3EG3A

Crystal structure of the n114a mutant of abl-sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
b'MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 12
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg3A00
2LQWA 2D1XA 2G6FX 2EKHA 1SHFA 2K7AA 3UF4A 4RTYA 1PKSA 1GRIA 1U3OA 2EW3A 1UTIA 3RBBB 1WA7A 1M30A 3C0CA 2ROLA 2DLPA 2ED1A 1WX6A 3M0SA 1K4US 1ARKA 4GBQA 1YCSB 2CH4W 4D8DA 2PZ1A 2CDTA 2LJ1A 4D8KA 1NLOC 4AFZC 1G83A 4RTUA 1OOTA 1ZLMA 2AZSA 3NPFA 1WFWA 2HDAA 2J06A 1UFFA 4LN2A 2JTEA 2MOXA 1WLPB 4RTZA 2FPEA 2L3PA 4RTWA 2CH4A 2ABLA 2BZXA 1UE9A 2RN8A 2VWFA 2O2OA 2GNCA 3VS1A 2LJ0A 1B3QA 1X6GA 4CC2A 1X6BA 2O9SA 1H92A 3PVLA 1WDXA 2HCKA 1WXUA 2V1QA 2LNHB 3UA7A 2DL7A 1OPLA 2L2PA 2CUDA 1EFNA 1X2KA 4OMLA 3LH5A 2LX7A 1PNJA 1PKTA 2HBWA 5IHNA 1NEGA 2ESWA 1Y0MA 1SPKA 2DL3A 1LCKA 1OPKA 1H3HA 1KSWA 3I35A 2D8HA 2A37A 2KGTA 3VS7A 5FW9A 2C0OA 3M0RA 1RLQC 1QCFA 2KNBB 1VYVA 5IXBA 4AFSC 1X69A 2H8HA 3REBB 1ZUYA 3IQLA 1K1ZA 1QKWA 2RQUA 1U06A 1SRMA 4AG2C 2L0AA 1AZGB 4J9DA 5L23A 1CKAA 1AEYA 1KIKA 2JMCA 2EGEA 4IIOA 4LE9A 1K0SA 2KT8A 2B86A 4J9IA 3TSWA 1E7OA 3CQTA 2RQVA 2FPDA 2K6DA 4HCKA 1YP5A 2DILA 4OMQA 2DVJA 2RPNA 2VKNA 1K0XA 2NWMA 3EG0A 1ZBJA 5IXFA 4JZ3A 1JQQA 1NLPC 2DM1A 3KFVA 1M3AA 2QDLA 3THKA 2PTKA 2FG0A 1FMKA 2LP5A 1UHFA 2CSQA 3M0QA 1AWOA 2W10A 1PRMC 4IIMA 2GGRA 4HXJA 4AFQC 1BB9A 1PRLC 4AG1C 4J9CA 2GBQA 4F14A 3I9QA 1AOJA 1AWXA 2W0ZA 2LQNA 2JM8A 2XMFA 1VA7A 2J05A 4J9FA 2CT4A 2CREA 4HVWA 1TUCA 2GTJA 4J9BA 1BK2A 1WYXA 2DBKA 2LMJA 4CC7A 1JO8A 2C0IA 3EG2A 1B07A 5FWBA 4DEYA 1M3BA 1IO6A 4FSSA 1RI9A 1Z9ZA 4A63B 5IH2A 2M0YA 2A28A 2CUBA 1TUDA 1FYNA 1ABQA 1RLPC 2DMOA 2KYMA 4OMMA 1QLYA 3M0PA 4OMNA 3M0UA 2EBPA 1UHCA 1UDLA 1T0HA 2SEMA 2EGAA 3UA6A 2D0NA 1VYTA 2AKKA 1SEMA 4RTTA 1KJWA 4M4ZA 2EGCA 4OMPA 4ORZA 2E5KA 2YUOA 2J6OA 3SEMA 2KEAA 2HSPA 2V1RA 2DF6A 2AZVA 1WXTA 1VYUA 2JS0A 3VRZA 3RNJA 2A36A 1SHGA 2MIOA 3TVTA 1Z9QA 3ZL7C 4JJBA 1JXOA 4J9EA 2DYBA 1OV3A 2KRSA 2NUZA 1NYFA 2KRNA 5GJVB 3REAB 1QKXA 1AWWA 1A0NB 3GBQA 3NHNA 5HCKA 1NG2A 2KROA 1YWPA 2JS2A 1SRLA 2F2WA 4JJDA 3ULRB 1K9AA 1CKBA 4HVVA 1JXMA 1TG0A 2SRCA 2DL8A 5IHIA 2K2MA 4K11A 1XOVA 3A98A 3VS4A 2K3BA 1ZUKA 2RQRA 2GQIA 1WIEA 1GFCA 3EHQA 2KRMA 2RMOA 1ZX6A 2ROTA 4Z88A 4Z8AA 4HVUA 3VS5A 4OMOA 2KT1A 2J6FA 3I5RA 4ZNXA 2O88A 2RQWA 2LJ3A 1K76A 1HD3A 1MUZA 1M3CA 1NYGA 1ZSGA 2EYXA 3JV3A 5IHKA 2DA9A 1UG1A 3M0TA 1E6GA 4X1VA 2FEIA 1UJ0A 1BU1A 2YDLA 1ABOA 2K9GA 2RF0A 2KYBA 1U5SA 4RUGA 1S1NA 2VVKA 1WI7A 2L3SA 2HEQA 4RTXA 2J6KA 4J9GA 1M27C 1QWFA 1X43A 1M8MA 2F2VA 2JMAA 1X2QA 1I1JA 4J9HA 1GBRA 3NMZC 2DNUA 1UJYA 1G2BA 2I0NA 1WXBA 1H8KA 2CT3A 2FO0A 1HSQA 4GLMA 4RTVA 3PE0A 4JZ4A 1T0JA 2DRKA 4Y92A 2KE9A 2EYZA 2X3WD 1MV0B 1YWOA 1AWJA 2OAWA 4QT7A 1T3LA 2JW4A 1YNZA 2F2XA 3H41A 3SHWA 4LNPA 2JT4A 3R6NA 2AK5A 3H0HA 3QWYA 1X27A 1BBZA 4LUEA 4CC4B 1GL5A 4F16A 4F17A 2PNIA 3H0FA 1MV3A 1QWEA 2KR3A 2A08A 2YT6A 2P4RA 2JM9A 1ZUUA 4WCIA 2MCNA 1OEBA 4AFUC 1T3SA 1UGVA 1W1FA 1JU5C 1HJDA 2FPFA 4ESRA 1J3TA 2GTOA 1UUEA 2LZ6B 5I22A 1W70A 4CC3A 2FRWA 2EVRA 2ECZA 2KBTA 3TSZA 2M51A 3EG1A 3NGPA 1GCQC 2YSQA 1KFZA 2X3XD 2DL5A 1E6HA 1AZEA 2DJQA 4EIKA 1PHTA 2IIMA 2J7IA 4R0KA 3EG3A 1GCPA 4E6RA 5GJWB 3EGUA 2BZYA 2DE0X 2L3QA 5ECAA 2C0TA 2EYWA 1NEBA 2DBMA 5FWCA 3VRYA 2AKLA 1NM7A 5I11A 1N5ZA 1GBQA 3VS6A 1PWTA 1AVZC 3UATA 2KXDA 2O31A 1RUWA 2EQIA 2ENMA 5EC7A 2KXCA 1AD5A 2BZ8A 2EPDA 2YUQA 2BTTA 1SSHA 1GCQA 2JXBA 1Y57A 2CSIA 1I07A 4KRTA 3I5SA 1I0CA 3FJ5A 2OI3A 4JPBW 3QWXX 2DL4A 4JJCA 3VS2A 2RQTA 2ED0A 2DX1A 1V1CA 2LCSA 2O9VA 3U23A 4LUDA 1W6XA 1GFDA 2OJ2A 2FRYA 2DRMA 3O5ZA 1CSKA 3PVQA 4DEXA 3VS3A 1YN8A 2RNAA 2YUNA 1JEGA 2K79A 3H0IA 2YUPA 1UECA 3EHRA 4Z89A 2D8JA 2EYYA 3VS0A
chains in the Genus database with same CATH superfamily
3I55T 2EKHA 2K7AA 3PIOA 1GRIA 1Y96A 5A2QE 4EMHA 1C6VX 2K4YA 1M90R 1D1CA 4F7UA 4M78A 1N8RU 1B7TA 1S72T 1WX6A 3C94A 1K4US 4RMOA 4BE2A 1YITT 4D8DA 3CCMA 2HQXA 2PZ1A 4D8KA 1G83A 1U8RA 2P4TA 3H6ZA 4FL6A 3CC4Q 4M7DB 2AZSA 4M7AD 3NPFA 4BI4A 1VQ9T 1V29B 5KYUA 2J06A 4E7HA 3GNFB 5CK9A 4RTZA 2RI5A 4RTWA 2CH4A 4NS5A 2HBPA 4OGCA 4C92C 1IGQA 1UE9A 1RACB 2RN8A 4BD3A 2LJ0A 3MO8A 1X6GA 4CC2A 3N5BB 2CKKA 1R77A 5CKHA 3V8JA 3M9QA 5A0GA 3PVLA 2HCKA 2YLCA 2QI2A 5LJ5e 2V1QA 2LNHB 3CCJA 1AT1B 3UA7A 2CP7A 2CUDA 1BI2A 4QQDA 1NJIC 4C92D 3PNWC 1PNJA 1PKTA 4J7IA 3FEOA 1KD1U 4RCCA 2PUKB 5KYYA 1NEGA 3A8OB 3MEUA 3P8BB 3QHSA 5A0DA 1H3HA 3QIIA 1IZ6A 4LDWA 5GAN5 1NE8A 1HYOA 4BI8B 4C8QF 3M4YA 2D8HA 2D9TA 1UEBA 3QG1A 3CD6Q 2C0OA 3M0RA 2E70A 3Q1JA 2DXBA 4AFSC 1KC8U 2FL7A 1VQNT 2F1LA 2L0AA 5GAN8 2QEXA 2JTFA 1CKAA 2LX9A 2JMCA 1K0SA 1S72Q 3MP8A 3CPWP 3L1AA 2RQVA 4HCKA 2DILA 4OMQA 2RPNA 1R8OB 1WHHA 2VGMA 3LW5E 1Q81R 2DAQA 4PJOE 1NLPC 1M3AA 4ZGDB 3A5ZB 5LJ3h 4IKFA 2LP5A 1UHFA 3M0QA 1AWOA 1PRMC 2R5AA 3G6EA 1JJ2P 1Y07A 4M7DG 2KVQG 4AFQC 4NL3A 4XTZA 1KC8C 2E6ZA 4M78E 2GBQA 4BY6C 4FCYA 1WHGA 3CCUQ 5IN1A 2XMFA 1X01A 4N0AC 2CREA 4ZGJB 1Q7YR 2XU8A 3JCMQ 2CZ7B 2GTJA 1BK2A 1U1TA 3JCMW 4C8QA 3OYFA 1JO8A 3EG2A 5FWBA 1B07A 3LLRA 5CVIA 3V7CA 3X20B 4DEYA 5GAN7 3G71Q 1VQ5T 4FSSA 1VQPQ 1TTHB 1UGRB 4N4HA 4A63B 3S3NA 1JBMA 1TUDA 1X75C 1ABQA 3EG9B 2NUPB 2ZPFB 2DPPB 3EH2A 2E12A 4GY5A 4OVAA 3L2VA 3OYYA 4LDVA 1UHCA 2SEMA 2D0NA 1VYTA 1MMAA 3GNGA 3RIRA 2RI2A 1HXDA 4MZMA 2OTLA 4C5EA 2HL5C 1D0XA 4JJNK 4RTTA 1KJWA 1YBYA 2EGCA 1YHQT 3FRNA 1EIFA 1K9MC 3URGA 2KEAA 4M75D 1K8AR 1WJSA 2AZVA 1Q82R 5KE2A 2QYZA 2Y4XA 2L8DA 2QQSA 2RJFA 3MPUB 3ZL7C 1VQLA 1K73C 3DLLA 1JXOA 4F04B 5GJVB 2KRNA 3CCQA 1M1KU 2HL3A 4MZTA 1NG2A 1YIJT 1YWPA 1SRLA 3JCMe 4J5YA 1VQMA 4MMLA 1MMDA 4M77C 1F1BB 4HVVA 2DJZA 1JXMA 4IUVA 1EZZB 1RAFB 5LJ5h 1XOVA 3VS4A 1ZUKA 1N8RR 3AHUA 2X4YA 4OGEA 1M1GA 1FX7A 3HRTA 3VS5A 4M7AF 2J6FA 3HFOA 3L2RA 2RQWA 1QVGP 4M7DE 3CXCP 3EGXB 3TCJA 1KHIA 2RF0A 4MDWA 2Y4YA 3WXMB 3NTKA 1S1NA 2IVWA 1VQ6T 1OX8A 2ZPEB 2L3SA 2HEQA 2V8KA 3LWHA 3EG9A 2J6KA 4KGXB 1M8MA 4A4KA 1X2QA 5GAOr 1WGSA 2NYSA 2F5TX 2M9UA 2EYQA 2DNUA 1UJYA 1G2BA 2E10A 1SF9A 1LPLA 4C92F 1IB8A 5I2SA 4P5NA 2NLUA 1OU9A 3VYHB 1KD1R 2ZPGB 3FB9A 1ZQ1A 3VYGA 3ASKA 1AWJA 4QT7A 1SG5A 2DERA 1HK9A 2YRCA 2F2XA 