3EG3A

Crystal structure of the n114a mutant of abl-sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
total genus 12
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg3A00
1QKXA 1UJ0A 2J6KA 1WLPB 2C0TA 4JJCA 2LQWA 2RQVA 4RTTA 2G6FX 2JM9A 2RF0A 2K2MA 1WXUA 4IIMA 2DL4A 1J3TA 3I5SA 2KE9A 1RUWA 1M30A 1UJYA 2A08A 1V1CA 2NWMA 1GFDA 1XOVA 1SPKA 2ECZA 1KFZA 1KIKA 2MIOA 1OEBA 4QT7A 4RTYA 4AG1C 4AFQC 2NUZA 2GGRA 2ENMA 5GJWB 2DLPA 2LZ6B 2LJ0A 2GTJA 5ECAA 1GCQC 5IXBA 1NYFA 2D1XA 2O9SA 5HCKA 1OV3A 1AOJA 5IXFA 2L3QA 2E5KA 1UGVA 2DBMA 4OMMA 1GCQA 4A63B 1QKWA 2I0NA 4HCKA 3R6NA 4HVUA 1BBZA 1K9AA 4AFZC 1CKBA 4K11A 2ESWA 2EYWA 1NEBA 2F2XA 1BU1A 4OMQA 1NLPC 2AKKA 3A98A 4J9GA 4CC7A 1EFNA 1TG0A 2KR3A 2HCKA 4AFUC 2PTKA 1WFWA 4LNPA 3QWXX 1GRIA 2H8HA 1JO8A 2EBPA 2YUQA 2JS2A 2LJ1A 1YWPA 2BZ8A 2M51A 2JW4A 1YWOA 4LUDA 2EPDA 1U3OA 2L3PA 2XMFA 2FO0A 3PE0A 2OJ2A 1X43A 2EW3A 1M8MA 3NPFA 1BB9A 3VS3A 1UDLA 2GTOA 1Z9QA 3M0SA 1NYGA 4E6RA 1TUDA 1Z9ZA 1JQQA 2JMCA 4RTWA 2CDTA 2JMAA 4JPBW 1YN8A 2ABLA 2LJ3A 4HVWA 1NG2A 4J9HA 3EG1A 3EG2A 4HVVA 2O88A 2ED0A 4D8KA 1ZLMA 1ABOA 1T3SA 3VRYA 2M0YA 1KJWA 2ROTA 2DRMA 2MCNA 1NM7A 1PRMC 1K0XA 1PKTA 2CT3A 2RQUA 3CQTA 2KXDA 4RUGA 2EKHA 2VVKA 2A37A 1B07A 1I0CA 1Y57A 1W1FA 2JXBA 3GBQA 1UG1A 2JS0A 2CT4A 3KFVA 4OMPA 5IHIA 4EIKA 1JU5C 1KSWA 1MUZA 4HXJA 1AZGB 5IH2A 1YCSB 1SHGA 1VYVA 2FPEA 2C0IA 2RNAA 2FRWA 3M0RA 1W70A 1WYXA 1ZX6A 2DRKA 4OMNA 2P4RA 4AFSC 1HD3A 2A28A 1GFCA 3PVLA 4J9FA 2RQTA 3IQLA 3C0CA 2X3XD 1UECA 3VS2A 2KYBA 3H0HA 2DILA 3VS0A 4ZNXA 1YP5A 1E6GA 2DMOA 2CUBA 3EHQA 4J9EA 3TVTA 1W6XA 2FPFA 1AZEA 2RQRA 2D8JA 3REAB 1VYTA 2DNUA 1WIEA 3VRZA 1M27C 4Y92A 3REBB 4GLMA 1JXOA 2ROLA 3EHRA 1E6HA 2KBTA 1QCFA 1WXTA 1BK2A 2EYXA 2YUPA 1QWFA 1RI9A 1SSHA 2JT4A 1SEMA 1UE9A 5FW9A 1H8KA 4KRTA 2W0ZA 4OMLA 1SRMA 2HSPA 2KROA 2W10A 3M0TA 2DVJA 3QWYA 2EVRA 3JV3A 5FWCA 2OI3A 2IIMA 1LCKA 2DM1A 3EGUA 2F2VA 4CC4B 2L3SA 3SEMA 1NLOC 3EG0A 3I5RA 2PZ1A 1YNZA 2LQNA 2KGTA 2CSQA 1WI7A 2BZXA 4OMOA 2EGCA 1T3LA 4J9IA 4DEYA 4JJBA 2AZSA 2EGAA 3TSZA 3VS5A 4LN2A 4Z88A 1GBQA 2EYZA 3M0PA 2SEMA 2CREA 2O9VA 2K6DA 1H92A 2KRSA 3ULRB 1PWTA 2J6FA 2DX1A 3SHWA 1AWXA 2D0NA 5IHKA 2L0AA 1H3HA 1ZBJA 2KYMA 2YSQA 1K4US 1K1ZA 1X2QA 1AEYA 2DJQA 1HSQA 1X27A 4F16A 5I11A 3U23A 1PKSA 2J05A 4RTUA 2RQWA 2K7AA 1NEGA 3UA7A 3VS4A 1ZUYA 1ZUKA 2LMJA 2K3BA 1IO6A 4Z89A 2J7IA 2VWFA 1VYUA 1SHFA 1PRLC 2KT1A 1ABQA 2OAWA 3NGPA 1MV3A 1WA7A 2SRCA 2RN8A 2CH4W 2DE0X 4J9DA 4JZ3A 4ESRA 1X69A 1UHCA 1ARKA 2LX7A 2YUOA 1M3CA 2DL7A 3UATA 1K76A 4D8DA 5GJVB 4AG2C 4ORZA 1HJDA 1MV0B 1OPLA 2O2OA 2DBKA 4CC2A 5I22A 2QDLA 5L23A 2GBQA 1GBRA 2AK5A 2ED1A 2K79A 4JJDA 2A36A 2YUNA 1A0NB 1AWWA 4FSSA 3ZL7C 3M0QA 2YT6A 1PNJA 2RPNA 1I1JA 1CKAA 2O31A 2PNIA 1UUEA 2EYYA 1VA7A 2EQIA 2EGEA 1CSKA 1UHFA 3H41A 2CSIA 2D8HA 2FRYA 4CC3A 3TSWA 1Y0MA 1B3QA 4Z8AA 1E7OA 1RLQC 2AKLA 1U5SA 5FWBA 3UF4A 3PVQA 1K0SA 1G2BA 4F17A 3VS6A 2DA9A 1UFFA 2AZVA 3LH5A 1X6BA 4M4ZA 1T0JA 3THKA 4JZ4A 2KXCA 2DL3A 1G83A 1JEGA 1X6GA 1X2KA 2CUDA 2DF6A 4GBQA 1M3AA 2CH4A 2JM8A 1PHTA 3RNJA 1AWOA 1ZUUA 2RMOA 4DEXA 3H0FA 1QWEA 3I9QA 2FEIA 3NMZC 1I07A 4LUEA 4WCIA 1AWJA 2K9GA 2J06A 2V1RA 3VS7A 1RLPC 2L2PA 2KRMA 1OPKA 4RTVA 4RTZA 2GNCA 3H0IA 1WDXA 1U06A 2C0OA 2DL8A 3EG3A 2HDAA 2FG0A 1TUCA 1M3BA 1FMKA 1OOTA 3FJ5A 2J6OA 3VS1A 4R0KA 1S1NA 2BZYA 1ZSGA 2HEQA 2BTTA 2B86A 1WX6A 2LCSA 2V1QA 4X1VA 4J9CA 2YDLA 4J9BA 1AVZC 5IHNA 1GL5A 1SRLA 3NHNA 2X3WD 2DL5A 2GQIA 4IIOA 1GCPA 1WXBA 2HBWA 2LNHB 1N5ZA 2DYBA 2KT8A 1FYNA 4F14A 1AD5A 2KNBB 2KRNA 1JXMA 4RTXA 2VKNA 2KEAA 5EC7A 2LP5A 3I35A 3M0UA 3O5ZA 1UTIA 2FPDA 1T0HA 1QLYA 2JTEA 3RBBB 4LE9A 3UA6A 2F2WA 2MOXA
chains in the Genus database with same CATH superfamily
3SWNA 2LCLA 1YITQ 5LL6S 4LD6A 2DTIA 3QXEB 2JM9A 2LCCA 2M02A 3VYHB 1RUWA 5CIUA 1MMDA 5LJ5h 5KCOA 1SPKA 1ZSZA 2ECZA 1KFZA 2MIOA 3HSBA 4OGEA 4DBRA 2DAQA 2E10A 4JS4A 1QP2A 3JB9H 2QGGA 2MWPA 2QQSA 3FC3A 1O75A 4PFPA 1GCQC 4ZGJB 5FU6B 4BY6C 4FL6A 1NYFA 2QAZA 2O9SA 3JAME 4WTOB 5GAOq 1VQNQ 3QPHA 4A63B 1GCQA 1Q82C 1QKWA 3R6NA 1VQ4T 2V8KA 2RJDA 1CKBA 4XU2A 2K3XA 4RCBA 2K5FA 3CPWS 1VQ8Q 2ESWA 2DEQA 3QYHB 2E3IA 1BU1A 4C8QD 2AKKA 4CC7A 1JRIA 1VQ7T 1PM3A 2RHZA 3JCMQ 2IG0A 4C5HA 2HCKA 1WFWA 5HK0A 1YJNT 4A4GA 3CD6A 2JTFA 3M4GA 3G6EA 2BZ8A 1K8AR 2HD0A 2WSEE 3PTAA 1K8AU 3OB9A 1D1BA 1VQ6A 4D6WA 3R6OA 2XMFA 5A0GA 5EG2A 2EW3A 3G4ST 3JCMP 6AT1B 3MEVA 5FROA 1VQMA 3CXCA 3M0SA 1RAFB 1VQ7A 4E6RA 4RTWA 1YN8A 1M90C 4C92F 5KYWB 2IVWA 4J9HA 4HVVA 2ED0A 1YJNA 4D8KA 1ZLMA 3JSCA 3JCMf 1YFNA 2ROTA 3SFMA 4J6XA 2AT1B 5LJ5d 1NM7A 2E4HA 3CQTA 3TREA 2H3EB 1K73C 4N4GA 1W1FA 2CZ0B 3QZ5B 1YBYA 1TH7A 4KULA 4VUBA 5GAMe 4HXJA 2M16A 1AZGB 2RNAA 4M78D 5DLOA 3OS0A 1FX7A 3QZ9B 5CCAA 1JJ2A 1BI0A 3PVLA 1M4ZA 2RQTA 2X3XD 3VS2A 4RMOA 1YIJQ 3Q1JA 1QP3A 5FLXE 2RI2A 2LDMA 8ATCB 4J7IA 3EHQA 3TVTA 3TCJA 5A2QE 1AZEA 4QKUA 4E7JA 3OYFA 2DNUA 3GIBA 3VUZA 1VQ5T 3FDRA 1WIEA 4FYXB 3VRZA 2JVVA 4C92B 4Y92A 3REBB 4PFOA 3UDCA 1UB4A 3EHRA 3WVDB 1BK2A 5DM7R 1VQLQ 3FLGA 2NUPB 1BCOA 2CZ7B 1RI9A 1Y07A 2JUFA 3LGLA 3DKMA 5FW9A 3G4SA 3CC2Q 4OMLA 2R5AA 1SRMA 2HSPA 1PG5B 2DVJA 2EVRA 3QWYA 1MMGA 2HKQB 2F2VA 3LW5E 3SEMA 1M1GA 4J6YA 4EPCA 2LQNA 2EGCA 3CCJT 1T3LA 4J9IA 2QYZA 2MYSA 3L2ZA 4LN2A 4Z88A 2E65A 4J7FA 1BI1A 3ZEHA 2SEMA 2QA4T 4E7IA 1XQHA 5CQXA 1PD1A 2LQ8A 3C95A 3E2UA 3J7AF 4M7DF 2X4JA 1BI2A 5IHKA 2L0AA 3DLLA 1IHWA 2QTXA 2RHYA 1X27A 2J05A 3A8LB 4RG8A 5CKEA 1YI2A 1ZUYA 2DEUA 2LMJA 2K3BA 3EGDA 1VQ5A 2J7IA 2FHDA 5GAOr 2VWFA 4E7ZA 1PRLC 2KT1A 4BACA 1JB0E 3NGPA 5KE2A 4PL6A 2SRCA 2RN8A 4J9DA 4ESRA 1ARKA 1D1AA 2LX7A 1M3CA 2DL7A 4BI4A 1K76A 2ZAEA 3L2QA 3D7SB 4AG2C 1KHIA 1IHVA 1MV0B 1QVGP 5J26A 3FRNA 4CC2A 5FU6C 3EGXB 3GNGA 2QDLA 2GBQA 3J80E 2AK5A 2ED1A 1VQLA 4JJDA 2YUNA 4FSSA 2RJEA 3ZL7C 3CXCS 5GAN3 1OQKA 4JLIA 1U1TA 2HQXA 4J8OA 4JS5A 2EYYA 1KQSS 2R57A 4L59A 2EQJA 2LX9A 4C8QB 2DJZA 3H41A 2YXYA 2RK2A 4C0GA 1NBEB 2E12A 1N8RU 3T9NA 3CCSQ 4BD3A 4PJOA 4Z8AA 3HFNA 3QJ6A 3BW1A 4KGXB 5M9OA 2AKLA 1U5SA 2ZZDA 2IPOB 1C1AA 1K0SA 1BIBA 1UGQB 4LD9K 4C92C 2OTLA 3CC4A 4E2FB 2FL7A 1Q7YC 1UFFA 2EJFA 1WZOA 3OS2A 2VGNA 