3EG6A

Structure of wdr5 bound to mll1 peptide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of WDR5 bound to mixed lineage leukemia protein-1 peptide.
pubmed doi rcsb
molecule keywords WD repeat-containing protein 5
molecule tags Protein binding
source organism Homo sapiens
total genus 104
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3eg6A00
4CY5A 2I3SA 3VGZA 4XYHA 1XIPA 5EMJB 3V5WB 3BG1A 5AFU3 4A09A 2HYEA 5IGOA 2PM9B 3OKYB 4PBZA 3I7PA 2OK4A 5A2Qg 4X61B 1GOTB 4K3ID 4J81A 3JPXA 2XU7A 2I3TA 3PXSD 4G56B 4JSNC 3EI1B 2P9IC 1U4CA 3N0DA 2CNXA 3PVWB 2Z2NA 4QT8A 1S4UX 5K19A 2B5LA 3OW8A 4FWWA 3SN6B 4E54B 4PSWB 3IIWA 4KFMB 1SHYB 5IJ7E 1B9YA 5SXMA 4PNKB 4L3GD 4J78A 4J79A 3I7OA 4FAND 2B5MA 1ERJA 4AEZA 2H6NA 4PXWA 4X3EA 3I8CA 4QRJA 1XHMA 2B4EA 2GC4A 1MDAH 1XKSA 3PSLA 2CN2A 4ESGA 1NR0A 2UZXB 5EMLB 2H9MA 3UVNA 2XL2A 4A2LA 5CYKB 4O3TB 3AL8A 2CE9A 4ZOZA 2YBAA 1JMXB 1GG2B 4BUJC 3RSEC 3EI2B 4A0AA 3I7NA 1PEVA 2TRCB 3ORVD 3I7KA 4FB1D 3SBQA 5JWZA 5HE2B 3J81g 4J73A 2I0TA 4A08A 3NVNA 4GMBA 2HXCA 2XL3A 3SHFA 1NEXB 2AGLA 5GMKn 3SWSD 2HESX 4IA9A 4GZ8A 3DSMA 5HE3B 3OTTA 3OKWA 2PBIB 5TDHB 2W18A 3SFZA 4EWRA 3GREA 5GSAA 2H14A 2BBKH 2OK6A 3KRXB 2OVQB 5CXCA 5HYNB 3PSCB 4JT5C 2HJBA 1JMZB 4X60B 3I89A 1GXRA 4PBYA 3JZHA 2UZYB 3EMHA 3UKRC 1FWXA 2IUQA 3F3PA 3U4YA 1VYHC 3RN1D 3RN0D 2YMUA 4JSXC 3I2NA 4J77A 5C2VB 5H1MA 4MK0B 4GQ2P 4NSXA 3L4MD 2AH1A 1U2VC 4J86A 4UI9R 3KRWB 2PM9A 3OKYA 3C99A 2O9KA 4FA5D 2HKRA 3AH8B 5FKRA 4XYIA 4L9OA 4PC0A 5HE0B 4Z8LA 4H5JA 2IUPA 2QXVA 2OVRB 5TEFA 3EWEA 3P4FA 2YB8B 3ZWLB 3EI1A 4J8GA 2P9LC 1TBGA 4BL0A 3CFVA 4J84A 3ODTA 1OLZA 4U7AA 1JOFA 2QC5A 1TYQC 2H9PA 4OZUA 4ZOYA 4A0BB 3CFSB 1MG2A 2CO0A 5EMMB 2CN3A 4GM9A 4FA9D 2EBSA 4A11B 4XEIC 3I7LA 4ZOVA 3A0FA 3AFCA 2G99A 1A0RB 1QNIA 4J8BA 2I0RA 3HFQA 4CY2A 4CI2A 3BWSA 3OL2B 4A2MA 1OMWB 1PI6A 2H9LA 3MKSB 2IAAA 3IKOA 3IJCA 4E5ZB 2HKMA 5K1CC 3UVOA 3JRPA 5CYKA 2AGYA 3OKTA 3FGBA 4LG8A 1N6EA 4TZ4A 4L1QD 3EI2A 1YFQA 4GQBB 4R7AB 3DXKC 2OIZA 5IC7A 5I5IA 4CI8A 3EI4B 5B4WA 5HQGA 4ES0A 2OJYA 4CI3A 3RFGA 2AGXA 2H6QA 3SCYA 4JXMA 3RMZD 3PE7A 2H13A 2XYIA 3EU7A 4K3JB 3DXMC 4LGNA 4A7JA 3E0CA 1L0QA 3FM0A 5C2WB 5IGQA 2AH0A 4J0WA 1MG3A 5EMKB 4HDJA 5EM2B 4J0XA 3PXTD 4O3UB 3IJ1A 3EI3B 3B7FA 4L3HD 4FAVD 5FA5B 3JB9L 3SBPA 3GFCA 2I0SA 2PM7B 3RFHA 3MZLA 1PGUA 4ZOXA 3CIKB 5CXBA 3MMYA 3V7DB 3NVQA 3SJLD 5CXCB 1Q47A 4Y5RD 4GM3A 4QQEA 5FKTA 2Z2PA 4LG9A 4ERQA 3DM0A 3K26A 5TEEA 2GC7A 1K8KC 4AOWA 4CZVA 4ZN4A 1GP2B 1SQ9A 4FHLA 2AGZA 4JT6C 5AJAA 4JSVC 3SLED 3PVUB 5FKSA 4I79A 4J82A 3F3FA 3IJ0A 4GGAA 3IIYA 5EAMA 4A09B 5GXIA 5FKQA 2Q7QA 3JZNA 2IWKA 2B5NA 3SVWD 3UR4A 3EG6A 2P9UC 2H9NA 2HJ4A 4D6VA 3L4OD 1K32A 4E54A 2YNPA 3F3GA 4GM8A 3W15A 2BCJB 3JROA 4FA4D 4A0BA 4J87A 5FQDA 2IWFA 4JSPC 2H3XA 3MKQA 2J57G 1B9XA 4CY1A 4A11A 1RI6A 2CE8A 5IT9g 3N0EA 3ULEC 2P9PC 3SXTD 5I5MA 4GGCA 3K27A 3SMRA 4N14A 5GXHA 3DWLC 4BH6A 1R5MA 3OL2A 2H68A 2AGWA 1N6DA 3V9FA 3J80g 4E5ZA 3UKUC 4Y7RA 3MXXA 2Z2OA 3JAMg 4X63B 2P9KC 2PM6B 3C9CA 4IMMA 3VA6A 4CI1A 1JJUB 5EALA 4CZYA 3EI4A 5EARA 3AL8B 2YNOA 4U1EI 3AL9A 3JZGA 5KDOB 2GNQA 3UVKA 4CC9A 4A0AB 4CY3A 2YNNA 4H5IA 3SBRA 1N6FA 4O45A 4D0KA 4QL1A 3UVMA 3I7HA 2MTAH 3BG0A 4GGDA 3I8EA 4PSXB 5H17A 2OVPB 3PXWD 5I5JA 4A08B 5TF2A 5EAPA 2IUVA 5EM2A 4JD2C 2AQ5A 5THAA 3FRXA 2H47A 2H6KA 3EI3A 2CO0C 5IJ8E 2P9SC 5FXYA 3C5MA 5H14A 1PBYB 3MZKA 4ERZA 2G9AA 4GQ1A 3RRMC 4O9DA 2IURA 3UVLA 4ERYA 1P22A 5FLXg 5AMSA 4FA1D 3RLMD 2J56H 3VH0A 5C9ZB 1SQJA 4OWRA 3NVXA 5HE1B 4O1QD 4CZXA 4YVDA 2P9NC 2J55H 3C75H 5CXBB
