2CSQ A;  2EKH A;  1E7O A;  2FPF A;  2YUO A;  3EG3 A;  3VS3 A;  2ECZ A;  1JEG A;  1G2B A;  1X43 A;  4EIK A;  3H41 A;  2W10 A;  4E6R A;  2KR3 A;  1T3S A;  2RN8 A;  2KT8 A;  2DL3 A;  2ESW A;  1H92 A;  2JW4 A;  4KRT A;  1QWE A;  2ABL A;  2EGE A;  2EQI A;  1SPK A;  5GJV B;  3PVQ A;  1H3H A;  3TSW A;  1QKW A;  2ROT A;  2HEQ A;  1UJY A;  2DYB A;  1T0H A;  4AG2 C;  1W1F A;  2LQN A;  4LN2 A;  1UUE A;  2EGC A;  5HCK A;  2EYY A;  2PTK A;  2CUB A;  2D8J A;  2M0Y A;  2YT6 A;  1AWW A;  1GL5 A;  3LH5 A;  2JS2 A;  1VYV A;  2DLP A;  1RLP C;  1SHG A;  1LCK A;  2EYX A;  4OML A;  4IIM A;  4A63 B;  2KRN A;  2RPN A;  1BB9 A;  1NG2 A;  1VYU A;  1AWJ A;  2GQI A;  2FG0 A;  2G6F X;  2MCN A;  4FSS A;  4OMM A;  4J9H A;  4JZ3 A;  2DX1 A;  4RTX A;  4JZ4 A;  2X3X D;  2KRM A;  2ROL A;  3M0R A;  1PKS A;  3PE0 A;  1A0N B;  3H0H A;  1UEC A;  2J05 A;  2EBP A;  2DJQ A;  4RTT A;  3I35 A;  3VRZ A;  4JJC A;  1AEY A;  3SEM A;  1BU1 A;  1WA7 A;  2LZ6 B;  3TSZ A;  2KE9 A;  2C0O A;  3FJ5 A;  3NMZ C;  3KFV A;  2CUD A;  2DIL A;  1K4U S;  2JM8 A;  1T3L A;  1CKB A;  1CSK A;  1M27 C;  1MUZ A;  1QLY A;  4M4Z A;  1U5S A;  1U3O A;  2PNI A;  2B86 A;  4HCK A;  3I9Q A;  1UDL A;  4D8K A;  2GGR A;  4IIO A;  1KJW A;  2CT3 A;  2J6F A;  1FMK A;  1OV3 A;  2EYZ A;  1AVZ C;  2BZY A;  1Z9Q A;  2DA9 A;  2F2X A;  4LE9 A;  2J6K A;  1SHF A;  2JXB A;  2O9S A;  1UHC A;  2I0N A;  5ECA A;  3VS1 A;  4RTV A;  3IQL A;  4Z88 A;  2J7I A;  4J9G A;  2EW3 A;  5IXB A;  2DL8 A;  3ZL7 C;  3EGU A;  1X27 A;  1OPL A;  2OI3 A;  4ZNX A;  2HBW A;  1K76 A;  4RTW A;  3RNJ A;  2L2P A;  1PHT A;  2GTJ A;  2KYB A;  2FPD A;  1UFF A;  3EG2 A;  2IIM A;  3UA6 A;  2MIO A;  1JO8 A;  1T0J A;  4GLM A;  2KXD A;  3O5Z A;  4R0K A;  1WXU A;  4WCI A;  1K0X A;  1TUD A;  1SEM A;  1GCQ A;  4LUE A;  1RLQ C;  1TUC A;  1X69 A;  2VKN A;  1W6X A;  2J6O A;  2DF6 A;  4LNP A;  1ABO A;  2KGT A;  5FWB A;  1PRL C;  1M3C A;  1OOT A;  2A37 A;  2RQV A;  1ZX6 A;  5L23 A;  2YUN A;  4CC7 A;  1HD3 A;  1QKX A;  3H0F A;  2A08 A;  2K9G A;  3EG0 A;  2DBM A;  4RTZ A;  4HXJ A;  1U06 A;  3VS0 A;  4LUD A;  2A36 A;  1WYX A;  2HSP A;  1W70 A;  2GNC A;  1QWF A;  1E6G A;  2F2W A;  1X6B A;  2V1R A;  4AFQ C;  2PZ1 A;  1RI9 A;  1KIK A;  3VS4 A;  2K3B A;  1PKT A;  1G83 A;  2H8H A;  3A98 A;  3R6N A;  2K2M A;  1ZSG A;  2DRM A;  2FO0 A;  2GTO A;  2LCS A;  1TG0 A;  3M0P A;  2KRS A;  3VS5 A;  2BZX A;  2MOX A;  1NM7 A;  2RMO A;  1H8K A;  2SEM A;  1JXM A;  2CH4 A;  2KBT A;  2RF0 A;  2EPD A;  2LX7 A;  2L3S A;  1WIE A;  1PWT A;  1X2Q A;  2C0I A;  1GBR A;  1RUW A;  1YN8 A;  2GBQ A;  1V1C A;  1ARK A;  3M0Q A;  2NUZ A;  3PVL A;  5EC7 A;  1AWO A;  3M0T A;  5I11 A;  4CC4 B;  1KFZ A;  2LNH B;  1I07 A;  2DL4 A;  4CC3 A;  1AD5 A;  1MV0 B;  3NGP A;  2DMO A;  3QWY A;  3SHW A;  2X3W D;  1YNZ A;  2O88 A;  2CRE A;  1B07 A;  1UGV A;  2VWF A;  5I22 A;  1PNJ A;  2ENM A;  2J06 A;  2M51 A;  2O9V A;  2AZV A;  1UJ0 A;  3NPF A;  4CC2 A;  1WDX A;  4K11 A;  1YWP A;  5IXF A;  3NHN A;  1YP5 A;  1VA7 A;  1KSW A;  1N5Z A;  2RNA A;  2ED1 A;  3CQT A;  1ZLM A;  4DEY A;  3JV3 A;  1Y57 A;  1FYN A;  2L0A A;  3EHR A;  5IHN A;  1EFN A;  1HSQ A;  1WI7 A;  2C0T A;  4J9F A;  3REA B;  2YUP A;  4HVU A;  2RQW A;  3M0U A;  3VS6 A;  2JMA A;  1NLP C;  4J9I A;  4JJB A;  4J9B A;  4D8D A;  2DRK A;  2CSI A;  4OMO A;  2V1Q A;  2O2O A;  2HDA A; 
#chains in the Genus database with same CATH topology