3CCQA 1X6BA 3OSVA 3G71T 3J81E 3CCLQ 4JZ4A 2DL3A 4LDWA 2MWOA 1YI2Q 4X9DA 1VIEA 3QYGB 4A4HA 1M3AA 1MNDA 3QG1A 2Y4XA 2GQVA 2RMOA 3H0FA 3QSUA 1BKBA 1I07A 5LJ3g 1AWJA 2L89A 2HL5C 2XKOC 2RD1A 1WHHA 2L2PA 1KHCA 2KRMA 3I56A 3RESA 2GNCA 3E19A 3CPFA 3CMAT 2C0OA 4PJLA 4DA4A 2OAUA 1TUCA 5D7UA 3CXCP 4C8QA 1FMKA 2DKGA 5GAOm 3FJ5A 3VS1A 4ELYC 2K5LA 1KC8R 1ZSGA 2CZ1B 4BY6B 4UC4A 1VIFA 4PJNA 1KQ2A 2LCSA 2V1QA 1Q86U 1VQKQ 4JRIA 1FMWA 1YJNQ 4PJOC 3L2VA 5DLQE 2YLCA 3ASKA 2DL5A 2PU9B 1VQLT 1RADB 3META 3OBWA 2GQIA 2BE7D 3LX7A 1WXBA 1SG5A 2KT8A 1FYNA 4F14A 1D3BA 3CCVA 4QVCA 1QVFA 2KEAA 3WXMB 2LP5A 4PNOA 2RHXA 5GAN4 3CCMA 4C8QC 1M5Q1 1UTIA 4ATOA 1T0HA 4Y91A 4XTZA 4X9CA 2JTEA 4ZN1A 3HPWA 2P4TA 3RDVA 4LE9A 1YIJT 1BIAA 1WLPB 1VOMA 1M90U 3QDFA 1BYMA 3CBPA 2Z0WA 2DD4A 2RF0A 1WXUA 4IIMA 1J3TA 2KE9A 4LDVA 1VQ8T 2QXFA 4XTUA 5KCHA 1G3SA 2JTMA 2A08A 1XOVA 4N4IA 2VXEA 3VV0A 2ZPBB 1SKUB 2GGRA 2ENMA 3X25B 3P8BB 2DZ9A 5GJWB 4BDZA 4M7AE 3M57A 2LJ0A 2X51A 4Q5WA 2OTJQ 4XQ3A 3JB9I 4M77C 1OI1A 1AOJA 1LOJA 3OW2S 5GANg 2DBMA 2X4YA 1BBZA 4AFZC 2XK0A 2RHUA 1S72Q 2EYWA 1NEBA 2F2XA 3OYYA 4J9GA 1ZA1B 2FVUA 2KR3A 2PTKA 4E7SA 1VQ9A 4IUVA 3CCRQ 3QWXX 3RKXA 2EBPA 4PJOD 1WJQA 2QA4Q 1YWPA 1TU0B 1AT1B 4C92E 1F1BB 1ZHIA 3CPWA 3JB9D 2DK3A 2EPDA 2FO0A 3JCMW 4HCBA 3OS1A 5CO7A 1KQSA 3DLMA 2WACA 1DJ7B 5L8RE 3RKYA 2RO0A 2DXUA 2QEXT 4M7AA 1M8MA 1WQWA 3VS3A 2GTOA 5LJ3j 3CC7A 2CS7A 1LVKA 3OA6A 3CMEQ 1S72T 2QQAA 4KGZB 5KYWA 3EH2A 3EG1A 1R77A 2K2VA 3RUXA 3SDZA 3CCST 1Y7XA 4GY5A 1ABOA 2V8JA 3G6ET 1VQ6Q 1TTHB 1G5VA 3ME9A 3PFSA 3CD6T 2ZPGB 1PKTA 4BB7A 2RQUA 2KXDA 1V76A 2E70A 2P0KA 4PKCC 1Y57A 2XDDA 3PNWC 2JXBA 1VQ4A 5CKHA 2VGMA 2HNIA 3JRZA 1B34B 1JU5C 1KSWA 1EZZB 4OP0A 1BI3A 4XTWA 1RAHB 2H3JA 2E6ZA 1SHGA 4ME7A 2KQWA 1W70A 1WYXA 1ZX6A 2DRKA 4OB1B 2RB6A 1M1KU 2A28A 3IQLA 3C0CA 1UECA 2KYBA 1YP5A 2XDBA 1E6GA 1YHQA 1VQ4Q 3QKJA 2V26A 4CRIA 3QO3A 4O5VA 2E3HA 2LNVA 3OW2A 1MNEA 2PUKB 1WNLA 2A3LA 1VQMT 1VQPQ 1WGSA 3G71Q 3C4SA 1JXOA 4M7AC 1E6HA 2KBTA 3CCUA 2O4XA 4M78E 1P92A 2YUPA 5D6XA 1VQKT 2BE9B 1SSHA 4M7AD 2JT4A 1SEMA 5C0MA 4C5GA 4A4KA 2W0ZA 1TOVA 1QVFP 1YHQT 1Q7YU 2KROA 2W10A 5LJ5e 3JV3A 5FWCA 4LDYA 3I56Q 4N0AA 3OYCA 4MMLA 4CC4B 3OBYA 2KGTA 3S3MA 8AT1B 3JB9J 5HY6A 3CC7Q 4JJBA 4KUDK 3RIRA 2EGAA 2DIQA 3TSZA 1K73R 3VS5A 2F69A 1IZ6A 3CCRA 1QW1A 1H92A 1PWTA 4XTXA 3SHWA 2KAFA 4C5EA 1AWXA 5GAN8 3E9GA 4XU0A 1ZBJA 1X2QA 2QA4A 1AEYA 3PT9A 3DB4A 2X4WA 4M7DC 3U23A 1KD1R 3H9NA 4KGVB 5DY9A 4OGCA 3L2WA 2A0FB 3BDLA 1IO6A 3CCQT 3CCSA 2Y90A 1G3TA 4IUPA 1SHFA 2HQHA 5LJ5f 1PCXA 2B8AA 3HKSA 3JCMb 2RI5A 3FJPA 1WA7A 1TUGB 2RM4A 4JZ3A 3M55A 3JCMc 1W2BS 3UATA 2ZPFB 1QVFS 1NZ9A 5KYYB 3P8HA 4C8QE 5IAYA 3EGDB 5GAOn 3FIFA 5LJ3f 4QVZA 3OYNA 5A0LA 2QG9B 1CKAA 4L5GA 2WSFE 4C92D 4EMKB 3EFSA 2RHIA 1W2BA 4PLIA 1I8FA 3CCVQ 3BDUA 5D6YA 2CSIA 4DBQA 2P0QA 4QQGA 3TSWA 1Y0MA 4R55A 2KMTA 1PSFA 1G2BA 1YJ9Q 4RKUE 5GAMh 3MEWA 3RMSA 2DA9A 1T0JA 2DXBA 3X20B 5LJ3d 2EAYA 2CUDA 2DF6A 4FIBA 2KVQG 5C6SA 4P5NA 3RR6A 1RAAB 2EKOA 4FT2A 1RAEB 1AWOA 2LVMA 1K8AC 1ZUUA 1Q81C 1Q95G 1QWEA 1D0ZA 2PUOB 3I9QA 3CCLA 4E7KA 4WCIA 1NJIU 1BCMA 3URGA 4KH0B 2J06A 1KD1C 1MHNA 1QVGA 2L3RA 4RTZA 3H0IA 1U06A 2R5MA 5IN1A 4BUGA 1TS9A 3L1AA 3G4SQ 5CKDA 2V8IA 4DOWA 4M78G 4Y28E 1IREB 4OF1A 3OW2P 1S72A 4J6WA 4AMCA 4R0KA 1S1NA 4LDXA 2HEQA 3OYBA 4PJOG 2CKKA 2XHCA 4J9CA 3CCEA 4F7UF 2F1LA 1GL5A 3M54A 1VQPT 1Y96A 2CP7A 1AHJB 2X3WD 1WHGA 4HKEA 3N5BB 2GF7A 4IIOA 2HBWA 1N5ZA 2DYBA 5KYXB 4AT1B 4C0ZA 3VYGA 1FXXA 2KNBB 3CBOA 2KRNA 4RTXA 2D9TA 3MP8A 2OTLQ 4IUTA 3BE3A 3I35A 3H6ZA 5KE3A 2XU8A 3EFOA 1QLYA 5KH6A 4TVRA 3JB9G 5I2SA 1QKXA 1YJ9T 2J6KA 1QCOA 2C0TA 2LQWA 2QQRA 1NJIC 2RQVA 4RTTA 2G6FX 2DL4A 1Q81U 3I5SA 3CCMQ 3CCEQ 1UJYA 4ZN3A 1V1CA 2NWMA 4OVAA 3L42A 1KIKA 2PVDB 3X24B 4QT7A 2CGHA 4RTYA 4AFQC 3GLXA 3JCMh 3I55T 2EJGA 1RAIB 2DLPA 1YI2T 1ZA2B 3KUFA 5ECAA 1WHJA 5IXBA 1WHKA 2D1XA 2L3QA 2E5KA 1UGVA 4JRKA 4OMMA 2CZ6B 4IUQA 4HCKA 1N8RC 1Y96B 1UGPB 1K9AA 2RJFA 4EDUA 1IXDA 2KK4A 4MZPA 3I56T 2CP2A 1M2OA 2QASA 3A98A 1EFNA 3HHTB 1KC8C 4C92G 3CMAQ 3M59A 1R0CB 4QVDA 2CP0A 1GXIE 3S3OA 3CC2A 3M56A 3M4YA 4YTLA 3KXTA 1Q82U 1JO8A 4M77G 2HL3A 4N4HA 1KG1A 2LJ1A 3VU3C 2GCXA 1MMAA 1ZBXA 2M51A 2JW4A 4C0DC 4LUDA 3TU4K 1U3OA 1TWBA 4V2SA 4XU1A 3PE0A 2OJ2A 5GAN5 4A54A 2LT4A 3NPFA 1BB9A 1Q82R 1Z9QA 2QGFB 2X4XA 1NYGA 2BUDA 1TXQA 4DOVA 1JQQA 4M77E 2K4YA 1VQNA 1HXDA 1NG2A 2DO3A 3S6WA 1YIJA 2AHJB 5J3BA 2QQ9A 2RI3A 2O88A 4QQDA 3VRYA 2M0YA 1KJWA 2P84A 4PJMA 2QTVA 2CP5A 2MCNA 3LYIA 1HYOA 1PRMC 2PVOB 1X75C 2CT3A 2Y4YA 4RUGA 2EKHA 2MPXC 2A37A 1B07A 4C0DB 3GBQA 2EYQA 1UG1A 2JS0A 2CT4A 3OYHA 3KFVA 4OMPA 3OYGA 1WPYA 1EX4A 5IHIA 4EIKA 2DFUA 1QVGS 5IH2A 4Z02A 5FRNA 3GPLA 2C0IA 3INZA 2FRWA 3M53A 1D3BB 3M0RA 2HAXA 1W4SA 1K9MR 1YCYA 3M9QA 4OMNA 4JDSA 4AFSC 1HD3A 3ZBDA 4NL3A 2VXFA 4DQ2A 3H0HA 2YLBA 3VS0A 3G7ZA 1I5LA 3A5ZB 4HA8A 2DMOA 1U8RA 3QUIA 1IB8A 2CUBA 4J9EA 2E1HA 1W6XA 2RQRA 3TQ7P 4M78F 3REAB 3HTRA 1KQSP 3HRTA 2JOYA 4HCZA 1N9SA 4NL2A 1M27C 2XG8D 5LJ3e 1EIFA 5GAMj 2ROLA 5AYFA 1QCFA 3OY9A 3C12A 2COWA 1WXTA 2E41A 2EIFA 1QVPA 3OQ5A 1QWFA 4XU3A 1VQMQ 5LJ5g 1UE9A 4JLGA 3A8OB 4E7HA 3OS5A 3CD6Q 1VQ7Q 1G3WA 1H8KA 1PSEA 4KRTA 3MPUB 3M0TA 1G8XA 2O4XB 2F5KA 2IIMA 2DTOA 5GAN6 1PC0A 1NLOC 1FMVA 3EG0A 3HL8A 5I2MA 3I5RA 3CMET 5GMKj 1YHQQ 5CKFA 4DBFA 2NYSA 1WQ7A 2FZGB 1ZQ1A 3EH1A 5A0DA 1GBQA 4X34A 4M7AB 3JB9F 2G3RA 4E47A 2CP6A 3QIIA 2K6DA 3QDRB 2KRSA 2DERA 5GANj 2DX1A 3OMCA 2BKDN 2KSSA 2D0NA 1WJRA 4RG2A 5GMKi 4BE2A 1H3HA 2KYMA 4BI3A 1K4US 1K1ZA 4HCCA 3O8VA 4DBHA 1PKSA 4FT4A 3OMGA 5CVIA 4RTUA 5CR2A 3EG9A 2K7AA 4FCYA 2DXCA 4M77A 4KUIA 3MEAA 3JCMe 4F7UG 1VYUA 4RCCA 5I21A 3LLRA 4KT0E 2XI9A 4ANJA 4IURA 2OAWA 2K5IA 1MV3A 2E64A 2CH4W 2EJ9A 3C94A 1X69A 1G3YA 1VQOT 1B7TA 1UHCA 3SB2A 1K9MU 4C92A 1D0YA 5GJVB 4GLKA 1M9SA 4WF2A 2O2OA 5GANf 2DBKA 2DYIA 1X01A 5LJ5j 1I4K1 3CC4T 1ACMB 1YITA 4B9WA 2A36A 1A0NB 1AWWA 5GAMd 3PIPA 3M0QA 1PNJA 4BE0A 1I1JA 2O31A 1UUEA 1VA7A 2EGEA 2LTOA 5IT9E 4C5IA 2D8HA 1H3ZA 4CC3A 1VUBA 4M75F 1VQPA 2CP3A 3NTKA 2BIVA 1E7OA 1RLQC 4MDWA 5FWBA 3PVQA 3V7CA 3CCVT 3VS6A 4M7AG 1NE8A 