chains in the Genus database with same CATH superfamily
4CY5A 2I3SA 3VGZA 4XYHA 1XIPA 3FCSA 5EMJB 3V5WB 3BG1A 3IVMA 5AFU3 4A09A 1C9LA 2HYEA 4MMXA 2QZPA 5IGOA 4AN1A 4JHNA 1UOQA 4Z7NA 2PM9B 3OKYB 4PBZA 3I7PA 2OK4A 3VI3A 5A2Qg 4X61B 2VC2A 1GOTB 2VDLA 4K3ID 4J81A 3JPXA 2XU7A 2I3TA 3PXSD 4G56B 3GD1I 4JSNC 3EI1B 2P9IC 2BKLA 1U4CA 3N0DA 2CNXA 3PVWB 2Z2NA 4QT8A 1S4UX 3MVDK 5K19A 3IUJA 2B5LA 2VDRA 3OW8A 4FWWA 3SN6B 4E54B 4PSWB 3IIWA 4KFMB 1SHYB 5IJ7E 1B9YA 5SXMA 3MUOA 4PNKB 3K72A 4L3GD 3ZE0A 4J78A 2VDPA 4J79A 4Z7QA 3I7OA 1H2YA 2B5MA 1H2WA 4FAND 1ERJA 1VZ2A 1H2XA 4AEZA 2H6NA 4PXWA 4X3EA 3I8CA 4QRJA 1XHMA 2B4EA 2GC4A 1MDAH 1XKSA 3PSLA 2CN2A 4ESGA 3QHYB 1NR0A 3EQ9A 2UZXB 5EMLB 2H9MA 4UM9A 4NENA 3UVNA 2XL2A 4A2LA 5CYKB 4O3TB 3AL8A 2CE9A 4ZOZA 4MMZA 2YBAA 2VZ1A 1JMXB 1GG2B 3KCIA 4BUJC 3RSEC 3EI2B 4A0AA 1YR2A 3I7NA 4BCCA 1PEVA 2TRCB 3ORVD 4BP9A 3I7KA 3O4GA 4BCDA 4FB1D 3T3PA 3SBQA 5JWZA 1C9IA 5HE2B 3J81g 4J73A 1GOGA 2I0TA 4A08A 3ZDZA 3IJEA 3NVNA 4GMBA 2HXCA 2XL3A 3SHFA 1NEXB 2AGLA 5E6UA 5GMKn 3SWSD 2HESX 4IA9A 4GZ8A 3DSMA 5HE3B 3OTTA 3OKWA 2PBIB 5TDHB 4RE6A 2W18A 3SFZA 4EWRA 3GREA 5GSAA 2H14A 3ZE2A 2BBKH 2OK6A 2EIEA 3KRXB 3MUNA 2OVQB 5CXCA 5HYNB 3PSCB 3O4IA 4JT5C 2HJBA 1JMZB 4X60B 3I89A 1GXRA 4PBYA 1O6FA 1O6GA 3JZHA 5FFGA 2UZYB 3EMHA 3UKRC 1FWXA 2IUQA 3F3PA 4BP8A 3U4YA 4G1EA 4QAMA 1VYHC 3RN1D 3RN0D 4DNUA 2YMUA 4DNVA 5M5UA 4JSXC 3I2NA 4J77A 5C2VB 5H1MA 4MK0B 4GQ2P 4NSXA 3L4MD 2AH1A 1U2VC 4J86A 4UI9R 3KRWB 1I2MB 2PM9A 3OKYA 3C99A 2O9KA 4FA5D 2HKRA 3AH8B 5FKRA 4WK0A 4XYIA 4L9OA 4PC0A 5HE0B 4Z8LA 4H5JA 2IUPA 2QXVA 2OVRB 5TEFA 4NC4A 3EWEA 3P4FA 2YB8B 1E8NA 3ZWLB 4J8GA 2P9LC 3EI1A 1TBGA 4BL0A 3CFVA 4J84A 3ODTA 4AX4A 3K6SA 1OLZA 4U7AA 5E6RA 1JOFA 2QC5A 1TYQC 2H9PA 1A12A 4OZUA 4ZOYA 4IRZA 1UOOA 2QR5A 4A0BB 3CFSB 3IURA 4AMYA 1MG2A 2CO0A 5EMMB 2CN3A 1VE7A 2HU8A 4GM9A 4FA9D 5C92A 2EBSA 4A11B 4XEIC 3I7LA 4ZOVA 3A0FA 2JKXA 2G99A 1A0RB 3AFCA 1QNIA 4NBMA 3EQ7A 4J8BA 2I0RA 3HFQA 4CY2A 3IUQA 5M5VA 4CI2A 4WJKA 3BWSA 3OL2B 5M5SA 4A2MA 1OMWB 1PI6A 3NIFA 2VDOA 3NIGA 2H9LA 3MKSB 3NIDA 2IAAA 3IKOA 2XE4A 3IJCA 2HKMA 5K1CC 4Z7OA 4E5ZB 3UVOA 2HU5A 4MMYA 2VDMA 3JRPA 5CYKA 2AGYA 2XZGA 2WQ8A 3OKTA 3FGBA 4LG8A 3EQ8A 1N6EA 4TZ4A 4L1QD 5M5RA 2EIBA 3EI2A 1YFQA 4GQBB 4R7AB 1K3IA 3DXKC 3QI0A 2OIZA 4RE5A 5IC7A 5I5IA 1QFMA 1L5GA 4CI8A 4BCBA 4WK4A 3EI4B 5B4WA 2EIDA 5HQGA 4ES0A 2OJYA 4CI3A 3RFGA 2AGXA 2H6QA 3SCYA 4JXMA 3RMZD 3PE7A 2H13A 2XYIA 3EU7A 4K3JB 2HU7A 3DXMC 4LGNA 4A7JA 3E0CA 1L0QA 3FM0A 2VDQA 5C2WB 5IGQA 2AH0A 4J0WA 1MG3A 1TYEA 5EMKB 4HDJA 5EM2B 4J0XA 3PXTD 4O3UB 3IJ1A 3EI3B 3B7FA 4L3HD 1VE6A 4FAVD 5FA5B 3K71A 3JB9L 3SBPA 3GFCA 2I0SA 2PM7B 3RFHA 3MZLA 1PGUA 4NAAA 3ZE1A 4ZOXA 1U8CA 3CIKB 5CXBA 3MMYA 3V7DB 3NVQA 3SJLD 5CXCB 1GOFA 1Q47A 3V4VA 4Y5RD 4GM3A 4QQEA 3DDUA 5FKTA 3GC3B 3ZDXA 2Z2PA 4LG9A 4ERQA 3DM0A 3K26A 5TEEA 2GC7A 1K8KC 4AOWA 4CZVA 4ZN4A 5M5TA 1GP2B 1SQ9A 4FHLA 2AGZA 4JT6C 5AJAA 3O4JA 4JSVC 3SLED 3PVUB 1QFSA 5FKSA 4I79A 1UTCA 3IUMA 4J82A 1JV2A 3F3FA 3IJ0A 4GGAA 3IIYA 5EAMA 4A09B 5GXIA 5FKQA 2Q7QA 3JZNA 2IWKA 2B5NA 3SVWD 5M61A 3EG6A 3UR4A 2P9UC 2H9NA 2HJ4A 3ZDYA 4D6VA 3L4OD 1K32A 4O2WA 4E54A 2YNPA 3F3GA 4GM8A 3W15A 2BCJB 3JROA 4L1MA 