 1BBZ A;  1K0S A;  4DEX A;  2FL7 A;  3CCM A;  4F16 A;  2R5A A;  3C0C A;  4PJL A;  4M75 D;  1XJW B;  1OEB A;  2JM9 A;  2QTV A;  1TSF A;  2MI6 A;  3M57 A;  5GMK l;  1PD0 A;  5KYX A;  5FW9 A;  2QXF A;  4J9D A;  1YBY A;  1GFC A;  1QVG P;  4ELZ C;  4CRI A;  2QG9 B;  2E5K A;  2OAW A;  2QK0 A;  3CCS Q;  1RAI B;  2DET A;  4QVC A;  2EVR A;  2QQA A;  3UAT A;  1Q81 R;  3NFC A;  1UGP B;  2DIQ A;  3CBP A;  4KBM B;  3FC3 A;  2NUP A;  3MPU B;  2HCK A;  4OMN A;  1K9M C;  2XHC A;  4BDZ A;  1S1N A;  1NEB A;  4RCB A;  1G3S A;  2LJ3 A;  2VXE A;  4J6X A;  1SRM A;  1VQ4 T;  2JN0 A;  3PFS A;  4LD6 A;  5CO7 A;  4F04 B;  3QWX X;  1X01 A;  5KYU B;  1N6A A;  3WVE B;  5GAN d;  2JT4 A;  4JPB W;  5KYY A;  4XK8 E;  2CZ0 B;  4OMP A;  4NS5 A;  1I5L A;  3EGD B;  5A0G A;  2EJF A;  3RKW A;  2DXB A;  1ZUY A;  1M1K R;  3MET A;  4V2S A;  3AHU A;  4C92 B;  3MCA B;  4R56 A;  1BK2 A;  1G3W A;  1AHJ B;  1QCN A;  1YI2 A;  4OMQ A;  3L1A A;  1YJW T;  1GCQ C;  2A28 A;  2FEI A;  1YI2 T;  5IHI A;  1AZE A;  4Y92 A;  3OS0 A;  3VS2 A;  4M7D A;  5LJ3 h;  2L3R A;  3CCV T;  2O31 A;  1HJD A;  1NYF A;  1TS9 A;  2KEA A;  3CCU A;  3OYI A;  1OQK A;  1JXO A;  3CC7 A;  5D7U A;  4FYY B;  4FYV B;  2XU8 A;  2CT4 A;  3VYG A;  3HSB A;  1SSF A;  2H3J A;  4PKC C;  2PVG B;  1NEG A;  4JRI A;  4PFP A;  1M90 R;  1RAA B;  3PT9 A;  1SG5 A;  3UPU A;  3I55 Q;  2X9H A;  2D0N A;  2RQT A;  1QVF A;  4C8Q A;  2VGN A;  1S72 T;  3L2Q A;  4FSX A;  2CP7 A;  1M3A A;  1VQ6 Q;  2F5K A;  2EWN A;  1G5V A;  1X2K A;  4C0G A;  3MP1 A;  2DTH A;  4D6W A;  4FU6 A;  1TOV A;  2D8H A;  1NYG A;  2FZC B;  3CD6 Q;  3OW2 P;  2VVK A;  1Q82 R;  2ED0 A;  3M59 A;  4F17 A;  1I5O B;  2P0P A;  1JU5 C;  2OTL A;  1RAF B;  2FRY A;  3EG1 A;  4L59 A;  3L2W A;  1IHW A;  1UEB A;  4JJD A;  2D9T A;  2E6Z A;  1C6V X;  1BCM A;  1Y96 B;  3OS1 A;  3OYM A;  1ZBX A;  4C92 E;  1VYT A;  2CSQ A;  4P5N A;  1K8A U;  4QKU A;  2YUO A;  4KH0 B;  3EG3 A;  2CP6 A;  1JEG A;  4JRK A;  1WHK A;  4EIK A;  3H41 A;  3WVD B;  2W10 A;  4OB0 B;  4E6R A;  4IUV A;  3E19 A;  4KRT A;  5CKE A;  3QZ5 B;  3URG A;  1BYM A;  1JJ2 P;  2EQI A;  4O5V A;  1NE8 A;  1H3H A;  3E9G A;  4PJO B;  2MF2 A;  3QO3 A;  4M77 B;  4AG2 C;  2QTX A;  3S3N A;  3G6E T;  1OU9 A;  3DKM A;  1EZZ B;  1I4K 1;  4LN2 A;  5HCK A;  2PUO B;  2CUB A;  2D8J A;  2M0Y A;  2PTK A;  2YLB A;  1WJQ A;  2OAU A;  1VYV A;  1RLP C;  1SHG A;  2GCX A;  2LX9 A;  3CMA T;  4IIM A;  1YJ9 A;  2RPN A;  2Y90 A;  2LT4 A;  3G1J A;  5GAN 4;  2X4Y A;  5GAN 8;  1BB9 A;  2OTJ Q;  3EFS A;  4XU1 A;  4N0A A;  4OMM A;  3LWI A;  2E5Q A;  4XTZ A;  2DX1 A;  3CC4 A;  3QHS A;  2M1H A;  4B6M A;  3P8H A;  2NUP B;  1VQK T;  1YI2 Q;  2EBP A;  2ZCF B;  4IUQ A;  4JJC A;  5AT1 B;  1KQ2 A;  3OA6 A;  1BU1 A;  2LZ6 B;  4J8O A;  2KE9 A;  4M7A B;  2C0O A;  3FJ5 A;  5LJ3 f;  2KI7 A;  2HL3 A;  2DIL A;  1H64 1;  1U1T A;  2VC8 A;  3G4S T;  1PCX A;  3OYB A;  1O9S A;  1T3L A;  1CKB A;  1M27 C;  2CS7 A;  5LJ5 h;  5A2Q E;  4J83 A;  2VGM A;  3SD4 A;  2M0O A;  5CK9 A;  2B86 A;  2CP0 A;  1UDL A;  4IIO A;  1VQ7 T;  1KJW A;  2CT3 A;  4KGZ B;  1FMK A;  1AVZ C;  4M7A F;  2HMA A;  5GAN j;  2K57 A;  2F2X A;  4DBH A;  2JXB A;  4EMK B;  4J5Y A;  1S72 Q;  4RTV A;  3JCM d;  2E3H A;  4X34 A;  2LQ8 A;  5IXB A;  3EGU A;  1X27 A;  3MEU A;  4RMO A;  2AHJ B;  4RTW A;  2DD5 A;  2E1H A;  3SFM A;  2KYB A;  