2PU9B 2QA4T 4LNPA 2X35A 2JT4A 3CMAA 3M56A 3H0HA 3PMTA 2RO0A 4CC4B 3UDCA 2K5FA 2GQVA 3H0FA 3SDZA 3OW2P 2QQBA 3JB9H 1D0ZA 1QWEA 2RM4A 1YJNA 3J80E 1QP3A 3BDUA 1OEBA 2JOYA 1OZ3A 1W1FA 1JU5C 2PVDB 1HJDA 4J83A 1Y71A 5FU6B 3A8MB 2EAYA 4M7AA 4FIBA 1M90U 4X9CA 1W70A 3JCMJ 4CC3A 2EVRA 2KBTA 3HP9A 1TU0B 2HD0A 1KFZA 6AT1B 2DL5A 1E6HA 2DJQA 4EIKA 4LXCA 1ZSZA 2COYA 2DIQA 2QGGA 2DE0X 5GAOm 2DZCA 1NEBA 2DBMA 3RMQA 2BE7D 3VS6A 3CCEA 2QGFB 1D0YA 5GANj 1ZA1B 5D7UA 1YJWQ 3C12A 2KXCA 4B9WA 2QDYB 2EPDA 3CCLA 2CP3A 5KCHA 2ZPBB 3I5SA 2XK0A 3FJ5A 2OI3A 1VQ4T 4FT2A 4JJCA 5CKEA 2ED0A 2Y90A 2BE9B 1V1CA 1RADB 1YFNA 2CP2A 2IPOB 4OF1A 4E7LA 4JRPA 4E7IA 1W6XA 3C4SA 2LRQA 3JCMh 1D1AA 8AT1B 3VS3A 2MYSA 4QVDA 3QZ9B 1YN8A 2YUNA 4IUTA 3VS0A 2YLBA 1XTDA 3CCRQ 2G6FX 1S72A 1YITA 4ELZC 2OTJT 1U3OA 3EFRA 1M30A 3C0CA 3G4SQ 2ROLA 2X4WA 1VQ9A 3OSSC 2ED1A 3M0SA 3X26B 4AFZC 4RTUA 2KSSA 1Q81U 3M54A 2OX7A 3BE3A 2K5LA 1WFWA 2PVGB 3RUXA 2P0QA 5DLOA 3MHXA 1OQKA 3V7RA 4KUIA 2GCXA 2X4JA 4LN2A 2FPEA 2DKGA 2DTIA 1Q86C 5FLXE 2ABLA 1EX4A 1Y96B 2VC8A 2LCCA 4M7AE 2E65A 2CS7A 2O2OA 3VS1A 2PVOB 4F7UB 4M78B 1B3QA 4KH1B 4HT9A 2QK0A 3TU4K 1W2BP 1QP2A 2WSCE 2CP5A 2DL7A 1Q7YU 5I21A 2P0PA 3E9GA 3GP8A 1X2KA 4OMLA 1IHWA 5KYUB 4XTYA 3CC4T 1QVFP 2A0FB 4EMGA 1SPKA 4OMFB 4DA4A 5GAMe 1LCKA 1OPKA 1PD0A 2VGNA 1KSWA 4FSXA 5GAMj 2EJGA 5FW9A 4C5IA 5LJ3j 3OYHA 1VYVA 2CZ6B 2XHCA 3HTRA 2H8HA 4M75A 4IUPA 3REBB 1ZUYA 1K1ZA 2X51A 2RQUA 1U06A 2HKQB 5GAOp 1SRMA 4UC4A 2FB7A 1AZGB 4J9DA 2ZZDA 1KIKA 2EGEA 3LYIA 2RJCA 3M53A 4HCCA 4MMKA 3OS1A 2DTHA 1YP5A 3F70A 2DVJA 2VKNA 3E2UA 1PSFA 2JJ9A 2NWMA 1NPRA 3EG0A 1ZBJA 3NTHA 4JZ3A 1JQQA 4IUUA 3THKA 4DOVA 2JTMA 5GAN3 2COWA 2PTKA 1FMKA 3CD6T 3DB3A 2CSQA 2W10A 5LL6S 2GF7A 4PJOG 4HXJA 2CZ0B 2WACA 1O9SA 3FJPA 3I9QA 1AOJA 1UGPB 2W0ZA 4J7FA 1VQ5A 2JM8A 2RK2A 3EFOA 1MMNA 4F7UG 4M78G 3I56Q 2XDDA 2YXYA 1K8AC 2JUFA 2LMJA 1Q82C 3GIBA 2C0IA 1M3BA 1Z9ZA 2A28A 4KUDK 1VQ8Q 1FYNA 5C6SA 2AIRB 1ZBXA 4PLLA 3PIPA 1YHQA 3M0UA 2EBPA 3QSUA 3QBYA 4DBRA 1KQSP 5CR2A 3UA6A 3L2QA 4C0DB 2AKKA 3ME9A 2CGHA 3CCUT 2EQMA 2A7YA 1SEMA 1YI2Q 5LJ5j 1TWBA 1N8RC 4M4ZA 4C8QB 2RB6A 2EQJA 4BE0A 1NZ9A 2DF6A 2GFUA 4EMKC 1YIJA 3S3MA 3G71T 3VRZA 3RNJA 1KQ2A 4AMCA 2A36A 1VQPT 3TVTA 1AHJB 2FYKA 1OV3A 2KRSA 2NUZA 1NYFA 3REAB 3KXTA 1AWWA 3OSVA 4M75E 2RK1A 3GBQA 5HCKA 1OYXA 3QZ5B 4JJDA 3OBWA 4X9DA 1VUBA 1NBEB 3L2ZA 3LGLA 3QUIA 2QQAA 1IHVA 1C1AA 4FYVB 2QAZA 1VQ6A 4JRKA 1KD1C 1LOJA 1GXIE 2KT1A 5GAMh 1M3CA 2YRDA 3P8DA 4LD6A 4XU1A 3A8GB 4PKCC 2CYZB 4E7ZA 4LDUA 2YDLA 1BI1A 1UJ0A 1ABOA 4N4GA 2XD0A 3OA6A 5A0LA 5GAN2 2ZGWA 1UGQB 3HHTB 4XK8E 4PNOA 1W4SA 1M27C 4F7UE 1X43A 2E6NA 2JMAA 1I1JA 4J9HA 1VQOQ 1M2VA 1GBRA 3CMEQ 1FXXA 3G7ZA 4A4GA 2I0NA 3EFSA 3WVEB 2QA4A 2M02A 2FO0A 5GMKl 3EAEA 2DRKA 2R5MA 2DXUA 2VUBA 1WHJA 1YWOA 4PJNA 3M4GA 2OAWA 1R0BG 3VUZA 3A8HB 2R58A 1YNZA 2X9HA 4C8QG 1ZA2B 4HCBA 3QJYA 1X27A 4LUEA 4XAXB 1WQ7A 4OB0B 1MV3A 2A08A 5DY9A 4FYXB 2DXCA 3VJPA 4WCIA 2MCNA 3JB9D 4KULA 4AFUC 4JDSA 1J3TA 2GTOA 1B34A 5I22A 2DEUA 2DFUA 1VQKT 3TSZA 4RG8A 3OYEA 3EG1A 4E47A 4QKUA 1YJ9Q 3JCMf 2NUTA 1M8VA 2D0QB 4LDXA 4DBHA 4R0KA 1GCPA 3NFCA 5GJWB 4ZGEB 1BI0A 3CC7Q 4C5GA 2EYWA 4J6YA 2AKLA 1NM7A 5I11A 4R56A 1N5ZA 1VQ4A 4ZN3A 1PWTA 1AVZC 2KXDA 4M7AB 2AT1B 4CI0C 4PJOC 2O31A 3CCVQ 2BZ8A 1WQWA 1SSHA 3RESA 1GCQA 2CSIA 2IG0A 3SWNA 4YTLA 5FU7B 4M77D 2MWPA 4JPBW 1ZSZB 5J3BA 2C06A 4M78C 2RQTA 4PJOD 4ANJA 2QQRA 4JRQA 3HSBA 1O75A 3MCAB 2DX1A 4LUDA 3JCMV 3S3OA 3BDLA 3CPWA 1P92A 2OTJA 3PVQA 1M1KC 5KYXA 4NOYA 3OQ5A 5GMKe 4C92B 2K79A 1QVPA 2YUPA 1RAIB 3M55A 4OB3B 3KUFA 4Z89A 3CCMQ 1YJWT 2DXTA 5M9OA 2G3RA 2EW3A 4C8QE 1JJ2A 4A4EA 1VQKQ 1WA7A 3HRUA 1DJ7B 2K2VA 3J81E 2YRVA 4II1A 2VV5A 4PL6A 4GBQA 2CH4W 3A1PA 4ME7A 5FROA 2LJ1A 5C0MA 1TUGB 2ATCB 5HK0A 2RH2A 3JCMb 3OBYA 1UFFA 3CCJQ 2BKDN 2L3PA 2O4XA 1MHNA 3E19A 3CCRT 3J7AF 3H8ZA 2VWFA 4XU3A 1XNIA 4O6JA 3RR6A 4BB7A 4NL2A 1X6BA 3CC4A 3MP6A 3JCMg 3G4ST 3CCSQ 1WDXA 2HKNA 1X6OA 1WXUA 4M7AG 1I8FA 1OX9A 5KH6A 5GANf 2LX7A 5CO7A 5IHNA 3S6WA 1WNLA 1VIEA 3ZBDA 3GOXA 2QEXQ 1Y0MA 1IRXA 4C0ZA 2DL3A 5GAN6 3JB9J 2DD5A 3I35A 3PMIA 3SFMA 2KGTA 3VS7A 4C92A 4M7DC 1RLQC 1H641 3LWIA 4BY6B 1FMVA 5CCAA 4OB1B 4PFPA 4AG2C 1V76A 2E3IA 1M90C 2LNVA 4RCBA 4C0FA 5CQXA 2LDMA 1M9SA 9ATCB 2B86A 4M7DD 3CD6A 3OYMA 4J9IA 3TSWA 3G6EQ 3QO3A 3CQTA 2FPDA 3V7SA 2XIDA 2K6DA 4E2FB 4EMKA 4C0DC 1K0XA 4QVCA 4J6XA 2KY9A 3V8LA 4Y28E 3KFVA 2QDLA 4FT4A 1QCNA 3V8KA 2MWOA 4E7KA 2F69A 2COZA 1RAEB 3O8VA 1QVGA 4KT0E 4M75B 3JB9F 1RAAB 3CXCA 2EIFA 4IIMA 4Q5WA 3MJXA 1BB9A 1PRLC 1NPPA 4F14A 2VXEA 3JSCA 3JRZA 2LQNA 2RHZA 2KK4A 2J05A 3P8HA 1TUCA 3FIFA 2MAMA 4ELYC 1WYXA 4R55A 2DBKA 3ZFJA 2XKOC 5FRMA 3OYJA 4CC7A 4KBMB 5GMKh 1PC0A 4BACA 3OYNA 1IO6A 1RI9A 3RERA 2HAXA 2M0YA 1BKBA 3CCUA 2LQKA 3OW2S 1IREB 4MDXA 2DMOA 2QQ9A 4OMNA 1QLYA 1XQHA 4DOWA 2LT1A 3FC3A 1N9SA 1UDLA 1M4ZA 2EGAA 1WPYA 2BUDA 3SB2A 2DVEA 4M77F 5HY6A 2E1HA 3OW2A 1ZHIA 3EFOB 3G71A 3CPFA 4D6WA 5GANg 4N0AA 3HPWA 5GAMf 1VQPA 2QTXA 1VQLQ 2QG9B 4PJOF 1WJRA 3CCQQ 4BUGA 5LJ3f 2R57A 5AT1B 3I56T 2CP6A 4ORZA 3TEEA 2YUOA 4L59A 1VQMQ 2HSPA 1Q81C 3G1JA 5CAIA 1VYUA 3HFNA 3MEVA 1BIBA 3RKXA 1SHGA 2MIOA 4C92E 1Z9QA 4JJBA 1VQ8T 4J9EA 2QASA 3ER0A 1RAHB 1A0NB 3NHNA 2VASA 4RG2A 3ULRB 4WF2A 3UWNA 5D6XA 1FMWA 1TG0A 2SRCA 4E7SA 2D6FA 1LVKA 1N6AA 2DL8A 4M75G 2K2MA 2DK3A 2RJEA 3A98A 1YI2T 2GQIA 1GFCA 2L5QA 2KRMA 1Q7YC 1ZX6A 1JRIA 4BDYA 4Z88A 4Z8AA 4B6MA 4HVUA 4ZNXA 2O88A 3T9NA 2LJ3A 3JV3A 5FRNA 2DA9A 2DZ9A 1E6GA 4QQ6A 4X1VA 1Q95G 3FDRA 2K9GA 2KYBA 1U5SA 1TH7A 4N4IA 1ACMB 2VVKA 1WI7A 4M77A 4JLGA 4A54A 3OB9A 1BIAA 1QWFA 3X28B 2F2VA 2E4HA 3OS0A 3EH1A 3NMZC 2V8JA 5CKFA 2RA2A 1MNEA 4PJMA 2VXFA 2QXFA 3CMAQ 1KG1A 3SD4A 3JCMd 2CT3A 4GLMA 4HT8A 1M2OA 2JN0A 4JZ4A 1T0JA 3QJ6A 4Y92A 2KE9A 4JLIA 1U1SA 4M7AC 2CP0A 2X3WD 1YJNQ 3C95A 2GFAA 4XTXA 4KH0B 2CZ1B 1T3LA 1NJIU 1VIFA 1QQJA 1D09B 3R6OA 3R6NA 2L3RA 5LJ5f 5FU7C 3CBMA 3QWYA 4QVZA 1BBZA 1GL5A 2EQUA 1ZSZC 2LVMA 5GAOq 4ATOA 4F17A 2PNIA 1KHCA 3DB4A 1M2VB 5CQYA 2WSEE 2ZPHB 1VQKA 5GAMg 3EGDA 1VQOT 3VV0A 3CMET 2RHIA 2KQWA 1OZ2A 5GAOn 3RDVA 4DBFA 5LJ3g 1T3SA 