4FA4D 4A0BA 4J87A 5FQDA 2IWFA 4JSPC 2H3XA 3MKQA 2J57G 1B9XA 4CY1A 4A11A 1RI6A 2CE8A 5IT9g 3N0EA 3ULEC 2P9PC 3SXTD 1VZ3A 5I5MA 4GGCA 3K27A 3SMRA 4N14A 5GXHA 3DWLC 4BH6A 1R5MA 5E6SA 3OL2A 2H68A 2AGWA 1N6DA 1T2XA 3V9FA 1BPOA 3J80g 4E5ZA 4DNWA 5FFOA 3UKUC 4Y7RA 3MXXA 2Z2OA 3JAMg 2VDKA 4X63B 2P9KC 4WK2A 2PM6B 3OF7A 4O02A 3C9CA 3IULA 2VDNA 4IMMA 3T3MA 3VA6A 4CI1A 1JJUB 5EALA 4CZYA 3EI4A 5EARA 3AL8B 4G55A 2YNOA 4U1EI 1GOHA 3AL9A 3JZGA 5KDOB 1UOPA 2GNQA 3UVKA 4CC9A 1JTDB 4A0AB 1E5TA 2YNNA 4CY3A 3IUNA 4H5IA 3SBRA 1N6FA 4O45A 4D0KA 4QL1A 3UVMA 3I7HA 2MTAH 4G1MA 3BG0A 4GGDA 3I8EA 4PSXB 5H17A 2OVPB 3PXWD 5I5JA 4A08B 5TF2A 5EAPA 2IUVA 4AN0A 5EM2A 4JD2C 2AQ5A 5THAA 5C86A 3FRXA 5HDBA 2H47A 2H6KA 3EI3A 3VI4A 1E8MA 5CXBB 2XDWA 3V4PA 2CO0C 5IJ8E 2P9SC 5FXYA 3C5MA 4JHPC 5H14A 1PBYB 3MZKA 4ERZA 2G9AA 4GQ1A 3RRMC 4O9DA 2IURA 3UVLA 3FCUA 4ERYA 2EICA 1P22A 5FLXg 5AMSA 4FA1D 3RLMD 2J56H 3VH0A 1H2ZA 5C9ZB 1SQJA 4OWRA 4D9SA 3NVXA 5HE1B 1M1XA 4O1QD 4CZXA 4UM8A 3O4HA 4YVDA 2P9NC 2J55H 3C75H 2VZ3A 4AMZA
chains in the Genus database with same CATH topology
4CY5A 2I3SA 3VGZA 4XYHA 1XIPA 5EMJB 3V5WB 3BG1A 5AFU3 4A09A 2HYEA 5IGOA 2PM9B 3OKYB 4PBZA 3I7PA 2OK4A 5A2Qg 4X61B 1GOTB 4K3ID 4J81A 3JPXA 2XU7A 2I3TA 3PXSD 4G56B 4JSNC 3EI1B 2P9IC 1U4CA 3N0DA 2CNXA 3PVWB 2Z2NA 4QT8A 1S4UX 5K19A 2B5LA 3OW8A 4FWWA 3SN6B 4E54B 4PSWB 3IIWA 4KFMB 1SHYB 5IJ7E 1B9YA 5SXMA 4PNKB 4L3GD 4J78A 4J79A 3I7OA 4FAND 2B5MA 1ERJA 4AEZA 2H6NA 4PXWA 4X3EA 3I8CA 4QRJA 1XHMA 2B4EA 2GC4A 1MDAH 1XKSA 3PSLA 2CN2A 4ESGA 1NR0A 2UZXB 5EMLB 2H9MA 3UVNA 2XL2A 4A2LA 5CYKB 4O3TB 3AL8A 2CE9A 4ZOZA 2YBAA 1JMXB 1GG2B 4BUJC 3RSEC 3EI2B 4A0AA 3I7NA 1PEVA 2TRCB 3ORVD 3I7KA 4FB1D 3SBQA 5JWZA 5HE2B 3J81g 4J73A 2I0TA 4A08A 3NVNA 4GMBA 2HXCA 2XL3A 3SHFA 1NEXB 2AGLA 5GMKn 3SWSD 2HESX 4IA9A 4GZ8A 3DSMA 5HE3B 3OTTA 3OKWA 2PBIB 5TDHB 2W18A 3SFZA 4EWRA 3GREA 5GSAA 2H14A 2BBKH 2OK6A 3KRXB 2OVQB 5CXCA 5HYNB 3PSCB 4JT5C 2HJBA 1JMZB 4X60B 3I89A 1GXRA 4PBYA 3JZHA 2UZYB 3EMHA 3UKRC 1FWXA 2IUQA 3F3PA 3U4YA 1VYHC 3RN1D 3RN0D 2YMUA 4JSXC 3I2NA 4J77A 5C2VB 5H1MA 4MK0B 4GQ2P 4NSXA 3L4MD 2AH1A 1U2VC 4J86A 4UI9R 3KRWB 2PM9A 3OKYA 3C99A 2O9KA 4FA5D 2HKRA 3AH8B 5FKRA 4XYIA 4L9OA 4PC0A 5HE0B 4Z8LA 4H5JA 2IUPA 2QXVA 2OVRB 5TEFA 3EWEA 3P4FA 2YB8B 3ZWLB 3EI1A 4J8GA 2P9LC 1TBGA 4BL0A 3CFVA 4J84A 3ODTA 1OLZA 4U7AA 1JOFA 2QC5A 1TYQC 2H9PA 4OZUA 4ZOYA 4A0BB 3CFSB 1MG2A 2CO0A 5EMMB 2CN3A 4GM9A 4FA9D 2EBSA 4A11B 4XEIC 3I7LA 4ZOVA 3A0FA 3AFCA 2G99A 1A0RB 1QNIA 4J8BA 2I0RA 3HFQA 4CY2A 4CI2A 3BWSA 3OL2B 4A2MA 1OMWB 1PI6A 2H9LA 3MKSB 2IAAA 3IKOA 3IJCA 4E5ZB 2HKMA 5K1CC 3UVOA 3JRPA 5CYKA 2AGYA 3OKTA 3FGBA 4LG8A 1N6EA 4TZ4A 4L1QD 3EI2A 1YFQA 4GQBB 4R7AB 3DXKC 2OIZA 5IC7A 5I5IA 4CI8A 3EI4B 5B4WA 5HQGA 4ES0A 2OJYA 4CI3A 3RFGA 2AGXA 2H6QA 3SCYA 4JXMA 3RMZD 3PE7A 2H13A 2XYIA 3EU7A 4K3JB 3DXMC 4LGNA 4A7JA 3E0CA 1L0QA 3FM0A 5C2WB 5IGQA 2AH0A 4J0WA 1MG3A 5EMKB 4HDJA 5EM2B 4J0XA 3PXTD 4O3UB 3IJ1A 3EI3B 3B7FA 4L3HD 4FAVD 5FA5B 3JB9L 3SBPA 3GFCA 2I0SA 2PM7B 3RFHA 3MZLA 1PGUA 4ZOXA 3CIKB 5CXBA 3MMYA 3V7DB 3NVQA 3SJLD 5CXCB 1Q47A 4Y5RD 4GM3A 4QQEA 5FKTA 2Z2PA 4LG9A 4ERQA 3DM0A 3K26A 5TEEA 2GC7A 1K8KC 4AOWA 4CZVA 4ZN4A 1GP2B 1SQ9A 4FHLA 2AGZA 4JT6C 5AJAA 4JSVC 3SLED 3PVUB 5FKSA 4I79A 4J82A 3F3FA 3IJ0A 4GGAA 3IIYA 5EAMA 4A09B 5GXIA 5FKQA 2Q7QA 3JZNA 2IWKA 2B5NA 3SVWD 3UR4A 3EG6A 2P9UC 