2AZVA 5GANd 1XTDA 3V8LA 1C6VX 4M4ZA 2K57A 5GAMg 1VQ9T 2EWNA 3THKA 3CC2T 4PFZA 1SSFA 1JEGA 1X2KA 4MZTA 4II1A 4BE1A 2CH4A 4JRPA 2CYZB 1PHTA 3BY7A 4KH1B 4C8QG 2JN0A 3CCRT 3G71A 2PVGB 4M7DG 3S3NA 2FEIA 3NMZC 1OU9A 1RACB 4LUEA 1U1SA 2VV5A 4JJNK 4HT8A 3MKDA 1JJ2P 1OU8A 2V1RA 4FU6A 4RTVA 3CCLT 3OYJA 1HK9A 5FRMA 1D1CA 3PIOA 3LGFA 1M3BA 2ZPHB 2QEXQ 1OOTA 3PMTA 2HKNA 2HMAA 2J6OA 3SWNC 4EMKC 2DIGA 2HSEB 1C0MA 1IGQA 2BTTA 2B86A 5GMKe 1WX6A 2L8DA 4M78C 2YDLA 3UT1A 2HZYA 4J5YA 4J9BA 2X35A 3CMEA 3SWNB 1PD0A 2YWWA 2EFIA 2FZCB 3JCMJ 1KK7A 4IKFA 1IRXA 1Q81R 4B9XA 2D0QB 5CQYA 5KYXA 1AD5A 1X6OA 2LQKA 3ER0A 3G1JA 5EC7A 3M0UA 4JRQA 4EMGA 2LRQA 2JJ9A 3OYIA 1YJWQ 3RKWA 2NUPA 3RBBB 2VASA 2F2WA 4NS5A 1UJ0A 4C8QF 4JJCA 5GMKl 1KQ1A 2EQUA 1Y71A 4J83A 3A8MB 2K2MA 4ZTFA 3ZFJA 1OULA 4M78B 2JNGA 5KYYA 1M30A 5AT1B 3JCMV 4FM4B 1GFDA 4FYWB 1V29B 3A8HB 1QCNA 1OEBA 3CMAA 2COYA 4AG1C 2NUZA 3EFOB 4M77F 2MI6A 3V8JA 2LZ6B 2XICA 2GTJA 3MO8A 2JZ2A 4EMKA 3CCJA 5HCKA 1OV3A 3I55A 5IXFA 3DB3A 4B6MA 2I0NA 4HVUA 2K3YA 2M9UA 4K11A 3HFOA 2KI7A 4OMQA 1NLPC 5D6WA 5GMKh 1TG0A 4AFUC 4LNPA 5CAIA 1NJIR 1GRIA 2H8HA 1MMNA 4A4FA 2OTJA 4M77D 2YUQA 2JS2A 2NLUA 1TSFA 3PMIA 4JUVA 1XNIA 1M1FA 2MK5A 1M2VA 1YWOA 4A53A 3CC7T 2KDSA 2L3PA 3CC4Q 2E5QA 4EMHA 4ZGDB 1X43A 3BFMA 4MZMA 1JJ2S 4FYVB 3GP8A 1OX9A 3JCMd 1FWZA 3CBMA 1UDLA 2YRDA 4M75C 1XJWB 1TUDA 1Z9ZA 2OX7A 2JMCA 4MMKA 2CDTA 2JMAA 4JPBW 5HKCA 2ABLA 3CCUT 2LJ3A 1VQKA 4HVWA 3EG2A 4CI0C 4ZTJA 1VQOQ 4M78A 1T3SA 4FYYB 3CEYA 3EG9B 4XK8E 3MEUA 2DRMA 2M0OA 1K0XA 2R58A 3M58A 2VVKA 2AIRB 1I0CA 2DPPB 3X26B 5GAN7 3VKIA 2M1HA 2XD0A 5FU7B 2DD5A 4ZGEB 1MGQA 3HP9A 4BI8B 3KBGA 1MUZA 1IGUA 1YCSB 1VYVA 2FPEA 5GMKm 3QJYA 2E6NA 1YJWA 2P4RA 1GFCA 4J9FA 2X9HA 1ZSZB 2DILA 2RA2A 3HRUA 1VQ5Q 4ZNXA 4IUUA 3CCQQ 2FPFA 2RJCA 1OX8A 2D8JA 3AHUA 1QMCA 3E1SA 3OYAA 3QBYA 1VYTA 3L2UA 4FW1A 3MP6A 1KD1U 1H641 4GLMA 2WSCE 5CK9A 3MJXA 1I5OB 1OZ3A 3AT1B 1I81A 1NPRA 2YHTA 2VYTA 2EYXA 1RI0A 2XDPA 4M7DB 2VUBA 1UEBA 4M7AF 1Q86R 1R8OB 1K73U 4F04B 3GF5A 3GNFB 1OYXA 2QEXA 2DXTA 1K9MC 3PGGA 7AT1B 2D6FA 4LDUA 3OYDA 1KC8U 2O01E 4R56A 5KYUA 4QW2A 2OI3A 4PJOE 2QK0A 1YITT 3P8DA 4LXCA 1LCKA 2DM1A 3EGUA 4M75D 2L3SA 3GOXA 1O9SA 3OYMA 1Q7YR 2OTJT 2PZ1A 1YNZA 2CSQA 1WI7A 2BZXA 4OMOA 2QDYB 4DEYA 3JCMg 2AZSA 3EFRA 4OB0B 4M7DD 2EYZA 3M0PA 4ELZC 1D09B 2CREA 2O9VA 1D0XA 2YRVA 4C0FA 3ULRB 2J6FA 2RK1A 3MHXA 4MDXA 1JBMA 2YSQA 2DVEA 2DJQA 1HSQA 4F16A 5KYUB 5I11A 1WHMA 3EAEA 2RH2A 2RQWA 3EGXA 1Q86C 1NEGA 3UA7A 3VS4A 1ZUKA 2GFUA 4F7UB 4Z89A 3CCJQ 1N27A 1QQJA 3QHSA 2MAMA 4O6JA 2L5QA 4BDYA 1ABQA 2QI2A 5GANh 2VB6A 3WVEB 4FW2A 4HT9A 1YJWT 1ZSZC 2PQWA 2DE0X 3V7SA 1N8RR 1M1KR 4M75G 1OZ2A 2YUOA 3I55Q 2HQEA 4D8DA 2OTLT 3OYLA 4ORZA 1HJDA 4NOYA 4M77B 1OPLA 2FYKA 3LWIA 5I22A 3V7RA 2C06A 2MF2A 5L23A 3FEOA 4PJJA 1GBRA 3SD4A 4M7DE 2K79A 5KYNA 1M8VA 1W2BP 3HRSA 2YT6A 2EQKA 2RPNA 3CCMT 2PNIA 2VC8A 4M75E 2EQIA 4QQ6A 1CSKA 2DZCA 1UHFA 2HBPA 1M2VB 4L6V5 3F70A 2DTHA 3X28B 2FRYA 1WHLA 4XTYA 1UGRB 1YJ9A 4PJOB 1B3QA 4OB2B 3UPUA 2ZPEB 1VQOA 1UGSB 3LWHA 2A7YA 5GAOl 3UF4A 3CCUQ 4F7UA 4F17A 3UWNA 3M5AA 1RAGB 3LH5A 2NUTB 4KBMB 2KXCA 1G83A 4M75B 1X6GA 4PLLA 4GBQA 1SF9A 2P0PA 2JM8A 2ZGWA 3RNJA 5GAMf 3OSSC 4DEXA 3TEEA 3CCET 1LJOA 9ATCB 4E7LA 5GANe 3NFCA 2K9GA 2MMPA 3VS7A 1LPLA 5LJ3h 1VQ8A 1RLPC 5CKBA 3A8GB 1OPKA 1WDXA 2XIDA 5J39A 3LH0A 3JCMX 2DL8A 3EG3A 2HDAA 2FG0A 2FZKB 2ATCB 5GAOp 1RL2A 3VUBA 3H8ZA 5GAN2 2COZA 3FB9A 1M1KC 4XAXB 2BZYA 4F7UE 3CPWP 2F5TX 4PJOF 4M7DA 4PK4A 2FB7A 4X1VA 1B34A 2GFAA 2I2LA 1AVZC 5IHNA 2KY9A 2ZPIB 1LNXA 3L2RA 1SRLA 4A4EA 3NHNA 3NTHA 1N6AA 4OB3B 3E9FA 4M75A 1R0BG 3VJPA 1GCPA 1WJSA 2LNHB 5FU7C 2NUTA 3OYEA 2QQBA 2ZCFB 3OYKA 1JXMA 1M90R 2VKNA 4XTVA 4OMFB 1N9RA 1VQ9Q 3O5ZA 3RMQA 2DETA 3RERA 3A1PA 2LC4A 3V8KA 1VQNT 2FPDA 4FSXA 2LT1A 2YRCA 3G6EQ 1RABB 3MCAB 3NTIA 4N0AC 3UA6A 1VQ6T 1NPPA 3MP1A 5HK3A 2MOXA 2EQMA
chains in the Genus database with same CATH topology
1QKXA 1UJ0A 2J6KA 1WLPB 2C0TA 4JJCA 2LQWA 2RQVA 4RTTA 2G6FX 2JM9A 2RF0A 2K2MA 1WXUA 4IIMA 2DL4A 1J3TA 3I5SA 2KE9A 1RUWA 1M30A 1UJYA 2A08A 1V1CA 2NWMA 1GFDA 1XOVA 1SPKA 2ECZA 1KFZA 1KIKA 2MIOA 1OEBA 4QT7A 4RTYA 4AG1C 4AFQC 2NUZA 2GGRA 2ENMA 5GJWB 2DLPA 2LZ6B 2LJ0A 2GTJA 5ECAA 1GCQC 5IXBA 1NYFA 2D1XA 2O9SA 5HCKA 1OV3A 1AOJA 5IXFA 2L3QA 2E5KA 1UGVA 2DBMA 4OMMA 1GCQA 4A63B 1QKWA 2I0NA 4HCKA 3R6NA 4HVUA 1BBZA 1K9AA 4AFZC 1CKBA 4K11A 2ESWA 2EYWA 1NEBA 2F2XA 1BU1A 4OMQA 1NLPC 2AKKA 3A98A 4J9GA 4CC7A 1EFNA 1TG0A 2KR3A 2HCKA 4AFUC 2PTKA 1WFWA 4LNPA 3QWXX 1GRIA 2H8HA 1JO8A 2EBPA 2YUQA 2JS2A 2LJ1A 1YWPA 2BZ8A 2M51A 2JW4A 1YWOA 4LUDA 2EPDA 1U3OA 2L3PA 2XMFA 2FO0A 3PE0A 2OJ2A 1X43A 2EW3A 1M8MA 3NPFA 1BB9A 3VS3A 1UDLA 2GTOA 1Z9QA 3M0SA 1NYGA 4E6RA 1TUDA 1Z9ZA 1JQQA 2JMCA 4RTWA 2CDTA 2JMAA 4JPBW 1YN8A 2ABLA 2LJ3A 4HVWA 1NG2A 4J9HA 3EG1A 3EG2A 4HVVA 2O88A 2ED0A 4D8KA 1ZLMA 1ABOA 1T3SA 3VRYA 2M0YA 1KJWA 2ROTA 2DRMA 2MCNA 1NM7A 1PRMC 1K0XA 1PKTA 2CT3A 2RQUA 3CQTA 2KXDA 4RUGA 2EKHA 2VVKA 2A37A 1B07A 1I0CA 1Y57A 1W1FA 2JXBA 3GBQA 1UG1A 2JS0A 2CT4A 3KFVA 4OMPA 5IHIA 4EIKA 1JU5C 1KSWA 1MUZA 4HXJA 1AZGB 5IH2A 1YCSB 1SHGA 1VYVA 2FPEA 2C0IA 2RNAA 2FRWA 3M0RA 1W70A 1WYXA 1ZX6A 2DRKA 4OMNA 2P4RA 4AFSC 1HD3A 2A28A 1GFCA 3PVLA 4J9FA 2RQTA 3IQLA 3C0CA 2X3XD 1UECA 3VS2A 2KYBA 3H0HA 2DILA 3VS0A 4ZNXA 1YP5A 1E6GA 2DMOA 2CUBA 3EHQA 4J9EA 3TVTA 1W6XA 2FPFA 1AZEA 2RQRA 2D8JA 3REAB 1VYTA 2DNUA 1WIEA 3VRZA 1M27C 4Y92A 3REBB 4GLMA 1JXOA 2ROLA 3EHRA 1E6HA 2KBTA 1QCFA 1WXTA 1BK2A 2EYXA 2YUPA 1QWFA 1RI9A 1SSHA 2JT4A 1SEMA 1UE9A 5FW9A 1H8KA 4KRTA 2W0ZA 4OMLA 1SRMA 2HSPA 2KROA 2W10A 3M0TA 2DVJA 3QWYA 2EVRA 3JV3A 5FWCA 2OI3A 2IIMA 1LCKA 2DM1A 3EGUA 2F2VA 4CC4B 2L3SA 3SEMA 1NLOC 3EG0A 3I5RA 2PZ1A 1YNZA 2LQNA 2KGTA 2CSQA 1WI7A 2BZXA 4OMOA 2EGCA 1T3LA 4J9IA 4DEYA 4JJBA 2AZSA 2EGAA 3TSZA 3VS5A 4LN2A 4Z88A 1GBQA 2EYZA 3M0PA 2SEMA 2CREA 2O9VA 2K6DA 1H92A 2KRSA 3ULRB 1PWTA 2J6FA 2DX1A 3SHWA 1AWXA 2D0NA 5IHKA 2L0AA 1H3HA 1ZBJA 2KYMA 2YSQA 1K4US 1K1ZA 1X2QA 1AEYA 2DJQA 1HSQA 1X27A 4F16A 5I11A 3U23A 1PKSA 2J05A 4RTUA 2RQWA 2K7AA 1NEGA 3UA7A 3VS4A 1ZUYA 