4M7DF 3TQ7P 4JS5A 2FPFA 5GMKi 1UUEA 2LZ6B 2XDPA 3PTAA 2FRWA 1W2BS 4PFOA 4QQGA 3NGPA 4PLIA 2YSQA 4BDZA 2X3XD 3CCEQ 3OMGA 5D6YA 4XU2A 1W2BA 5KYWB 2J7IA 4FU6A 1WHLA 3EG3A 4E6RA 1VQ7T 1QVFS 3CCLQ 2EFIA 4C0GA 4V2SA 2VYTA 4Y91A 5ECAA 7AT1B 4A4FA 5FWCA 1QVFA 3CCSA 2HNIA 1GBQA 2PQWA 3UATA 1RI0A 2E64A 1Q86R 1B34B 4MZPA 2ENMA 5EC7A 3I55Q 2KMTA 4XQ3A 1AD5A 2YUQA 1RABB 2JVVA 2DO3A 4L5GA 2P0KA 2NUTB 2FZGB 5GAN4 2E5QA 1YJ9T 3BW1A 5FU6C 3QWXX 3QDFA 2DL4A 2DYIA 4PJLA 3OYGA 3CC2T 1YITQ 2LCSA 5EG2A 3U23A 1YJWA 5KE3A 2MMPA 3OYBA 1JB0E 3CC7T 4M77E 2OJ2A 2FRYA 2DRMA 8ATCB 3QYGB 4O5VA 4DEXA 2HSEB 1KQ1A 1VQ9Q 3RMSA 2RNAA 3HKSA 3CBPA 1JEGA 4M7DA 1Y7XA 3H0IA 3PGGA 1PSEA 2RHUA 4XTUA 3LH0A 2LQWA 2D1XA 3LGFA 3OS5A 1SHFA 3CCVT 3SWNB 3UF4A 3GF5A 4FW1A 4RTYA 1TOVA 3NTIA 1PKSA 1G3YA 1N9RA 1UTIA 3RBBB 5GANd 2H3EB 3X24B 1OI1A 1UB4A 2DLPA 2K3XA 3OMCA 1ARKA 5LJ5g 1YCSB 3CCRA 2CDTA 1K9MU 2DEQA 5KYXB 1RL2A 1NLOC 1VQ7Q 5KYWA 3QYHB 1OOTA 1ZLMA 2FHDA 5GAOl 2RHXA 2HDAA 3G4SA 1WHKA 1K73U 2P84A 2JTEA 2MOXA 1WLPB 1R0CB 4DQ2A 3CCMT 3D7SB 2BZXA 4VUBA 5J39A 4ZTFA 1KQSS 2GNCA 3DLMA 1VQNQ 1PD1A 2E3HA 4M75C 4E7JA 2O9SA 2F5KA 1H92A 1KQSA 4KGZB 1KK7A 1OPLA 2L2PA 3CC2Q 1EFNA 1MMGA 3LH5A 4LD9K 1C0MA 2HBWA 2ESWA 4PJJA 2O4XB 1TSFA 2AHJB 3CCJT 3OYAA 5D6WA 1QCOA 4HA8A 2MK5A 2A37A 3QPHA 1QCFA 2KNBB 5IXBA 1VOMA 1X69A 2LQ8A 1PG5B 2FZKB 2VB6A 3IQLA 1QKWA 2MI6A 5KYNA 1WHMA 3GLXA 3CCST 4QW2A 1I81A 5L23A 3E1SA 1AEYA 2OAUA 4AT1B 3CPWS 2K57A 4IIOA 4LE9A 2KT8A 3PT9A 2L89A 2EQKA 1NJIR 1E7OA 3HL8A 4DBQA 3ZEHA 2QEXT 3M57A 2KI7A 3VU3C 5IXFA 4XU0A 2DM1A 3M5AA 5GMKj 2HMAA 1VQ5Q 3META 3QXEB 2FVUA 2FG0A 3QKJA 4M78D 3H9NA 4J6WA 5DM7R 1MGQA 1JJ2S 1G5VA 3INZA 1G3SA 3MKDA 3JCMc 5IAYA 2RI3A 2GGRA 5GAMd 5KCOA 3OYLA 5DLQE 4ZN1A 2NUPA 2K3YA 1BI3A 5LJ3d 5L8RE 4AG1C 4J9CA 2B8AA 2V26A 4HCZA 3E9FA 2HQEA 4CRIA 1D1BA 2A3LA 1AWXA 2O01E 1LJOA 4EMKB 3G6ET 1VA7A 4J9FA 2CT4A 4HVWA 2LTOA 4J9BA 1YHQQ 2Z0WA 4BE1A 4WTOB 1IXDA 1SKUB 1PM3A 4ZTJA 4TVRA 5IH2A 2CUBA 4J8OA 1RLPC 3JCMP 1MNDA 2M0OA 2KYMA 4OMMA 2DETA 3M0PA 3I56A 2EJ9A 4FM4B 3GPLA 1I5LA 2YWWA 1YIJQ 1KC8R 1T0HA 3BFMA 2ZAEA 4A4HA 5CKDA 1BCOA 3OYIA 2EKOA 5GMKm 1VQ8A 3M58A 4OMPA 1UGSB 2DTOA 2E5KA 3PFSA 2J6OA 3SEMA 3CEYA 2V1RA 1WXTA 2JS0A 4FYYB 5AYFA 2OTLT 1FWZA 1M5Q1 2DYBA 3EGXA 1YI2A 1QKXA 4IURA 1VQ6Q 1IGUA 3HRSA 2KROA 4HKEA 2JS2A 2F2WA 4C92G 1K9AA 3OYCA 2XICA 1CKBA 3M59A 2H3JA 5GANe 1I4K1 4L6V5 5IHIA 1VQLT 4K11A 2K3BA 3L2UA 2RQRA 3CCQT 2LC4A 3KBGA 1WIEA 4EPCA 3EHQA 3JAME 3BY7A 1BCMA 2RMOA 5J26A 1VQMT 1K9MR 2ROTA 3OYDA 3TREA 1QVGS 2YHTA 3MP1A 4OMOA 5LJ5d 3CXCS 1I5OB 3I5RA 1G3TA 1K76A 1HD3A 1MUZA 1NYGA 1ZSGA 2EYXA 5IHKA 4C8QC 4BI3A 1PCXA 1UG1A 2HZYA 3M0TA 2FEIA 1BU1A 2QA4Q 1K73R 4RUGA 3I55A 3VUBA 4PK4A 2DIGA 2X4XA 5CIUA 2MF2A 5HK3A 1OULA 2LCLA 3VKIA 4RTXA 4J9GA 4OB2B 1OU8A 1Q86U 4C8QD 1XJWB 1WXBA 1H8KA 3AT1B 2KAFA 1M1FA 1HSQA 4RTVA 3PE0A 2EJFA 4IUQA 1D3BB 2EWNA 2EYZA 4M75F 2DD4A 1MV0B 4JS4A 2OTLQ 1VQOA 2JW4A 3H41A 2WSFE 3SHWA 3CMEA 5IT9E 4M77B 3JCMX 2AK5A 3RKYA 3L2WA 4F16A 4PJOB 3L42A 4XTVA 1M1KR 2KR3A 1BYMA 2YT6A 3MEAA 3A8LB 2FZCB 3DKMA 2P4RA 2QTVA 3OYKA 2JM9A 1ZUUA 2MPXC 4GLKA 3CMAT 2V8IA 1N27A 1RAGB 4JRIA 1UGVA 2LT4A 3QDRB 4ESRA 1VQ7A 2ZPIB 2KDSA 2ECZA 2M51A 1YJNT 1GCQC 3CBOA 1VQ4Q 3SWNC 1TXQA 4XTWA 1AZEA 1QW1A 1PHTA 1LNXA 2IIMA 4EDUA 4F7UF 4M78F 3FLGA 3OY9A 1YCYA 2RHYA 2XG8D 4X34A 1TS9A 3EGUA 4LDYA 3JB9G 2BZYA 2XI9A 2L3QA 3EGDB 4KGVB 4Z02A 4JUVA 2C0TA 1VQNA 3VRYA 2E41A 5CKBA 1YJ9A 3OS2A 1QMCA 5LJ3e 2BIVA 3UPUA 1RUWA 2EQIA 4FYWB 2XDBA 2PUOB 4FW2A 1WJQA 3CC2A 1WZOA 2M16A 4B9XA 2BTTA 3X25B 2OTJQ 2JXBA 1Y57A 1I07A 4KRTA 3CC7A 1G3WA 1I0CA 2RJDA 1H3ZA 1D3BA 3CCET 2M1HA 4PFZA 2RD1A 3VS2A 5I2MA 3JB9I 5KYYB 2HQHA 2O9VA 2ZCFB 4OP0A 4A53A 3CCLT 3CCVA 1K8AU 2JNGA 1GFDA 4RKUE 1Q82U 3RKWA 3WVDB 3O5ZA 1CSKA 3UT1A 1SSFA 1G8XA 3LX7A 4C5HA 2JZ2A 4PJOA 5GANh 2I2LA 2K5IA 5HKCA 1UECA 3MEWA 3EHRA 2D8JA 2EYYA 4M77G
chains in the Genus database with same CATH topology
2LQWA 2D1XA 2G6FX 2EKHA 1SHFA 2K7AA 3UF4A 4RTYA 1PKSA 1GRIA 1U3OA 2EW3A 1UTIA 3RBBB 1WA7A 1M30A 3C0CA 2ROLA 2DLPA 2ED1A 1WX6A 3M0SA 1K4US 1ARKA 4GBQA 1YCSB 2CH4W 4D8DA 2PZ1A 2CDTA 2LJ1A 4D8KA 1NLOC 4AFZC 1G83A 4RTUA 1OOTA 1ZLMA 2AZSA 3NPFA 1WFWA 2HDAA 2J06A 1UFFA 4LN2A 2JTEA 2MOXA 1WLPB 4RTZA 2FPEA 2L3PA 4RTWA 2CH4A 2ABLA 2BZXA 1UE9A 2RN8A 2VWFA 2O2OA 2GNCA 3VS1A 2LJ0A 1B3QA 1X6GA 4CC2A 1X6BA 2O9SA 1H92A 3PVLA 1WDXA 2HCKA 1WXUA 2V1QA 2LNHB 3UA7A 2DL7A 1OPLA 2L2PA 2CUDA 1EFNA 1X2KA 4OMLA 3LH5A 2LX7A 1PNJA 1PKTA 2HBWA 5IHNA 1NEGA 2ESWA 1Y0MA 1SPKA 2DL3A 1LCKA 1OPKA 1H3HA 1KSWA 3I35A 2D8HA 2A37A 2KGTA 3VS7A 5FW9A 2C0OA 3M0RA 1RLQC 1QCFA 2KNBB 1VYVA 5IXBA 4AFSC 1X69A 2H8HA 3REBB 1ZUYA 3IQLA 1K1ZA 1QKWA 2RQUA 1U06A 1SRMA 4AG2C 2L0AA 1AZGB 4J9DA 5L23A 1CKAA 1AEYA 1KIKA 2JMCA 2EGEA 4IIOA 4LE9A 1K0SA 2KT8A 2B86A 4J9IA 3TSWA 1E7OA 3CQTA 2RQVA 2FPDA 2K6DA 4HCKA 1YP5A 2DILA 4OMQA 2DVJA 2RPNA 2VKNA 1K0XA 2NWMA 3EG0A 1ZBJA 5IXFA 4JZ3A 1JQQA 1NLPC 2DM1A 3KFVA 1M3AA 2QDLA 3THKA 2PTKA 2FG0A 1FMKA 2LP5A 1UHFA 2CSQA 3M0QA 1AWOA 2W10A 1PRMC 4IIMA 2GGRA 4HXJA 4AFQC 1BB9A 1PRLC 4AG1C 4J9CA 2GBQA 4F14A 3I9QA 1AOJA 1AWXA 2W0ZA 2LQNA 2JM8A 2XMFA 1VA7A 2J05A 4J9FA 2CT4A 2CREA 4HVWA 1TUCA 2GTJA 4J9BA 1BK2A 1WYXA 2DBKA 2LMJA 4CC7A 1JO8A 2C0IA 3EG2A 1B07A 5FWBA 4DEYA 1M3BA 1IO6A 4FSSA 1RI9A 1Z9ZA 4A63B 5IH2A 2M0YA 2A28A 2CUBA 1TUDA 1FYNA 1ABQA 1RLPC 2DMOA 2KYMA 4OMMA 1QLYA 3M0PA 4OMNA 3M0UA 2EBPA 1UHCA 1UDLA 1T0HA 2SEMA 2EGAA 3UA6A 2D0NA 1VYTA 2AKKA 1SEMA 4RTTA 1KJWA 4M4ZA 2EGCA 4OMPA 4ORZA 2E5KA 2YUOA 2J6OA 3SEMA 2KEAA 2HSPA 2V1RA 2DF6A 2AZVA 1WXTA 1VYUA 2JS0A 3VRZA 3RNJA 2A36A 1SHGA 2MIOA 3TVTA 1Z9QA 3ZL7C 4JJBA 1JXOA 4J9EA 2DYBA 1OV3A 2KRSA 2NUZA 1NYFA 2KRNA 5GJVB 3REAB 1QKXA 1AWWA 1A0NB 3GBQA 3NHNA 5HCKA 1NG2A 2KROA 1YWPA 2JS2A 1SRLA 2F2WA 4JJDA 3ULRB 1K9AA 1CKBA 4HVVA 1JXMA 1TG0A 2SRCA 2DL8A 5IHIA 2K2MA 4K11A 1XOVA 3A98A 3VS4A 2K3BA 1ZUKA 2RQRA 2GQIA 1WIEA 1GFCA 3EHQA 2KRMA 2RMOA 1ZX6A 2ROTA 4Z88A 4Z8AA 4HVUA 3VS5A 4OMOA 2KT1A 2J6FA 3I5RA 4ZNXA 2O88A 2RQWA 2LJ3A 1K76A 1HD3A 1MUZA 1M3CA 1NYGA 1ZSGA 