3EG6A

Structure of wdr5 bound to mll1 peptide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Structure of WDR5 bound to mixed lineage leukemia protein-1 peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 104
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3eg6A00
3CIKB 5GXIA 3UKUC 4J0XA 3A0FA 4R7AB 5CXCA 4ZOYA 3JB9L 4LG8A 3PVUB 3IJCA 5THAA 4CY1A 5FKQA 5CYKB 4BH6A 4TZ4A 3BG0A 3J80g 2PM6B 5HYNB 4L9OA 2P9IC 2Z2OA 2H6KA 4Y5RD 4O3TB 4LGNA 2OVRB 2YB8B 5CYKA 2I3SA 4K3ID 1RI6A 4J79A 4JXMA 1SQJA 3AL9A 5I5JA 4BL0A 2HESX 2I3TA 2HJ4A 2OVQB 4QQEA 3JZNA 1VYHC 4O45A 3ODTA 5C2VB 3K26A 1R5MA 4A7JA 4CY3A 5B4WA 2XYIA 2W18A 4J0WA 4N14A 5HE0B 4A09A 2B5NA 4Z8LA 4JSXC 2I0SA 5JWZA 4J87A 3SXTD 3RN0D 2H9PA 3DM0A 1JJUB 1XIPA 1GP2B 3SJLD 5HQGA 3I7NA 3C9CA 4A0AB 4OWRA 2IWFA 5FLXg 4AOWA 4JT6C 3K27A 1ERJA 1PBYB 5IGQA 2IUPA 2AH0A 3I89A 2CN3A 2H47A 2H68A 4H5IA 4PC0A 2I0TA 4PNKB 1TBGA 3IJ0A 4E54B 4GQ2P 3OKYB 4L3GD 1NEXB 3SFZA 3CFVA 3UVLA 3RMZD 4ES0A 1TYQC 2YMUA 2J55H 4PBYA 2H3XA 4YVDA 4E54A 4D6VA 3EI4B 2B5MA 4QT8A 3I7LA 5GMKn 5AJAA 1U2VC 5EMJB 5EM2A 4X60B 2HXCA 2H9MA 4GGDA 4O9DA 3NVQA 2IURA 3PXWD 2Q7QA 4E5ZB 5EARA 3EI3B 4D0KA 4EWRA 1PEVA 2HKMA 4L1QD 3PXSD 3N0EA 3RN1D 3SN6B 4FA5D 3EI3A 5TEFA 4U7AA 3OW8A 5EAMA 2MTAH 4ZOVA 4ERQA 4GGCA 3DWLC 2YNNA 1A0RB 2QXVA 3I7KA 2H9LA 3EG6A 2GNQA 3IKOA 4XYHA 2OJYA 3GFCA 5AMSA 4KFMB 4PSWB 4A2MA 2UZYB 4J81A 3MKSB 4I79A 3EMHA 2AGYA 3AFCA 3RLMD 3BG1A 5C9ZB 3VH0A 3RFHA 5TDHB 5EALA 3SBQA 3P4FA 3FM0A 3RRMC 4FAVD 4IA9A 3I2NA 2AGWA 3IIWA 1Q47A 4X63B 5TF2A 5HE1B 4GM3A 4J86A 5KDOB 1N6EA 4CY5A 3J81g 2G99A 1SQ9A 3DXKC 3PSLA 3SHFA 3DXMC 5FXYA 3AL8B 3EI2B 4A11B 2XL3A 2B5LA 2HKRA 1P22A 4J73A 3MXXA 2H9NA 2XL2A 3UVNA 4OZUA 4JT5C 3UVMA 5I5IA 3F3GA 2IUVA 1JMXB 4O3UB 4IMMA 3EI2A 4A11A 3DSMA 3KRWB 4L3HD 2CNXA 1B9XA 2CN2A 2P9LC 3UVKA 4GMBA 1GOTB 4K3JB 2QC5A 4ZOXA 1OMWB 3JROA 3SWSD 1FWXA 2GC7A 3IIYA 5IC7A 3SBPA 4A0AA 1K8KC 5FKSA 4XEIC 4ESGA 5IJ7E 4XYIA 2GC4A 2IAAA 3SVWD 3SCYA 2P9SC 1MDAH 3MZKA 3OKYA 4CI2A 3I7HA 2H6NA 5K19A 4X61B 5HE2B 1JMZB 3GREA 3PE7A 2Z2PA 5AFU3 1QNIA 3KRXB 3EI4A 4FAND 3OL2B 3ORVD 1N6DA 3V7DB 3UKRC 2BBKH 3B7FA 2H6QA 4NSXA 4GZ8A 4CI3A 4JSVC 4CI8A 2BCJB 4CZYA 3JAMg 5FQDA 5EMMB 4QL1A 3FGBA 3L4MD 3MKQA 3JRPA 3AH8B 2PM9B 3ZWLB 3MMYA 3OL2A 3JZHA 4E5ZA 4AEZA 3MZLA 1SHYB 2AQ5A 1PI6A 3BWSA 5CXCB 2P9KC 3IJ1A 3RSEC 4J8BA 2P9NC 3V5WB 1JOFA 3F3FA 1GXRA 4CZXA 2AGLA 4ZN4A 4PXWA 4BUJC 1NR0A 2CO0A 5H1MA 4X3EA 4A08B 3C5MA 3I7PA 3OKTA 4J78A 5HE3B 2CE9A 3OKWA 2IUQA 2OIZA 5GSAA 3EWEA 4FWWA 3EI1B 2P9PC 5TEEA 4GM9A 2OVPB 4HDJA 3EU7A 4A08A 1MG2A 4GQ1A 1L0QA 4CY2A 3JZGA 5GXHA 3EI1A 5C2WB 5EMLB 3NVXA 4J8GA 4A09B 4U1EI 2AGXA 2TRCB 3UR4A 4O1QD 4GGAA 5CXBB 3SLED 4H5JA 5IGOA 5I5MA 2IWKA 3N0DA 2AH1A 4FA1D 2J56H 3AL8A 4ZOZA 1PGUA 5FKTA 3UVOA 2J57G 3C99A 5H14A 3NVNA 3JPXA 1YFQA 4CC9A 2HJBA 4A2LA 4FA9D 3HFQA 3VA6A 5CXBA 2XU7A 2HYEA 3V9FA 3OTTA 2UZXB 1U4CA 4A0BB 4QRJA 4UI9R 4LG9A 1MG3A 2EBSA 4JD2C 4FA4D 5SXMA 4JSPC 4JSNC 4MK0B 4PBZA 4CZVA 2YNPA 3L4OD 3SBRA 5K1CC 1XKSA 1XHMA 3W15A 2P9UC 4J77A 2H14A 3VGZA 3SMRA 4A0BA 1S4UX 4FHLA 5FA5B 3I8EA 2H13A 4G56B 5H17A 2YBAA 4J84A 2PM7B 2PBIB 1K32A 1GG2B 1N6FA 5EM2B 2AGZA 4GM8A 4ERZA 2OK4A 2B4EA 4J82A 3E0CA 3PVWB 3U4YA 5IJ8E 4FB1D 3PXTD 4CI1A 2CE8A 5IT9g 5EAPA 2I0RA 3FRXA 2YNOA 4Y7RA 2Z2NA 3PSCB 3I8CA 3ULEC 4PSXB 1OLZA 2CO0C 2OK6A 2PM9A 3CFSB 5A2Qg 3C75H 3F3PA 5FKRA 2O9KA 1B9YA 4ERYA 3I7OA 2G9AA 4GQBB 5EMKB 3RFGA