1MMN A;  2E4H A;  2FPD A;  3EG2 A;  3CD6 A;  1FXX A;  2DIG A;  1D3B A;  3O5Z A;  1K0X A;  1TUD A;  3EGX A;  1UGQ B;  2IPO B;  5GAO m;  4M78 G;  2VKN A;  4C92 G;  4ZGJ B;  3QZ9 B;  4IUU A;  1VQ8 Q;  2KGT A;  3JCM g;  3G6E Q;  1PRL C;  1M3C A;  1OOT A;  2M16 A;  3CPW A;  2LDM A;  2A0F B;  2KSS A;  1R0B G;  2F1L A;  1HD3 A;  3FRN A;  1VQ5 T;  3EH1 A;  3HKS A;  4C8Q B;  2DBM A;  1ZHI A;  2BIV A;  4PFO A;  2A36 A;  2I2L A;  2V8I A;  5GAN 2;  1E6G A;  1F1B B;  2EQM A;  4C0D B;  3E9F A;  1RI9 A;  3A8L B;  4J7F A;  3VS4 A;  3AT1 B;  1G83 A;  2H8H A;  4OF1 A;  3A98 A;  2QA4 A;  2GTO A;  2LCS A;  1WZO A;  1TG0 A;  3M0P A;  1VQK Q;  1WHM A;  4KH1 B;  1WHH A;  3GIB A;  3BFM A;  3TCJ A;  1UGS B;  1RL2 A;  2CH4 A;  3TEE A;  2RF0 A;  1PM3 A;  2EPD A;  2LX7 A;  4XU3 A;  3QG1 A;  1PWT A;  1X2Q A;  1WHL A;  1GBR A;  2VUB A;  4PL6 A;  2VV5 A;  4C92 A;  3V8L A;  3M0T A;  5I11 A;  4MDW A;  2XKO C;  1RAH B;  5GAN 3;  4IUR A;  4PJJ A;  4CC3 A;  3RMQ A;  1B34 B;  2DMO A;  3CCU Q;  1VQO A;  2O88 A;  2X3W D;  2QDY B;  3CC7 Q;  5I22 A;  3LW5 E;  5A0D A;  4C5H A;  1WDX A;  2EKO A;  4K11 A;  4LXC A;  1YWP A;  2KY9 A;  1VA7 A;  4TVR A;  1ZLM A;  3A8H B;  1IXD A;  3EHR A;  4JS5 A;  4C8Q D;  2P0K A;  1HSQ A;  1TH7 A;  3EG9 A;  3CCS T;  4JLG A;  2C0T A;  1MHN A;  2QQ9 A;  3REA B;  3M54 A;  4IKF A;  1VQ7 Q;  5L8R E;  1VIE A;  3M0U A;  1R0C B;  1Q82 U;  5D6X A;  2G3R A;  2JMA A;  2KK4 A;  4D8D A;  2CSI A;  3FB9 A;  3VJP A;  3KBG A;  1VQ8 A;  2BUD A;  4ATO A;  5FLX E;  1M1F A;  3VKI A;  2DYI A;  1RAC B;  2E64 A;  3TQ7 P;  1IO6 A;  1X75 C;  1C1A A;  1U8R A;  3CC2 A;  2KT1 A;  1Y07 A;  3SWN C;  3JRZ A;  2AKL A;  5CKD A;  3RUX A;  1VQ5 Q;  4HVV A;  3CCL Q;  4KUD K;  2FPE A;  1QCO A;  3VRY A;  4M7D F;  5GAN h;  2QA4 T;  4ZTF A;  1OX8 A;  5GAM j;  4M78 F;  4FL6 A;  1ZBJ A;  5CVI A;  5LJ5 e;  5FRN A;  1SSH A;  2LQW A;  5IHK A;  1XTD A;  1ZUK A;  1PSE A;  5D6Y A;  1WFW A;  2AIR B;  3JCM P;  5GAN g;  2MWP A;  4LDX A;  4C0Z A;  4PNO A;  4N4I A;  4HT9 A;  1NLO C;  1XOV A;  3OS2 A;  3KXT A;  1I81 A;  1Q81 C;  5AYF A;  1E6H A;  2DL5 A;  3DLM A;  1VQL T;  2KNB B;  3HRS A;  1WPY A;  4XTW A;  2QAZ A;  1M9S A;  1K73 C;  4RTY A;  3QPH A;  2K3Y A;  3CCU T;  1UGR B;  4A4E A;  5IAY A;  4M78 C;  3CC7 T;  4ZGD B;  4MML A;  2ZPI B;  2LCC A;  2ZAE A;  3ULR B;  1JBM A;  4BI3 A;  1YJN Q;  4BE0 A;  2ZPH B;  2YDL A;  3GPL A;  4M7A A;  1K9A A;  2DEQ A;  2RJD A;  1YWO A;  1JQQ A;  5GAO p;  4L5G A;  3DB3 A;  1G8X A;  1Y7X A;  2E3I A;  3CCE Q;  3LH0 A;  2DEU A;  1ZSZ A;  5LJ5 d;  5KYU A;  1LOJ A;  2DTO A;  4M7D D;  3ME9 A;  2EJG A;  1Q86 C;  4BAC A;  1FMV A;  2CH4 W;  1NPR A;  2YHT A;  1M8M A;  5CR2 A;  2JS0 A;  4C5G A;  3OYJ A;  2K7A A;  2RH2 A;  4ZTJ A;  1M4Z A;  3EFO B;  1YHQ T;  4R55 A;  3MEV A;  3CCL A;  4FM4 B;  2E6N A;  3CCJ Q;  3CCL T;  3F70 A;  2RJC A;  2MPX C;  5IH2 A;  4HVW A;  3U23 A;  1NJI U;  1ZA2 B;  4NL3 A;  4PJO C;  2DM1 A;  1KQS P;  3NTI A;  1RAG B;  4J9E A;  1BI1 A;  1SF9 A;  4X1V A;  3EH2 A;  3D7S B;  5CAI A;  1WXB A;  2K79 A;  2FZK B;  1WXT A;  2L3P A;  2E65 A;  2RK2 A;  4IUT A;  4EPC A;  2XD0 A;  2L5Q A;  1MND A;  3CPF A;  2NUT A;  4C92 D;  3G6E A;  9ATC B;  2EKH A;  3BW1 A;  3RES A;  5KYY B;  3E2U A;  3L2U A;  1D1B A;  3OYE A;  1K73 U;  2HKN A;  3CXC P;  4QQG A;  3TRE A;  2KR3 A;  5J39 A;  2RN8 A;  1D0Y A;  4GLK A;  