2EYXA 3JV3A 5IHKA 2DA9A 1UG1A 3M0TA 1E6GA 4X1VA 2FEIA 1UJ0A 1BU1A 2YDLA 1ABOA 2K9GA 2RF0A 2KYBA 1U5SA 4RUGA 1S1NA 2VVKA 1WI7A 2L3SA 2HEQA 4RTXA 2J6KA 4J9GA 1M27C 1QWFA 1X43A 1M8MA 2F2VA 2JMAA 1X2QA 1I1JA 4J9HA 1GBRA 3NMZC 2DNUA 1UJYA 1G2BA 2I0NA 1WXBA 1H8KA 2CT3A 2FO0A 1HSQA 4GLMA 4RTVA 3PE0A 4JZ4A 1T0JA 2DRKA 4Y92A 2KE9A 2EYZA 2X3WD 1MV0B 1YWOA 1AWJA 2OAWA 4QT7A 1T3LA 2JW4A 1YNZA 2F2XA 3H41A 3SHWA 4LNPA 2JT4A 3R6NA 2AK5A 3H0HA 3QWYA 1X27A 1BBZA 4LUEA 4CC4B 1GL5A 4F16A 4F17A 2PNIA 3H0FA 1MV3A 1QWEA 2KR3A 2A08A 2YT6A 2P4RA 2JM9A 1ZUUA 4WCIA 2MCNA 1OEBA 4AFUC 1T3SA 1UGVA 1W1FA 1JU5C 1HJDA 2FPFA 4ESRA 1J3TA 2GTOA 1UUEA 2LZ6B 5I22A 1W70A 4CC3A 2FRWA 2EVRA 2ECZA 2KBTA 3TSZA 2M51A 3EG1A 3NGPA 1GCQC 2YSQA 1KFZA 2X3XD 2DL5A 1E6HA 1AZEA 2DJQA 4EIKA 1PHTA 2IIMA 2J7IA 4R0KA 3EG3A 1GCPA 4E6RA 5GJWB 3EGUA 2BZYA 2DE0X 2L3QA 5ECAA 2C0TA 2EYWA 1NEBA 2DBMA 5FWCA 3VRYA 2AKLA 1NM7A 5I11A 1N5ZA 1GBQA 3VS6A 1PWTA 1AVZC 3UATA 2KXDA 2O31A 1RUWA 2EQIA 2ENMA 5EC7A 2KXCA 1AD5A 2BZ8A 2EPDA 2YUQA 2BTTA 1SSHA 1GCQA 2JXBA 1Y57A 2CSIA 1I07A 4KRTA 3I5SA 1I0CA 3FJ5A 2OI3A 4JPBW 3QWXX 2DL4A 4JJCA 3VS2A 2RQTA 2ED0A 2DX1A 1V1CA 2LCSA 2O9VA 3U23A 4LUDA 1W6XA 1GFDA 2OJ2A 2FRYA 2DRMA 3O5ZA 1CSKA 3PVQA 4DEXA 3VS3A 1YN8A 2RNAA 2YUNA 1JEGA 2K79A 3H0IA 2YUPA 1UECA 3EHRA 4Z89A 2D8JA 2EYYA 3VS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQW A;  2D1X A;  2G6F X;  2EKH A;  1SHF A;  2K7A A;  3UF4 A;  4RTY A;  1PKS A;  1GRI A;  1U3O A;  2EW3 A;  1UTI A;  3RBB B;  1WA7 A;  1M30 A;  3C0C A;  2ROL A;  2DLP A;  2ED1 A;  1WX6 A;  3M0S A;  1K4U S;  1ARK A;  4GBQ A;  1YCS B;  2CH4 W;  4D8D A;  2PZ1 A;  2CDT A;  2LJ1 A;  4D8K A;  1NLO C;  4AFZ C;  1G83 A;  4RTU A;  1OOT A;  1ZLM A;  2AZS A;  3NPF A;  1WFW A;  2HDA A;  2J06 A;  1UFF A;  4LN2 A;  2JTE A;  2MOX A;  1WLP B;  4RTZ A;  2FPE A;  2L3P A;  4RTW A;  2CH4 A;  2ABL A;  2BZX A;  1UE9 A;  2RN8 A;  2VWF A;  2O2O A;  2GNC A;  3VS1 A;  2LJ0 A;  1B3Q A;  1X6G A;  4CC2 A;  1X6B A;  2O9S A;  1H92 A;  3PVL A;  1WDX A;  2HCK A;  1WXU A;  2V1Q A;  2LNH B;  3UA7 A;  2DL7 A;  1OPL A;  2L2P A;  2CUD A;  1EFN A;  1X2K A;  4OML A;  3LH5 A;  2LX7 A;  1PNJ A;  1PKT A;  2HBW A;  5IHN A;  1NEG A;  2ESW A;  1Y0M A;  1SPK A;  2DL3 A;  1LCK A;  1OPK A;  1H3H A;  1KSW A;  3I35 A;  2D8H A;  2A37 A;  2KGT A;  3VS7 A;  5FW9 A;  2C0O A;  3M0R A;  1RLQ C;  1QCF A;  2KNB B;  1VYV A;  5IXB A;  4AFS C;  1X69 A;  2H8H A;  3REB B;  1ZUY A;  3IQL A;  1K1Z A;  1QKW A;  2RQU A;  1U06 A;  1SRM A;  4AG2 C;  2L0A A;  1AZG B;  4J9D A;  5L23 A;  1CKA A;  1AEY A;  1KIK A;  2JMC A;  2EGE A;  4IIO A;  4LE9 A;  1K0S A;  2KT8 A;  2B86 A;  4J9I A;  3TSW A;  1E7O A;  3CQT A;  2RQV A;  2FPD A;  2K6D A;  4HCK A;  1YP5 A;  2DIL A;  4OMQ A;  2DVJ A;  2RPN A;  2VKN A;  1K0X A;  2NWM A;  3EG0 A;  1ZBJ A;  5IXF A;  4JZ3 A;  1JQQ A;  1NLP C;  2DM1 A;  3KFV A;  1M3A A;  2QDL A;  3THK A;  2PTK A;  2FG0 A;  1FMK A;  2LP5 A;  1UHF A;  2CSQ A;  3M0Q A;  1AWO A;  2W10 A;  1PRM C;  4IIM A;  2GGR A;  4HXJ A;  4AFQ C;  1BB9 A;  1PRL C;  4AG1 C;  4J9C A;  2GBQ A;  4F14 A;  3I9Q A;  1AOJ A;  1AWX A;  2W0Z A;  2LQN A;  2JM8 A;  2XMF A;  1VA7 A;  2J05 A;  4J9F A;  2CT4 A;  2CRE A;  4HVW A;  1TUC A;  2GTJ A;  4J9B A;  1BK2 A;  1WYX A;  2DBK A;  2LMJ A;  4CC7 A;  1JO8 A;  2C0I A;  3EG2 A;  1B07 A;  5FWB A;  4DEY A;  1M3B A;  1IO6 A;  4FSS A;  1RI9 A;  1Z9Z A;  4A63 B;  5IH2 A;  2M0Y A;  2A28 A;  2CUB A;  1TUD A;  1FYN A;  1ABQ A;  1RLP C;  2DMO A;  2KYM A;  4OMM A;  1QLY A;  3M0P A;  4OMN A;  3M0U A;  2EBP A;  1UHC A;  1UDL A;  1T0H A;  2SEM A;  2EGA A;  3UA6 A;  2D0N A;  1VYT A;  2AKK A;  1SEM A;  4RTT A;  1KJW A;  4M4Z A;  2EGC A;  4OMP A;  4ORZ A;  2E5K A;  2YUO A;  2J6O A;  3SEM A;  2KEA A;  2HSP A;  2V1R A;  2DF6 A;  2AZV A;  1WXT A;  1VYU A;  2JS0 A;  3VRZ A;  3RNJ A;  2A36 A;  1SHG A;  2MIO A;  3TVT A;  1Z9Q A;  3ZL7 C;  4JJB A;  1JXO A;  4J9E A;  2DYB A;  1OV3 A;  2KRS A;  2NUZ A;  1NYF A;  2KRN A;  5GJV B;  3REA B;  1QKX A;  1AWW A;  1A0N B;  3GBQ A;  3NHN A;  5HCK A;  1NG2 A;  2KRO A;  1YWP A;  2JS2 A;  1SRL A;  2F2W A;  4JJD A;  3ULR B;  1K9A A;  1CKB A;  4HVV A;  1JXM A;  1TG0 A;  2SRC A;  2DL8 A;  5IHI A;  2K2M A;  4K11 A;  1XOV A;  3A98 A;  3VS4 A;  2K3B A;  1ZUK A;  2RQR A;  2GQI A;  1WIE A;  1GFC A;  3EHQ A;  2KRM A;  2RMO A;  1ZX6 A;  2ROT A;  4Z88 A;  4Z8A A;  4HVU A;  3VS5 A;  4OMO A;  2KT1 A;  2J6F A;  3I5R A;  4ZNX A;  2O88 A;  2RQW A;  2LJ3 A;  1K76 A;  1HD3 A;  1MUZ A;  1M3C A;  1NYG A;  1ZSG A;  2EYX A;  3JV3 A;  5IHK A;  2DA9 A;  1UG1 A;  3M0T A;  1E6G A;  4X1V A;  2FEI A;  1UJ0 A;  1BU1 A;  2YDL A;  1ABO A;  2K9G A;  2RF0 A;  2KYB A;  1U5S A;  4RUG A;  1S1N A;  2VVK A;  1WI7 A;  2L3S A;  2HEQ A;  4RTX A;  2J6K A;  4J9G A;  1M27 C;  1QWF A;  1X43 A;  1M8M A;  2F2V A;  2JMA A;  1X2Q A;  1I1J A;  4J9H A;  1GBR A;  3NMZ C;  2DNU A;  1UJY A;  1G2B A;  2I0N A;  1WXB A;  1H8K A;  2CT3 A;  2FO0 A;  1HSQ A;  4GLM A;  4RTV A;  3PE0 A;  4JZ4 A;  1T0J A;  2DRK A;  4Y92 A;  2KE9 A;  2EYZ A;  2X3W D;  1MV0 B;  1YWO A;  1AWJ A;  2OAW A;  4QT7 A;  1T3L A;  2JW4 A;  1YNZ A;  2F2X A;  3H41 A;  3SHW A;  4LNP A;  2JT4 A;  3R6N A;  2AK5 A;  3H0H A;  3QWY A;  1X27 A;  1BBZ A;  4LUE A;  4CC4 B;  1GL5 A;  4F16 A;  4F17 A;  2PNI A;  3H0F A;  1MV3 A;  1QWE A;  2KR3 A;  2A08 A;  2YT6 A;  2P4R A;  2JM9 A;  1ZUU A;  4WCI A;  2MCN A;  1OEB A;  4AFU C;  1T3S A;  1UGV A;  1W1F A;  1JU5 C;  1HJD A;  2FPF A;  4ESR A;  1J3T A;  2GTO A;  1UUE A;  2LZ6 B;  5I22 A;  1W70 A;  4CC3 A;  2FRW A;  2EVR A;  2ECZ A;  2KBT A;  3TSZ A;  2M51 A;  3EG1 A;  3NGP A;  1GCQ C;  2YSQ A;  1KFZ A;  2X3X D;  2DL5 A;  1E6H A;  1AZE A;  2DJQ A;  4EIK A;  1PHT A;  2IIM A;  2J7I A;  4R0K A;  3EG3 A;  1GCP A;  4E6R A;  5GJW B;  3EGU A;  2BZY A;  2DE0 X;  2L3Q A;  5ECA A;  2C0T A;  2EYW A;  1NEB A;  2DBM A;  5FWC A;  3VRY A;  2AKL A;  1NM7 A;  5I11 A;  1N5Z A;  1GBQ A;  3VS6 A;  1PWT A;  1AVZ C;  3UAT A;  2KXD A;  2O31 A;  1RUW A;  2EQI A;  2ENM A;  5EC7 A;  2KXC A;  1AD5 A;  2BZ8 A;  2EPD A;  2YUQ A;  2BTT A;  1SSH A;  1GCQ A;  2JXB A;  1Y57 A;  2CSI A;  1I07 A;  4KRT A;  3I5S A;  1I0C A;  3FJ5 A;  2OI3 A;  4JPB W;  3QWX X;  2DL4 A;  4JJC A;  3VS2 A;  2RQT A;  2ED0 A;  2DX1 A;  1V1C A;  2LCS A;  2O9V A;  3U23 A;  4LUD A;  1W6X A;  1GFD A;  2OJ2 A;  2FRY A;  2DRM A;  3O5Z A;  1CSK A;  3PVQ A;  4DEX A;  3VS3 A;  1YN8 A;  2RNA A;  2YUN A;  1JEG A;  2K79 A;  3H0I A;  2YUP A;  1UEC A;  3EHR A;  4Z89 A;  2D8J A;  2EYY A;  3VS0 A; 