chains in the Genus database with same CATH superfamily
5C86A 3CIKB 5GXIA 3UKUC 4J0XA 3A0FA 3IUQA 4R7AB 5CXCA 4ZOYA 3JB9L 4LG8A 3PVUB 3IJCA 5THAA 4CY1A 5FKQA 5CYKB 4BH6A 4TZ4A 3BG0A 4G1MA 3J80g 2PM6B 4DNVA 5HYNB 5M5UA 4L9OA 2P9IC 4IRZA 2EIEA 2Z2OA 2H6KA 3NIFA 4Y5RD 4O3TB 3QI0A 1H2ZA 4LGNA 2OVRB 2YB8B 5CYKA 2I3SA 4K3ID 1RI6A 4J79A 4JXMA 1L5GA 1SQJA 3AL9A 5I5JA 4BL0A 1E5TA 2HESX 2I3TA 2HJ4A 2OVQB 4QQEA 3JZNA 1VYHC 3ZDZA 4O45A 3ODTA 5C2VB 3K26A 1R5MA 1JV2A 3ZDYA 4A7JA 4CY3A 5B4WA 2VDRA 2XYIA 2W18A 4J0WA 4N14A 5HE0B 4A09A 2B5NA 4Z8LA 4L1MA 4WK2A 4JSXC 2I0SA 5JWZA 4NAAA 4J87A 1VE6A 3SXTD 4Z7QA 3RN0D 2H9PA 3DM0A 1JJUB 1H2WA 1XIPA 1GP2B 2XE4A 5FFGA 3SJLD 4D9SA 3OF7A 4DNUA 4Z7OA 4NC4A 2XZGA 3MUNA 5HQGA 3I7NA 3C9CA 4RE6A 4A0AB 4OWRA 2IWFA 5FLXg 4AOWA 4JT6C 3K27A 1ERJA 1PBYB 5IGQA 2IUPA 2AH0A 3I89A 3IULA 2CN3A 2H47A 2H68A 1H2XA 4H5IA 2BKLA 4PC0A 2I0TA 4PNKB 1TBGA 3IJ0A 1VZ3A 4E54B 1U8CA 4GQ2P 3OKYB 4L3GD 1NEXB 3SFZA 4DNWA 3CFVA 3UVLA 3RMZD 4ES0A 1TYQC 2YMUA 3O4JA 2J55H 4PBYA 2H3XA 4YVDA 4E54A 5E6UA 4D6VA 3EI4B 1UOQA 3EQ9A 2B5MA 4QT8A 3I7LA 2XDWA 5GMKn 5AJAA 1O6FA 1U2VC 5EMJB 5C92A 5EM2A 4X60B 2HXCA 3IUJA 2H9MA 1E8NA 2VC2A 4GGDA 1E8MA 4QAMA 4Z7NA 4O9DA 3NVQA 2VZ3A 2IURA 3PXWD 2Q7QA 1UOOA 4E5ZB 5EARA 3EI3B 4D0KA 4EWRA 3V4PA 3MUOA 4UM9A 3IVMA 1UTCA 1PEVA 2HKMA 5E6RA 4L1QD 3PXSD 3N0EA 3IURA 4BCDA 3DDUA 3RN1D 3SN6B 4FA5D 3EI3A 5TEFA 4BCBA 5FFOA 4U7AA 2WQ8A 3OW8A 5EAMA 2MTAH 4AX4A 4ZOVA 4ERQA 4GGCA 3IUNA 3DWLC 2YNNA 1A0RB 2QXVA 3I7KA 2H9LA 3EG6A 2GNQA 3T3PA 3IKOA 3GD1I 4NBMA 2OJYA 4XYHA 3GFCA 5AMSA 4KFMB 4PSWB 4A2MA 5M5VA 2UZYB 3NIGA 4J81A 3MKSB 4I79A 3EMHA 2AGYA 3AFCA 3RLMD 4MMYA 3BG1A 5C9ZB 3VH0A 3RFHA 5TDHB 5EALA 1JTDB 1K3IA 4G1EA 4JHPC 3SBQA 3P4FA 3FM0A 3RRMC 4FAVD 4IA9A 3I2NA 2AGWA 3IIWA 1Q47A 4X63B 5TF2A 5E6SA 5HE1B 2VDLA 4GM3A 4J86A 5HDBA 1M1XA 5KDOB 1N6EA 4CY5A 3J81g 2G99A 1SQ9A 3DXKC 3PSLA 3SHFA 3DXMC 5FXYA 3AL8B 3MVDK 3EI2B 4A11B 2XL3A 2B5LA 2HKRA 1P22A 4J73A 4G55A 1QFMA 3MXXA 2H9NA 2XL2A 3UVNA 4OZUA 4JT5C 3UVMA 5I5IA 2VDKA 3F3GA 2IUVA 1JMXB 4O3UB 4IMMA 3EI2A 4A11A 3DSMA 3KRWB 4L3HD 2CNXA 1B9XA 4NENA 2CN2A 5M61A 2P9LC 3UVKA 1GOTB 4GMBA 4K3JB 2QC5A 3ZE1A 4ZOXA 4AMZA 1OMWB 3JROA 3SWSD 1FWXA 2GC7A 3IIYA 5IC7A 3SBPA 4O02A 4A0AA 3IJEA 1K8KC 1O6GA 2EICA 5FKSA 2EIBA 4XEIC 4ESGA 5IJ7E 4XYIA 2GC4A 2IAAA 3SVWD 3SCYA 1UOPA 2P9SC 1MDAH 3MZKA 1BPOA 4AN0A 3OKYA 4CI2A 3I7HA 2H6NA 5K19A 4X61B 5HE2B 4BCCA 3K72A 1JMZB 4AMYA 1YR2A 2VDOA 3GREA 3PE7A 2Z2PA 4WK4A 3O4IA 5AFU3 1QNIA 3KRXB 3EI4A 4FAND 3OL2B 3V4VA 3ORVD 1N6DA 3V7DB 3UKRC 2BBKH 3B7FA 2H6QA 4NSXA 4GZ8A 1VZ2A 4CI3A 4JSVC 4CI8A 1GOHA 2BCJB 4CZYA 3JAMg 5FQDA 5EMMB 4QL1A 3FGBA 3L4MD 3MKQA 3JRPA 3AH8B 2PM9B 3ZWLB 3K6SA 3MMYA 4WJKA 3OL2A 3JZHA 4E5ZA 4AEZA 3VI4A 1GOFA 1SHYB 3MZLA 3K71A 3EQ7A 2AQ5A 1PI6A 3BWSA 3ZE2A 2VDQA 5CXCB 2P9KC 3GC3B 3IJ1A 3RSEC 4J8BA 2P9NC 3V5WB 1I2MB 1JOFA 3F3FA 1GXRA 4CZXA 2AGLA 4ZN4A 4PXWA 4BUJC 1NR0A 2CO0A 5H1MA 2HU7A 4X3EA 1C9IA 3ZDXA 4A08B 3C5MA 3I7PA 3OKTA 4J78A 5HE3B 2CE9A 3OKWA 4MMXA 3VI3A 2IUQA 3FCUA 2OIZA 5GSAA 3EWEA 4FWWA 3EI1B 2P9PC 5TEEA 1T2XA 2OVPB 4GM9A 4HDJA 3EU7A 2VDMA 4UM8A 1H2YA 4A08A 4MMZA 1MG2A 4GQ1A 1L0QA 4CY2A 3JZGA 1C9LA 5GXHA 3EI1A 5C2WB 2HU8A 5EMLB 3NVXA 5M5RA 4J8GA 3NIDA 5M5TA 