3EG6A

Structure of wdr5 bound to mll1 peptide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of WDR5 bound to mixed lineage leukemia protein-1 peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords WD repeat-containing protein 5
total genus 104
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3eg6A00
2PBIB 4K3ID 4JSPC 4A0BB 2YBAA 3PSCB 5I5JA 4UI9R 3IKOA 4J86A 4O9DA 4IMMA 2HJ4A 2AH0A 4LG9A 2B5LA 2PM9A 2AGZA 5K19A 3IIYA 4OZUA 3SJLD 5IJ8E 2AGXA 2CE8A 4ERQA 4O45A 4YVDA 4ZN4A 1R5MA 2CO0C 2MTAH 2Q7QA 5FKSA 4A08B 4E5ZB 1FWXA 5K1CC 1N6EA 2H6QA 4FB1D 5EALA 4A09A 3KRXB 3ODTA 3C99A 2PM7B 5HQGA 3HFQA 4TZ4A 1TBGA 2OVPB 3GFCA 3I89A 3OKTA 1U2VC 4J0XA 5H14A 4D0KA 3C75H 3I7OA 4ZOVA 2H9PA 4A11A 1GOTB 5IGOA 3JROA 4J84A 1NEXB 3E0CA 3VA6A 4FA5D 2I0RA 3EI2A 4J82A 4L9OA 5GXIA 2P9UC 4U1EI 2YNOA 5FKTA 5CXBB 2XYIA 3PVWB 5KDOB 3C5MA 3K27A 2H9LA 2AQ5A 4CZXA 4L3GD 3I7LA 4PXWA 1GXRA 4NSXA 4PC0A 4GMBA 3EI2B 1JOFA 1JMXB 5FA5B 3RFGA 3RN1D 1SHYB 2XL2A 2I3SA 2H9MA 4ZOXA 3MZLA 3V7DB 3C9CA 2IAAA 4J0WA 3RRMC 4BUJC 5I5IA 2OVRB 5CXCB 4ES0A 4JT5C 4AEZA 1SQ9A 3SBPA 2OK6A 5H17A 1SQJA 4O1QD 1N6DA 2P9SC 1GP2B 2QXVA 3PXTD 4L1QD 2IURA 5EAPA 2AGWA 5TDHB 1JJUB 5FKRA 4L3HD 3EI4B 4A2MA 4H5IA 3EMHA 4FA4D 4CY1A 3SCYA 2BBKH 3EI4A 3IIWA 3OTTA 2H47A 3CFSB 2UZYB 5CXBA 3PXSD 1JMZB 3N0EA 5HE0B 2P9KC 1TYQC 3UVMA 4FA1D 4GQBB 4JT6C 2O9KA 1K8KC 3DWLC 3JPXA 3EI3B 4CI8A 3UVKA 4BL0A 3FM0A 1XIPA 3I7NA 4Y7RA 3I2NA 4E54A 2XL3A 3OL2B 4PNKB 1OLZA 4H5JA 4CY5A 5A2Qg 5C2WB 2HESX 4FHLA 5EARA 5C9ZB 4ZOZA 1QNIA 2OIZA 2YNPA 1PEVA 1RI6A 3V5WB 2YNNA 2W18A 3J81g 4PBZA 3JZNA 5CYKB 5TF2A 4J79A 2TRCB 4GZ8A 5EM2A 3SHFA 4A09B 3NVNA 4A0AB 4CY2A 2PM9B 3IJ1A 2J56H 2P9LC 4A2LA 4E54B 3PVUB 3BG0A 4J78A 3JZHA 1PI6A 4PSXB 3ORVD 3I7PA 3I7HA 3IJCA 2UZXB 3RFHA 3SWSD 2H13A 2J55H 2H3XA 3FGBA 2CE9A 2I0SA 3DXKC 3MMYA 4QL1A 5FLXg 5TEFA 4GGDA 4LGNA 3JZGA 3V9FA 2BCJB 4ERYA 2HKMA 2I0TA 3PSLA 4OWRA 4A11B 4A0BA 