1ZUKA 2LMJA 2K3BA 1IO6A 4Z89A 2J7IA 2VWFA 1VYUA 1SHFA 1PRLC 2KT1A 1ABQA 2OAWA 3NGPA 1MV3A 1WA7A 2SRCA 2RN8A 2CH4W 2DE0X 4J9DA 4JZ3A 4ESRA 1X69A 1UHCA 1ARKA 2LX7A 2YUOA 1M3CA 2DL7A 3UATA 1K76A 4D8DA 5GJVB 4AG2C 4ORZA 1HJDA 1MV0B 1OPLA 2O2OA 2DBKA 4CC2A 5I22A 2QDLA 5L23A 2GBQA 1GBRA 2AK5A 2ED1A 2K79A 4JJDA 2A36A 2YUNA 1A0NB 1AWWA 4FSSA 3ZL7C 3M0QA 2YT6A 1PNJA 2RPNA 1I1JA 1CKAA 2O31A 2PNIA 1UUEA 2EYYA 1VA7A 2EQIA 2EGEA 1CSKA 1UHFA 3H41A 2CSIA 2D8HA 2FRYA 4CC3A 3TSWA 1Y0MA 1B3QA 4Z8AA 1E7OA 1RLQC 2AKLA 1U5SA 5FWBA 3UF4A 3PVQA 1K0SA 1G2BA 4F17A 3VS6A 2DA9A 1UFFA 2AZVA 3LH5A 1X6BA 4M4ZA 1T0JA 3THKA 4JZ4A 2KXCA 2DL3A 1G83A 1JEGA 1X6GA 1X2KA 2CUDA 2DF6A 4GBQA 1M3AA 2CH4A 2JM8A 1PHTA 3RNJA 1AWOA 1ZUUA 2RMOA 4DEXA 3H0FA 1QWEA 3I9QA 2FEIA 3NMZC 1I07A 4LUEA 4WCIA 1AWJA 2K9GA 2J06A 2V1RA 3VS7A 1RLPC 2L2PA 2KRMA 1OPKA 4RTVA 4RTZA 2GNCA 3H0IA 1WDXA 1U06A 2C0OA 2DL8A 3EG3A 2HDAA 2FG0A 1TUCA 1M3BA 1FMKA 1OOTA 3FJ5A 2J6OA 3VS1A 4R0KA 1S1NA 2BZYA 1ZSGA 2HEQA 2BTTA 2B86A 1WX6A 2LCSA 2V1QA 4X1VA 4J9CA 2YDLA 4J9BA 1AVZC 5IHNA 1GL5A 1SRLA 3NHNA 2X3WD 2DL5A 2GQIA 4IIOA 1GCPA 1WXBA 2HBWA 2LNHB 1N5ZA 2DYBA 2KT8A 1FYNA 4F14A 1AD5A 2KNBB 2KRNA 1JXMA 4RTXA 2VKNA 2KEAA 5EC7A 2LP5A 3I35A 3M0UA 3O5ZA 1UTIA 2FPDA 1T0HA 1QLYA 2JTEA 3RBBB 4LE9A 3UA6A 2F2WA 2MOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKX A;  1UJ0 A;  2J6K A;  1WLP B;  2C0T A;  4JJC A;  2LQW A;  2RQV A;  4RTT A;  2G6F X;  2JM9 A;  2RF0 A;  2K2M A;  1WXU A;  4IIM A;  2DL4 A;  1J3T A;  3I5S A;  2KE9 A;  1RUW A;  1M30 A;  1UJY A;  2A08 A;  1V1C A;  2NWM A;  1GFD A;  1XOV A;  1SPK A;  2ECZ A;  1KFZ A;  1KIK A;  2MIO A;  1OEB A;  4QT7 A;  4RTY A;  4AG1 C;  4AFQ C;  2NUZ A;  2GGR A;  2ENM A;  5GJW B;  2DLP A;  2LZ6 B;  2LJ0 A;  2GTJ A;  5ECA A;  1GCQ C;  5IXB A;  1NYF A;  2D1X A;  2O9S A;  5HCK A;  1OV3 A;  1AOJ A;  5IXF A;  2L3Q A;  2E5K A;  1UGV A;  2DBM A;  4OMM A;  1GCQ A;  4A63 B;  1QKW A;  2I0N A;  4HCK A;  3R6N A;  4HVU A;  1BBZ A;  1K9A A;  4AFZ C;  1CKB A;  4K11 A;  2ESW A;  2EYW A;  1NEB A;  2F2X A;  1BU1 A;  4OMQ A;  1NLP C;  2AKK A;  3A98 A;  4J9G A;  4CC7 A;  1EFN A;  1TG0 A;  2KR3 A;  2HCK A;  4AFU C;  2PTK A;  1WFW A;  4LNP A;  3QWX X;  1GRI A;  2H8H A;  1JO8 A;  2EBP A;  2YUQ A;  2JS2 A;  2LJ1 A;  1YWP A;  2BZ8 A;  2M51 A;  2JW4 A;  1YWO A;  4LUD A;  2EPD A;  1U3O A;  2L3P A;  2XMF A;  2FO0 A;  3PE0 A;  2OJ2 A;  1X43 A;  2EW3 A;  1M8M A;  3NPF A;  1BB9 A;  3VS3 A;  1UDL A;  2GTO A;  1Z9Q A;  3M0S A;  1NYG A;  4E6R A;  1TUD A;  1Z9Z A;  1JQQ A;  2JMC A;  4RTW A;  2CDT A;  2JMA A;  4JPB W;  1YN8 A;  2ABL A;  2LJ3 A;  4HVW A;  1NG2 A;  4J9H A;  3EG1 A;  3EG2 A;  4HVV A;  2O88 A;  2ED0 A;  4D8K A;  1ZLM A;  1ABO A;  1T3S A;  3VRY A;  2M0Y A;  1KJW A;  2ROT A;  2DRM A;  2MCN A;  1NM7 A;  1PRM C;  1K0X A;  1PKT A;  2CT3 A;  2RQU A;  3CQT A;  2KXD A;  4RUG A;  2EKH A;  2VVK A;  2A37 A;  1B07 A;  1I0C A;  1Y57 A;  1W1F A;  2JXB A;  3GBQ A;  1UG1 A;  2JS0 A;  2CT4 A;  3KFV A;  4OMP A;  5IHI A;  4EIK A;  1JU5 C;  1KSW A;  1MUZ A;  4HXJ A;  1AZG B;  5IH2 A;  1YCS B;  1SHG A;  1VYV A;  2FPE A;  2C0I A;  2RNA A;  2FRW A;  3M0R A;  1W70 A;  1WYX A;  1ZX6 A;  2DRK A;  4OMN A;  2P4R A;  4AFS C;  1HD3 A;  2A28 A;  1GFC A;  3PVL A;  4J9F A;  2RQT A;  3IQL A;  3C0C A;  2X3X D;  1UEC A;  3VS2 A;  2KYB A;  3H0H A;  2DIL A;  3VS0 A;  4ZNX A;  1YP5 A;  1E6G A;  2DMO A;  2CUB A;  3EHQ A;  4J9E A;  3TVT A;  1W6X A;  2FPF A;  1AZE A;  2RQR A;  2D8J A;  3REA B;  1VYT A;  2DNU A;  1WIE A;  3VRZ A;  1M27 C;  4Y92 A;  3REB B;  4GLM A;  1JXO A;  2ROL A;  3EHR A;  1E6H A;  2KBT A;  1QCF A;  1WXT A;  1BK2 A;  2EYX A;  2YUP A;  1QWF A;  1RI9 A;  1SSH A;  2JT4 A;  1SEM A;  1UE9 A;  5FW9 A;  1H8K A;  4KRT A;  2W0Z A;  4OML A;  1SRM A;  2HSP A;  2KRO A;  2W10 A;  3M0T A;  2DVJ A;  3QWY A;  2EVR A;  3JV3 A;  5FWC A;  2OI3 A;  2IIM A;  1LCK A;  2DM1 A;  3EGU A;  2F2V A;  4CC4 B;  2L3S A;  3SEM A;  1NLO C;  3EG0 A;  3I5R A;  2PZ1 A;  1YNZ A;  2LQN A;  2KGT A;  2CSQ A;  1WI7 A;  2BZX A;  4OMO A;  2EGC A;  1T3L A;  4J9I A;  4DEY A;  4JJB A;  2AZS A;  2EGA A;  3TSZ A;  3VS5 A;  4LN2 A;  4Z88 A;  1GBQ A;  2EYZ A;  3M0P A;  2SEM A;  2CRE A;  2O9V A;  2K6D A;  1H92 A;  2KRS A;  3ULR B;  1PWT A;  2J6F A;  2DX1 A;  3SHW A;  1AWX A;  2D0N A;  5IHK A;  2L0A A;  1H3H A;  1ZBJ A;  2KYM A;  2YSQ A;  1K4U S;  1K1Z A;  1X2Q A;  1AEY A;  2DJQ A;  1HSQ A;  1X27 A;  4F16 A;  5I11 A;  3U23 A;  1PKS A;  2J05 A;  4RTU A;  2RQW A;  2K7A A;  1NEG A;  3UA7 A;  3VS4 A;  1ZUY A;  1ZUK A;  2LMJ A;  2K3B A;  1IO6 A;  4Z89 A;  2J7I A;  2VWF A;  1VYU A;  1SHF A;  1PRL C;  2KT1 A;  1ABQ A;  2OAW A;  3NGP A;  1MV3 A;  1WA7 A;  2SRC A;  2RN8 A;  2CH4 W;  2DE0 X;  4J9D A;  4JZ3 A;  4ESR A;  1X69 A;  1UHC A;  1ARK A;  2LX7 A;  2YUO A;  1M3C A;  2DL7 A;  3UAT A;  1K76 A;  4D8D A;  5GJV B;  4AG2 C;  4ORZ A;  1HJD A;  1MV0 B;  1OPL A;  2O2O A;  2DBK A;  4CC2 A;  5I22 A;  2QDL A;  5L23 A;  2GBQ A;  1GBR A;  2AK5 A;  2ED1 A;  2K79 A;  4JJD A;  2A36 A;  2YUN A;  1A0N B;  1AWW A;  4FSS A;  3ZL7 C;  3M0Q A;  2YT6 A;  1PNJ A;  2RPN A;  1I1J A;  1CKA A;  2O31 A;  2PNI A;  1UUE A;  2EYY A;  1VA7 A;  2EQI A;  2EGE A;  1CSK A;  1UHF A;  3H41 A;  2CSI A;  2D8H A;  2FRY A;  4CC3 A;  3TSW A;  1Y0M A;  1B3Q A;  4Z8A A;  1E7O A;  1RLQ C;  2AKL A;  1U5S A;  5FWB A;  3UF4 A;  3PVQ A;  1K0S A;  1G2B A;  4F17 A;  3VS6 A;  2DA9 A;  1UFF A;  2AZV A;  3LH5 A;  1X6B A;  4M4Z A;  1T0J A;  3THK A;  4JZ4 A;  2KXC A;  2DL3 A;  1G83 A;  1JEG A;  1X6G A;  1X2K A;  2CUD A;  2DF6 A;  4GBQ A;  1M3A A;  2CH4 A;  2JM8 A;  1PHT A;  3RNJ A;  1AWO A;  1ZUU A;  2RMO A;  4DEX A;  3H0F A;  1QWE A;  3I9Q A;  2FEI A;  3NMZ C;  1I07 A;  4LUE A;  4WCI A;  1AWJ A;  2K9G A;  2J06 A;  2V1R A;  3VS7 A;  1RLP C;  2L2P A;  2KRM A;  1OPK A;  4RTV A;  4RTZ A;  2GNC A;  3H0I A;  1WDX A;  1U06 A;  2C0O A;  2DL8 A;  3EG3 A;  2HDA A;  2FG0 A;  1TUC A;  1M3B A;  1FMK A;  1OOT A;  3FJ5 A;  2J6O A;  3VS1 A;  4R0K A;  1S1N A;  2BZY A;  1ZSG A;  2HEQ A;  2BTT A;  2B86 A;  1WX6 A;  2LCS A;  2V1Q A;  4X1V A;  4J9C A;  2YDL A;  4J9B A;  1AVZ C;  5IHN A;  1GL5 A;  1SRL A;  3NHN A;  2X3W D;  2DL5 A;  2GQI A;  4IIO A;  1GCP A;  1WXB A;  2HBW A;  2LNH B;  1N5Z A;  2DYB A;  2KT8 A;  1FYN A;  4F14 A;  1AD5 A;  2KNB B;  2KRN A;  1JXM A;  4RTX A;  2VKN A;  2KEA A;  5EC7 A;  2LP5 A;  3I35 A;  3M0U A;  3O5Z A;  1UTI A;  2FPD A;  1T0H A;  1QLY A;  2JTE A;  3RBB B;  4LE9 A;  3UA6 A;  2F2W A;  2MOX A; 