4A09B 4U1EI 2AGXA 2TRCB 3UR4A 4O1QD 4GGAA 2VZ1A 3T3MA 2JKXA 5CXBB 3SLED 1VE7A 4H5JA 5IGOA 5I5MA 2VDNA 2IWKA 2VDPA 3N0DA 2AH1A 4FA1D 2J56H 3AL8A 3KCIA 4ZOZA 1PGUA 5FKTA 3UVOA 2J57G 3C99A 5H14A 3O4GA 3NVNA 3JPXA 1YFQA 4CC9A 2HJBA 4A2LA 4FA9D 3HFQA 3VA6A 5CXBA 3ZE0A 2XU7A 2HYEA 3V9FA 3OTTA 3QHYB 2UZXB 4RE5A 1U4CA 4A0BB 4QRJA 4UI9R 4LG9A 1MG3A 2EBSA 4JD2C 4FA4D 5SXMA 4JSPC 4JSNC 4MK0B 4BP8A 4PBZA 4CZVA 2YNPA 3L4OD 3SBRA 5K1CC 1XKSA 2QR5A 2QZPA 1XHMA 4WK0A 3W15A 2P9UC 4J77A 2H14A 3VGZA 3SMRA 4A0BA 1S4UX 4FHLA 4JHNA 5M5SA 5FA5B 3I8EA 3O4HA 2H13A 4G56B 5H17A 2YBAA 4J84A 1GOGA 2PM7B 2PBIB 3FCSA 1TYEA 1GG2B 1K32A 1N6FA 5EM2B 2AGZA 4GM8A 4AN1A 3EQ8A 4BP9A 4ERZA 2OK4A 2B4EA 4J82A 2HU5A 3E0CA 3PVWB 1QFSA 3U4YA 5IJ8E 4FB1D 3PXTD 4CI1A 2EIDA 2CE8A 5IT9g 5EAPA 2I0RA 3FRXA 2YNOA 4Y7RA 2Z2NA 3PSCB 4O2WA 3I8CA 3ULEC 1A12A 4PSXB 1OLZA 2CO0C 2OK6A 2PM9A 3CFSB 5A2Qg 3C75H 3F3PA 5FKRA 2O9KA 3IUMA 1B9YA 4ERYA 3I7OA 2G9AA 4GQBB 5EMKB 3RFGA
chains in the Genus database with same CATH topology
3CIKB 5GXIA 3UKUC 4J0XA 3A0FA 4R7AB 5CXCA 4ZOYA 3JB9L 4LG8A 3PVUB 3IJCA 5THAA 4CY1A 5FKQA 5CYKB 4BH6A 4TZ4A 3BG0A 3J80g 2PM6B 5HYNB 4L9OA 2P9IC 2Z2OA 2H6KA 4Y5RD 4O3TB 4LGNA 2OVRB 2YB8B 5CYKA 2I3SA 4K3ID 1RI6A 4J79A 4JXMA 1SQJA 3AL9A 5I5JA 4BL0A 2HESX 2I3TA 2HJ4A 2OVQB 4QQEA 3JZNA 1VYHC 4O45A 3ODTA 5C2VB 3K26A 1R5MA 4A7JA 4CY3A 5B4WA 2XYIA 2W18A 4J0WA 4N14A 5HE0B 4A09A 2B5NA 4Z8LA 4JSXC 2I0SA 5JWZA 4J87A 3SXTD 3RN0D 2H9PA 3DM0A 1JJUB 1XIPA 1GP2B 3SJLD 5HQGA 3I7NA 3C9CA 4A0AB 4OWRA 2IWFA 5FLXg 4AOWA 4JT6C 3K27A 1ERJA 1PBYB 5IGQA 2IUPA 2AH0A 3I89A 2CN3A 2H47A 2H68A 4H5IA 4PC0A 2I0TA 4PNKB 1TBGA 3IJ0A 4E54B 4GQ2P 3OKYB 4L3GD 1NEXB 3SFZA 3CFVA 3UVLA 3RMZD 4ES0A 1TYQC 2YMUA 2J55H 4PBYA 2H3XA 4YVDA 4E54A 4D6VA 3EI4B 2B5MA 4QT8A 3I7LA 5GMKn 5AJAA 1U2VC 5EMJB 5EM2A 4X60B 2HXCA 2H9MA 4GGDA 4O9DA 3NVQA 2IURA 3PXWD 2Q7QA 4E5ZB 5EARA 3EI3B 4D0KA 4EWRA 1PEVA 2HKMA 4L1QD 3PXSD 3N0EA 3RN1D 3SN6B 4FA5D 3EI3A 5TEFA 4U7AA 3OW8A 5EAMA 2MTAH 4ZOVA 4ERQA 4GGCA 3DWLC 2YNNA 1A0RB 2QXVA 3I7KA 2H9LA 3EG6A 2GNQA 3IKOA 4XYHA 2OJYA 3GFCA 5AMSA 4KFMB 4PSWB 4A2MA 2UZYB 4J81A 3MKSB 4I79A 3EMHA 2AGYA 3AFCA 3RLMD 3BG1A 5C9ZB 3VH0A 3RFHA 5TDHB 5EALA 3SBQA 3P4FA 3FM0A 3RRMC 4FAVD 4IA9A 3I2NA 2AGWA 3IIWA 1Q47A 4X63B 5TF2A 5HE1B 4GM3A 4J86A 5KDOB 1N6EA 4CY5A 3J81g 2G99A 1SQ9A 3DXKC 3PSLA 3SHFA 3DXMC 5FXYA 3AL8B 3EI2B 4A11B 2XL3A 2B5LA 2HKRA 1P22A 4J73A 3MXXA 2H9NA 2XL2A 3UVNA 4OZUA 4JT5C 3UVMA 5I5IA 3F3GA 2IUVA 1JMXB 4O3UB 4IMMA 3EI2A 4A11A 3DSMA 3KRWB 4L3HD 2CNXA 1B9XA 2CN2A 2P9LC 3UVKA 4GMBA 1GOTB 4K3JB 2QC5A 4ZOXA 1OMWB 3JROA 3SWSD 1FWXA 2GC7A 3IIYA 5IC7A 3SBPA 4A0AA 1K8KC 5FKSA 4XEIC 4ESGA 5IJ7E 4XYIA 2GC4A 2IAAA 3SVWD 3SCYA 2P9SC 1MDAH 3MZKA 3OKYA 4CI2A 3I7HA 2H6NA 5K19A 4X61B 5HE2B 1JMZB 3GREA 3PE7A 2Z2PA 5AFU3 1QNIA 3KRXB 3EI4A 4FAND 3OL2B 3ORVD 1N6DA 3V7DB 3UKRC 2BBKH 3B7FA 2H6QA 4NSXA 4GZ8A 4CI3A 4JSVC 4CI8A 2BCJB 4CZYA 3JAMg 5FQDA 5EMMB 4QL1A 3FGBA 3L4MD 3MKQA 3JRPA 3AH8B 2PM9B 3ZWLB 3MMYA 3OL2A 3JZHA 4E5ZA 4AEZA 3MZLA 1SHYB 2AQ5A 1PI6A 3BWSA 5CXCB 2P9KC 3IJ1A 3RSEC 4J8BA 2P9NC 3V5WB 1JOFA 3F3FA 1GXRA 4CZXA 2AGLA 4ZN4A 4PXWA 4BUJC 1NR0A 2CO0A 5H1MA 4X3EA 4A08B 3C5MA 3I7PA 3OKTA 4J78A 5HE3B 2CE9A 3OKWA 2IUQA 2OIZA 5GSAA 3EWEA 4FWWA 3EI1B 2P9PC 5TEEA 4GM9A 2OVPB 4HDJA 3EU7A 4A08A 1MG2A 4GQ1A 1L0QA 4CY2A 