2YMUA 4J8GA 3L4OD 4I79A 2H9NA 4XYIA 2GC4A 1PBYB 3JB9L 2CO0A 3CFVA 3EWEA 4JSVC 1A0RB 3DXMC 4JSXC 5THAA 5CXCA 4X3EA 3AL9A 2IUQA 3UVOA 1GG2B 3OW8A 3UVLA 5I5MA 3UKRC 1OMWB 2H14A 4ERZA 2QC5A 1NR0A 4CI3A 2OK4A 4CC9A 4A0AA 5AFU3 3OL2A 3EI3A 2J57G 3AL8B 3ULEC 5EMLB 3EG6A 3CIKB 3VGZA 4GM8A 3RSEC 5SXMA 5GXHA 4HDJA 2AH1A 4JSNC 1MG2A 5AJAA 3SBQA 2G9AA 2H68A 3SMRA 3UR4A 1XKSA 4FA9D 5HE1B 4J81A 3AL8A 3W15A 4QT8A 4O3TB 4E5ZA 3MXXA 4XYHA 3L4MD 2P9IC 4GQ2P 1K32A 3MKQA 2IUVA 3SN6B 4BH6A 5EM2B 4GM9A 1B9YA 4J77A 5GSAA 2IWFA 2Z2PA 3OKYB 2B5MA 4J8BA 1S4UX 3U4YA 4CY3A 2CN2A 3SBRA 3B7FA 3A0FA 3JAMg 3PE7A 3SFZA 2GC7A 4GM3A 3RLMD 3EU7A 4PBYA 4JXMA 3OKYA 3UKUC 4X61B 4CZYA 4XEIC 4JD2C 2H6NA 2YB8B 2HYEA 4ESGA 3SLED 4IA9A 4A08A 3SVWD 5EMJB 4FAVD 4CI1A 2P9PC 3IJ0A 2HXCA 3RMZD 4K3JB 2P9NC 4X63B 3K26A 3DM0A 5C2VB 3F3FA 5IGQA 3MKSB 2IUPA 1MDAH 2HJBA 2Z2OA 5B4WA 3PXWD 4N14A 4G56B 5IC7A 4GQ1A 3OKWA 1ERJA 3I8EA 5CYKA 3AFCA 3I8CA 5EMKB 3J80g 3KRWB 3P4FA 1PGUA 3JRPA 3MZKA 2CN3A 3I7KA 4LG8A 5JWZA 4O3UB 2GNQA 4MK0B 2CNXA 1MG3A 2HKRA 4X60B 4Y5RD 2XU7A 4GGCA 2H6KA 4QRJA 1P22A 5FQDA 5EMMB 5HYNB 5HE3B 3BG1A 5IJ7E 3NVQA 5HE2B 1B9XA 1Q47A 2AGYA 4A7JA 2AGLA 4J73A 4U7AA 5FKQA 1U4CA 2I3TA 3FRXA 5H1MA 3F3GA 4J87A 1VYHC 4AOWA 2Z2NA 3GREA 4QQEA 4CI2A 3NVXA 2EBSA 3VH0A 2OVQB 4FAND 1N6FA 3N0DA 2B4EA 3F3PA 4R7AB 3EI1A 2B5NA 3UVNA 5EAMA 5TEEA 5AMSA 1XHMA 4Z8LA 4KFMB 4GGAA 3DSMA 4ZOYA 5GMKn 2OJYA 4PSWB 4CZVA 1L0QA 2PM6B 3RN0D 5IT9g 3BWSA 4EWRA 3SXTD 3AH8B 1YFQA 5FXYA 2G99A 4D6VA 4FWWA 2IWKA 3EI1B 3ZWLB
chains in the Genus database with same CATH superfamily
2PBIB 4K3ID 4JSPC 5HDBA 4A0BB 2YBAA 3PSCB 1H2WA 2EICA 5I5JA 4UI9R 3IKOA 4J86A 4O9DA 3VI4A 4IMMA 5C92A 2HJ4A 2AH0A 4LG9A 2B5LA 2PM9A 2AGZA 3VI3A 5K19A 3IIYA 4OZUA 3SJLD 1K3IA 5IJ8E 2AGXA 2CE8A 3IUMA 4ERQA 4O45A 4YVDA 4ZN4A 1R5MA 2CO0C 2MTAH 2Q7QA 5FKSA 4A08B 3IVMA 4E5ZB 1FWXA 2XDWA 5K1CC 1N6EA 4L1MA 2H6QA 4FB1D 3FCUA 5EALA 