#chains in the Genus database with same CATH topology
 3SWN A;  2LCL A;  1YIT Q;  5LL6 S;  4LD6 A;  2DTI A;  3QXE B;  2JM9 A;  2LCC A;  2M02 A;  3VYH B;  1RUW A;  5CIU A;  1MMD A;  5LJ5 h;  5KCO A;  1SPK A;  1ZSZ A;  2ECZ A;  1KFZ A;  2MIO A;  3HSB A;  4OGE A;  4DBR A;  2DAQ A;  2E10 A;  4JS4 A;  1QP2 A;  3JB9 H;  2QGG A;  2MWP A;  2QQS A;  3FC3 A;  1O75 A;  4PFP A;  1GCQ C;  4ZGJ B;  5FU6 B;  4BY6 C;  4FL6 A;  1NYF A;  2QAZ A;  2O9S A;  3JAM E;  4WTO B;  5GAO q;  1VQN Q;  3QPH A;  4A63 B;  1GCQ A;  1Q82 C;  1QKW A;  3R6N A;  1VQ4 T;  2V8K A;  2RJD A;  1CKB A;  4XU2 A;  2K3X A;  4RCB A;  2K5F A;  3CPW S;  1VQ8 Q;  2ESW A;  2DEQ A;  3QYH B;  2E3I A;  1BU1 A;  4C8Q D;  2AKK A;  4CC7 A;  1JRI A;  1VQ7 T;  1PM3 A;  2RHZ A;  3JCM Q;  2IG0 A;  4C5H A;  2HCK A;  1WFW A;  5HK0 A;  1YJN T;  4A4G A;  3CD6 A;  2JTF A;  3M4G A;  3G6E A;  2BZ8 A;  1K8A R;  2HD0 A;  2WSE E;  3PTA A;  1K8A U;  3OB9 A;  1D1B A;  1VQ6 A;  4D6W A;  3R6O A;  2XMF A;  5A0G A;  5EG2 A;  2EW3 A;  3G4S T;  3JCM P;  6AT1 B;  3MEV A;  5FRO A;  1VQM A;  3CXC A;  3M0S A;  1RAF B;  1VQ7 A;  4E6R A;  4RTW A;  1YN8 A;  1M90 C;  4C92 F;  5KYW B;  2IVW A;  4J9H A;  4HVV A;  2ED0 A;  1YJN A;  4D8K A;  1ZLM A;  3JSC A;  3JCM f;  1YFN A;  2ROT A;  3SFM A;  4J6X A;  2AT1 B;  5LJ5 d;  1NM7 A;  2E4H A;  3CQT A;  3TRE A;  2H3E B;  1K73 C;  4N4G A;  1W1F A;  2CZ0 B;  3QZ5 B;  1YBY A;  1TH7 A;  4KUL A;  4VUB A;  5GAM e;  4HXJ A;  2M16 A;  1AZG B;  2RNA A;  4M78 D;  5DLO A;  3OS0 A;  1FX7 A;  3QZ9 B;  5CCA A;  1JJ2 A;  1BI0 A;  3PVL A;  1M4Z A;  2RQT A;  2X3X D;  3VS2 A;  4RMO A;  1YIJ Q;  3Q1J A;  1QP3 A;  5FLX E;  2RI2 A;  2LDM A;  8ATC B;  4J7I A;  3EHQ A;  3TVT A;  3TCJ A;  5A2Q E;  1AZE A;  4QKU A;  4E7J A;  3OYF A;  2DNU A;  3GIB A;  3VUZ A;  1VQ5 T;  3FDR A;  1WIE A;  4FYX B;  3VRZ A;  2JVV A;  4C92 B;  4Y92 A;  3REB B;  4PFO A;  3UDC A;  1UB4 A;  3EHR A;  3WVD B;  1BK2 A;  5DM7 R;  1VQL Q;  3FLG A;  2NUP B;  1BCO A;  2CZ7 B;  1RI9 A;  1Y07 A;  2JUF A;  3LGL A;  3DKM A;  5FW9 A;  3G4S A;  3CC2 Q;  4OML A;  2R5A A;  1SRM A;  2HSP A;  1PG5 B;  2DVJ A;  2EVR A;  3QWY A;  1MMG A;  2HKQ B;  2F2V A;  3LW5 E;  3SEM A;  1M1G A;  4J6Y A;  4EPC A;  2LQN A;  2EGC A;  3CCJ T;  1T3L A;  4J9I A;  2QYZ A;  2MYS A;  3L2Z A;  4LN2 A;  4Z88 A;  2E65 A;  4J7F A;  1BI1 A;  3ZEH A;  2SEM A;  2QA4 T;  4E7I A;  1XQH A;  5CQX A;  1PD1 A;  2LQ8 A;  3C95 A;  3E2U A;  3J7A F;  4M7D F;  2X4J A;  1BI2 A;  5IHK A;  2L0A A;  3DLL A;  1IHW A;  2QTX A;  2RHY A;  1X27 A;  2J05 A;  3A8L B;  4RG8 A;  5CKE A;  1YI2 A;  1ZUY A;  2DEU A;  2LMJ A;  2K3B A;  3EGD A;  1VQ5 A;  2J7I A;  2FHD A;  5GAO r;  2VWF A;  4E7Z A;  1PRL C;  2KT1 A;  4BAC A;  1JB0 E;  3NGP A;  5KE2 A;  4PL6 A;  2SRC A;  2RN8 A;  4J9D A;  4ESR A;  1ARK A;  1D1A A;  2LX7 A;  1M3C A;  2DL7 A;  4BI4 A;  1K76 A;  2ZAE A;  3L2Q A;  3D7S B;  4AG2 C;  1KHI A;  1IHV A;  1MV0 B;  1QVG P;  5J26 A;  3FRN A;  4CC2 A;  5FU6 C;  3EGX B;  3GNG A;  2QDL A;  2GBQ A;  3J80 E;  2AK5 A;  2ED1 A;  1VQL A;  4JJD A;  2YUN A;  4FSS A;  2RJE A;  3ZL7 C;  3CXC S;  5GAN 3;  1OQK A;  4JLI A;  1U1T A;  2HQX A;  4J8O A;  4JS5 A;  2EYY A;  1KQS S;  2R57 A;  4L59 A;  2EQJ A;  2LX9 A;  4C8Q B;  2DJZ A;  3H41 A;  2YXY A;  2RK2 A;  4C0G A;  1NBE B;  2E12 A;  1N8R U;  3T9N A;  3CCS Q;  4BD3 A;  4PJO A;  4Z8A A;  3HFN A;  3QJ6 A;  3BW1 A;  4KGX B;  5M9O A;  2AKL A;  1U5S A;  2ZZD A;  2IPO B;  1C1A A;  1K0S A;  1BIB A;  1UGQ B;  4LD9 K;  4C92 C;  2OTL A;  3CC4 A;  4E2F B;  2FL7 A;  1Q7Y C;  1UFF A;  2EJF A;  1WZO A;  3OS2 A;  2VGN A;  3CCQ A;  1X6B A;  3OSV A;  3G71 T;  3J81 E;  3CCL Q;  4JZ4 A;  2DL3 A;  4LDW A;  2MWO A;  1YI2 Q;  4X9D A;  1VIE A;  3QYG B;  4A4H A;  1M3A A;  1MND A;  3QG1 A;  2Y4X A;  2GQV A;  2RMO A;  3H0F A;  3QSU A;  1BKB A;  1I07 A;  5LJ3 g;  1AWJ A;  2L89 A;  2HL5 C;  2XKO C;  2RD1 A;  1WHH A;  2L2P A;  1KHC A;  2KRM A;  3I56 A;  3RES A;  2GNC A;  3E19 A;  3CPF A;  3CMA T;  2C0O A;  4PJL A;  4DA4 A;  2OAU A;  1TUC A;  5D7U A;  3CXC P;  4C8Q A;  1FMK A;  2DKG A;  5GAO m;  3FJ5 A;  3VS1 A;  4ELY C;  2K5L A;  1KC8 R;  1ZSG A;  2CZ1 B;  4BY6 B;  4UC4 A;  1VIF A;  4PJN A;  1KQ2 A;  2LCS A;  2V1Q A;  1Q86 U;  1VQK Q;  4JRI A;  1FMW A;  1YJN Q;  4PJO C;  3L2V A;  5DLQ E;  2YLC A;  3ASK A;  2DL5 A;  2PU9 B;  1VQL T;  1RAD B;  3MET A;  3OBW A;  2GQI A;  2BE7 D;  3LX7 A;  1WXB A;  1SG5 A;  2KT8 A;  1FYN A;  4F14 A;  1D3B A;  3CCV A;  4QVC A;  1QVF A;  2KEA A;  3WXM B;  2LP5 A;  4PNO A;  2RHX A;  5GAN 4;  3CCM A;  4C8Q C;  1M5Q 1;  1UTI A;  4ATO A;  1T0H A;  4Y91 A;  4XTZ A;  4X9C A;  2JTE A;  4ZN1 A;  3HPW A;  2P4T A;  3RDV A;  4LE9 A;  1YIJ T;  1BIA A;  1WLP B;  1VOM A;  1M90 U;  3QDF A;  1BYM A;  3CBP A;  2Z0W A;  2DD4 A;  2RF0 A;  1WXU A;  4IIM A;  1J3T A;  2KE9 A;  4LDV A;  1VQ8 T;  2QXF A;  4XTU A;  5KCH A;  1G3S A;  2JTM A;  2A08 A;  1XOV A;  4N4I A;  2VXE A;  3VV0 A;  2ZPB B;  1SKU B;  2GGR A;  2ENM A;  3X25 B;  3P8B B;  2DZ9 A;  5GJW B;  4BDZ A;  4M7A E;  3M57 A;  2LJ0 A;  2X51 A;  4Q5W A;  2OTJ Q;  4XQ3 A;  3JB9 I;  4M77 C;  1OI1 A;  1AOJ A;  1LOJ A;  3OW2 S;  5GAN g;  2DBM A;  2X4Y A;  1BBZ A;  4AFZ C;  2XK0 A;  2RHU A;  1S72 Q;  2EYW A;  1NEB A;  2F2X A;  3OYY A;  4J9G A;  1ZA1 B;  2FVU A;  2KR3 A;  2PTK A;  4E7S A;  1VQ9 A;  4IUV A;  3CCR Q;  3QWX X;  3RKX A;  2EBP A;  4PJO D;  1WJQ A;  2QA4 Q;  1YWP A;  1TU0 B;  1AT1 B;  4C92 E;  1F1B B;  1ZHI A;  3CPW A;  3JB9 D;  2DK3 A;  2EPD A;  2FO0 A;  3JCM W;  4HCB A;  3OS1 A;  5CO7 A;  1KQS A;  3DLM A;  2WAC A;  1DJ7 B;  