3JZGA 5GXHA 3EI1A 5C2WB 5EMLB 3NVXA 4J8GA 4A09B 4U1EI 2AGXA 2TRCB 3UR4A 4O1QD 4GGAA 5CXBB 3SLED 4H5JA 5IGOA 5I5MA 2IWKA 3N0DA 2AH1A 4FA1D 2J56H 3AL8A 4ZOZA 1PGUA 5FKTA 3UVOA 2J57G 3C99A 5H14A 3NVNA 3JPXA 1YFQA 4CC9A 2HJBA 4A2LA 4FA9D 3HFQA 3VA6A 5CXBA 2XU7A 2HYEA 3V9FA 3OTTA 2UZXB 1U4CA 4A0BB 4QRJA 4UI9R 4LG9A 1MG3A 2EBSA 4JD2C 4FA4D 5SXMA 4JSPC 4JSNC 4MK0B 4PBZA 4CZVA 2YNPA 3L4OD 3SBRA 5K1CC 1XKSA 1XHMA 3W15A 2P9UC 4J77A 2H14A 3VGZA 3SMRA 4A0BA 1S4UX 4FHLA 5FA5B 3I8EA 2H13A 4G56B 5H17A 2YBAA 4J84A 2PM7B 2PBIB 1K32A 1GG2B 1N6FA 5EM2B 2AGZA 4GM8A 4ERZA 2OK4A 2B4EA 4J82A 3E0CA 3PVWB 3U4YA 5IJ8E 4FB1D 3PXTD 4CI1A 2CE8A 5IT9g 5EAPA 2I0RA 3FRXA 2YNOA 4Y7RA 2Z2NA 3PSCB 3I8CA 3ULEC 4PSXB 1OLZA 2CO0C 2OK6A 2PM9A 3CFSB 5A2Qg 3C75H 3F3PA 5FKRA 2O9KA 1B9YA 4ERYA 3I7OA 2G9AA 4GQBB 5EMKB 3RFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIK B;  5GXI A;  3UKU C;  4J0X A;  3A0F A;  4R7A B;  5CXC A;  4ZOY A;  3JB9 L;  4LG8 A;  3PVU B;  3IJC A;  5THA A;  4CY1 A;  5FKQ A;  5CYK B;  4BH6 A;  4TZ4 A;  3BG0 A;  3J80 g;  2PM6 B;  5HYN B;  4L9O A;  2P9I C;  2Z2O A;  2H6K A;  4Y5R D;  4O3T B;  4LGN A;  2OVR B;  2YB8 B;  5CYK A;  2I3S A;  4K3I D;  1RI6 A;  4J79 A;  4JXM A;  1SQJ A;  3AL9 A;  5I5J A;  4BL0 A;  2HES X;  2I3T A;  2HJ4 A;  2OVQ B;  4QQE A;  3JZN A;  1VYH C;  4O45 A;  3ODT A;  5C2V B;  3K26 A;  1R5M A;  4A7J A;  4CY3 A;  5B4W A;  2XYI A;  2W18 A;  4J0W A;  4N14 A;  5HE0 B;  4A09 A;  2B5N A;  4Z8L A;  4JSX C;  2I0S A;  5JWZ A;  4J87 A;  3SXT D;  3RN0 D;  2H9P A;  3DM0 A;  1JJU B;  1XIP A;  1GP2 B;  3SJL D;  5HQG A;  3I7N A;  3C9C A;  4A0A B;  4OWR A;  2IWF A;  5FLX g;  4AOW A;  4JT6 C;  3K27 A;  1ERJ A;  1PBY B;  5IGQ A;  2IUP A;  2AH0 A;  3I89 A;  2CN3 A;  2H47 A;  2H68 A;  4H5I A;  4PC0 A;  2I0T A;  4PNK B;  1TBG A;  3IJ0 A;  4E54 B;  4GQ2 P;  3OKY B;  4L3G D;  1NEX B;  3SFZ A;  3CFV A;  3UVL A;  3RMZ D;  4ES0 A;  1TYQ C;  2YMU A;  2J55 H;  4PBY A;  2H3X A;  4YVD A;  4E54 A;  4D6V A;  3EI4 B;  2B5M A;  4QT8 A;  3I7L A;  5GMK n;  5AJA A;  1U2V C;  5EMJ B;  5EM2 A;  4X60 B;  2HXC A;  2H9M A;  4GGD A;  4O9D A;  3NVQ A;  2IUR A;  3PXW D;  2Q7Q A;  4E5Z B;  5EAR A;  3EI3 B;  4D0K A;  4EWR A;  1PEV A;  2HKM A;  4L1Q D;  3PXS D;  3N0E A;  3RN1 D;  3SN6 B;  4FA5 D;  3EI3 A;  5TEF A;  4U7A A;  3OW8 A;  5EAM A;  2MTA H;  4ZOV A;  4ERQ A;  4GGC A;  3DWL C;  2YNN A;  1A0R B;  2QXV A;  3I7K A;  2H9L A;  3EG6 A;  2GNQ A;  3IKO A;  4XYH A;  2OJY A;  3GFC A;  5AMS A;  4KFM B;  4PSW B;  4A2M A;  2UZY B;  4J81 A;  3MKS B;  4I79 A;  3EMH A;  2AGY A;  3AFC A;  3RLM D;  3BG1 A;  5C9Z B;  3VH0 A;  3RFH A;  5TDH B;  5EAL A;  3SBQ A;  3P4F A;  3FM0 A;  3RRM C;  4FAV D;  4IA9 A;  3I2N A;  2AGW A;  3IIW A;  1Q47 A;  4X63 B;  5TF2 A;  5HE1 B;  4GM3 A;  4J86 A;  5KDO B;  1N6E A;  4CY5 A;  3J81 g;  2G99 A;  1SQ9 A;  3DXK C;  3PSL A;  3SHF A;  3DXM C;  5FXY A;  3AL8 B;  3EI2 B;  4A11 B;  2XL3 A;  2B5L A;  2HKR A;  1P22 A;  4J73 A;  3MXX A;  2H9N A;  2XL2 A;  3UVN A;  4OZU A;  4JT5 C;  3UVM A;  5I5I A;  3F3G A;  2IUV A;  1JMX B;  4O3U B;  4IMM A;  3EI2 A;  4A11 A;  3DSM A;  3KRW B;  4L3H D;  2CNX A;  1B9X A;  2CN2 A;  2P9L C;  3UVK A;  4GMB A;  1GOT B;  4K3J B;  2QC5 A;  4ZOX A;  1OMW B;  3JRO A;  3SWS D;  1FWX A;  2GC7 A;  3IIY A;  5IC7 A;  3SBP A;  4A0A A;  1K8K C;  5FKS A;  