2DL3 A;  1YJ9 T;  4PJM A;  2EGE A;  2V26 A;  1SPK A;  3V7S A;  4PFZ A;  3TSW A;  2HBP A;  2O01 E;  2XDB A;  5GAN 7;  4MMK A;  4BY6 C;  2DYB A;  1T0H A;  3HTR A;  1BIB A;  3UDC A;  3JB9 F;  1PD1 A;  1VIF A;  3CCE A;  4PJO D;  7AT1 B;  1VQP T;  1GL5 A;  1WHG A;  2O4X B;  1XNI A;  3LH5 A;  4KGV B;  1M5Q 1;  4II1 A;  2OX7 A;  5DY9 A;  2KRN A;  3SDZ A;  4M78 B;  4DQ2 A;  2EJ9 A;  3CPW P;  1VQ9 Q;  4BE2 A;  4M7D B;  1NG2 A;  2BKD N;  3HP9 A;  2MMP A;  5CCA A;  2MCN A;  1K9M R;  4E7K A;  4O6J A;  2KRM A;  3LWH A;  1PKS A;  2RB6 A;  5FU6 B;  2XIC A;  2J05 A;  3CCE T;  3J81 E;  3I35 A;  4N4H A;  3VRZ A;  2JVV A;  1WA7 A;  3JB9 H;  5LJ3 d;  2COY A;  2IG0 A;  4MZM A;  1QLY A;  1MMG A;  1D09 B;  4OVA A;  1K73 R;  3JCM c;  3FIF A;  5I2S A;  2EIF A;  4HKE A;  5KYW A;  3JB9 I;  4JS4 A;  4HCK A;  4D8K A;  1OUL A;  2GGR A;  4XAX B;  1YHQ Q;  2DKG A;  3BE3 A;  3OSV A;  2QQR A;  1W2B S;  2JTM A;  1Z9Q A;  1SHF A;  2O9S A;  1UHC A;  4QQD A;  2P84 A;  5ECA A;  4YTL A;  4Z88 A;  2DXU A;  1WJS A;  4M75 A;  2A7Y A;  1H3Z A;  4ZNX A;  2HBW A;  4OGC A;  3SB2 A;  2L2P A;  1WHJ A;  2PVD B;  4EDU A;  5LL6 S;  5LJ3 e;  2LVM A;  3UA6 A;  1FMW A;  4GLM A;  5KCO A;  2KXD A;  5M9O A;  1OU8 A;  3CBM A;  4R0K A;  1WXU A;  1ZQ1 A;  1TUC A;  1X69 A;  1W6X A;  2J6O A;  2GQV A;  3QJ6 A;  3X25 B;  3EFR A;  1ABO A;  5KYX B;  3OY9 A;  2K5I A;  2A37 A;  4XTX A;  1ZX6 A;  1NJI C;  2AT1 B;  2YUN A;  4CC7 A;  1W4S A;  3H0F A;  2A08 A;  3EG0 A;  1YJ9 Q;  1U06 A;  4LUD A;  1O75 A;  4M75 E;  5HK3 A;  1FWZ A;  2GNC A;  3UWN A;  2HD0 A;  3A1P A;  3UT1 A;  2ZPF B;  2PZ1 A;  1TXQ A;  2GF7 A;  4ZN1 A;  4M77 E;  4QVD A;  3R6N A;  1IGU A;  4EMK A;  2NLU A;  2KDS A;  3GOX A;  3HPW A;  2MOX A;  2P4T A;  3CD6 T;  4BE1 A;  1H8K A;  2SEM A;  3CCQ T;  1VQO T;  4C8Q G;  1WIE A;  1C0M A;  1VQ9 T;  1V1C A;  1AWO A;  1HYO A;  3M0Q A;  3HRT A;  3V7R A;  5GMK m;  3TU4 K;  1IGQ A;  2L89 A;  3RMS A;  4M7A D;  4C0D C;  3DLL A;  1UGV A;  2VWF A;  2E12 A;  3M9Q A;  2COW A;  4C5I A;  1NBE B;  1OX9 A;  1UJ0 A;  4X9D A;  4M77 F;  3M56 A;  3MJX A;  3HFN A;  3NHN A;  1YP5 A;  1LNX A;  3I56 T;  3JV3 A;  5CKB A;  1Y57 A;  1FYN A;  5J3B A;  1N8R C;  2HNI A;  4FT4 A;  2YUP A;  4HVU A;  3CC2 T;  2RI2 A;  2RQW A;  3VS6 A;  1QVP A;  1BI3 A;  4J9I A;  2DRK A;  4OMO A;  3CXC A;  1VQ4 A;  2LRQ A;  4JUV A;  1ACM B;  2RM4 A;  2YSQ A;  4L6V 5;  4LDU A;  1M2V A;  2AZS A;  5KCH A;  1GBQ A;  3CCR Q;  1AZG B;  2QEX T;  1VQL Q;  4RG2 A;  4BB7 A;  1GRI A;  3L2V A;  4C0F A;  3I56 A;  5FWC A;  2CP5 A;  4J6W A;  3JCM W;  1M90 U;  3JCM V;  3EHQ A;  3L2Z A;  3ASK A;  2FVU A;  2L3Q A;  2D1X A;  2DBK A;  5GAM d;  3GBQ A;  1RAE B;  2RHY A;  2JMC A;  1OYX A;  4M7A C;  4UC4 A;  1BI0 A;  3G4S Q;  1QW1 A;  2OJ2 A;  4DOW A;  1QCF A;  2YWW A;  2LP5 A;  5DLQ E;  3TVT A;  3H0I A;  3M0S A;  1SRL A;  1GXI E;  2R58 A;  1YCS B;  2O4X A;  3OYF A;  2QEX A;  3ER0 A;  1ZSZ C;  2B8A A;  3OYC A;  4AFU C;  1R8O B;  5LJ5 f;  4PJO F;  1Q7Y U;  4J7I A;  3PIO A;  1MMA A;  4QQ6 A;  4ELY C;  2EYQ A;  2KRO A;  3MEW A;  2XID A;  1TUG B;  4E47 A;  4Q5W A;  1VQ6 A;  1X6G A;  3JCM e;  3NTH A;  3QII A;  2RK1 A;  2HL5 C;  3I5S A;  2DPP B;  1N8R R;  5KYW B;  4M75 C;  2RHU A;  4RUG A;  3CCV A;  4HT8 A;  1RAB B;  2E10 A;  1B3Q A;  1UE9 A;  3V8J A;  1K8A C;  1MNE A;  3QUI A;  4M77 C;  4JRQ A;  2WSC E;  5HY6 A;  