5L8R E;  3RKY A;  2RO0 A;  2DXU A;  2QEX T;  4M7A A;  1M8M A;  1WQW A;  3VS3 A;  2GTO A;  5LJ3 j;  3CC7 A;  2CS7 A;  1LVK A;  3OA6 A;  3CME Q;  1S72 T;  2QQA A;  4KGZ B;  5KYW A;  3EH2 A;  3EG1 A;  1R77 A;  2K2V A;  3RUX A;  3SDZ A;  3CCS T;  1Y7X A;  4GY5 A;  1ABO A;  2V8J A;  3G6E T;  1VQ6 Q;  1TTH B;  1G5V A;  3ME9 A;  3PFS A;  3CD6 T;  2ZPG B;  1PKT A;  4BB7 A;  2RQU A;  2KXD A;  1V76 A;  2E70 A;  2P0K A;  4PKC C;  1Y57 A;  2XDD A;  3PNW C;  2JXB A;  1VQ4 A;  5CKH A;  2VGM A;  2HNI A;  3JRZ A;  1B34 B;  1JU5 C;  1KSW A;  1EZZ B;  4OP0 A;  1BI3 A;  4XTW A;  1RAH B;  2H3J A;  2E6Z A;  1SHG A;  4ME7 A;  2KQW A;  1W70 A;  1WYX A;  1ZX6 A;  2DRK A;  4OB1 B;  2RB6 A;  1M1K U;  2A28 A;  3IQL A;  3C0C A;  1UEC A;  2KYB A;  1YP5 A;  2XDB A;  1E6G A;  1YHQ A;  1VQ4 Q;  3QKJ A;  2V26 A;  4CRI A;  3QO3 A;  4O5V A;  2E3H A;  2LNV A;  3OW2 A;  1MNE A;  2PUK B;  1WNL A;  2A3L A;  1VQM T;  1VQP Q;  1WGS A;  3G71 Q;  3C4S A;  1JXO A;  4M7A C;  1E6H A;  2KBT A;  3CCU A;  2O4X A;  4M78 E;  1P92 A;  2YUP A;  5D6X A;  1VQK T;  2BE9 B;  1SSH A;  4M7A D;  2JT4 A;  1SEM A;  5C0M A;  4C5G A;  4A4K A;  2W0Z A;  1TOV A;  1QVF P;  1YHQ T;  1Q7Y U;  2KRO A;  2W10 A;  5LJ5 e;  3JV3 A;  5FWC A;  4LDY A;  3I56 Q;  4N0A A;  3OYC A;  4MML A;  4CC4 B;  3OBY A;  2KGT A;  3S3M A;  8AT1 B;  3JB9 J;  5HY6 A;  3CC7 Q;  4JJB A;  4KUD K;  3RIR A;  2EGA A;  2DIQ A;  3TSZ A;  1K73 R;  3VS5 A;  2F69 A;  1IZ6 A;  3CCR A;  1QW1 A;  1H92 A;  1PWT A;  4XTX A;  3SHW A;  2KAF A;  4C5E A;  1AWX A;  5GAN 8;  3E9G A;  4XU0 A;  1ZBJ A;  1X2Q A;  2QA4 A;  1AEY A;  3PT9 A;  3DB4 A;  2X4W A;  4M7D C;  3U23 A;  1KD1 R;  3H9N A;  4KGV B;  5DY9 A;  4OGC A;  3L2W A;  2A0F B;  3BDL A;  1IO6 A;  3CCQ T;  3CCS A;  2Y90 A;  1G3T A;  4IUP A;  1SHF A;  2HQH A;  5LJ5 f;  1PCX A;  2B8A A;  3HKS A;  3JCM b;  2RI5 A;  3FJP A;  1WA7 A;  1TUG B;  2RM4 A;  4JZ3 A;  3M55 A;  3JCM c;  1W2B S;  3UAT A;  2ZPF B;  1QVF S;  1NZ9 A;  5KYY B;  3P8H A;  4C8Q E;  5IAY A;  3EGD B;  5GAO n;  3FIF A;  5LJ3 f;  4QVZ A;  3OYN A;  5A0L A;  2QG9 B;  1CKA A;  4L5G A;  2WSF E;  4C92 D;  4EMK B;  3EFS A;  2RHI A;  1W2B A;  4PLI A;  1I8F A;  3CCV Q;  3BDU A;  5D6Y A;  2CSI A;  4DBQ A;  2P0Q A;  4QQG A;  3TSW A;  1Y0M A;  4R55 A;  2KMT A;  1PSF A;  1G2B A;  1YJ9 Q;  4RKU E;  5GAM h;  3MEW A;  3RMS A;  2DA9 A;  1T0J A;  2DXB A;  3X20 B;  5LJ3 d;  2EAY A;  2CUD A;  2DF6 A;  4FIB A;  2KVQ G;  5C6S A;  4P5N A;  3RR6 A;  1RAA B;  2EKO A;  4FT2 A;  1RAE B;  1AWO A;  2LVM A;  1K8A C;  1ZUU A;  1Q81 C;  1Q95 G;  1QWE A;  1D0Z A;  2PUO B;  3I9Q A;  3CCL A;  4E7K A;  4WCI A;  1NJI U;  1BCM A;  3URG A;  4KH0 B;  2J06 A;  1KD1 C;  1MHN A;  1QVG A;  2L3R A;  4RTZ A;  3H0I A;  1U06 A;  2R5M A;  5IN1 A;  4BUG A;  1TS9 A;  3L1A A;  3G4S Q;  5CKD A;  2V8I A;  4DOW A;  4M78 G;  4Y28 E;  1IRE B;  4OF1 A;  3OW2 P;  1S72 A;  4J6W A;  4AMC A;  4R0K A;  1S1N A;  4LDX A;  2HEQ A;  3OYB A;  4PJO G;  2CKK A;  2XHC A;  4J9C A;  3CCE A;  4F7U F;  2F1L A;  1GL5 A;  3M54 A;  1VQP T;  1Y96 A;  2CP7 A;  1AHJ B;  2X3W D;  1WHG A;  4HKE A;  3N5B B;  2GF7 A;  4IIO A;  2HBW A;  1N5Z A;  2DYB A;  5KYX B;  4AT1 B;  4C0Z A;  3VYG A;  1FXX A;  2KNB B;  3CBO A;  2KRN A;  4RTX A;  2D9T A;  3MP8 A;  2OTL Q;  4IUT A;  3BE3 A;  3I35 A;  3H6Z A;  5KE3 A;  2XU8 A;  3EFO A;  1QLY A;  5KH6 A;  4TVR A;  3JB9 G;  5I2S A;  1QKX A;  1YJ9 T;  2J6K A;  1QCO A;  2C0T A;  2LQW A;  2QQR A;  1NJI C;  2RQV A;  4RTT A;  2G6F X;  2DL4 A;  1Q81 U;  3I5S A;  3CCM Q;  3CCE Q;  1UJY A;  4ZN3 A;  1V1C A;  2NWM A;  4OVA A;  3L42 A;  1KIK A;  2PVD B;  3X24 B;  4QT7 A;  2CGH A;  4RTY A;  4AFQ C;  3GLX A;  3JCM h;  3I55 T;  2EJG A;  1RAI B;  2DLP A;  1YI2 T;  1ZA2 B;  3KUF A;  5ECA A;  1WHJ A;  5IXB A;  1WHK A;  2D1X A;  2L3Q A;  2E5K A;  1UGV A;  4JRK A;  4OMM A;  2CZ6 B;  4IUQ A;  4HCK A;  1N8R C;  1Y96 B;  1UGP B;  1K9A A;  2RJF A;  4EDU A;  1IXD A;  2KK4 A;  4MZP A;  3I56 T;  2CP2 A;  1M2O A;  2QAS A;  3A98 A;  1EFN A;  3HHT B;  1KC8 C;  4C92 G;  3CMA Q;  3M59 A;  1R0C B;  4QVD A;  2CP0 A;  1GXI E;  3S3O A;  3CC2 A;  3M56 A;  3M4Y A;  4YTL A;  3KXT A;  1Q82 U;  1JO8 A;  4M77 G;  2HL3 A;  4N4H A;  1KG1 A;  2LJ1 A;  3VU3 C;  2GCX A;  1MMA A;  1ZBX A;  2M51 A;  2JW4 A;  4C0D C;  4LUD A;  3TU4 K;  1U3O A;  1TWB A;  4V2S A;  4XU1 A;  3PE0 A;  2OJ2 A;  5GAN 5;  4A54 A;  2LT4 A;  3NPF A;  1BB9 A;  1Q82 R;  1Z9Q A;  2QGF B;  2X4X A;  1NYG A;  2BUD A;  1TXQ A;  4DOV A;  1JQQ A;  4M77 E;  2K4Y A;  1VQN A;  1HXD A;  1NG2 A;  2DO3 A;  3S6W A;  1YIJ A;  2AHJ B;  5J3B A;  2QQ9 A;  2RI3 A;  2O88 A;  4QQD A;  3VRY A;  2M0Y A;  1KJW A;  2P84 A;  4PJM A;  2QTV A;  2CP5 A;  2MCN A;  3LYI A;  1HYO A;  1PRM C;  2PVO B;  1X75 C;  2CT3 A;  2Y4Y A;  4RUG A;  2EKH A;  2MPX C;  2A37 A;  1B07 A;  4C0D B;  3GBQ A;  2EYQ A;  1UG1 A;  2JS0 A;  2CT4 A;  3OYH A;  3KFV A;  4OMP A;  3OYG A;  1WPY A;  1EX4 A;  5IHI A;  4EIK A;  2DFU A;  1QVG S;  5IH2 A;  4Z02 A;  5FRN A;  3GPL A;  2C0I A;  3INZ A;  2FRW A;  3M53 A;  1D3B B;  3M0R A;  2HAX A;  1W4S A;  1K9M R;  1YCY A;  3M9Q A;  4OMN A;  4JDS A;  4AFS C;  1HD3 A;  3ZBD A;  4NL3 A;  2VXF A;  4DQ2 A;  3H0H A;  2YLB A;  3VS0 A;  3G7Z A;  1I5L A;  3A5Z B;  4HA8 A;  2DMO A;  1U8R A;  3QUI A;  1IB8 A;  2CUB A;  4J9E A;  2E1H A;  1W6X A;  2RQR A;  3TQ7 P;  4M78 F;  3REA B;  3HTR A;  1KQS P;  3HRT A;  2JOY A;  4HCZ A;  1N9S A;  4NL2 A;  1M27 C;  2XG8 D;  5LJ3 e;  1EIF A;  5GAM j;  2ROL A;  5AYF A;  1QCF A;  3OY9 A;  3C12 A;  2COW A;  1WXT A;  2E41 A;  2EIF A;  1QVP A;  3OQ5 A;  1QWF A;  4XU3 A;  1VQM Q;  5LJ5 g;  1UE9 A;  4JLG A;  3A8O B;  4E7H A;  3OS5 A;  3CD6 Q;  1VQ7 Q;  1G3W A;  1H8K A;  1PSE A;  4KRT A;  3MPU B;  3M0T A;  1G8X A;  2O4X B;  2F5K A;  2IIM A;  2DTO A;  5GAN 6;  1PC0 A;  1NLO C;  1FMV A;  3EG0 A;  3HL8 A;  5I2M A;  3I5R A;  3CME T;  5GMK j;  1YHQ Q;  5CKF A;  4DBF A;  2NYS A;  1WQ7 A;  2FZG B;  1ZQ1 A;  3EH1 A;  5A0D A;  1GBQ A;  4X34 A;  4M7A B;  3JB9 F;  2G3R A;  4E47 A;  2CP6 A;  3QII A;  2K6D