#chains in the Genus database with same CATH topology
 3I55 T;  2EKH A;  2K7A A;  3PIO A;  1GRI A;  1Y96 A;  5A2Q E;  4EMH A;  1C6V X;  2K4Y A;  1M90 R;  1D1C A;  4F7U A;  4M78 A;  1N8R U;  1B7T A;  1S72 T;  1WX6 A;  3C94 A;  1K4U S;  4RMO A;  4BE2 A;  1YIT T;  4D8D A;  3CCM A;  2HQX A;  2PZ1 A;  4D8K A;  1G83 A;  1U8R A;  2P4T A;  3H6Z A;  4FL6 A;  3CC4 Q;  4M7D B;  2AZS A;  4M7A D;  3NPF A;  4BI4 A;  1VQ9 T;  1V29 B;  5KYU A;  2J06 A;  4E7H A;  3GNF B;  5CK9 A;  4RTZ A;  2RI5 A;  4RTW A;  2CH4 A;  4NS5 A;  2HBP A;  4OGC A;  4C92 C;  1IGQ A;  1UE9 A;  1RAC B;  2RN8 A;  4BD3 A;  2LJ0 A;  3MO8 A;  1X6G A;  4CC2 A;  3N5B B;  2CKK A;  1R77 A;  5CKH A;  3V8J A;  3M9Q A;  5A0G A;  3PVL A;  2HCK A;  2YLC A;  2QI2 A;  5LJ5 e;  2V1Q A;  2LNH B;  3CCJ A;  1AT1 B;  3UA7 A;  2CP7 A;  2CUD A;  1BI2 A;  4QQD A;  1NJI C;  4C92 D;  3PNW C;  1PNJ A;  1PKT A;  4J7I A;  3FEO A;  1KD1 U;  4RCC A;  2PUK B;  5KYY A;  1NEG A;  3A8O B;  3MEU A;  3P8B B;  3QHS A;  5A0D A;  1H3H A;  3QII A;  1IZ6 A;  4LDW A;  5GAN 5;  1NE8 A;  1HYO A;  4BI8 B;  4C8Q F;  3M4Y A;  2D8H A;  2D9T A;  1UEB A;  3QG1 A;  3CD6 Q;  2C0O A;  3M0R A;  2E70 A;  3Q1J A;  2DXB A;  4AFS C;  1KC8 U;  2FL7 A;  1VQN T;  2F1L A;  2L0A A;  5GAN 8;  2QEX A;  2JTF A;  1CKA A;  2LX9 A;  2JMC A;  1K0S A;  1S72 Q;  3MP8 A;  3CPW P;  3L1A A;  2RQV A;  4HCK A;  2DIL A;  4OMQ A;  2RPN A;  1R8O B;  1WHH A;  2VGM A;  3LW5 E;  1Q81 R;  2DAQ A;  4PJO E;  1NLP C;  1M3A A;  4ZGD B;  3A5Z B;  5LJ3 h;  4IKF A;  2LP5 A;  1UHF A;  3M0Q A;  1AWO A;  1PRM C;  2R5A A;  3G6E A;  1JJ2 P;  1Y07 A;  4M7D G;  2KVQ G;  4AFQ C;  4NL3 A;  4XTZ A;  1KC8 C;  2E6Z A;  4M78 E;  2GBQ A;  4BY6 C;  4FCY A;  1WHG A;  3CCU Q;  5IN1 A;  2XMF A;  1X01 A;  4N0A C;  2CRE A;  4ZGJ B;  1Q7Y R;  2XU8 A;  3JCM Q;  2CZ7 B;  2GTJ A;  1BK2 A;  1U1T A;  3JCM W;  4C8Q A;  3OYF A;  1JO8 A;  3EG2 A;  5FWB A;  1B07 A;  3LLR A;  5CVI A;  3V7C A;  3X20 B;  4DEY A;  5GAN 7;  3G71 Q;  1VQ5 T;  4FSS A;  1VQP Q;  1TTH B;  1UGR B;  4N4H A;  4A63 B;  3S3N A;  1JBM A;  1TUD A;  1X75 C;  1ABQ A;  3EG9 B;  2NUP B;  2ZPF B;  2DPP B;  3EH2 A;  2E12 A;  4GY5 A;  4OVA A;  3L2V A;  3OYY A;  4LDV A;  1UHC A;  2SEM A;  2D0N A;  1VYT A;  1MMA A;  3GNG A;  3RIR A;  2RI2 A;  1HXD A;  4MZM A;  2OTL A;  4C5E A;  2HL5 C;  1D0X A;  4JJN K;  4RTT A;  1KJW A;  1YBY A;  2EGC A;  1YHQ T;  3FRN A;  1EIF A;  1K9M C;  3URG A;  2KEA A;  4M75 D;  1K8A R;  1WJS A;  2AZV A;  1Q82 R;  5KE2 A;  2QYZ A;  2Y4X A;  2L8D A;  2QQS A;  2RJF A;  3MPU B;  3ZL7 C;  1VQL A;  1K73 C;  3DLL A;  1JXO A;  4F04 B;  5GJV B;  2KRN A;  3CCQ A;  1M1K U;  2HL3 A;  4MZT A;  1NG2 A;  1YIJ T;  1YWP A;  1SRL A;  3JCM e;  4J5Y A;  1VQM A;  4MML A;  1MMD A;  4M77 C;  1F1B B;  4HVV A;  2DJZ A;  1JXM A;  4IUV A;  1EZZ B;  1RAF B;  5LJ5 h;  1XOV A;  3VS4 A;  1ZUK A;  1N8R R;  3AHU A;  2X4Y A;  4OGE A;  1M1G A;  1FX7 A;  3HRT A;  3VS5 A;  4M7A F;  2J6F A;  3HFO A;  3L2R A;  2RQW A;  1QVG P;  4M7D E;  3CXC P;  3EGX B;  3TCJ A;  1KHI A;  2RF0 A;  4MDW A;  2Y4Y A;  3WXM B;  3NTK A;  1S1N A;  2IVW A;  1VQ6 T;  1OX8 A;  2ZPE B;  2L3S A;  2HEQ A;  2V8K A;  3LWH A;  3EG9 A;  2J6K A;  4KGX B;  1M8M A;  4A4K A;  1X2Q A;  5GAO r;  1WGS A;  2NYS A;  2F5T X;  2M9U A;  2EYQ A;  2DNU A;  1UJY A;  1G2B A;  2E10 A;  1SF9 A;  1LPL A;  4C92 F;  1IB8 A;  5I2S A;  4P5N A;  2NLU A;  1OU9 A;  3VYH B;  1KD1 R;  2ZPG B;  3FB9 A;  1ZQ1 A;  3VYG A;  3ASK A;  1AWJ A;  4QT7 A;  1SG5 A;  2DER A;  1HK9 A;  2YRC A;  2F2X A;  2PU9 B;  2QA4 T;  4LNP A;  2X35 A;  2JT4 A;  3CMA A;  3M56 A;  3H0H A;  3PMT A;  2RO0 A;  4CC4 B;  3UDC A;  2K5F A;  2GQV A;  3H0F A;  3SDZ A;  3OW2 P;  2QQB A;  3JB9 H;  1D0Z A;  1QWE A;  2RM4 A;  1YJN A;  3J80 E;  1QP3 A;  3BDU A;  1OEB A;  2JOY A;  1OZ3 A;  1W1F A;  1JU5 C;  2PVD B;  1HJD A;  4J83 A;  1Y71 A;  5FU6 B;  3A8M B;  2EAY A;  4M7A A;  4FIB A;  1M90 U;  4X9C A;  1W70 A;  3JCM J;  4CC3 A;  2EVR A;  2KBT A;  3HP9 A;  1TU0 B;  2HD0 A;  1KFZ A;  6AT1 B;  2DL5 A;  1E6H A;  2DJQ A;  4EIK A;  4LXC A;  1ZSZ A;  2COY A;  2DIQ A;  2QGG A;  2DE0 X;  5GAO m;  2DZC A;  1NEB A;  2DBM A;  3RMQ A;  2BE7 D;  3VS6 A;  3CCE A;  2QGF B;  1D0Y A;  5GAN j;  1ZA1 B;  5D7U A;  1YJW Q;  3C12 A;  2KXC A;  4B9W A;  2QDY B;  2EPD A;  3CCL A;  2CP3 A;  5KCH A;  2ZPB B;  3I5S A;  2XK0 A;  3FJ5 A;  2OI3 A;  1VQ4 T;  4FT2 A;  4JJC A;  5CKE A;  2ED0 A;  2Y90 A;  2BE9 B;  1V1C A;  1RAD B;  1YFN A;  2CP2 A;  2IPO B;  4OF1 A;  4E7L A;  4JRP A;  4E7I A;  1W6X A;  3C4S A;  2LRQ A;  3JCM h;  1D1A A;  8AT1 B;  3VS3 A;  2MYS A;  4QVD A;  3QZ9 B;  1YN8 A;  2YUN A;  4IUT A;  3VS0 A;  2YLB A;  1XTD A;  3CCR Q;  2G6F X;  1S72 A;  1YIT A;  4ELZ C;  2OTJ T;  1U3O A;  3EFR A;  1M30 A;  3C0C A;  3G4S Q;  2ROL A;  2X4W A;  1VQ9 A;  3OSS C;  2ED1 A;  3M0S A;  3X26 B;  4AFZ C;  4RTU A;  2KSS A;  1Q81 U;  3M54 A;  2OX7 A;  3BE3 A;  2K5L A;  1WFW A;  2PVG B;  3RUX A;  2P0Q A;  5DLO A;  3MHX A;  1OQK A;  3V7R A;  4KUI A;  2GCX A;  2X4J A;  4LN2 A;  2FPE A;  2DKG A;  2DTI A;  1Q86 C;  5FLX E;  2ABL A;  1EX4 A;  1Y96 B;  2VC8 A;  2LCC A;  4M7A E;  2E65 A;  2CS7 A;  2O2O A;  3VS1 A;  2PVO B;  4F7U B;  4M78 B;  1B3Q A;  4KH1 B;  4HT9 A;  2QK0 A;  3TU4 K;  1W2B P;  1QP2 A;  2WSC E;  2CP5 A;  2DL7 A;  1Q7Y U;  5I21 A;  2P0P A;  3E9G A;  3GP8 A;  1X2K A;  4OML A;  1IHW A;  5KYU B;  4XTY A;  3CC4 T;  1QVF P;  2A0F B;  4EMG A;  1SPK A;  4OMF B;  4DA4 A;  5GAM e;  1LCK A;  1OPK A;  1PD0 A;  2VGN A;  1KSW A;  4FSX A;  5GAM j;  2EJG A;  5FW9 A;  4C5I A;  5LJ3 