2HQH A;  1JRI A;  2CDT A;  4HCC A;  1Y0M A;  3A5Z B;  2CKK A;  4M78 D;  2DL7 A;  1WGS A;  4BI4 A;  1KD1 C;  1R77 A;  1AOJ A;  2H3E B;  3M4Y A;  2F2V A;  3JCM Q;  1OI1 A;  1QVF P;  4AMC A;  4C8Q E;  2YRD A;  3ZFJ A;  1YHQ A;  5KYN A;  2SRC A;  8AT1 B;  2DE0 X;  3CEY A;  4IUP A;  3J7A F;  1VQL A;  1WX6 A;  3CME A;  1I0C A;  2NYS A;  4ORZ A;  3CCR T;  3I56 Q;  5CQX A;  2LTO A;  4HCB A;  1IHV A;  3OMC A;  5FRO A;  1OZ2 A;  3DB4 A;  4QT7 A;  6AT1 B;  3VYH B;  4M78 E;  1VQN Q;  3UA7 A;  3OYN A;  4FW1 A;  4LD9 K;  2EYW A;  1GCP A;  4ESR A;  1YIJ T;  4N4G A;  2GFU A;  3LLR A;  4RTU A;  5C6S A;  1K1Z A;  3A8G B;  1CKA A;  1D0X A;  2WSE E;  3J80 E;  2ZPB B;  2YXY A;  1B34 A;  3ZEH A;  2QEX Q;  1HXD A;  4XU0 A;  1YIT Q;  1VQP Q;  3CCR A;  2KYM A;  5GMK j;  1J3T A;  3E1S A;  3VS3 A;  3BDL A;  5FU7 C;  1G2B A;  1X43 A;  2DD4 A;  2VYT A;  3GP8 A;  2LCL A;  1M1G A;  5A0L A;  2DO3 A;  5C0M A;  1D1C A;  3BY7 A;  3H6Z A;  3PNW C;  3P8B B;  3HHT B;  2KQW A;  3L42 A;  1JB0 E;  5GJV B;  3PVQ A;  4E7I A;  2Z0W A;  1Q7Y C;  1BI2 A;  1VQM T;  3CPW S;  2ROT A;  2WAC A;  4EMG A;  3WXM B;  4PJO E;  2EGC A;  2EYY A;  2YT6 A;  1S72 A;  1AWW A;  2HQX A;  4F7U F;  4OB1 B;  1LCK A;  1KD1 R;  5CQY A;  2EYX A;  4OML A;  2YRV A;  5GAN e;  1KQS S;  1YFN A;  3SWN A;  4CI0 C;  5LJ3 g;  1VYU A;  4FIB A;  1AWJ A;  3OYG A;  2G6F X;  4J9H A;  2X51 A;  4GY5 A;  3M0R A;  5D6W A;  1YCY A;  1A0N B;  3H0H A;  1BCO A;  1UEC A;  3P8D A;  1AEY A;  2LQK A;  5GAM f;  3NMZ C;  1IRX A;  2CUD A;  4C92 F;  2DXC A;  2ATC B;  3QYG B;  2PQW A;  1K4U S;  2CP3 A;  1U1S A;  1CSK A;  3OYH A;  4F7U E;  4PJN A;  2ZZD A;  2JOY A;  1U5S A;  2PNI A;  1UB4 A;  2RA2 A;  3I9Q A;  2K5L A;  1KHI A;  3L2R A;  2J6F A;  4E7Z A;  1DJ7 B;  2EYZ A;  3JSC A;  1YIT T;  4QVZ A;  3LX7 A;  1WJR A;  2BZY A;  4M77 G;  2J6K A;  1VOM A;  1Q86 U;  2I0N A;  5GAO n;  3M55 A;  2J7I A;  3KUF A;  4J9G A;  2A3L A;  3OS5 A;  5IN1 A;  2DL8 A;  1YIJ Q;  4B9X A;  1OPL A;  2OI3 A;  1Y96 A;  1KQS A;  2FHD A;  3M58 A;  3QYH B;  1VQ9 A;  3EFO A;  3QBY A;  2LC4 A;  2EFI A;  3S6W A;  4MZT A;  2MIO A;  1JO8 A;  1D1A A;  1T0J A;  1NJI R;  1W2B P;  2Y4X A;  1V29 B;  4B9W A;  5GAO l;  4WCI A;  4Y91 A;  3PTA A;  1YJW Q;  2RHI A;  2DK3 A;  1GCQ A;  3CBO A;  4LUE A;  1RLQ C;  1PC0 A;  2VB6 A;  3CCQ Q;  4F7U B;  1VQO Q;  1JJ2 A;  4VUB A;  2ZPE B;  2RQV A;  2R5M A;  1QVG S;  3JCM X;  3VV0 A;  3CCM Q;  3PMT A;  5DLO A;  2K9G A;  2M9U A;  5GMK h;  2WSF E;  4RTZ A;  4ZN3 A;  4HXJ A;  3VS0 A;  1VQM A;  1WYX A;  3A8M B;  1XQH A;  2DER A;  3EG9 B;  2V1R A;  4AFQ C;  3I55 T;  3CCJ T;  2EAY A;  2K3B A;  4BY6 B;  1PKT A;  1KK7 A;  2XI9 A;  5DM7 R;  3JCM b;  2FO0 A;  2VAS A;  2CZ6 B;  1KD1 U;  1KC8 U;  1M1K U;  1NM7 A;  2KBT A;  3JCM J;  2EQJ A;  2L3S A;  1MGQ A;  5CKF A;  1G3T A;  3CC2 Q;  3QXE B;  3V7C A;  1LVK A;  2C0I A;  1RUW A;  1Y71 A;  3M4G A;  3C12 A;  1VQ5 A;  1ARK A;  5EC7 A;  2LNH B;  1RI0 A;  3EGD A;  2MYS A;  4WTO B;  4WF2 A;  3QWY A;  2FZG B;  4ZGE B;  5KE2 A;  2M51 A;  2X4X A;  3NPF A;  2DAQ A;  3JB9 G;  3RKY A;  2KMT A;  4XU2 A;  4EMK C;  1V76 A;  1B7T A;  2RNA A;  2JZ2 A;  2ED1 A;  3CQT A;  1LPL A;  1QVG A;  4M7D E;  4JLI A;  5IHN A;  1QP2 A;  2HSE B;  1BIA A;  3OQ5 A;  2RHZ A;  3OYY A;  3JB9 D;  4LDY A;  2YRC A;  4NOY A;  1NLP C;  2QI2 A;  4JJB A;  2V8K A;  1TWB A;  2V1Q A;  2O2O