4XEI C;  4ESG A;  5IJ7 E;  4XYI A;  2GC4 A;  2IAA A;  3SVW D;  3SCY A;  2P9S C;  1MDA H;  3MZK A;  3OKY A;  4CI2 A;  3I7H A;  2H6N A;  5K19 A;  4X61 B;  5HE2 B;  1JMZ B;  3GRE A;  3PE7 A;  2Z2P A;  5AFU 3;  1QNI A;  3KRX B;  3EI4 A;  4FAN D;  3OL2 B;  3ORV D;  1N6D A;  3V7D B;  3UKR C;  2BBK H;  3B7F A;  2H6Q A;  4NSX A;  4GZ8 A;  4CI3 A;  4JSV C;  4CI8 A;  2BCJ B;  4CZY A;  3JAM g;  5FQD A;  5EMM B;  4QL1 A;  3FGB A;  3L4M D;  3MKQ A;  3JRP A;  3AH8 B;  2PM9 B;  3ZWL B;  3MMY A;  3OL2 A;  3JZH A;  4E5Z A;  4AEZ A;  3MZL A;  1SHY B;  2AQ5 A;  1PI6 A;  3BWS A;  5CXC B;  2P9K C;  3IJ1 A;  3RSE C;  4J8B A;  2P9N C;  3V5W B;  1JOF A;  3F3F A;  1GXR A;  4CZX A;  2AGL A;  4ZN4 A;  4PXW A;  4BUJ C;  1NR0 A;  2CO0 A;  5H1M A;  4X3E A;  4A08 B;  3C5M A;  3I7P A;  3OKT A;  4J78 A;  5HE3 B;  2CE9 A;  3OKW A;  2IUQ A;  2OIZ A;  5GSA A;  3EWE A;  4FWW A;  3EI1 B;  2P9P C;  5TEE A;  4GM9 A;  2OVP B;  4HDJ A;  3EU7 A;  4A08 A;  1MG2 A;  4GQ1 A;  1L0Q A;  4CY2 A;  3JZG A;  5GXH A;  3EI1 A;  5C2W B;  5EML B;  3NVX A;  4J8G A;  4A09 B;  4U1E I;  2AGX A;  2TRC B;  3UR4 A;  4O1Q D;  4GGA A;  5CXB B;  3SLE D;  4H5J A;  5IGO A;  5I5M A;  2IWK A;  3N0D A;  2AH1 A;  4FA1 D;  2J56 H;  3AL8 A;  4ZOZ A;  1PGU A;  5FKT A;  3UVO A;  2J57 G;  3C99 A;  5H14 A;  3NVN A;  3JPX A;  1YFQ A;  4CC9 A;  2HJB A;  4A2L A;  4FA9 D;  3HFQ A;  3VA6 A;  5CXB A;  2XU7 A;  2HYE A;  3V9F A;  3OTT A;  2UZX B;  1U4C A;  4A0B B;  4QRJ A;  4UI9 R;  4LG9 A;  1MG3 A;  2EBS A;  4JD2 C;  4FA4 D;  5SXM A;  4JSP C;  4JSN C;  4MK0 B;  4PBZ A;  4CZV A;  2YNP A;  3L4O D;  3SBR A;  5K1C C;  1XKS A;  1XHM A;  3W15 A;  2P9U C;  4J77 A;  2H14 A;  3VGZ A;  3SMR A;  4A0B A;  1S4U X;  4FHL A;  5FA5 B;  3I8E A;  2H13 A;  4G56 B;  5H17 A;  2YBA A;  4J84 A;  2PM7 B;  2PBI B;  1K32 A;  1GG2 B;  1N6F A;  5EM2 B;  2AGZ A;  4GM8 A;  4ERZ A;  2OK4 A;  2B4E A;  4J82 A;  3E0C A;  3PVW B;  3U4Y A;  5IJ8 E;  4FB1 D;  3PXT D;  4CI1 A;  2CE8 A;  5IT9 g;  5EAP A;  2I0R A;  3FRX A;  2YNO A;  4Y7R A;  2Z2N A;  3PSC B;  3I8C A;  3ULE C;  4PSX B;  1OLZ A;  2CO0 C;  2OK6 A;  2PM9 A;  3CFS B;  5A2Q g;  3C75 H;  3F3P A;  5FKR A;  2O9K A;  1B9Y A;  4ERY A;  3I7O A;  2G9A A;  4GQB B;  5EMK B;  3RFG A; 
#chains in the Genus database with same CATH topology
 5C86 A;  3CIK B;  5GXI A;  3UKU C;  4J0X A;  3A0F A;  3IUQ A;  4R7A B;  5CXC A;  4ZOY A;  3JB9 L;  4LG8 A;  3PVU B;  3IJC A;  5THA A;  4CY1 A;  5FKQ A;  5CYK B;  4BH6 A;  4TZ4 A;  3BG0 A;  4G1M A;  3J80 g;  2PM6 B;  4DNV A;  5HYN B;  5M5U A;  4L9O A;  2P9I C;  4IRZ A;  2EIE A;  2Z2O A;  2H6K A;  3NIF A;  4Y5R D;  4O3T B;  3QI0 A;  1H2Z A;  4LGN A;  2OVR B;  2YB8 B;  5CYK A;  2I3S A;  4K3I D;  1RI6 A;  4J79 A;  4JXM A;  1L5G A;  1SQJ A;  3AL9 A;  5I5J A;  4BL0 A;  1E5T A;  2HES X;  2I3T A;  2HJ4 A;  2OVQ B;  4QQE A;  3JZN A;  1VYH C;  3ZDZ A;  4O45 A;  3ODT A;  5C2V B;  3K26 A;  1R5M A;  1JV2 A;  3ZDY A;  4A7J A;  4CY3 A;  5B4W A;  2VDR A;  2XYI A;  2W18 A;  4J0W A;  4N14 A;  5HE0 B;  4A09 A;  2B5N A;  4Z8L A;  4L1M A;  4WK2 A;  4JSX C;  2I0S A;  5JWZ A;  4NAA A;  4J87 A;  1VE6 A;  3SXT D;  4Z7Q A;  3RN0 D;  2H9P A;  3DM0 A;  1JJU B;  1H2W A;  1XIP A;  1GP2 B;  2XE4 A;  5FFG A;  3SJL D;  4D9S A;  3OF7 A;  4DNU A;  4Z7O A;  4NC4 A;  2XZG A;  3MUN A;  5HQG A;  3I7N A;  3C9C A;  4RE6 