j;  3OYH A;  1VYV A;  2CZ6 B;  2XHC A;  3HTR A;  2H8H A;  4M75 A;  4IUP A;  3REB B;  1ZUY A;  1K1Z A;  2X51 A;  2RQU A;  1U06 A;  2HKQ B;  5GAO p;  1SRM A;  4UC4 A;  2FB7 A;  1AZG B;  4J9D A;  2ZZD A;  1KIK A;  2EGE A;  3LYI A;  2RJC A;  3M53 A;  4HCC A;  4MMK A;  3OS1 A;  2DTH A;  1YP5 A;  3F70 A;  2DVJ A;  2VKN A;  3E2U A;  1PSF A;  2JJ9 A;  2NWM A;  1NPR A;  3EG0 A;  1ZBJ A;  3NTH A;  4JZ3 A;  1JQQ A;  4IUU A;  3THK A;  4DOV A;  2JTM A;  5GAN 3;  2COW A;  2PTK A;  1FMK A;  3CD6 T;  3DB3 A;  2CSQ A;  2W10 A;  5LL6 S;  2GF7 A;  4PJO G;  4HXJ A;  2CZ0 B;  2WAC A;  1O9S A;  3FJP A;  3I9Q A;  1AOJ A;  1UGP B;  2W0Z A;  4J7F A;  1VQ5 A;  2JM8 A;  2RK2 A;  3EFO A;  1MMN A;  4F7U G;  4M78 G;  3I56 Q;  2XDD A;  2YXY A;  1K8A C;  2JUF A;  2LMJ A;  1Q82 C;  3GIB A;  2C0I A;  1M3B A;  1Z9Z A;  2A28 A;  4KUD K;  1VQ8 Q;  1FYN A;  5C6S A;  2AIR B;  1ZBX A;  4PLL A;  3PIP A;  1YHQ A;  3M0U A;  2EBP A;  3QSU A;  3QBY A;  4DBR A;  1KQS P;  5CR2 A;  3UA6 A;  3L2Q A;  4C0D B;  2AKK A;  3ME9 A;  2CGH A;  3CCU T;  2EQM A;  2A7Y A;  1SEM A;  1YI2 Q;  5LJ5 j;  1TWB A;  1N8R C;  4M4Z A;  4C8Q B;  2RB6 A;  2EQJ A;  4BE0 A;  1NZ9 A;  2DF6 A;  2GFU A;  4EMK C;  1YIJ A;  3S3M A;  3G71 T;  3VRZ A;  3RNJ A;  1KQ2 A;  4AMC A;  2A36 A;  1VQP T;  3TVT A;  1AHJ B;  2FYK A;  1OV3 A;  2KRS A;  2NUZ A;  1NYF A;  3REA B;  3KXT A;  1AWW A;  3OSV A;  4M75 E;  2RK1 A;  3GBQ A;  5HCK A;  1OYX A;  3QZ5 B;  4JJD A;  3OBW A;  4X9D A;  1VUB A;  1NBE B;  3L2Z A;  3LGL A;  3QUI A;  2QQA A;  1IHV A;  1C1A A;  4FYV B;  2QAZ A;  1VQ6 A;  4JRK A;  1KD1 C;  1LOJ A;  1GXI E;  2KT1 A;  5GAM h;  1M3C A;  2YRD A;  3P8D A;  4LD6 A;  4XU1 A;  3A8G B;  4PKC C;  2CYZ B;  4E7Z A;  4LDU A;  2YDL A;  1BI1 A;  1UJ0 A;  1ABO A;  4N4G A;  2XD0 A;  3OA6 A;  5A0L A;  5GAN 2;  2ZGW A;  1UGQ B;  3HHT B;  4XK8 E;  4PNO A;  1W4S A;  1M27 C;  4F7U E;  1X43 A;  2E6N A;  2JMA A;  1I1J A;  4J9H A;  1VQO Q;  1M2V A;  1GBR A;  3CME Q;  1FXX A;  3G7Z A;  4A4G A;  2I0N A;  3EFS A;  3WVE B;  2QA4 A;  2M02 A;  2FO0 A;  5GMK l;  3EAE A;  2DRK A;  2R5M A;  2DXU A;  2VUB A;  1WHJ A;  1YWO A;  4PJN A;  3M4G A;  2OAW A;  1R0B G;  3VUZ A;  3A8H B;  2R58 A;  1YNZ A;  2X9H A;  4C8Q G;  1ZA2 B;  4HCB A;  3QJY A;  1X27 A;  4LUE A;  4XAX B;  1WQ7 A;  4OB0 B;  1MV3 A;  2A08 A;  5DY9 A;  4FYX B;  2DXC A;  3VJP A;  4WCI A;  2MCN A;  3JB9 D;  4KUL A;  4AFU C;  4JDS A;  1J3T A;  2GTO A;  1B34 A;  5I22 A;  2DEU A;  2DFU A;  1VQK T;  3TSZ A;  4RG8 A;  3OYE A;  3EG1 A;  4E47 A;  4QKU A;  1YJ9 Q;  3JCM f;  2NUT A;  1M8V A;  2D0Q B;  4LDX A;  4DBH A;  4R0K A;  1GCP A;  3NFC A;  5GJW B;  4ZGE B;  1BI0 A;  3CC7 Q;  4C5G A;  2EYW A;  4J6Y A;  2AKL A;  1NM7 A;  5I11 A;  4R56 A;  1N5Z A;  1VQ4 A;  4ZN3 A;  1PWT A;  1AVZ C;  2KXD A;  4M7A B;  2AT1 B;  4CI0 C;  4PJO C;  2O31 A;  3CCV Q;  2BZ8 A;  1WQW A;  1SSH A;  3RES A;  1GCQ A;  2CSI A;  2IG0 A;  3SWN A;  4YTL A;  5FU7 B;  4M77 D;  2MWP A;  4JPB W;  1ZSZ B;  5J3B A;  2C06 A;  4M78 C;  2RQT A;  4PJO D;  4ANJ A;  2QQR A;  4JRQ A;  3HSB A;  1O75 A;  3MCA B;  2DX1 A;  4LUD A;  3JCM V;  3S3O A;  3BDL A;  3CPW A;  1P92 A;  2OTJ A;  3PVQ A;  1M1K C;  5KYX A;  4NOY A;  3OQ5 A;  5GMK e;  4C92 B;  2K79 A;  1QVP A;  2YUP A;  1RAI B;  3M55 A;  4OB3 B;  3KUF A;  4Z89 A;  3CCM Q;  1YJW T;  2DXT A;  5M9O A;  2G3R A;  2EW3 A;  4C8Q E;  1JJ2 A;  4A4E A;  1VQK Q;  1WA7 A;  3HRU A;  1DJ7 B;  2K2V A;  3J81 E;  2YRV A;  4II1 A;  2VV5 A;  4PL6 A;  4GBQ A;  2CH4 W;  3A1P A;  4ME7 A;  5FRO A;  2LJ1 A;  5C0M A;  1TUG B;  2ATC B;  5HK0 A;  2RH2 A;  3JCM b;  3OBY A;  1UFF A;  3CCJ Q;  2BKD N;  2L3P A;  2O4X A;  1MHN A;  3E19 A;  3CCR T;  3J7A F;  3H8Z A;  2VWF A;  4XU3 A;  1XNI A;  4O6J A;  3RR6 A;  4BB7 A;  4NL2 A;  1X6B A;  3CC4 A;  3MP6 A;  3JCM g;  3G4S T;  3CCS Q;  1WDX A;  2HKN A;  1X6O A;  1WXU A;  4M7A G;  1I8F A;  1OX9 A;  5KH6 A;  5GAN f;  2LX7 A;  5CO7 A;  5IHN A;  3S6W A;  1WNL A;  1VIE A;  3ZBD A;  3GOX A;  2QEX Q;  1Y0M A;  1IRX A;  4C0Z A;  2DL3 A;  5GAN 6;  3JB9 J;  2DD5 A;  3I35 A;  3PMI A;  3SFM A;  2KGT A;  3VS7 A;  4C92 A;  4M7D C;  1RLQ C;  1H64 1;  3LWI A;  4BY6 B;  1FMV A;  5CCA A;  4OB1 B;  4PFP A;  4AG2 C;  1V76 A;  2E3I A;  1M90 C;  2LNV A;  4RCB A;  4C0F A;  5CQX A;  2LDM A;  1M9S A;  9ATC B;  2B86 A;  4M7D D;  3CD6 A;  3OYM A;  4J9I A;  3TSW A;  3G6E Q;  3QO3 A;  3CQT A;  2FPD A;  3V7S A;  2XID A;  2K6D A;  4E2F B;  4EMK A;  4C0D C;  1K0X A;  4QVC A;  4J6X A;  2KY9 A;  3V8L A;  4Y28 E;  3KFV A;  2QDL A;  4FT4 A;  1QCN A;  3V8K A;  2MWO A;  4E7K A;  2F69 A;  2COZ A;  1RAE B;  3O8V A;  1QVG A;  4KT0 E;  4M75 B;  3JB9 F;  1RAA B;  3CXC A;  2EIF A;  4IIM A;  4Q5W A;  3MJX A;  1BB9 A;  1PRL C;  1NPP A;  4F14 A;  2VXE A;  3JSC A;  3JRZ A;  2LQN A;  2RHZ A;  2KK4 A;  2J05 A;  3P8H A;  1TUC A;  3FIF A;  2MAM A;  4ELY C;  1WYX A;  4R55 A;  2DBK A;  3ZFJ A;  2XKO C;  5FRM A;  3OYJ A;  4CC7 A;  4KBM B;  5GMK h;  1PC0 A;  4BAC A;  3OYN A;  1IO6 A;  1RI9 A;  3RER A;  2HAX A;  2M0Y A;  1BKB A;  3CCU A;  2LQK A;  3OW2 S;  1IRE B;  4MDX A;  2DMO A;  2QQ9 A;  4OMN A;  1QLY A;  1XQH A;  4DOW A;  2LT1 A;  3FC3 A;  1N9S A;  1UDL A;  1M4Z A;  2EGA A;  1WPY A;  2BUD A;  3SB2 A;  2DVE A;  4M77 F;  5HY6 A;  2E1H A;  3OW2 A;  1ZHI A;  3EFO B;  3G71 A;  3CPF A;  4D6W A;  5GAN g;  4N0A A;  3HPW A;  5GAM f;  1VQP A;  2QTX A;  1VQL Q;  2QG9 B;  4PJO F;  1WJR A;  3CCQ Q;  4BUG A;  5LJ3 f;  2R57 A;  5AT1 B;  3I56 T;  2CP6 A;  4ORZ A;  3TEE A;  2YUO A;  4L59 A;  1VQM Q;  2HSP A;  1Q81 C;  3G1J A;  5CAI A;  1VYU A;  3HFN A;  3MEV A;  1BIB A;  3RKX A;  1SHG A;  2MIO A;  4C92 E;  1Z9Q A;  4JJB A;  1VQ8 T;  4J9E A;  2QAS A;  3ER0 A;  1RAH B;  1A0N B;  3NHN A;  2VAS A;  4RG2 A;  3ULR B;  4WF2 A;  3UWN A;  5D6X A;  1FMW A;  1TG0 A;  2SRC A;  4E7S A;  2D6F A;  1LVK A;  1N6A A;  2DL8 A;  4M75 G;  2K2M A;  2DK3 A;  2RJE A;  3A98 A;  1YI2 T;  2GQI A;  1GFC A;  2L5Q A;  2KRM A;  1Q7Y C;  1ZX6 A;  1JRI A;  4BDY A;  4Z88 A;  4Z8A A;  4B6M A;  4HVU A;  4ZNX A;  2O88 