A;  3QDR B;  2KRS A;  2DER A;  5GAN j;  2DX1 A;  3OMC A;  2BKD N;  2KSS A;  2D0N A;  1WJR A;  4RG2 A;  5GMK i;  4BE2 A;  1H3H A;  2KYM A;  4BI3 A;  1K4U S;  1K1Z A;  4HCC A;  3O8V A;  4DBH A;  1PKS A;  4FT4 A;  3OMG A;  5CVI A;  4RTU A;  5CR2 A;  3EG9 A;  2K7A A;  4FCY A;  2DXC A;  4M77 A;  4KUI A;  3MEA A;  3JCM e;  4F7U G;  1VYU A;  4RCC A;  5I21 A;  3LLR A;  4KT0 E;  2XI9 A;  4ANJ A;  4IUR A;  2OAW A;  2K5I A;  1MV3 A;  2E64 A;  2CH4 W;  2EJ9 A;  3C94 A;  1X69 A;  1G3Y A;  1VQO T;  1B7T A;  1UHC A;  3SB2 A;  1K9M U;  4C92 A;  1D0Y A;  5GJV B;  4GLK A;  1M9S A;  4WF2 A;  2O2O A;  5GAN f;  2DBK A;  2DYI A;  1X01 A;  5LJ5 j;  1I4K 1;  3CC4 T;  1ACM B;  1YIT A;  4B9W A;  2A36 A;  1A0N B;  1AWW A;  5GAM d;  3PIP A;  3M0Q A;  1PNJ A;  4BE0 A;  1I1J A;  2O31 A;  1UUE A;  1VA7 A;  2EGE A;  2LTO A;  5IT9 E;  4C5I A;  2D8H A;  1H3Z A;  4CC3 A;  1VUB A;  4M75 F;  1VQP A;  2CP3 A;  3NTK A;  2BIV A;  1E7O A;  1RLQ C;  4MDW A;  5FWB A;  3PVQ A;  3V7C A;  3CCV T;  3VS6 A;  4M7A G;  1NE8 A;  2AZV A;  5GAN d;  1XTD A;  3V8L A;  1C6V X;  4M4Z A;  2K57 A;  5GAM g;  1VQ9 T;  2EWN A;  3THK A;  3CC2 T;  4PFZ A;  1SSF A;  1JEG A;  1X2K A;  4MZT A;  4II1 A;  4BE1 A;  2CH4 A;  4JRP A;  2CYZ B;  1PHT A;  3BY7 A;  4KH1 B;  4C8Q G;  2JN0 A;  3CCR T;  3G71 A;  2PVG B;  4M7D G;  3S3N A;  2FEI A;  3NMZ C;  1OU9 A;  1RAC B;  4LUE A;  1U1S A;  2VV5 A;  4JJN K;  4HT8 A;  3MKD A;  1JJ2 P;  1OU8 A;  2V1R A;  4FU6 A;  4RTV A;  3CCL T;  3OYJ A;  1HK9 A;  5FRM A;  1D1C A;  3PIO A;  3LGF A;  1M3B A;  2ZPH B;  2QEX Q;  1OOT A;  3PMT A;  2HKN A;  2HMA A;  2J6O A;  3SWN C;  4EMK C;  2DIG A;  2HSE B;  1C0M A;  1IGQ A;  2BTT A;  2B86 A;  5GMK e;  1WX6 A;  2L8D A;  4M78 C;  2YDL A;  3UT1 A;  2HZY A;  4J5Y A;  4J9B A;  2X35 A;  3CME A;  3SWN B;  1PD0 A;  2YWW A;  2EFI A;  2FZC B;  3JCM J;  1KK7 A;  4IKF A;  1IRX A;  1Q81 R;  4B9X A;  2D0Q B;  5CQY A;  5KYX A;  1AD5 A;  1X6O A;  2LQK A;  3ER0 A;  3G1J A;  5EC7 A;  3M0U A;  4JRQ A;  4EMG A;  2LRQ A;  2JJ9 A;  3OYI A;  1YJW Q;  3RKW A;  2NUP A;  3RBB B;  2VAS A;  2F2W A;  4NS5 A;  1UJ0 A;  4C8Q F;  4JJC A;  5GMK l;  1KQ1 A;  2EQU A;  1Y71 A;  4J83 A;  3A8M B;  2K2M A;  4ZTF A;  3ZFJ A;  1OUL A;  4M78 B;  2JNG A;  5KYY A;  1M30 A;  5AT1 B;  3JCM V;  4FM4 B;  1GFD A;  4FYW B;  1V29 B;  3A8H B;  1QCN A;  1OEB A;  3CMA A;  2COY A;  4AG1 C;  2NUZ A;  3EFO B;  4M77 F;  2MI6 A;  3V8J A;  2LZ6 B;  2XIC A;  2GTJ A;  3MO8 A;  2JZ2 A;  4EMK A;  3CCJ A;  5HCK A;  1OV3 A;  3I55 A;  5IXF A;  3DB3 A;  4B6M A;  2I0N A;  4HVU A;  2K3Y A;  2M9U A;  4K11 A;  3HFO A;  2KI7 A;  4OMQ A;  1NLP C;  5D6W A;  5GMK h;  1TG0 A;  4AFU C;  4LNP A;  5CAI A;  1NJI R;  1GRI A;  2H8H A;  1MMN A;  4A4F A;  2OTJ A;  4M77 D;  2YUQ A;  2JS2 A;  2NLU A;  1TSF A;  3PMI A;  4JUV A;  1XNI A;  1M1F A;  2MK5 A;  1M2V A;  1YWO A;  4A53 A;  3CC7 T;  2KDS A;  2L3P A;  3CC4 Q;  2E5Q A;  4EMH A;  4ZGD B;  1X43 A;  3BFM A;  4MZM A;  1JJ2 S;  4FYV B;  3GP8 A;  1OX9 A;  3JCM d;  1FWZ A;  3CBM A;  1UDL A;  2YRD A;  4M75 C;  1XJW B;  1TUD A;  1Z9Z A;  2OX7 A;  2JMC A;  4MMK A;  2CDT A;  2JMA A;  4JPB W;  5HKC A;  2ABL A;  3CCU T;  2LJ3 A;  1VQK A;  4HVW A;  3EG2 A;  4CI0 C;  4ZTJ A;  1VQO Q;  4M78 A;  1T3S A;  4FYY B;  3CEY A;  3EG9 B;  4XK8 E;  3MEU A;  2DRM A;  2M0O A;  1K0X A;  2R58 A;  3M58 A;  2VVK A;  2AIR B;  1I0C A;  2DPP B;  3X26 B;  5GAN 7;  3VKI A;  2M1H A;  2XD0 A;  5FU7 B;  2DD5 A;  4ZGE B;  1MGQ A;  3HP9 A;  4BI8 B;  3KBG A;  1MUZ A;  1IGU A;  1YCS B;  1VYV A;  2FPE A;  5GMK m;  3QJY A;  2E6N A;  1YJW A;  2P4R A;  1GFC A;  4J9F A;  2X9H A;  1ZSZ B;  2DIL A;  2RA2 A;  3HRU A;  1VQ5 Q;  4ZNX A;  4IUU A;  3CCQ Q;  2FPF A;  2RJC A;  1OX8 A;  2D8J A;  3AHU A;  1QMC A;  3E1S A;  3OYA A;  3QBY A;  1VYT A;  3L2U A;  4FW1 A;  3MP6 A;  1KD1 U;  1H64 1;  4GLM A;  2WSC E;  5CK9 A;  3MJX A;  1I5O B;  1OZ3 A;  3AT1 B;  1I81 A;  1NPR A;  2YHT A;  2VYT A;  2EYX A;  1RI0 A;  2XDP A;  4M7D B;  2VUB A;  1UEB A;  4M7A F;  1Q86 R;  1R8O B;  1K73 U;  4F04 B;  3GF5 A;  3GNF B;  1OYX A;  2QEX A;  2DXT A;  1K9M C;  3PGG A;  7AT1 B;  2D6F A;  4LDU A;  3OYD A;  1KC8 U;  2O01 E;  4R56 A;  5KYU A;  4QW2 A;  2OI3 A;  4PJO E;  2QK0 A;  1YIT T;  3P8D A;  4LXC A;  1LCK A;  2DM1 A;  3EGU A;  4M75 D;  2L3S A;  3GOX A;  1O9S A;  3OYM A;  1Q7Y R;  2OTJ T;  2PZ1 A;  1YNZ A;  2CSQ A;  1WI7 A;  2BZX A;  4OMO A;  2QDY B;  4DEY A;  3JCM g;  2AZS A;  3EFR A;  4OB0 B;  4M7D D;  2EYZ A;  3M0P A;  4ELZ C;  1D09 B;  2CRE A;  2O9V A;  1D0X A;  2YRV A;  4C0F A;  3ULR B;  2J6F A;  2RK1 A;  3MHX A;  4MDX A;  1JBM A;  2YSQ A;  2DVE A;  2DJQ A;  1HSQ A;  4F16 A;  5KYU B;  5I11 A;  1WHM A;  3EAE A;  2RH2 A;  2RQW A;  3EGX A;  1Q86 C;  1NEG A;  3UA7 A;  3VS4 A;  1ZUK A;  2GFU A;  4F7U B;  4Z89 A;  3CCJ Q;  1N27 A;  1QQJ A;  3QHS A;  2MAM A;  4O6J A;  2L5Q A;  4BDY A;  1ABQ A;  2QI2 A;  5GAN h;  2VB6 A;  3WVE B;  4FW2 A;  4HT9 A;  1YJW T;  1ZSZ C;  2PQW A;  2DE0 X;  3V7S A;  1N8R R;  1M1K R;  4M75 G;  1OZ2 A;  2YUO A;  3I55 Q;  2HQE A;  4D8D A;  2OTL T;  3OYL A;  4ORZ A;  1HJD A;  4NOY A;  4M77 B;  1OPL A;  2FYK A;  3LWI A;  5I22 A;  3V7R A;  2C06 A;  2MF2 A;  5L23 A;  3FEO A;  4PJJ A;  1GBR A;  3SD4 A;  4M7D E;  2K79 A;  5KYN A;  1M8V A;  1W2B P;  3HRS A;  2YT6 A;  2EQK A;  2RPN A;  3CCM T;  2PNI A;  2VC8 A;  4M75 E;  2EQI A;  4QQ6 A;  1CSK A;  2DZC A;  1UHF A;  2HBP A;  1M2V B;  4L6V 5;  3F70 A;  2DTH A;  3X28 B;  2FRY A;  1WHL A;  4XTY A;  1UGR B;  1YJ9 A;  4PJO B;  1B3Q A;  4OB2 B;  3UPU A;  2ZPE B;  1VQO A;  1UGS B;  3LWH A;  2A7Y A;  5GAO l;  3UF4 A;  3CCU Q;  4F7U A;  4F17 A;  3UWN A;  3M5A A;  1RAG B;  3LH5 A;  2NUT B;  4KBM B;  2KXC A;  1G83 A;  4M75 B;  1X6G A;  4PLL A;  4GBQ A;  1SF9 A;  2P0P A;  2JM8 A;  2ZGW A;  3RNJ A;  5GAM f;  3OSS C;  4DEX A;  3TEE A;  3CCE T;  1LJO A;  9ATC B;  4E7L A;  5GAN e;  3NFC A;  2K9G A;  2MMP A;  3VS7 A;  1LPL A;  5LJ3 h;  1VQ8 A;  1RLP C;  5CKB A;  3A8G B;  1OPK A;  1WDX A;  2XID A;  5J39 A;  3LH0 A;  3JCM X;  2DL8 A;  3EG3 A;  2HDA A;  2FG0 A;  2FZK B;  2ATC B;  5GAO p;  1RL2 A;  3VUB A;  3H8Z A;  5GAN 2;  2COZ A;  3FB9 A;  1M1K C;  4XAX B;  2BZY A;  4F7U E;  3CPW P;  2F5T X;  4PJO F;  4M7D A;  4PK4 A;  2FB7 A;  4X1V A;  1B34 A;  2GFA A;  2I2L A;  1AVZ C;  5IHN A;  2KY9 A;  2ZPI B;  1LNX A;  3L2R A;  1SRL A;  4A4E A;  3NHN A;  3NTH A;  1N6A A;  4OB3 B;  3E9F A;  4M75 A;  1R0B G;  3VJP A;  1GCP A;  1WJS A;  2LNH B;  5FU7 C;  2NUT A;  3OYE A;  2QQB A;  2ZCF B;  3OYK A;  1JXM A;  1M90 R;  2VKN A;  4XTV A;  4OMF B;  1N9R A;  1VQ9 Q;  3O5Z A;  3RMQ A;  2DET A;  3RER A;  3A1P A;  2LC4 A;  3V8K A;  1VQN T;  2FPD A;  4FSX A;  2LT1 A;  2YRC A;  3G6E Q;  1RAB B;  3MCA B;  3NTI A;  4N0A C;  3UA6 A;  1VQ6 T;  1NPP A;  3MP1 A;  5HK3 A;  2MOX A;  2EQM A; 