A;  2HDA A;  4J9C A;  1QP3 A;  2YLC A;  3CMA Q;  2R57 A;  2LJ1 A;  4AFS C;  4Z89 A;  3FLG A;  3THK A;  2OTJ T;  3HRU A;  4Z02 A;  2LJ0 A;  3EGX B;  2K6D A;  4RKU E;  5I21 A;  3UF4 A;  1N9S A;  2P4R A;  3BDU A;  4N0A C;  2XK0 A;  3RER A;  2CZ1 B;  3S3M A;  2RI5 A;  5J26 A;  4A4G A;  2PVO B;  1ZSZ B;  2DVJ A;  4A53 A;  4AG1 C;  3QSU A;  1M2O A;  2K4Y A;  3VS7 A;  4XTU A;  2NWM A;  1IB8 A;  2JNG A;  2YUQ A;  5GMK e;  4GBQ A;  3CCQ A;  1D3B B;  2DZC A;  2DZ9 A;  2NUT B;  2QGG A;  2XMF A;  3REB B;  2OTL Q;  3CCM T;  2KXC A;  4AFZ C;  1M30 A;  3GNF B;  2VXF A;  1MV3 A;  1IZ6 A;  4XQ3 A;  3C94 A;  1QQJ A;  8ATC B;  3EAE A;  1WQ7 A;  1TTH B;  3FJP A;  1PG5 B;  5GAM h;  2DNU A;  3JCM f;  3VUZ A;  3OSS C;  1N8R U;  4RG8 A;  2COZ A;  1KHC A;  2DTI A;  2FRW A;  2BZ8 A;  3S3O A;  4BI8 B;  4OMF B;  2QDL A;  1GFD A;  2BE9 B;  1ZUU A;  4LDW A;  5KH6 A;  4KUL A;  1QMC A;  3C95 A;  2L8D A;  2C06 A;  2K5F A;  4DBQ A;  2EGA A;  1Q7Y R;  3LGL A;  3RBB B;  1M3B A;  3GNG A;  3OYA A;  1OPK A;  4A4K A;  4PLL A;  2X35 A;  2FB7 A;  1YIJ A;  4ANJ A;  1WLP B;  4M7A E;  3HL8 A;  1M2V B;  4E7S A;  2EQU A;  3ZBD A;  1VUB A;  2BTT A;  5CIU A;  1VQ4 Q;  2CZ7 B;  3I5R A;  4DOV A;  3QDF A;  1Z9Z A;  3QKJ A;  3RR6 A;  4X9C A;  2RQR A;  1KC8 C;  2RD1 A;  5IT9 E;  2DVE A;  3MP6 A;  3CME T;  1I1J A;  2RHX A;  4M7D G;  2HQE A;  3CC4 Q;  2W0Z A;  4KUI A;  4F14 A;  2RJE A;  3C4S A;  4PLI A;  3G71 Q;  1TU0 B;  3QJY A;  2MK5 A;  1UG1 A;  4Z8A A;  4OB3 B;  5EG2 A;  3GLX A;  1UTI A;  1VQM Q;  3M5A A;  2RQU A;  2K3X A;  4NL2 A;  3X24 B;  1WNL A;  3INZ A;  2M02 A;  2MWO A;  1AWX A;  1IRE B;  1PRM C;  4M7D C;  2DFU A;  3CCV Q;  2OTJ A;  1D0Z A;  2AK5 A;  5HKC A;  3CMA A;  1KG1 A;  2FYK A;  2RI3 A;  3PIP A;  4FT2 A;  2CYZ B;  2LMJ A;  2AKK A;  3O8V A;  5FU7 B;  1ABQ A;  2JTE A;  5GJW B;  1UHF A;  1EX4 A;  1E7O A;  2FPF A;  1M90 C;  3PMI A;  1QVF S;  2ECZ A;  1JJ2 S;  3OMG A;  4C8Q C;  3N5B B;  1T3S A;  2KT8 A;  2ESW A;  1H92 A;  5GMK i;  1BKB A;  2JW4 A;  1NZ9 A;  2DXT A;  1QWE A;  2ABL A;  3T9N A;  4C5E A;  2D0Q B;  2OTL T;  2PUK B;  2Y4Y A;  4E7J A;  1QKW A;  3RKX A;  2EQK A;  3SWN B;  2HEQ A;  1UJY A;  3PGG A;  1I8F A;  3MKD A;  1P92 A;  1W1F A;  3JCM h;  4A54 A;  2LQN A;  2XDD A;  4Y28 E;  2CGH A;  2V8J A;  2DJZ A;  1UUE A;  1VQN A;  4BD3 A;  2HZY A;  2JS2 A;  2DLP A;  3Q1J A;  1KC8 R;  1HK9 A;  4A63 B;  4F7U G;  2K2V A;  4E2F B;  3RDV A;  1N27 A;  4M75 G;  5LJ5 g;  3MHX A;  2GQI A;  2FG0 A;  2JUF A;  4FSS A;  2QQS A;  2X4W A;  1YIT A;  4JZ3 A;  4RTX A;  3CME Q;  4JZ4 A;  2X3X D;  2HKQ B;  2ROL A;  2E41 A;  2QA4 Q;  3PE0 A;  4JRP A;  4LDV A;  1W2B A;  2JTF A;  2XDP A;  4RCC A;  2DJQ A;  4RTT A;  3G71 A;  1VQK A;  2ZGW A;  3SEM A;  3OW2 A;  3TSZ A;  4M75 B;  3KFV A;  2ZPG B;  5LJ5 j;  2JM8 A;  4DBR A;  2MAM A;  1MUZ A;  2F5T X;  5FU6 C;  4JDS A;  4M4Z A;  1KQ1 A;  2HAX A;  1U3O A;  4DBF A;  3OW2 S;  3CC4 T;  1K8A R;  1VQP A;  1OV3 A;  2QQB A;  2IVW A;  3OBW A;  3G4S A;  3X28 B;  4LE9 A;  2DA9 A;  3G71 T;  3R6O A;  2PU9 B;  4BDY A;  4HCZ A;  3VS1 A;  3IQL A;  4DA4 A;  3X20 B;  2EW3 A;  1Q86 R;  5GAO r;  3JB9 J;  4M78 A;  3ZL7 C;  2KAF A;  2CP2 A;  1K76 A;  2RO0 A;  1X6O A;  3RNJ A;  1PHT A;  1SKU B;  2GTJ A;  2QAS A;  2QYZ A;  4OGE A;  1YJN T;  1UFF A;  3H8Z A;  2IIM A;  4M77 A;  5FRM A;  2LNV A;  1N9R A;  3QDR B;  4C8Q