A;  3T9N A;  2LJ3 A;  3JV3 A;  5FRN A;  2DA9 A;  2DZ9 A;  1E6G A;  4QQ6 A;  4X1V A;  1Q95 G;  3FDR A;  2K9G A;  2KYB A;  1U5S A;  1TH7 A;  4N4I A;  1ACM B;  2VVK A;  1WI7 A;  4M77 A;  4JLG A;  4A54 A;  3OB9 A;  1BIA A;  1QWF A;  3X28 B;  2F2V A;  2E4H A;  3OS0 A;  3EH1 A;  3NMZ C;  2V8J A;  5CKF A;  2RA2 A;  1MNE A;  4PJM A;  2VXF A;  2QXF A;  3CMA Q;  1KG1 A;  3SD4 A;  3JCM d;  2CT3 A;  4GLM A;  4HT8 A;  1M2O A;  2JN0 A;  4JZ4 A;  1T0J A;  3QJ6 A;  4Y92 A;  2KE9 A;  4JLI A;  1U1S A;  4M7A C;  2CP0 A;  2X3W D;  1YJN Q;  3C95 A;  2GFA A;  4XTX A;  4KH0 B;  2CZ1 B;  1T3L A;  1NJI U;  1VIF A;  1QQJ A;  1D09 B;  3R6O A;  3R6N A;  2L3R A;  5LJ5 f;  5FU7 C;  3CBM A;  3QWY A;  4QVZ A;  1BBZ A;  1GL5 A;  2EQU A;  1ZSZ C;  2LVM A;  5GAO q;  4ATO A;  4F17 A;  2PNI A;  1KHC A;  3DB4 A;  1M2V B;  5CQY A;  2WSE E;  2ZPH B;  1VQK A;  5GAM g;  3EGD A;  1VQO T;  3VV0 A;  3CME T;  2RHI A;  2KQW A;  1OZ2 A;  5GAO n;  3RDV A;  4DBF A;  5LJ3 g;  1T3S A;  4M7D F;  3TQ7 P;  4JS5 A;  2FPF A;  5GMK i;  1UUE A;  2LZ6 B;  2XDP A;  3PTA A;  2FRW A;  1W2B S;  4PFO A;  4QQG A;  3NGP A;  4PLI A;  2YSQ A;  4BDZ A;  2X3X D;  3CCE Q;  3OMG A;  5D6Y A;  4XU2 A;  1W2B A;  5KYW B;  2J7I A;  4FU6 A;  1WHL A;  3EG3 A;  4E6R A;  1VQ7 T;  1QVF S;  3CCL Q;  2EFI A;  4C0G A;  4V2S A;  2VYT A;  4Y91 A;  5ECA A;  7AT1 B;  4A4F A;  5FWC A;  1QVF A;  3CCS A;  2HNI A;  1GBQ A;  2PQW A;  3UAT A;  1RI0 A;  2E64 A;  1Q86 R;  1B34 B;  4MZP A;  2ENM A;  5EC7 A;  3I55 Q;  2KMT A;  4XQ3 A;  1AD5 A;  2YUQ A;  1RAB B;  2JVV A;  2DO3 A;  4L5G A;  2P0K A;  2NUT B;  2FZG B;  5GAN 4;  2E5Q A;  1YJ9 T;  3BW1 A;  5FU6 C;  3QWX X;  3QDF A;  2DL4 A;  2DYI A;  4PJL A;  3OYG A;  3CC2 T;  1YIT Q;  2LCS A;  5EG2 A;  3U23 A;  1YJW A;  5KE3 A;  2MMP A;  3OYB A;  1JB0 E;  3CC7 T;  4M77 E;  2OJ2 A;  2FRY A;  2DRM A;  8ATC B;  3QYG B;  4O5V A;  4DEX A;  2HSE B;  1KQ1 A;  1VQ9 Q;  3RMS A;  2RNA A;  3HKS A;  3CBP A;  1JEG A;  4M7D A;  1Y7X A;  3H0I A;  3PGG A;  1PSE A;  2RHU A;  4XTU A;  3LH0 A;  2LQW A;  2D1X A;  3LGF A;  3OS5 A;  1SHF A;  3CCV T;  3SWN B;  3UF4 A;  3GF5 A;  4FW1 A;  4RTY A;  1TOV A;  3NTI A;  1PKS A;  1G3Y A;  1N9R A;  1UTI A;  3RBB B;  5GAN d;  2H3E B;  3X24 B;  1OI1 A;  1UB4 A;  2DLP A;  2K3X A;  3OMC A;  1ARK A;  5LJ5 g;  1YCS B;  3CCR A;  2CDT A;  1K9M U;  2DEQ A;  5KYX B;  1RL2 A;  1NLO C;  1VQ7 Q;  5KYW A;  3QYH B;  1OOT A;  1ZLM A;  2FHD A;  5GAO l;  2RHX A;  2HDA A;  3G4S A;  1WHK A;  1K73 U;  2P84 A;  2JTE A;  2MOX A;  1WLP B;  1R0C B;  4DQ2 A;  3CCM T;  3D7S B;  2BZX A;  4VUB A;  5J39 A;  4ZTF A;  1KQS S;  2GNC A;  3DLM A;  1VQN Q;  1PD1 A;  2E3H A;  4M75 C;  4E7J A;  2O9S A;  2F5K A;  1H92 A;  1KQS A;  4KGZ B;  1KK7 A;  1OPL A;  2L2P A;  3CC2 Q;  1EFN A;  1MMG A;  3LH5 A;  4LD9 K;  1C0M A;  2HBW A;  2ESW A;  4PJJ A;  2O4X B;  1TSF A;  2AHJ B;  3CCJ T;  3OYA A;  5D6W A;  1QCO A;  4HA8 A;  2MK5 A;  2A37 A;  3QPH A;  1QCF A;  2KNB B;  5IXB A;  1VOM A;  1X69 A;  2LQ8 A;  1PG5 B;  2FZK B;  2VB6 A;  3IQL A;  1QKW A;  2MI6 A;  5KYN A;  1WHM A;  3GLX A;  3CCS T;  4QW2 A;  1I81 A;  5L23 A;  3E1S A;  1AEY A;  2OAU A;  4AT1 B;  3CPW S;  2K57 A;  4IIO A;  4LE9 A;  2KT8 A;  3PT9 A;  2L89 A;  2EQK A;  1NJI R;  1E7O A;  3HL8 A;  4DBQ A;  3ZEH A;  2QEX T;  3M57 A;  2KI7 A;  3VU3 C;  5IXF A;  4XU0 A;  2DM1 A;  3M5A A;  5GMK j;  2HMA A;  1VQ5 Q;  3MET A;  3QXE B;  2FVU A;  2FG0 A;  3QKJ A;  4M78 D;  3H9N A;  4J6W A;  5DM7 R;  1MGQ A;  1JJ2 S;  1G5V A;  3INZ A;  1G3S A;  3MKD A;  3JCM c;  5IAY A;  2RI3 A;  2GGR A;  5GAM d;  5KCO A;  3OYL A;  5DLQ E;  4ZN1 A;  2NUP A;  2K3Y A;  1BI3 A;  5LJ3 d;  5L8R E;  4AG1 C;  4J9C A;  2B8A A;  2V26 A;  4HCZ A;  3E9F A;  2HQE A;  4CRI A;  1D1B A;  2A3L A;  1AWX A;  2O01 E;  1LJO A;  4EMK B;  3G6E T;  1VA7 A;  4J9F A;  2CT4 A;  4HVW A;  2LTO A;  4J9B A;  1YHQ Q;  2Z0W A;  4BE1 A;  4WTO B;  1IXD A;  1SKU B;  1PM3 A;  4ZTJ A;  4TVR A;  5IH2 A;  2CUB A;  4J8O A;  1RLP C;  3JCM P;  1MND A;  2M0O A;  2KYM A;  4OMM A;  2DET A;  3M0P A;  3I56 A;  2EJ9 A;  4FM4 B;  3GPL A;  1I5L A;  2YWW A;  1YIJ Q;  1KC8 R;  1T0H A;  3BFM A;  2ZAE A;  4A4H A;  5CKD A;  1BCO A;  3OYI A;  2EKO A;  5GMK m;  1VQ8 A;  3M58 A;  4OMP A;  1UGS B;  2DTO A;  2E5K A;  3PFS A;  2J6O A;  3SEM A;  3CEY A;  2V1R A;  1WXT A;  2JS0 A;  4FYY B;  5AYF A;  2OTL T;  1FWZ A;  1M5Q 1;  2DYB A;  3EGX A;  1YI2 A;  1QKX A;  4IUR A;  1VQ6 Q;  1IGU A;  3HRS A;  2KRO A;  4HKE A;  2JS2 A;  2F2W A;  4C92 G;  1K9A A;  3OYC A;  2XIC A;  1CKB A;  3M59 A;  2H3J A;  5GAN e;  1I4K 1;  4L6V 5;  5IHI A;  1VQL T;  4K11 A;  2K3B A;  3L2U A;  2RQR A;  3CCQ T;  2LC4 A;  3KBG A;  1WIE A;  4EPC A;  3EHQ A;  3JAM E;  3BY7 A;  1BCM A;  2RMO A;  5J26 A;  1VQM T;  1K9M R;  2ROT A;  3OYD A;  3TRE A;  1QVG S;  2YHT A;  3MP1 A;  4OMO A;  5LJ5 d;  3CXC S;  1I5O B;  3I5R A;  1G3T A;  1K76 A;  1HD3 A;  1MUZ A;  1NYG A;  1ZSG A;  2EYX A;  5IHK A;  4C8Q C;  4BI3 A;  1PCX A;  1UG1 A;  2HZY A;  3M0T A;  2FEI A;  1BU1 A;  2QA4 Q;  1K73 R;  4RUG A;  3I55 A;  3VUB A;  4PK4 A;  2DIG A;  2X4X A;  5CIU A;  2MF2 A;  5HK3 A;  1OUL A;  2LCL A;  3VKI A;  4RTX A;  4J9G A;  4OB2 B;  1OU8 A;  1Q86 U;  4C8Q D;  1XJW B;  1WXB A;  1H8K A;  3AT1 B;  2KAF A;  1M1F A;  1HSQ A;  4RTV A;  3PE0 A;  2EJF A;  4IUQ A;  1D3B B;  2EWN A;  2EYZ A;  4M75 F;  2DD4 A;  1MV0 B;  4JS4 A;  2OTL Q;  1VQO A;  2JW4 A;  3H41 A;  2WSF E;  3SHW A;  3CME A;  5IT9 E;  4M77 B;  3JCM X;  2AK5 A;  3RKY A;  3L2W A;  4F16 A;  4PJO B;  3L42 A;  4XTV A;  1M1K R;  2KR3 A;  1BYM A;  2YT6 A;  3MEA A;  3A8L B;  2FZC B;  3DKM A;  2P4R A;  2QTV A;  3OYK A;  2JM9 A;  1ZUU A;  2MPX C;  4GLK A;  3CMA T;  2V8I A;  1N27 A;  1RAG B;  4JRI A;  1UGV A;  2LT4 A;  3QDR B;  4ESR A;  1VQ7 A;  2ZPI B;  2KDS A;  2ECZ A;  2M51 A;  1YJN T;  1GCQ C;  3CBO A;  1VQ4 Q;  3SWN C;  1TXQ A;  4XTW A;  1AZE A;  1QW1 A;  1PHT A;  1LNX A;  2IIM A;  4EDU A;  4F7U F;  4M78 F;  3FLG A;  3OY9 A;  1YCY A;  2RHY A;  2XG8 D;  4X34 A;  1TS9 A;  3EGU A;  4LDY A;  3JB9 G;  2BZY A;  2XI9 A;  2L3Q A;  3EGD B;  4KGV B;  4Z02 A;  4JUV A;  2C0T A;  1VQN A;  3VRY A;  2E41 A;  5CKB A;  1YJ9 A;  3OS2 A;  1QMC A;  5LJ3 e;  2BIV A;  3UPU A;  1RUW A;  2EQI A;  4FYW B;  2XDB A;  2PUO B;  4FW2 A;  1WJQ A;  3CC2 A;  1WZO A;  2M16 A;  4B9X A;  2BTT A;  3X25 B;  2OTJ Q;  2JXB A;  1Y57 A;  1I07 A;  4KRT A;  3CC7 A;  1G3W A;  1I0C A;  2RJD A;  1H3Z A;  1D3B A;  3CCE T;  2M1H A;  4PFZ A;  2RD1 A;  3VS2 A;  5I2M A;  3JB9 I;  5KYY B;  2HQH A;  2O9V A;  2ZCF B;  4OP0 A;  4A53 A;  3CCL T;  3CCV A;  1K8A U;  2JNG A;  1GFD A;  4RKU E;  1Q82 U;  3RKW A;  3WVD B;  3O5Z A;  1CSK A;  3UT1 A;  1SSF A;  1G8X A;  3LX7 A;  4C5H A;  2JZ2 A;  4PJO A;  5GAN h;  2I2L A;  2K5I A;  5HKC A;  1UEC A;  3MEW A;  3EHR A;  2D8J A;  2EYY A;  4M77 G; 