#chains in the Genus database with same CATH homology
 1QKX A;  1UJ0 A;  2J6K A;  1WLP B;  2C0T A;  4JJC A;  2LQW A;  2RQV A;  4RTT A;  2G6F X;  2JM9 A;  2RF0 A;  2K2M A;  1WXU A;  4IIM A;  2DL4 A;  1J3T A;  3I5S A;  2KE9 A;  1RUW A;  1M30 A;  1UJY A;  2A08 A;  1V1C A;  2NWM A;  1GFD A;  1XOV A;  1SPK A;  2ECZ A;  1KFZ A;  1KIK A;  2MIO A;  1OEB A;  4QT7 A;  4RTY A;  4AG1 C;  4AFQ C;  2NUZ A;  2GGR A;  2ENM A;  5GJW B;  2DLP A;  2LZ6 B;  2LJ0 A;  2GTJ A;  5ECA A;  1GCQ C;  5IXB A;  1NYF A;  2D1X A;  2O9S A;  5HCK A;  1OV3 A;  1AOJ A;  5IXF A;  2L3Q A;  2E5K A;  1UGV A;  2DBM A;  4OMM A;  1GCQ A;  4A63 B;  1QKW A;  2I0N A;  4HCK A;  3R6N A;  4HVU A;  1BBZ A;  1K9A A;  4AFZ C;  1CKB A;  4K11 A;  2ESW A;  2EYW A;  1NEB A;  2F2X A;  1BU1 A;  4OMQ A;  1NLP C;  2AKK A;  3A98 A;  4J9G A;  4CC7 A;  1EFN A;  1TG0 A;  2KR3 A;  2HCK A;  4AFU C;  2PTK A;  1WFW A;  4LNP A;  3QWX X;  1GRI A;  2H8H A;  1JO8 A;  2EBP A;  2YUQ A;  2JS2 A;  2LJ1 A;  1YWP A;  2BZ8 A;  2M51 A;  2JW4 A;  1YWO A;  4LUD A;  2EPD A;  1U3O A;  2L3P A;  2XMF A;  2FO0 A;  3PE0 A;  2OJ2 A;  1X43 A;  2EW3 A;  1M8M A;  3NPF A;  1BB9 A;  3VS3 A;  1UDL A;  2GTO A;  1Z9Q A;  3M0S A;  1NYG A;  4E6R A;  1TUD A;  1Z9Z A;  1JQQ A;  2JMC A;  4RTW A;  2CDT A;  2JMA A;  4JPB W;  1YN8 A;  2ABL A;  2LJ3 A;  4HVW A;  1NG2 A;  4J9H A;  3EG1 A;  3EG2 A;  4HVV A;  2O88 A;  2ED0 A;  4D8K A;  1ZLM A;  1ABO A;  1T3S A;  3VRY A;  2M0Y A;  1KJW A;  2ROT A;  2DRM A;  2MCN A;  1NM7 A;  1PRM C;  1K0X A;  1PKT A;  2CT3 A;  2RQU A;  3CQT A;  2KXD A;  4RUG A;  2EKH A;  2VVK A;  2A37 A;  1B07 A;  1I0C A;  1Y57 A;  1W1F A;  2JXB A;  3GBQ A;  1UG1 A;  2JS0 A;  2CT4 A;  3KFV A;  4OMP A;  5IHI A;  4EIK A;  1JU5 C;  1KSW A;  1MUZ A;  4HXJ A;  1AZG B;  5IH2 A;  1YCS B;  1SHG A;  1VYV A;  2FPE A;  2C0I A;  2RNA A;  2FRW A;  3M0R A;  1W70 A;  1WYX A;  1ZX6 A;  2DRK A;  4OMN A;  2P4R A;  4AFS C;  1HD3 A;  2A28 A;  1GFC A;  3PVL A;  4J9F A;  2RQT A;  3IQL A;  3C0C A;  2X3X D;  1UEC A;  3VS2 A;  2KYB A;  3H0H A;  2DIL A;  3VS0 A;  4ZNX A;  1YP5 A;  1E6G A;  2DMO A;  2CUB A;  3EHQ A;  4J9E A;  3TVT A;  1W6X A;  2FPF A;  1AZE A;  2RQR A;  2D8J A;  3REA B;  1VYT A;  2DNU A;  1WIE A;  3VRZ A;  1M27 C;  4Y92 A;  3REB B;  4GLM A;  1JXO A;  2ROL A;  3EHR A;  1E6H A;  2KBT A;  1QCF A;  1WXT A;  1BK2 A;  2EYX A;  2YUP A;  1QWF A;  1RI9 A;  1SSH A;  2JT4 A;  1SEM A;  1UE9 A;  5FW9 A;  1H8K A;  4KRT A;  2W0Z A;  4OML A;  1SRM A;  2HSP A;  2KRO A;  2W10 A;  3M0T A;  2DVJ A;  3QWY A;  2EVR A;  3JV3 A;  5FWC A;  2OI3 A;  2IIM A;  1LCK A;  2DM1 A;  3EGU A;  2F2V A;  4CC4 B;  2L3S A;  3SEM A;  1NLO C;  3EG0 A;  3I5R A;  2PZ1 A;  1YNZ A;  2LQN A;  2KGT A;  2CSQ A;  1WI7 A;  2BZX A;  4OMO A;  2EGC A;  1T3L A;  4J9I A;  4DEY A;  4JJB A;  2AZS A;  2EGA A;  3TSZ A;  3VS5 A;  4LN2 A;  4Z88 A;  1GBQ A;  2EYZ A;  3M0P A;  2SEM A;  2CRE A;  2O9V A;  2K6D A;  1H92 A;  2KRS A;  3ULR B;  1PWT A;  2J6F A;  2DX1 A;  3SHW A;  1AWX A;  2D0N A;  5IHK A;  2L0A A;  1H3H A;  1ZBJ A;  2KYM A;  2YSQ A;  1K4U S;  1K1Z A;  1X2Q A;  1AEY A;  2DJQ A;  1HSQ A;  1X27 A;  4F16 A;  5I11 A;  3U23 A;  1PKS A;  2J05 A;  4RTU A;  2RQW A;  2K7A A;  1NEG A;  3UA7 A;  3VS4 A;  1ZUY A;  1ZUK A;  2LMJ A;  2K3B A;  1IO6 A;  4Z89 A;  2J7I A;  2VWF A;  1VYU A;  1SHF A;  1PRL C;  2KT1 A;  1ABQ A;  2OAW A;  3NGP A;  1MV3 A;  1WA7 A;  2SRC A;  2RN8 A;  2CH4 W;  2DE0 X;  4J9D A;  4JZ3 A;  4ESR A;  1X69 A;  1UHC A;  1ARK A;  2LX7 A;  2YUO A;  1M3C A;  2DL7 A;  3UAT A;  1K76 A;  4D8D A;  5GJV B;  4AG2 C;  4ORZ A;  1HJD A;  1MV0 B;  1OPL A;  2O2O A;  2DBK A;  4CC2 A;  5I22 A;  2QDL A;  5L23 A;  2GBQ A;  1GBR A;  2AK5 A;  2ED1 A;  2K79 A;  4JJD A;  2A36 A;  2YUN A;  1A0N B;  1AWW A;  4FSS A;  3ZL7 C;  3M0Q A;  2YT6 A;  1PNJ A;  2RPN A;  1I1J A;  1CKA A;  2O31 A;  2PNI A;  1UUE A;  2EYY A;  1VA7 A;  2EQI A;  2EGE A;  1CSK A;  1UHF A;  3H41 A;  2CSI A;  2D8H A;  2FRY A;  4CC3 A;  3TSW A;  1Y0M A;  1B3Q A;  4Z8A A;  1E7O A;  1RLQ C;  2AKL A;  1U5S A;  5FWB A;  3UF4 A;  3PVQ A;  1K0S A;  1G2B A;  4F17 A;  3VS6 A;  2DA9 A;  1UFF A;  2AZV A;  3LH5 A;  1X6B A;  4M4Z A;  1T0J A;  3THK A;  4JZ4 A;  2KXC A;  2DL3 A;  1G83 A;  1JEG A;  1X6G A;  1X2K A;  2CUD A;  2DF6 A;  4GBQ A;  1M3A A;  2CH4 A;  2JM8 A;  1PHT A;  3RNJ A;  1AWO A;  1ZUU A;  2RMO A;  4DEX A;  3H0F A;  1QWE A;  3I9Q A;  2FEI A;  3NMZ C;  1I07 A;  4LUE A;  4WCI A;  1AWJ A;  2K9G A;  2J06 A;  2V1R A;  3VS7 A;  1RLP C;  2L2P A;  2KRM A;  1OPK A;  4RTV A;  4RTZ A;  2GNC A;  3H0I A;  1WDX A;  1U06 A;  2C0O A;  2DL8 A;  3EG3 A;  2HDA A;  2FG0 A;  1TUC A;  1M3B A;  1FMK A;  1OOT A;  3FJ5 A;  2J6O A;  3VS1 A;  4R0K A;  1S1N A;  2BZY A;  1ZSG A;  2HEQ A;  2BTT A;  2B86 A;  1WX6 A;  2LCS A;  2V1Q A;  4X1V A;  4J9C A;  2YDL A;  4J9B A;  1AVZ C;  5IHN A;  1GL5 A;  1SRL A;  3NHN A;  2X3W D;  2DL5 A;  2GQI A;  4IIO A;  1GCP A;  1WXB A;  2HBW A;  2LNH B;  1N5Z A;  2DYB A;  2KT8 A;  1FYN A;  4F14 A;  1AD5 A;  2KNB B;  2KRN A;  1JXM A;  4RTX A;  2VKN A;  2KEA A;  5EC7 A;  2LP5 A;  3I35 A;  3M0U A;  3O5Z A;  1UTI A;  2FPD A;  1T0H A;  1QLY A;  2JTE A;  3RBB B;  4LE9 A;  3UA6 A;  2F2W A;  2MOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...