F;  4E7L A;  3CXC S;  2X4J A;  5GAN 5;  3OBY A;  1SEM A;  4FYX B;  5I2M A;  3M53 A;  3CCS A;  4J6Y A;  4AT1 B;  2DF6 A;  4LNP A;  5FWB A;  1AT1 B;  4PK4 A;  5L23 A;  3CCJ A;  3NTK A;  3A8O B;  4MZP A;  4OB2 B;  1QKX A;  5GAN f;  1WQW A;  3JAM E;  5CKH A;  4BUG A;  3OYK A;  5GAM g;  5KE3 A;  1EIF A;  2HSP A;  1W70 A;  4KT0 E;  4A4F A;  1QWF A;  2E70 A;  2F2W A;  1X6B A;  2JJ9 A;  1K9M U;  4OP0 A;  1KIK A;  2KVQ G;  4QW2 A;  1VQ7 A;  2GFA A;  3LYI A;  4XTV A;  4EMH A;  2K2M A;  3HFO A;  1ZSG A;  1VQN T;  2DRM A;  1FX7 A;  1M8V A;  2KRS A;  3VS5 A;  2BZX A;  4HA8 A;  5GAM e;  2F69 A;  4PJO A;  2RMO A;  3OYL A;  1JXM A;  4M7A G;  2QGF B;  1VQ8 T;  3OYD A;  3VUB A;  1YN8 A;  5HK0 A;  1G3Y A;  3MP8 A;  2GBQ A;  2XG8 D;  4A4H A;  2NUZ A;  3PVL A;  2LT1 A;  4CC4 B;  4FYW B;  3V8K A;  1KFZ A;  2D6F A;  5GAO q;  3FEO A;  1I07 A;  2DL4 A;  1YJW A;  1AD5 A;  1MV0 B;  3NGP A;  5GAN 6;  1MMD A;  2RJF A;  1OZ3 A;  3SHW A;  1YNZ A;  3X26 B;  2CRE A;  1B07 A;  3FDR A;  3MO8 A;  1PNJ A;  4E7H A;  2ENM A;  2J06 A;  3OB9 A;  2O9V A;  2AZV A;  1PSF A;  4FW2 A;  4CC2 A;  3G7Z A;  1LJO A;  5IXF A;  1YJN A;  1Q95 G;  1Q81 U;  1RAD B;  1KSW A;  3I55 A;  1N5Z A;  4FCY A;  2BE7 D;  4MDX A;  3H9N A;  1M1K C;  4M75 F;  4DEY A;  2L0A A;  4JJN K;  2P0Q A;  1EFN A;  5LJ3 j;  4ME7 A;  3RIR A;  4F7U A;  1Q82 C;  1WI7 A;  3MEA A;  4J9F A;  1ZA1 B;  4XTY A;  1VQ6 T;  4PJO G;  3LGF A;  4J9B A;  1NPP A;  3VU3 C;  4C92 C;  4M77 D;  3GF5 A;  4KGX B; 
#chains in the Genus database with same CATH homology
 1BBZ A;  4J9C A;  1K0S A;  4DEX A;  2YSQ A;  1IO6 A;  2LJ1 A;  4F16 A;  2AZS A;  1GBQ A;  4AFS C;  4Z89 A;  1AZG B;  2KT1 A;  3C0C A;  3THK A;  2AKL A;  1GRI A;  1OEB A;  4HVV A;  2JM9 A;  2LJ0 A;  5FWC A;  2K6D A;  2FPE A;  3UF4 A;  2P4R A;  3VRY A;  5FW9 A;  4J9D A;  3EHQ A;  2DVJ A;  1GFC A;  1ZBJ A;  4AG1 C;  1SSH A;  2LQW A;  2L3Q A;  3VS7 A;  2D1X A;  2DBK A;  2NWM A;  5IHK A;  2E5K A;  2OAW A;  1ZUK A;  2YUQ A;  3GBQ A;  2JMC A;  4GBQ A;  2EVR A;  1WFW A;  3UAT A;  2OJ2 A;  2XMF A;  1QCF A;  2LP5 A;  3REB B;  3TVT A;  3H0I A;  3M0S A;  1SRL A;  2KXC A;  1YCS B;  4AFZ C;  1M30 A;  1NLO C;  2HCK A;  4OMN A;  1MV3 A;  4AFU C;  1XOV A;  1S1N A;  1NEB A;  2LJ3 A;  1SRM A;  1E6H A;  2DL5 A;  2KNB B;  2KRO A;  3QWX X;  1X6G A;  2DNU A;  4RTY A;  3I5S A;  2JT4 A;  4JPB W;  2FRW A;  2BZ8 A;  4OMP A;  3ULR B;  1ZUY A;  2QDL A;  4RUG A;  1GFD A;  1ZUU A;  2YDL A;  1B3Q A;  1BK2 A;  1UE9 A;  1K9A A;  2EGA A;  1YWO A;  4OMQ A;  3RBB B;  1M3B A;  1OPK A;  1GCQ C;  2A28 A;  2FEI A;  2CDT A;  1JQQ A;  5IHI A;  1Y0M A;  1AZE A;  4Y92 A;  3VS2 A;  1WLP B;  2DL7 A;  2O31 A;  1HJD A;  1NYF A;  1AOJ A;  2BTT A;  2KEA A;  1JXO A;  2F2V A;  2CH4 W;  3I5R A;  1M8M A;  1Z9Z A;  2CT4 A;  2JS0 A;  2RQR A;  2K7A A;  1I1J A;  1NEG A;  2SRC A;  2DE0 X;  1WX6 A;  2W0Z A;  1I0C A;  4ORZ A;  2D0N A;  2RQT A;  4F14 A;  4QT7 A;  5IH2 A;  4HVW A;  3U23 A;  1M3A A;  1UG1 A;  4Z8A A;  3UA7 A;  1X2K A;  2EYW A;  1UTI A;  1GCP A;  2RQU A;  4ESR A;  2DM1 A;  2D8H A;  4J9E A;  1NYG A;  4RTU A;  1K1Z A;  1CKA A;  4X1V A;  1AWX A;  1PRM C;  2VVK A;  2ED0 A;  4F17 A;  1JU5 C;  1WXB A;  2AK5 A;  2K79 A;  2FRY A;  3EG1 A;  1WXT A;  4JJD A;  2L3P A;  2LMJ A;  2AKK A;  2KYM A;  1ABQ A;  2JTE A;  5GJW B;  1UHF A;  1VYT A;  1J3T A;  2CSQ A;  2EKH A;  1E7O