2H9NA 2HJ4A 4D6VA 3L4OD 1K32A 4E54A 2YNPA 3F3GA 4GM8A 3W15A 2BCJB 3JROA 4FA4D 4A0BA 4J87A 5FQDA 2IWFA 4JSPC 2H3XA 3MKQA 2J57G 1B9XA 4CY1A 4A11A 1RI6A 2CE8A 5IT9g 3N0EA 3ULEC 2P9PC 3SXTD 5I5MA 4GGCA 3K27A 3SMRA 4N14A 5GXHA 3DWLC 4BH6A 1R5MA 3OL2A 2H68A 2AGWA 1N6DA 3V9FA 3J80g 4E5ZA 3UKUC 4Y7RA 3MXXA 2Z2OA 3JAMg 4X63B 2P9KC 2PM6B 3C9CA 4IMMA 3VA6A 4CI1A 1JJUB 5EALA 4CZYA 3EI4A 5EARA 3AL8B 2YNOA 4U1EI 3AL9A 3JZGA 5KDOB 2GNQA 3UVKA 4CC9A 4A0AB 4CY3A 2YNNA 4H5IA 3SBRA 1N6FA 4O45A 4D0KA 4QL1A 3UVMA 3I7HA 2MTAH 3BG0A 4GGDA 3I8EA 4PSXB 5H17A 2OVPB 3PXWD 5I5JA 4A08B 5TF2A 5EAPA 2IUVA 5EM2A 4JD2C 2AQ5A 5THAA 3FRXA 2H47A 2H6KA 3EI3A 2CO0C 5IJ8E 2P9SC 5FXYA 3C5MA 5H14A 1PBYB 3MZKA 4ERZA 2G9AA 4GQ1A 3RRMC 4O9DA 2IURA 3UVLA 4ERYA 1P22A 5FLXg 5AMSA 4FA1D 3RLMD 2J56H 3VH0A 5C9ZB 1SQJA 4OWRA 3NVXA 5HE1B 4O1QD 4CZXA 4YVDA 2P9NC 2J55H 3C75H 5CXBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CY5 A;  2I3S A;  3VGZ A;  4XYH A;  1XIP A;  5EMJ B;  3V5W B;  3BG1 A;  5AFU 3;  4A09 A;  2HYE A;  5IGO A;  2PM9 B;  3OKY B;  4PBZ A;  3I7P A;  2OK4 A;  5A2Q g;  4X61 B;  1GOT B;  4K3I D;  4J81 A;  3JPX A;  2XU7 A;  2I3T A;  3PXS D;  4G56 B;  4JSN C;  3EI1 B;  2P9I C;  1U4C A;  3N0D A;  2CNX A;  3PVW B;  2Z2N A;  4QT8 A;  1S4U X;  5K19 A;  2B5L A;  3OW8 A;  4FWW A;  3SN6 B;  4E54 B;  4PSW B;  3IIW A;  4KFM B;  1SHY B;  5IJ7 E;  1B9Y A;  5SXM A;  4PNK B;  4L3G D;  4J78 A;  4J79 A;  3I7O A;  4FAN D;  2B5M A;  1ERJ A;  4AEZ A;  2H6N A;  4PXW A;  4X3E A;  3I8C A;  4QRJ A;  1XHM A;  2B4E A;  2GC4 A;  1MDA H;  1XKS A;  3PSL A;  2CN2 A;  4ESG A;  1NR0 A;  2UZX B;  5EML B;  2H9M A;  3UVN A;  2XL2 A;  4A2L A;  5CYK B;  4O3T B;  3AL8 A;  2CE9 A;  4ZOZ A;  2YBA A;  1JMX B;  1GG2 B;  4BUJ C;  3RSE C;  3EI2 B;  4A0A A;  3I7N A;  1PEV A;  2TRC B;  3ORV D;  3I7K A;  4FB1 D;  3SBQ A;  5JWZ A;  5HE2 B;  3J81 g;  4J73 A;  2I0T A;  4A08 A;  3NVN A;  4GMB A;  2HXC A;  2XL3 A;  3SHF A;  1NEX B;  2AGL A;  5GMK n;  3SWS D;  2HES X;  4IA9 A;  4GZ8 A;  3DSM A;  5HE3 B;  3OTT A;  3OKW A;  2PBI B;  5TDH B;  2W18 A;  3SFZ A;  4EWR A;  3GRE A;  5GSA A;  2H14 A;  2BBK H;  2OK6 A;  3KRX B;  2OVQ B;  5CXC A;  5HYN B;  3PSC B;  4JT5 C;  2HJB A;  1JMZ B;  4X60 B;  3I89 A;  1GXR A;  4PBY A;  3JZH A;  2UZY B;  3EMH A;  3UKR C;  1FWX A;  2IUQ A;  3F3P A;  3U4Y A;  1VYH C;  3RN1 D;  3RN0 D;  2YMU A;  4JSX C;  3I2N A;  4J77 A;  5C2V B;  5H1M A;  4MK0 B;  4GQ2 P;  4NSX A;  3L4M D;  2AH1 A;  1U2V C;  4J86 A;  4UI9 R;  3KRW B;  2PM9 A;  3OKY A;  3C99 A;  2O9K A;  4FA5 D;  2HKR A;  3AH8 B;  5FKR A;  4XYI A;  4L9O A;  4PC0 A;  5HE0 B;  4Z8L A;  4H5J A;  2IUP A;  2QXV A;  2OVR B;  5TEF A;  3EWE A;  3P4F A;  2YB8 B;  3ZWL B;  3EI1 A;  4J8G A;  2P9L C;  1TBG A;  4BL0 A;  3CFV A;  4J84 A;  3ODT A;  1OLZ A;  4U7A A;  1JOF A;  2QC5 A;  1TYQ C;  2H9P A;  4OZU A;  4ZOY A;  4A0B B;  3CFS B;  1MG2 A;  2CO0 A;  5EMM B;  2CN3 A;  4GM9 A;  4FA9 D;  2EBS A;  4A11 B;  4XEI C;  3I7L A;  4ZOV A;  3A0F A;  3AFC A;  2G99 A;  1A0R B;  1QNI A;  4J8B A;  2I0R A;  3HFQ A;  4CY2 A;  4CI2 A;  3BWS A;  3OL2 B;  4A2M A;  1OMW B;  1PI6 A;  2H9L A;  3MKS B;  2IAA A;  3IKO A;  3IJC A;  4E5Z B;  2HKM A;  5K1C C;  3UVO A;  3JRP A;  5CYK A;  2AGY A;  3OKT A;  3FGB A;  4LG8 A;  1N6E A;  4TZ4 A;  4L1Q D;  3EI2 A;  1YFQ A;  4GQB B;  4R7A B;  3DXK C;  2OIZ A;  