A;  4A0A B;  4OWR A;  2IWF A;  5FLX g;  4AOW A;  4JT6 C;  3K27 A;  1ERJ A;  1PBY B;  5IGQ A;  2IUP A;  2AH0 A;  3I89 A;  3IUL A;  2CN3 A;  2H47 A;  2H68 A;  1H2X A;  4H5I A;  2BKL A;  4PC0 A;  2I0T A;  4PNK B;  1TBG A;  3IJ0 A;  1VZ3 A;  4E54 B;  1U8C A;  4GQ2 P;  3OKY B;  4L3G D;  1NEX B;  3SFZ A;  4DNW A;  3CFV A;  3UVL A;  3RMZ D;  4ES0 A;  1TYQ C;  2YMU A;  3O4J A;  2J55 H;  4PBY A;  2H3X A;  4YVD A;  4E54 A;  5E6U A;  4D6V A;  3EI4 B;  1UOQ A;  3EQ9 A;  2B5M A;  4QT8 A;  3I7L A;  2XDW A;  5GMK n;  5AJA A;  1O6F A;  1U2V C;  5EMJ B;  5C92 A;  5EM2 A;  4X60 B;  2HXC A;  3IUJ A;  2H9M A;  1E8N A;  2VC2 A;  4GGD A;  1E8M A;  4QAM A;  4Z7N A;  4O9D A;  3NVQ A;  2VZ3 A;  2IUR A;  3PXW D;  2Q7Q A;  1UOO A;  4E5Z B;  5EAR A;  3EI3 B;  4D0K A;  4EWR A;  3V4P A;  3MUO A;  4UM9 A;  3IVM A;  1UTC A;  1PEV A;  2HKM A;  5E6R A;  4L1Q D;  3PXS D;  3N0E A;  3IUR A;  4BCD A;  3DDU A;  3RN1 D;  3SN6 B;  4FA5 D;  3EI3 A;  5TEF A;  4BCB A;  5FFO A;  4U7A A;  2WQ8 A;  3OW8 A;  5EAM A;  2MTA H;  4AX4 A;  4ZOV A;  4ERQ A;  4GGC A;  3IUN A;  3DWL C;  2YNN A;  1A0R B;  2QXV A;  3I7K A;  2H9L A;  3EG6 A;  2GNQ A;  3T3P A;  3IKO A;  3GD1 I;  4NBM A;  2OJY A;  4XYH A;  3GFC A;  5AMS A;  4KFM B;  4PSW B;  4A2M A;  5M5V A;  2UZY B;  3NIG A;  4J81 A;  3MKS B;  4I79 A;  3EMH A;  2AGY A;  3AFC A;  3RLM D;  4MMY A;  3BG1 A;  5C9Z B;  3VH0 A;  3RFH A;  5TDH B;  5EAL A;  1JTD B;  1K3I A;  4G1E A;  4JHP C;  3SBQ A;  3P4F A;  3FM0 A;  3RRM C;  4FAV D;  4IA9 A;  3I2N A;  2AGW A;  3IIW A;  1Q47 A;  4X63 B;  5TF2 A;  5E6S A;  5HE1 B;  2VDL A;  4GM3 A;  4J86 A;  5HDB A;  1M1X A;  5KDO B;  1N6E A;  4CY5 A;  3J81 g;  2G99 A;  1SQ9 A;  3DXK C;  3PSL A;  3SHF A;  3DXM C;  5FXY A;  3AL8 B;  3MVD K;  3EI2 B;  4A11 B;  2XL3 A;  2B5L A;  2HKR A;  1P22 A;  4J73 A;  4G55 A;  1QFM A;  3MXX A;  2H9N A;  2XL2 A;  3UVN A;  4OZU A;  4JT5 C;  3UVM A;  5I5I A;  2VDK A;  3F3G A;  2IUV A;  1JMX B;  4O3U B;  4IMM A;  3EI2 A;  4A11 A;  3DSM A;  3KRW B;  4L3H D;  2CNX A;  1B9X A;  4NEN A;  2CN2 A;  5M61 A;  2P9L C;  3UVK A;  1GOT B;  4GMB A;  4K3J B;  2QC5 A;  3ZE1 A;  4ZOX A;  4AMZ A;  1OMW B;  3JRO A;  3SWS D;  1FWX A;  2GC7 A;  3IIY A;  5IC7 A;  3SBP A;  4O02 A;  4A0A A;  3IJE A;  1K8K C;  1O6G A;  2EIC A;  5FKS A;  2EIB A;  4XEI C;  4ESG A;  5IJ7 E;  4XYI A;  2GC4 A;  2IAA A;  3SVW D;  3SCY A;  1UOP A;  2P9S C;  1MDA H;  3MZK A;  1BPO A;  4AN0 A;  3OKY A;  4CI2 A;  3I7H A;  2H6N A;  5K19 A;  4X61 B;  5HE2 B;  4BCC A;  3K72 A;  1JMZ B;  4AMY A;  1YR2 A;  2VDO A;  3GRE A;  3PE7 A;  2Z2P A;  4WK4 A;  3O4I A;  5AFU 3;  1QNI A;  3KRX B;  3EI4 A;  4FAN D;  3OL2 B;  3V4V A;  3ORV D;  1N6D A;  3V7D B;  3UKR C;  2BBK H;  3B7F A;  2H6Q A;  4NSX A;  4GZ8 A;  1VZ2 A;  4CI3 A;  4JSV C;  4CI8 A;  1GOH A;  2BCJ B;  4CZY A;  3JAM g;  5FQD A;  5EMM B;  4QL1 A;  3FGB A;  3L4M D;  3MKQ A;  3JRP A;  3AH8 B;  2PM9 B;  3ZWL B;  3K6S A;  3MMY A;  4WJK A;  3OL2 A;  3JZH A;  4E5Z A;  4AEZ A;  3VI4 A;  1GOF A;  1SHY B;  3MZL A;  3K71 A;  3EQ7 A;  2AQ5 A;  1PI6 A;  3BWS A;  3ZE2 A;  2VDQ A;  5CXC B;  2P9K C;  3GC3 B;  3IJ1 A;  3RSE C;  4J8B A;  2P9N C;  3V5W B;  1I2M B;  1JOF A;  3F3F A;  1GXR A;  4CZX A;  2AGL A;  4ZN4 A;  4PXW A;  4BUJ C;  1NR0 A;  2CO0 A;  5H1M A;  2HU7 A;  4X3E A;  1C9I A;  3ZDX A;  4A08 B;  3C5M A;  