A;  2FPF A;  2YUO A;  3EG3 A;  3VS3 A;  2ECZ A;  1JEG A;  1G2B A;  1X43 A;  4EIK A;  3H41 A;  2W10 A;  4E6R A;  2KR3 A;  1T3S A;  2RN8 A;  2KT8 A;  2DL3 A;  2ESW A;  1H92 A;  2JW4 A;  4KRT A;  1QWE A;  2ABL A;  2EGE A;  2EQI A;  1SPK A;  5GJV B;  3PVQ A;  1H3H A;  3TSW A;  1QKW A;  2ROT A;  2HEQ A;  1UJY A;  2DYB A;  1T0H A;  4AG2 C;  1W1F A;  2LQN A;  4LN2 A;  1UUE A;  2EGC A;  5HCK A;  2EYY A;  2PTK A;  2CUB A;  2D8J A;  2M0Y A;  2YT6 A;  1AWW A;  1GL5 A;  3LH5 A;  2JS2 A;  1VYV A;  2DLP A;  1RLP C;  1SHG A;  1LCK A;  2EYX A;  4OML A;  4IIM A;  4A63 B;  2KRN A;  2RPN A;  1BB9 A;  1NG2 A;  1VYU A;  1AWJ A;  2GQI A;  2FG0 A;  2G6F X;  2MCN A;  4FSS A;  4OMM A;  4J9H A;  4JZ3 A;  2DX1 A;  4RTX A;  4JZ4 A;  2X3X D;  2KRM A;  2ROL A;  3M0R A;  1PKS A;  3PE0 A;  1A0N B;  3H0H A;  1UEC A;  2J05 A;  2EBP A;  2DJQ A;  4RTT A;  3I35 A;  3VRZ A;  4JJC A;  1AEY A;  3SEM A;  1BU1 A;  1WA7 A;  2LZ6 B;  3TSZ A;  2KE9 A;  2C0O A;  3FJ5 A;  3NMZ C;  3KFV A;  2CUD A;  2DIL A;  1K4U S;  2JM8 A;  1T3L A;  1CKB A;  1CSK A;  1M27 C;  1MUZ A;  1QLY A;  4M4Z A;  1U5S A;  1U3O A;  2PNI A;  2B86 A;  4HCK A;  3I9Q A;  1UDL A;  4D8K A;  2GGR A;  4IIO A;  1KJW A;  2CT3 A;  2J6F A;  1FMK A;  1OV3 A;  2EYZ A;  1AVZ C;  2BZY A;  1Z9Q A;  2DA9 A;  2F2X A;  4LE9 A;  2J6K A;  1SHF A;  2JXB A;  2O9S A;  1UHC A;  2I0N A;  5ECA A;  3VS1 A;  4RTV A;  3IQL A;  4Z88 A;  2J7I A;  4J9G A;  2EW3 A;  5IXB A;  2DL8 A;  3ZL7 C;  3EGU A;  1X27 A;  1OPL A;  2OI3 A;  4ZNX A;  2HBW A;  1K76 A;  4RTW A;  3RNJ A;  2L2P A;  1PHT A;  2GTJ A;  2KYB A;  2FPD A;  1UFF A;  3EG2 A;  2IIM A;  3UA6 A;  2MIO A;  1JO8 A;  1T0J A;  4GLM A;  2KXD A;  3O5Z A;  4R0K A;  1WXU A;  4WCI A;  1K0X A;  1TUD A;  1SEM A;  1GCQ A;  4LUE A;  1RLQ C;  1TUC A;  1X69 A;  2VKN A;  1W6X A;  2J6O A;  2DF6 A;  4LNP A;  1ABO A;  2KGT A;  5FWB A;  1PRL C;  1M3C A;  1OOT A;  2A37 A;  2RQV A;  1ZX6 A;  5L23 A;  2YUN A;  4CC7 A;  1HD3 A;  1QKX A;  3H0F A;  2A08 A;  2K9G A;  3EG0 A;  2DBM A;  4RTZ A;  4HXJ A;  1U06 A;  3VS0 A;  4LUD A;  2A36 A;  1WYX A;  2HSP A;  1W70 A;  2GNC A;  1QWF A;  1E6G A;  2F2W A;  1X6B A;  2V1R A;  4AFQ C;  2PZ1 A;  1RI9 A;  1KIK A;  3VS4 A;  2K3B A;  1PKT A;  1G83 A;  2H8H A;  3A98 A;  3R6N A;  2K2M A;  1ZSG A;  2DRM A;  2FO0 A;  2GTO A;  2LCS A;  1TG0 A;  3M0P A;  2KRS A;  3VS5 A;  2BZX A;  2MOX A;  1NM7 A;  2RMO A;  1H8K A;  2SEM A;  1JXM A;  2CH4 A;  2KBT A;  2RF0 A;  2EPD A;  2LX7 A;  2L3S A;  1WIE A;  1PWT A;  1X2Q A;  2C0I A;  1GBR A;  1RUW A;  1YN8 A;  2GBQ A;  1V1C A;  1ARK A;  3M0Q A;  2NUZ A;  3PVL A;  5EC7 A;  1AWO A;  3M0T A;  5I11 A;  4CC4 B;  1KFZ A;  2LNH B;  1I07 A;  2DL4 A;  4CC3 A;  1AD5 A;  1MV0 B;  3NGP A;  2DMO A;  3QWY A;  3SHW A;  2X3W D;  1YNZ A;  2O88 A;  2CRE A;  1B07 A;  1UGV A;  2VWF A;  5I22 A;  1PNJ A;  2ENM A;  2J06 A;  2M51 A;  2O9V A;  2AZV A;  1UJ0 A;  3NPF A;  4CC2 A;  1WDX A;  4K11 A;  1YWP A;  5IXF A;  3NHN A;  1YP5 A;  1VA7 A;  1KSW A;  1N5Z A;  2RNA A;  2ED1 A;  3CQT A;  1ZLM A;  4DEY A;  3JV3 A;  1Y57 A;  1FYN A;  2L0A A;  3EHR A;  5IHN A;  1EFN A;  1HSQ A;  1WI7 A;  2C0T A;  4J9F A;  3REA B;  2YUP A;  4HVU A;  2RQW A;  3M0U A;  3VS6 A;  2JMA A;  1NLP C;  4J9I A;  4JJB A;  4J9B A;  4D8D A;  2DRK A;  2CSI A;  4OMO A;  2V1Q A;  2O2O A;  2HDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...