5IC7 A;  5I5I A;  4CI8 A;  3EI4 B;  5B4W A;  5HQG A;  4ES0 A;  2OJY A;  4CI3 A;  3RFG A;  2AGX A;  2H6Q A;  3SCY A;  4JXM A;  3RMZ D;  3PE7 A;  2H13 A;  2XYI A;  3EU7 A;  4K3J B;  3DXM C;  4LGN A;  4A7J A;  3E0C A;  1L0Q A;  3FM0 A;  5C2W B;  5IGQ A;  2AH0 A;  4J0W A;  1MG3 A;  5EMK B;  4HDJ A;  5EM2 B;  4J0X A;  3PXT D;  4O3U B;  3IJ1 A;  3EI3 B;  3B7F A;  4L3H D;  4FAV D;  5FA5 B;  3JB9 L;  3SBP A;  3GFC A;  2I0S A;  2PM7 B;  3RFH A;  3MZL A;  1PGU A;  4ZOX A;  3CIK B;  5CXB A;  3MMY A;  3V7D B;  3NVQ A;  3SJL D;  5CXC B;  1Q47 A;  4Y5R D;  4GM3 A;  4QQE A;  5FKT A;  2Z2P A;  4LG9 A;  4ERQ A;  3DM0 A;  3K26 A;  5TEE A;  2GC7 A;  1K8K C;  4AOW A;  4CZV A;  4ZN4 A;  1GP2 B;  1SQ9 A;  4FHL A;  2AGZ A;  4JT6 C;  5AJA A;  4JSV C;  3SLE D;  3PVU B;  5FKS A;  4I79 A;  4J82 A;  3F3F A;  3IJ0 A;  4GGA A;  3IIY A;  5EAM A;  4A09 B;  5GXI A;  5FKQ A;  2Q7Q A;  3JZN A;  2IWK A;  2B5N A;  3SVW D;  3UR4 A;  3EG6 A;  2P9U C;  2H9N A;  2HJ4 A;  4D6V A;  3L4O D;  1K32 A;  4E54 A;  2YNP A;  3F3G A;  4GM8 A;  3W15 A;  2BCJ B;  3JRO A;  4FA4 D;  4A0B A;  4J87 A;  5FQD A;  2IWF A;  4JSP C;  2H3X A;  3MKQ A;  2J57 G;  1B9X A;  4CY1 A;  4A11 A;  1RI6 A;  2CE8 A;  5IT9 g;  3N0E A;  3ULE C;  2P9P C;  3SXT D;  5I5M A;  4GGC A;  3K27 A;  3SMR A;  4N14 A;  5GXH A;  3DWL C;  4BH6 A;  1R5M A;  3OL2 A;  2H68 A;  2AGW A;  1N6D A;  3V9F A;  3J80 g;  4E5Z A;  3UKU C;  4Y7R A;  3MXX A;  2Z2O A;  3JAM g;  4X63 B;  2P9K C;  2PM6 B;  3C9C A;  4IMM A;  3VA6 A;  4CI1 A;  1JJU B;  5EAL A;  4CZY A;  3EI4 A;  5EAR A;  3AL8 B;  2YNO A;  4U1E I;  3AL9 A;  3JZG A;  5KDO B;  2GNQ A;  3UVK A;  4CC9 A;  4A0A B;  4CY3 A;  2YNN A;  4H5I A;  3SBR A;  1N6F A;  4O45 A;  4D0K A;  4QL1 A;  3UVM A;  3I7H A;  2MTA H;  3BG0 A;  4GGD A;  3I8E A;  4PSX B;  5H17 A;  2OVP B;  3PXW D;  5I5J A;  4A08 B;  5TF2 A;  5EAP A;  2IUV A;  5EM2 A;  4JD2 C;  2AQ5 A;  5THA A;  3FRX A;  2H47 A;  2H6K A;  3EI3 A;  2CO0 C;  5IJ8 E;  2P9S C;  5FXY A;  3C5M A;  5H14 A;  1PBY B;  3MZK A;  4ERZ A;  2G9A A;  4GQ1 A;  3RRM C;  4O9D A;  2IUR A;  3UVL A;  4ERY A;  1P22 A;  5FLX g;  5AMS A;  4FA1 D;  3RLM D;  2J56 H;  3VH0 A;  5C9Z B;  1SQJ A;  4OWR A;  3NVX A;  5HE1 B;  4O1Q D;  4CZX A;  4YVD A;  2P9N C;  2J55 H;  3C75 H;  5CXB B; 
#chains in the Genus database with same CATH topology
 4CY5 A;  2I3S A;  3VGZ A;  4XYH A;  1XIP A;  3FCS A;  5EMJ B;  3V5W B;  3BG1 A;  3IVM A;  5AFU 3;  4A09 A;  1C9L A;  2HYE A;  4MMX A;  2QZP A;  5IGO A;  4AN1 A;  4JHN A;  1UOQ A;  4Z7N A;  2PM9 B;  3OKY B;  4PBZ A;  3I7P A;  2OK4 A;  3VI3 A;  5A2Q g;  4X61 B;  2VC2 A;  1GOT B;  2VDL A;  4K3I D;  4J81 A;  3JPX A;  2XU7 A;  2I3T A;  3PXS D;  4G56 B;  3GD1 I;  4JSN C;  3EI1 B;  2P9I C;  2BKL A;  1U4C A;  3N0D A;  2CNX A;  3PVW B;  2Z2N A;  4QT8 A;  1S4U X;  3MVD K;  5K19 A;  3IUJ A;  2B5L A;  2VDR A;  3OW8 A;  4FWW A;  3SN6 B;  4E54 B;  4PSW B;  3IIW A;  4KFM B;  1SHY B;  5IJ7 E;  1B9Y A;  5SXM A;  3MUO A;  4PNK B;  3K72 A;  4L3G D;  3ZE0 A;  4J78 A;  2VDP A;  4J79 A;  4Z7Q A;  3I7O A;  1H2Y A;  2B5M A;  1H2W A;  4FAN D;  1ERJ A;  1VZ2 A;  1H2X A;  4AEZ A;  2H6N A;  4PXW A;  4X3E A;  3I8C A;  4QRJ A;  1XHM A;  2B4E A;  2GC4 A;  1MDA H;  1XKS A;  3PSL A;  2CN2 A;  4ESG A;  3QHY B;  1NR0 A;  3EQ9 A;  2UZX B;  5EML B;  2H9M A;  4UM9 A;  4NEN A;  3UVN A;  