3I7P A;  3OKT A;  4J78 A;  5HE3 B;  2CE9 A;  3OKW A;  4MMX A;  3VI3 A;  2IUQ A;  3FCU A;  2OIZ A;  5GSA A;  3EWE A;  4FWW A;  3EI1 B;  2P9P C;  5TEE A;  1T2X A;  2OVP B;  4GM9 A;  4HDJ A;  3EU7 A;  2VDM A;  4UM8 A;  1H2Y A;  4A08 A;  4MMZ A;  1MG2 A;  4GQ1 A;  1L0Q A;  4CY2 A;  3JZG A;  1C9L A;  5GXH A;  3EI1 A;  5C2W B;  2HU8 A;  5EML B;  3NVX A;  5M5R A;  4J8G A;  3NID A;  5M5T A;  4A09 B;  4U1E I;  2AGX A;  2TRC B;  3UR4 A;  4O1Q D;  4GGA A;  2VZ1 A;  3T3M A;  2JKX A;  5CXB B;  3SLE D;  1VE7 A;  4H5J A;  5IGO A;  5I5M A;  2VDN A;  2IWK A;  2VDP A;  3N0D A;  2AH1 A;  4FA1 D;  2J56 H;  3AL8 A;  3KCI A;  4ZOZ A;  1PGU A;  5FKT A;  3UVO A;  2J57 G;  3C99 A;  5H14 A;  3O4G A;  3NVN A;  3JPX A;  1YFQ A;  4CC9 A;  2HJB A;  4A2L A;  4FA9 D;  3HFQ A;  3VA6 A;  5CXB A;  3ZE0 A;  2XU7 A;  2HYE A;  3V9F A;  3OTT A;  3QHY B;  2UZX B;  4RE5 A;  1U4C A;  4A0B B;  4QRJ A;  4UI9 R;  4LG9 A;  1MG3 A;  2EBS A;  4JD2 C;  4FA4 D;  5SXM A;  4JSP C;  4JSN C;  4MK0 B;  4BP8 A;  4PBZ A;  4CZV A;  2YNP A;  3L4O D;  3SBR A;  5K1C C;  1XKS A;  2QR5 A;  2QZP A;  1XHM A;  4WK0 A;  3W15 A;  2P9U C;  4J77 A;  2H14 A;  3VGZ A;  3SMR A;  4A0B A;  1S4U X;  4FHL A;  4JHN A;  5M5S A;  5FA5 B;  3I8E A;  3O4H A;  2H13 A;  4G56 B;  5H17 A;  2YBA A;  4J84 A;  1GOG A;  2PM7 B;  2PBI B;  3FCS A;  1TYE A;  1GG2 B;  1K32 A;  1N6F A;  5EM2 B;  2AGZ A;  4GM8 A;  4AN1 A;  3EQ8 A;  4BP9 A;  4ERZ A;  2OK4 A;  2B4E A;  4J82 A;  2HU5 A;  3E0C A;  3PVW B;  1QFS A;  3U4Y A;  5IJ8 E;  4FB1 D;  3PXT D;  4CI1 A;  2EID A;  2CE8 A;  5IT9 g;  5EAP A;  2I0R A;  3FRX A;  2YNO A;  4Y7R A;  2Z2N A;  3PSC B;  4O2W A;  3I8C A;  3ULE C;  1A12 A;  4PSX B;  1OLZ A;  2CO0 C;  2OK6 A;  2PM9 A;  3CFS B;  5A2Q g;  3C75 H;  3F3P A;  5FKR A;  2O9K A;  3IUM A;  1B9Y A;  4ERY A;  3I7O A;  2G9A A;  4GQB B;  5EMK B;  3RFG A; 
#chains in the Genus database with same CATH homology
 3CIK B;  5GXI A;  3UKU C;  4J0X A;  3A0F A;  4R7A B;  5CXC A;  4ZOY A;  3JB9 L;  4LG8 A;  3PVU B;  3IJC A;  5THA A;  4CY1 A;  5FKQ A;  5CYK B;  4BH6 A;  4TZ4 A;  3BG0 A;  3J80 g;  2PM6 B;  5HYN B;  4L9O A;  2P9I C;  2Z2O A;  2H6K A;  4Y5R D;  4O3T B;  4LGN A;  2OVR B;  2YB8 B;  5CYK A;  2I3S A;  4K3I D;  1RI6 A;  4J79 A;  4JXM A;  1SQJ A;  3AL9 A;  5I5J A;  4BL0 A;  2HES X;  2I3T A;  2HJ4 A;  2OVQ B;  4QQE A;  3JZN A;  1VYH C;  4O45 A;  3ODT A;  5C2V B;  3K26 A;  1R5M A;  4A7J A;  4CY3 A;  5B4W A;  2XYI A;  2W18 A;  4J0W A;  4N14 A;  5HE0 B;  4A09 A;  2B5N A;  4Z8L A;  4JSX C;  2I0S A;  5JWZ A;  4J87 A;  3SXT D;  3RN0 D;  2H9P A;  3DM0 A;  1JJU B;  1XIP A;  1GP2 B;  3SJL D;  5HQG A;  3I7N A;  3C9C A;  4A0A B;  4OWR A;  2IWF A;  5FLX g;  4AOW A;  4JT6 C;  3K27 A;  1ERJ A;  1PBY B;  5IGQ A;  2IUP A;  2AH0 A;  3I89 A;  2CN3 A;  2H47 A;  2H68 A;  4H5I A;  4PC0 A;  2I0T A;  4PNK B;  1TBG A;  3IJ0 A;  4E54 B;  4GQ2 P;  3OKY B;  4L3G D;  1NEX B;  3SFZ A;  3CFV A;  3UVL A;  3RMZ D;  4ES0 A;  1TYQ C;  2YMU A;  2J55 H;  4PBY A;  2H3X A;  4YVD A;  4E54 A;  4D6V A;  3EI4 B;  2B5M A;  4QT8 A;  3I7L A;  5GMK n;  5AJA A;  1U2V C;  5EMJ B;  5EM2 A;  4X60 B;  2HXC A;  2H9M A;  4GGD A;  4O9D A;  3NVQ A;  2IUR A;  3PXW D;  2Q7Q A;  4E5Z B;  5EAR A;  3EI3 B;  4D0K A;  4EWR A;  1PEV A;  2HKM A;  4L1Q D;  3PXS D;  3N0E A;  3RN1 D;  3SN6 B;  4FA5 D;  3EI3 A;  