#chains in the Genus database with same CATH homology
 2LQW A;  2D1X A;  2G6F X;  2EKH A;  1SHF A;  2K7A A;  3UF4 A;  4RTY A;  1PKS A;  1GRI A;  1U3O A;  2EW3 A;  1UTI A;  3RBB B;  1WA7 A;  1M30 A;  3C0C A;  2ROL A;  2DLP A;  2ED1 A;  1WX6 A;  3M0S A;  1K4U S;  1ARK A;  4GBQ A;  1YCS B;  2CH4 W;  4D8D A;  2PZ1 A;  2CDT A;  2LJ1 A;  4D8K A;  1NLO C;  4AFZ C;  1G83 A;  4RTU A;  1OOT A;  1ZLM A;  2AZS A;  3NPF A;  1WFW A;  2HDA A;  2J06 A;  1UFF A;  4LN2 A;  2JTE A;  2MOX A;  1WLP B;  4RTZ A;  2FPE A;  2L3P A;  4RTW A;  2CH4 A;  2ABL A;  2BZX A;  1UE9 A;  2RN8 A;  2VWF A;  2O2O A;  2GNC A;  3VS1 A;  2LJ0 A;  1B3Q A;  1X6G A;  4CC2 A;  1X6B A;  2O9S A;  1H92 A;  3PVL A;  1WDX A;  2HCK A;  1WXU A;  2V1Q A;  2LNH B;  3UA7 A;  2DL7 A;  1OPL A;  2L2P A;  2CUD A;  1EFN A;  1X2K A;  4OML A;  3LH5 A;  2LX7 A;  1PNJ A;  1PKT A;  2HBW A;  5IHN A;  1NEG A;  2ESW A;  1Y0M A;  1SPK A;  2DL3 A;  1LCK A;  1OPK A;  1H3H A;  1KSW A;  3I35 A;  2D8H A;  2A37 A;  2KGT A;  3VS7 A;  5FW9 A;  2C0O A;  3M0R A;  1RLQ C;  1QCF A;  2KNB B;  1VYV A;  5IXB A;  4AFS C;  1X69 A;  2H8H A;  3REB B;  1ZUY A;  3IQL A;  1K1Z A;  1QKW A;  2RQU A;  1U06 A;  1SRM A;  4AG2 C;  2L0A A;  1AZG B;  4J9D A;  5L23 A;  1CKA A;  1AEY A;  1KIK A;  2JMC A;  2EGE A;  4IIO A;  4LE9 A;  1K0S A;  2KT8 A;  2B86 A;  4J9I A;  3TSW A;  1E7O A;  3CQT A;  2RQV A;  2FPD A;  2K6D A;  4HCK A;  1YP5 A;  2DIL A;  4OMQ A;  2DVJ A;  2RPN A;  2VKN A;  1K0X A;  2NWM A;  3EG0 A;  1ZBJ A;  5IXF A;  4JZ3 A;  1JQQ A;  1NLP C;  2DM1 A;  3KFV A;  1M3A A;  2QDL A;  3THK A;  2PTK A;  2FG0 A;  1FMK A;  2LP5 A;  1UHF A;  2CSQ A;  3M0Q A;  1AWO A;  2W10 A;  1PRM C;  4IIM A;  2GGR A;  4HXJ A;  4AFQ C;  1BB9 A;  1PRL C;  4AG1 C;  4J9C A;  2GBQ A;  4F14 A;  3I9Q A;  1AOJ A;  1AWX A;  2W0Z A;  2LQN A;  2JM8 A;  2XMF A;  1VA7 A;  2J05 A;  4J9F A;  2CT4 A;  2CRE A;  4HVW A;  1TUC A;  2GTJ A;  4J9B A;  1BK2 A;  1WYX A;  2DBK A;  2LMJ A;  4CC7 A;  1JO8 A;  2C0I A;  3EG2 A;  1B07 A;  5FWB A;  4DEY A;  1M3B A;  1IO6 A;  4FSS A;  1RI9 A;  1Z9Z A;  4A63 B;  5IH2 A;  2M0Y A;  2A28 A;  2CUB A;  1TUD A;  1FYN A;  1ABQ A;  1RLP C;  2DMO A;  2KYM A;  4OMM A;  1QLY A;  3M0P A;  4OMN A;  3M0U A;  2EBP A;  1UHC A;  1UDL A;  1T0H A;  2SEM A;  2EGA A;  3UA6 A;  2D0N A;  1VYT A;  2AKK A;  1SEM A;  4RTT A;  1KJW A;  4M4Z A;  2EGC A;  4OMP A;  4ORZ A;  2E5K A;  2YUO A;  2J6O A;  3SEM A;  2KEA A;  2HSP A;  2V1R A;  2DF6 A;  2AZV A;  1WXT A;  1VYU A;  2JS0 A;  3VRZ A;  3RNJ A;  2A36 A;  1SHG A;  2MIO A;  3TVT A;  1Z9Q A;  3ZL7 C;  4JJB A;  1JXO A;  4J9E A;  2DYB A;  1OV3 A;  2KRS A;  2NUZ A;  1NYF A;  2KRN A;  5GJV B;  3REA B;  1QKX A;  1AWW A;  1A0N B;  3GBQ A;  3NHN A;  5HCK A;  1NG2 A;  2KRO A;  1YWP A;  2JS2 A;  1SRL A;  2F2W A;  4JJD A;  3ULR B;  1K9A A;  1CKB A;  4HVV A;  1JXM A;  1TG0 A;  2SRC A;  2DL8 A;  5IHI A;  2K2M A;  4K11 A;  1XOV A;  3A98 A;  3VS4 A;  2K3B A;  1ZUK A;  2RQR A;  2GQI A;  1WIE A;  1GFC A;  3EHQ A;  2KRM A;  2RMO A;  1ZX6 A;  2ROT A;  4Z88 A;  4Z8A A;  4HVU A;  3VS5 A;  4OMO A;  2KT1 A;  2J6F A;  3I5R A;  4ZNX A;  2O88 A;  2RQW A;  2LJ3 A;  1K76 A;  1HD3 A;  1MUZ A;  1M3C A;  1NYG A;  1ZSG A;  2EYX A;  3JV3 A;  5IHK A;  2DA9 A;  1UG1 A;  3M0T A;  1E6G A;  4X1V A;  2FEI A;  1UJ0 A;  1BU1 A;  2YDL A;  1ABO A;  2K9G A;  2RF0 A;  2KYB A;  1U5S A;  4RUG A;  1S1N A;  2VVK A;  1WI7 A;  2L3S A;  2HEQ A;  4RTX A;  2J6K A;  4J9G A;  1M27 C;  1QWF A;  1X43 A;  1M8M A;  2F2V A;  2JMA A;  1X2Q A;  1I1J A;  4J9H A;  1GBR A;  3NMZ C;  2DNU A;  1UJY A;  1G2B A;  2I0N A;  1WXB A;  1H8K A;  2CT3 A;  2FO0 A;  1HSQ A;  4GLM A;  4RTV A;  3PE0 A;  4JZ4 A;  1T0J A;  2DRK A;  4Y92 A;  2KE9 A;  2EYZ A;  2X3W D;  1MV0 B;  1YWO A;  1AWJ A;  2OAW A;  4QT7 A;  1T3L A;  2JW4 A;  1YNZ A;  2F2X A;  3H41 A;  3SHW A;  4LNP A;  2JT4 A;  3R6N A;  2AK5 A;  3H0H A;  3QWY A;  1X27 A;  1BBZ A;  4LUE A;  4CC4 B;  1GL5 A;  4F16 A;  4F17 A;  2PNI A;  3H0F A;  1MV3 A;  1QWE A;  2KR3 A;  2A08 A;  2YT6 A;  2P4R A;  2JM9 A;  1ZUU A;  4WCI A;  2MCN A;  1OEB A;  4AFU C;  1T3S A;  1UGV A;  1W1F A;  1JU5 C;  1HJD A;  2FPF A;  4ESR A;  1J3T A;  2GTO A;  1UUE A;  2LZ6 B;  5I22 A;  1W70 A;  4CC3 A;  2FRW A;  2EVR A;  2ECZ A;  2KBT A;  3TSZ A;  2M51 A;  3EG1 A;  3NGP A;  1GCQ C;  2YSQ A;  1KFZ A;  2X3X D;  2DL5 A;  1E6H A;  1AZE A;  2DJQ A;  4EIK A;  1PHT A;  2IIM A;  2J7I A;  4R0K A;  3EG3 A;  1GCP A;  4E6R A;  5GJW B;  3EGU A;  2BZY A;  2DE0 X;  2L3Q A;  5ECA A;  2C0T A;  2EYW A;  1NEB A;  2DBM A;  5FWC A;  3VRY A;  2AKL A;  1NM7 A;  5I11 A;  1N5Z A;  1GBQ A;  3VS6 A;  1PWT A;  1AVZ C;  3UAT A;  2KXD A;  2O31 A;  1RUW A;  2EQI A;  2ENM A;  5EC7 A;  2KXC A;  1AD5 A;  2BZ8 A;  2EPD A;  2YUQ A;  2BTT A;  1SSH A;  1GCQ A;  2JXB A;  1Y57 A;  2CSI A;  1I07 A;  4KRT A;  3I5S A;  1I0C A;  3FJ5 A;  2OI3 A;  4JPB W;  3QWX X;  2DL4 A;  4JJC A;  3VS2 A;  2RQT A;  2ED0 A;  2DX1 A;  1V1C A;  2LCS A;  2O9V A;  3U23 A;  4LUD A;  1W6X A;  1GFD A;  2OJ2 A;  2FRY A;  2DRM A;  3O5Z A;  1CSK A;  3PVQ A;  4DEX A;  3VS3 A;  1YN8 A;  2RNA A;  2YUN A;  1JEG A;  2K79 A;  3H0I A;  2YUP A;  1UEC A;  3EHR A;  4Z89 A;  2D8J A;  2EYY A;  3VS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...