2XL2 A;  4A2L A;  5CYK B;  4O3T B;  3AL8 A;  2CE9 A;  4ZOZ A;  4MMZ A;  2YBA A;  2VZ1 A;  1JMX B;  1GG2 B;  3KCI A;  4BUJ C;  3RSE C;  3EI2 B;  4A0A A;  1YR2 A;  3I7N A;  4BCC A;  1PEV A;  2TRC B;  3ORV D;  4BP9 A;  3I7K A;  3O4G A;  4BCD A;  4FB1 D;  3T3P A;  3SBQ A;  5JWZ A;  1C9I A;  5HE2 B;  3J81 g;  4J73 A;  1GOG A;  2I0T A;  4A08 A;  3ZDZ A;  3IJE A;  3NVN A;  4GMB A;  2HXC A;  2XL3 A;  3SHF A;  1NEX B;  2AGL A;  5E6U A;  5GMK n;  3SWS D;  2HES X;  4IA9 A;  4GZ8 A;  3DSM A;  5HE3 B;  3OTT A;  3OKW A;  2PBI B;  5TDH B;  4RE6 A;  2W18 A;  3SFZ A;  4EWR A;  3GRE A;  5GSA A;  2H14 A;  3ZE2 A;  2BBK H;  2OK6 A;  2EIE A;  3KRX B;  3MUN A;  2OVQ B;  5CXC A;  5HYN B;  3PSC B;  3O4I A;  4JT5 C;  2HJB A;  1JMZ B;  4X60 B;  3I89 A;  1GXR A;  4PBY A;  1O6F A;  1O6G A;  3JZH A;  5FFG A;  2UZY B;  3EMH A;  3UKR C;  1FWX A;  2IUQ A;  3F3P A;  4BP8 A;  3U4Y A;  4G1E A;  4QAM A;  1VYH C;  3RN1 D;  3RN0 D;  4DNU A;  2YMU A;  4DNV A;  5M5U A;  4JSX C;  3I2N A;  4J77 A;  5C2V B;  5H1M A;  4MK0 B;  4GQ2 P;  4NSX A;  3L4M D;  2AH1 A;  1U2V C;  4J86 A;  4UI9 R;  3KRW B;  1I2M B;  2PM9 A;  3OKY A;  3C99 A;  2O9K A;  4FA5 D;  2HKR A;  3AH8 B;  5FKR A;  4WK0 A;  4XYI A;  4L9O A;  4PC0 A;  5HE0 B;  4Z8L A;  4H5J A;  2IUP A;  2QXV A;  2OVR B;  5TEF A;  4NC4 A;  3EWE A;  3P4F A;  2YB8 B;  1E8N A;  3ZWL B;  4J8G A;  2P9L C;  3EI1 A;  1TBG A;  4BL0 A;  3CFV A;  4J84 A;  3ODT A;  4AX4 A;  3K6S A;  1OLZ A;  4U7A A;  5E6R A;  1JOF A;  2QC5 A;  1TYQ C;  2H9P A;  1A12 A;  4OZU A;  4ZOY A;  4IRZ A;  1UOO A;  2QR5 A;  4A0B B;  3CFS B;  3IUR A;  4AMY A;  1MG2 A;  2CO0 A;  5EMM B;  2CN3 A;  1VE7 A;  2HU8 A;  4GM9 A;  4FA9 D;  5C92 A;  2EBS A;  4A11 B;  4XEI C;  3I7L A;  4ZOV A;  3A0F A;  2JKX A;  2G99 A;  1A0R B;  3AFC A;  1QNI A;  4NBM A;  3EQ7 A;  4J8B A;  2I0R A;  3HFQ A;  4CY2 A;  3IUQ A;  5M5V A;  4CI2 A;  4WJK A;  3BWS A;  3OL2 B;  5M5S A;  4A2M A;  1OMW B;  1PI6 A;  3NIF A;  2VDO A;  3NIG A;  2H9L A;  3MKS B;  3NID A;  2IAA A;  3IKO A;  2XE4 A;  3IJC A;  2HKM A;  5K1C C;  4Z7O A;  4E5Z B;  3UVO A;  2HU5 A;  4MMY A;  2VDM A;  3JRP A;  5CYK A;  2AGY A;  2XZG A;  2WQ8 A;  3OKT A;  3FGB A;  4LG8 A;  3EQ8 A;  1N6E A;  4TZ4 A;  4L1Q D;  5M5R A;  2EIB A;  3EI2 A;  1YFQ A;  4GQB B;  4R7A B;  1K3I A;  3DXK C;  3QI0 A;  2OIZ A;  4RE5 A;  5IC7 A;  5I5I A;  1QFM A;  1L5G A;  4CI8 A;  4BCB A;  4WK4 A;  3EI4 B;  5B4W A;  2EID A;  5HQG A;  4ES0 A;  2OJY A;  4CI3 A;  3RFG A;  2AGX A;  2H6Q A;  3SCY A;  4JXM A;  3RMZ D;  3PE7 A;  2H13 A;  2XYI A;  3EU7 A;  4K3J B;  2HU7 A;  3DXM C;  4LGN A;  4A7J A;  3E0C A;  1L0Q A;  3FM0 A;  2VDQ A;  5C2W B;  5IGQ A;  2AH0 A;  4J0W A;  1MG3 A;  1TYE A;  5EMK B;  4HDJ A;  5EM2 B;  4J0X A;  3PXT D;  4O3U B;  3IJ1 A;  3EI3 B;  3B7F A;  4L3H D;  1VE6 A;  4FAV D;  5FA5 B;  3K71 A;  3JB9 L;  3SBP A;  3GFC A;  2I0S A;  2PM7 B;  3RFH A;  3MZL A;  1PGU A;  4NAA A;  3ZE1 A;  4ZOX A;  1U8C A;  3CIK B;  5CXB A;  3MMY A;  3V7D B;  3NVQ A;  3SJL D;  5CXC B;  1GOF A;  1Q47 A;  3V4V A;  4Y5R D;  4GM3 A;  4QQE A;  3DDU A;  5FKT A;  3GC3 B;  3ZDX A;  2Z2P A;  4LG9 A;  4ERQ A;  3DM0 A;  3K26 A;  5TEE A;  2GC7 A;  1K8K C;  4AOW A;  4CZV A;  4ZN4 A;  5M5T A;  1GP2 B;  1SQ9 A;  4FHL A;  2AGZ A;  4JT6 C;  5AJA A;  3O4J A;  4JSV C;  3SLE D;  3PVU B;  1QFS A;  5FKS A;  4I79 A;  1UTC