5TEF A;  4U7A A;  3OW8 A;  5EAM A;  2MTA H;  4ZOV A;  4ERQ A;  4GGC A;  3DWL C;  2YNN A;  1A0R B;  2QXV A;  3I7K A;  2H9L A;  3EG6 A;  2GNQ A;  3IKO A;  4XYH A;  2OJY A;  3GFC A;  5AMS A;  4KFM B;  4PSW B;  4A2M A;  2UZY B;  4J81 A;  3MKS B;  4I79 A;  3EMH A;  2AGY A;  3AFC A;  3RLM D;  3BG1 A;  5C9Z B;  3VH0 A;  3RFH A;  5TDH B;  5EAL A;  3SBQ A;  3P4F A;  3FM0 A;  3RRM C;  4FAV D;  4IA9 A;  3I2N A;  2AGW A;  3IIW A;  1Q47 A;  4X63 B;  5TF2 A;  5HE1 B;  4GM3 A;  4J86 A;  5KDO B;  1N6E A;  4CY5 A;  3J81 g;  2G99 A;  1SQ9 A;  3DXK C;  3PSL A;  3SHF A;  3DXM C;  5FXY A;  3AL8 B;  3EI2 B;  4A11 B;  2XL3 A;  2B5L A;  2HKR A;  1P22 A;  4J73 A;  3MXX A;  2H9N A;  2XL2 A;  3UVN A;  4OZU A;  4JT5 C;  3UVM A;  5I5I A;  3F3G A;  2IUV A;  1JMX B;  4O3U B;  4IMM A;  3EI2 A;  4A11 A;  3DSM A;  3KRW B;  4L3H D;  2CNX A;  1B9X A;  2CN2 A;  2P9L C;  3UVK A;  4GMB A;  1GOT B;  4K3J B;  2QC5 A;  4ZOX A;  1OMW B;  3JRO A;  3SWS D;  1FWX A;  2GC7 A;  3IIY A;  5IC7 A;  3SBP A;  4A0A A;  1K8K C;  5FKS A;  4XEI C;  4ESG A;  5IJ7 E;  4XYI A;  2GC4 A;  2IAA A;  3SVW D;  3SCY A;  2P9S C;  1MDA H;  3MZK A;  3OKY A;  4CI2 A;  3I7H A;  2H6N A;  5K19 A;  4X61 B;  5HE2 B;  1JMZ B;  3GRE A;  3PE7 A;  2Z2P A;  5AFU 3;  1QNI A;  3KRX B;  3EI4 A;  4FAN D;  3OL2 B;  3ORV D;  1N6D A;  3V7D B;  3UKR C;  2BBK H;  3B7F A;  2H6Q A;  4NSX A;  4GZ8 A;  4CI3 A;  4JSV C;  4CI8 A;  2BCJ B;  4CZY A;  3JAM g;  5FQD A;  5EMM B;  4QL1 A;  3FGB A;  3L4M D;  3MKQ A;  3JRP A;  3AH8 B;  2PM9 B;  3ZWL B;  3MMY A;  3OL2 A;  3JZH A;  4E5Z A;  4AEZ A;  3MZL A;  1SHY B;  2AQ5 A;  1PI6 A;  3BWS A;  5CXC B;  2P9K C;  3IJ1 A;  3RSE C;  4J8B A;  2P9N C;  3V5W B;  1JOF A;  3F3F A;  1GXR A;  4CZX A;  2AGL A;  4ZN4 A;  4PXW A;  4BUJ C;  1NR0 A;  2CO0 A;  5H1M A;  4X3E A;  4A08 B;  3C5M A;  3I7P A;  3OKT A;  4J78 A;  5HE3 B;  2CE9 A;  3OKW A;  2IUQ A;  2OIZ A;  5GSA A;  3EWE A;  4FWW A;  3EI1 B;  2P9P C;  5TEE A;  4GM9 A;  2OVP B;  4HDJ A;  3EU7 A;  4A08 A;  1MG2 A;  4GQ1 A;  1L0Q A;  4CY2 A;  3JZG A;  5GXH A;  3EI1 A;  5C2W B;  5EML B;  3NVX A;  4J8G A;  4A09 B;  4U1E I;  2AGX A;  2TRC B;  3UR4 A;  4O1Q D;  4GGA A;  5CXB B;  3SLE D;  4H5J A;  5IGO A;  5I5M A;  2IWK A;  3N0D A;  2AH1 A;  4FA1 D;  2J56 H;  3AL8 A;  4ZOZ A;  1PGU A;  5FKT A;  3UVO A;  2J57 G;  3C99 A;  5H14 A;  3NVN A;  3JPX A;  1YFQ A;  4CC9 A;  2HJB A;  4A2L A;  4FA9 D;  3HFQ A;  3VA6 A;  5CXB A;  2XU7 A;  2HYE A;  3V9F A;  3OTT A;  2UZX B;  1U4C A;  4A0B B;  4QRJ A;  4UI9 R;  4LG9 A;  1MG3 A;  2EBS A;  4JD2 C;  4FA4 D;  5SXM A;  4JSP C;  4JSN C;  4MK0 B;  4PBZ A;  4CZV A;  2YNP A;  3L4O D;  3SBR A;  5K1C C;  1XKS A;  1XHM A;  3W15 A;  2P9U C;  4J77 A;  2H14 A;  3VGZ A;  3SMR A;  4A0B A;  1S4U X;  4FHL A;  5FA5 B;  3I8E A;  2H13 A;  4G56 B;  5H17 A;  2YBA A;  4J84 A;  2PM7 B;  2PBI B;  1K32 A;  1GG2 B;  1N6F A;  5EM2 B;  2AGZ A;  4GM8 A;  4ERZ A;  2OK4 A;  2B4E A;  4J82 A;  3E0C A;  3PVW B;  3U4Y A;  5IJ8 E;  4FB1 D;  3PXT D;  4CI1 A;  2CE8 A;  5IT9 g;  5EAP A;  2I0R A;  3FRX A;  2YNO A;  4Y7R A;  2Z2N A;  3PSC B;  3I8C A;  3ULE C;  4PSX B;  1OLZ A;  2CO0 C;  2OK6 A;  2PM9 A;  3CFS B;  5A2Q g;  3C75 H;  3F3P A;  5FKR A;  2O9K A;  1B9Y A;  4ERY A;  3I7O A;  2G9A A;  4GQB B;  5EMK B;  3RFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...