A;  3IUM A;  4J82 A;  1JV2 A;  3F3F A;  3IJ0 A;  4GGA A;  3IIY A;  5EAM A;  4A09 B;  5GXI A;  5FKQ A;  2Q7Q A;  3JZN A;  2IWK A;  2B5N A;  3SVW D;  5M61 A;  3EG6 A;  3UR4 A;  2P9U C;  2H9N A;  2HJ4 A;  3ZDY A;  4D6V A;  3L4O D;  1K32 A;  4O2W A;  4E54 A;  2YNP A;  3F3G A;  4GM8 A;  3W15 A;  2BCJ B;  3JRO A;  4L1M A;  4FA4 D;  4A0B A;  4J87 A;  5FQD A;  2IWF A;  4JSP C;  2H3X A;  3MKQ A;  2J57 G;  1B9X A;  4CY1 A;  4A11 A;  1RI6 A;  2CE8 A;  5IT9 g;  3N0E A;  3ULE C;  2P9P C;  3SXT D;  1VZ3 A;  5I5M A;  4GGC A;  3K27 A;  3SMR A;  4N14 A;  5GXH A;  3DWL C;  4BH6 A;  1R5M A;  5E6S A;  3OL2 A;  2H68 A;  2AGW A;  1N6D A;  1T2X A;  3V9F A;  1BPO A;  3J80 g;  4E5Z A;  4DNW A;  5FFO A;  3UKU C;  4Y7R A;  3MXX A;  2Z2O A;  3JAM g;  2VDK A;  4X63 B;  2P9K C;  4WK2 A;  2PM6 B;  3OF7 A;  4O02 A;  3C9C A;  3IUL A;  2VDN A;  4IMM A;  3T3M A;  3VA6 A;  4CI1 A;  1JJU B;  5EAL A;  4CZY A;  3EI4 A;  5EAR A;  3AL8 B;  4G55 A;  2YNO A;  4U1E I;  1GOH A;  3AL9 A;  3JZG A;  5KDO B;  1UOP A;  2GNQ A;  3UVK A;  4CC9 A;  1JTD B;  4A0A B;  1E5T A;  2YNN A;  4CY3 A;  3IUN A;  4H5I A;  3SBR A;  1N6F A;  4O45 A;  4D0K A;  4QL1 A;  3UVM A;  3I7H A;  2MTA H;  4G1M A;  3BG0 A;  4GGD A;  3I8E A;  4PSX B;  5H17 A;  2OVP B;  3PXW D;  5I5J A;  4A08 B;  5TF2 A;  5EAP A;  2IUV A;  4AN0 A;  5EM2 A;  4JD2 C;  2AQ5 A;  5THA A;  5C86 A;  3FRX A;  5HDB A;  2H47 A;  2H6K A;  3EI3 A;  3VI4 A;  1E8M A;  5CXB B;  2XDW A;  3V4P A;  2CO0 C;  5IJ8 E;  2P9S C;  5FXY A;  3C5M A;  4JHP C;  5H14 A;  1PBY B;  3MZK A;  4ERZ A;  2G9A A;  4GQ1 A;  3RRM C;  4O9D A;  2IUR A;  3UVL A;  3FCU A;  4ERY A;  2EIC A;  1P22 A;  5FLX g;  5AMS A;  4FA1 D;  3RLM D;  2J56 H;  3VH0 A;  1H2Z A;  5C9Z B;  1SQJ A;  4OWR A;  4D9S A;  3NVX A;  5HE1 B;  1M1X A;  4O1Q D;  4CZX A;  4UM8 A;  3O4H A;  4YVD A;  2P9N C;  2J55 H;  3C75 H;  2VZ3 A;  4AMZ A; 
#chains in the Genus database with same CATH homology
 4CY5 A;  2I3S A;  3VGZ A;  4XYH A;  1XIP A;  5EMJ B;  3V5W B;  3BG1 A;  5AFU 3;  4A09 A;  2HYE A;  5IGO A;  2PM9 B;  3OKY B;  4PBZ A;  3I7P A;  2OK4 A;  5A2Q g;  4X61 B;  1GOT B;  4K3I D;  4J81 A;  3JPX A;  2XU7 A;  2I3T A;  3PXS D;  4G56 B;  4JSN C;  3EI1 B;  2P9I C;  1U4C A;  3N0D A;  2CNX A;  3PVW B;  2Z2N A;  4QT8 A;  1S4U X;  5K19 A;  2B5L A;  3OW8 A;  4FWW A;  3SN6 B;  4E54 B;  4PSW B;  3IIW A;  4KFM B;  1SHY B;  5IJ7 E;  1B9Y A;  5SXM A;  4PNK B;  4L3G D;  4J78 A;  4J79 A;  3I7O A;  4FAN D;  2B5M A;  1ERJ A;  4AEZ A;  2H6N A;  4PXW A;  4X3E A;  3I8C A;  4QRJ A;  1XHM A;  2B4E A;  2GC4 A;  1MDA H;  1XKS A;  3PSL A;  2CN2 A;  4ESG A;  1NR0 A;  2UZX B;  5EML B;  2H9M A;  3UVN A;  2XL2 A;  4A2L A;  5CYK B;  4O3T B;  3AL8 A;  2CE9 A;  4ZOZ A;  2YBA A;  1JMX B;  1GG2 B;  4BUJ C;  3RSE C;  3EI2 B;  4A0A A;  3I7N A;  1PEV A;  2TRC B;  3ORV D;  3I7K A;  4FB1 D;  3SBQ A;  5JWZ A;  5HE2 B;  3J81 g;  4J73 A;  2I0T A;  4A08 A;  3NVN A;  4GMB A;  2HXC A;  2XL3 A;  3SHF A;  1NEX B;  2AGL A;  5GMK n;  3SWS D;  2HES X;  4IA9 A;  4GZ8 A;  3DSM A;  5HE3 B;  3OTT A;  3OKW A;  2PBI B;  5TDH B;  2W18 A;  3SFZ A;  4EWR A;  3GRE A;  5GSA A;  2H14 A;  2BBK H;  2OK6 A;  3KRX B;  2OVQ B;  5CXC A;  5HYN B;  3PSC B;  4JT5 C;  2HJB A;  1JMZ B;  4X60 B;  3I89 A;  1GXR A;  4PBY A;  3JZH A;  2UZY B;  3EMH A;  3UKR C;  1FWX A;  2IUQ A;  3F3P A;  3U4Y A;  1VYH C;  3RN1 D;  3RN0 D;  2YMU A;  4JSX C;  3I2N A;  4J77 A;  5C2V B;  5H1M A;  4MK0 B;  4GQ2 P;  4NSX A;  3L4M D;  2AH1 A;  1U2V C;  4J86 A;  4UI9 R;  3KRW B;  2PM9 A;  3OKY A;  3C99 A;  2O9K A;  4FA5 D;  2HKR A;  3AH8 B;  5FKR A;  4XYI A;  4L9O A;  4PC0 A;  5HE0 B;  4Z8L A;  4H5J A;  2IUP A;  2QXV A;  2OVR B;  5TEF A;  3EWE A;  3P4F A;  2YB8 B;  3ZWL B;  3EI1 A;  4J8G A;  2P9L C;  1TBG A;  4BL0 A;  3CFV A;  4J84 A;  3ODT A;  1OLZ A;  4U7A A;  1JOF A;  2QC5 A;  1TYQ C;  2H9P A;  4OZU A;  4ZOY A;  4A0B B;  3CFS B;  1MG2 A;  2CO0 A;  5EMM B;  2CN3 A;  4GM9 A;  4FA9 D;  2EBS A;  4A11 B;  4XEI C;  3I7L A;  4ZOV A;  3A0F A;  3AFC A;  2G99 A;  1A0R B;  1QNI A;  4J8B A;  2I0R A;  3HFQ A;  4CY2 A;  4CI2 A;  3BWS A;  3OL2 B;  4A2M A;  1OMW B;  1PI6 A;  2H9L A;  3MKS B;  2IAA A;  3IKO A;  3IJC A;  4E5Z B;  2HKM A;  5K1C C;  3UVO A;  3JRP A;  5CYK A;  2AGY A;  3OKT A;  3FGB A;  4LG8 A;  1N6E A;  4TZ4 A;  4L1Q D;  3EI2 A;  1YFQ A;  4GQB B;  4R7A B;  3DXK C;  2OIZ A;  5IC7 A;  5I5I A;  4CI8 A;  3EI4 B;  5B4W A;  5HQG A;  4ES0 A;  2OJY A;  4CI3 A;  3RFG A;  2AGX A;  2H6Q A;  3SCY A;  4JXM A;  3RMZ D;  3PE7 A;  2H13 A;  2XYI A;  3EU7 A;  4K3J B;  3DXM C;  4LGN A;  4A7J A;  3E0C A;  1L0Q A;  3FM0 A;  5C2W B;  5IGQ A;  2AH0 A;  4J0W A;  1MG3 A;  5EMK B;  4HDJ A;  5EM2 B;  4J0X A;  3PXT D;  4O3U B;  3IJ1 A;  3EI3 B;  3B7F A;  4L3H D;  4FAV D;  5FA5 B;  3JB9 L;  3SBP A;  3GFC A;  2I0S A;  2PM7 B;  3RFH A;  3MZL A;  1PGU A;  4ZOX A;  3CIK B;  5CXB A;  3MMY A;  3V7D B;  3NVQ A;  3SJL D;  5CXC B;  1Q47 A;  4Y5R D;  4GM3 A;  4QQE A;  5FKT A;  2Z2P A;  4LG9 A;  4ERQ A;  3DM0 A;  3K26 A;  5TEE A;  2GC7 A;  1K8K C;  4AOW A;  4CZV A;  4ZN4 A;  1GP2 B;  1SQ9 A;  4FHL A;  2AGZ A;  4JT6 C;  5AJA A;  4JSV C;  3SLE D;  3PVU B;  5FKS A;  4I79 A;  4J82 A;  3F3F A;  3IJ0 A;  4GGA A;  3IIY A;  5EAM A;  4A09 B;  5GXI A;  5FKQ A;  2Q7Q A;  3JZN A;  2IWK A;  2B5N A;  3SVW D;  3UR4 A;  3EG6 A;  2P9U C;  2H9N A;  2HJ4 A;  4D6V A;  3L4O D;  1K32 A;  4E54 A;  2YNP A;  3F3G A;  4GM8 A;  3W15 A;  2BCJ B;  3JRO A;  4FA4 D;  4A0B A;  4J87 A;  5FQD A;  2IWF A;  4JSP C;  2H3X A;  3MKQ A;  2J57 G;  1B9X A;  4CY1 A;  4A11 A;  1RI6 A;  2CE8 A;  5IT9 g;  3N0E A;  3ULE C;  2P9P C;  3SXT D;  5I5M A;  4GGC A;  3K27 A;  3SMR A;  4N14 A;  5GXH A;  3DWL C;  4BH6 A;  1R5M A;  3OL2 A;  2H68 A;  2AGW A;  1N6D A;  3V9F A;  3J80 g;  4E5Z A;  3UKU C;  4Y7R A;  3MXX A;  2Z2O A;  3JAM g;  4X63 B;  2P9K C;  2PM6 B;  3C9C A;  4IMM A;  3VA6 A;  4CI1 A;  1JJU B;  5EAL A;  4CZY A;  3EI4 A;  5EAR A;  3AL8 B;  2YNO A;  4U1E I;  3AL9 A;  3JZG A;  5KDO B;  2GNQ A;  3UVK A;  4CC9 A;  4A0A B;  4CY3 A;  2YNN A;  4H5I A;  3SBR A;  1N6F A;  4O45 A;  4D0K A;  4QL1 A;  3UVM A;  3I7H A;  2MTA H;  3BG0 A;  4GGD A;  3I8E A;  4PSX B;  5H17 A;  2OVP B;  3PXW D;  5I5J A;  4A08 B;  5TF2 A;  5EAP A;  2IUV A;  5EM2 A;  4JD2 C;  2AQ5 A;  5THA A;  3FRX A;  2H47 A;  2H6K A;  3EI3 A;  2CO0 C;  5IJ8 E;  2P9S C;  5FXY A;  3C5M A;  5H14 A;  1PBY B;  3MZK A;  4ERZ A;  2G9A A;  4GQ1 A;  3RRM C;  4O9D A;  2IUR A;  3UVL A;  4ERY A;  1P22 A;  5FLX g;  5AMS A;  4FA1 D;  3RLM D;  2J56 H;  3VH0 A;  5C9Z B;  1SQJ A;  4OWR A;  3NVX A;  5HE1 B;  4O1Q D;  4CZX A;  4YVD A;  2P9N C;  2J55 H;  3C75 H;  5CXB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...