4A09A 1H2ZA 1E8MA 3KRXB 3ODTA 4Z7OA 3C99A 2PM7B 5HQGA 3HFQA 4TZ4A 1TBGA 4DNVA 2OVPB 3GFCA 3I89A 3QI0A 3OKTA 2HU7A 1U2VC 2EIDA 4J0XA 5H14A 4D0KA 3C75H 3I7OA 3IULA 4ZOVA 2H9PA 4A11A 1GOTB 5IGOA 3JROA 4J84A 3ZE0A 3NIDA 1NEXB 3E0CA 3VA6A 4FA5D 2I0RA 3GC3B 3EI2A 4J82A 4L9OA 5GXIA 4DNWA 2P9UC 3NIGA 4U1EI 2YNOA 5FKTA 5CXBB 2XYIA 3PVWB 5KDOB 1H2YA 3C5MA 3K27A 1UTCA 2H9LA 2AQ5A 4CZXA 4L3GD 2VC2A 1O6FA 3I7LA 4PXWA 1GXRA 4NSXA 2VDMA 3OF7A 4GMBA 4PC0A 4AMYA 5FFGA 3EI2B 1JOFA 4JHNA 1JMXB 5FA5B 1I2MB 3RFGA 1SHYB 2VDLA 3RN1D 2XL2A 2JKXA 2I3SA 2H9MA 4ZOXA 3MZLA 3V7DB 1GOHA 3C9CA 2IAAA 4J0WA 3RRMC 4BUJC 2XZGA 5I5IA 2OVRB 5CXCB 1L5GA 4ES0A 4JT5C 4AEZA 3EQ7A 1SQ9A 2XE4A 3SBPA 2OK6A 5H17A 1SQJA 4O1QD 1N6DA 2P9SC 3ZE2A 1GP2B 5E6UA 2QXVA 3PXTD 4L1QD 2IURA 5EAPA 2AGWA 5TDHB 1JJUB 1JV2A 5FKRA 4L3HD 3EI4B 4A2MA 4H5IA 4D9SA 3EMHA 4FA4D 4CY1A 3SCYA 4IRZA 2BBKH 4BCCA 5M61A 1UOOA 3EI4A 3IIWA 3OTTA 2VDRA 2H47A 3CFSB 4NENA 5M5VA 3QHYB 2UZYB 1C9LA 5CXBA 3PXSD 1JMZB 3N0EA 5HE0B 2P9KC 1TYQC 3UVMA 4FA1D 4GQBB 4JT6C 2O9KA 1K8KC 3DWLC 3JPXA 3EI3B 2HU5A 3KCIA 4CI8A 3UVKA 4BL0A 3FM0A 3T3MA 1XIPA 4RE6A 1QFSA 3I7NA 4Y7RA 3I2NA 4E54A 2XL3A 3OL2B 4PNKB 1OLZA 4H5JA 4CY5A 3K71A 4MMYA 5A2Qg 5M5UA 5C2WB 3MVDK 2HESX 4FHLA 5EARA 5C9ZB 4ZOZA 1QNIA 2OIZA 2YNPA 1PEVA 1RI6A 5M5RA 3V5WB 2YNNA 2W18A 3J81g 4PBZA 3JZNA 5CYKB 5TF2A 1VE6A 4J79A 2TRCB 4GZ8A 5EM2A 3SHFA 4AN0A 4A09B 3NVNA 1VZ2A 1U8CA 2VZ1A 4JHPC 4A0AB 4NAAA 4CY2A 2PM9B 4BP8A 3IJ1A 2J56H 2P9LC 4A2LA 4E54B 3IJEA 3PVUB 3BG0A 3V4PA 4J78A 3JZHA 1PI6A 4PSXB 3ORVD 3I7PA 3I7HA 3IJCA 2UZXB 3RFHA 3K72A 3SWSD 2H13A 1M1XA 2J55H 2H3XA 3FGBA 2CE9A 2I0SA 2VZ3A 3DXKC 3MMYA 4WK2A 4QL1A 5FLXg 5TEFA 4GGDA 4WK0A 2BKLA 3O4IA 3JZGA 4LGNA 2BCJB 3V9FA 4ERYA 2HKMA 2I0TA 1E8NA 3PSLA 4OWRA 1O6GA 1JTDB 5E6RA 4A11B 4A0BA 2YMUA 4J8GA 3EQ8A 3L4OD 4I79A 2H9NA 3O4HA 4XYIA 2GC4A 1PBYB 3JB9L 2CO0A 3CFVA 3EWEA 4JSVC 4DNUA 1A0RB 3DXMC 4JSXC 5THAA 4WJKA 4G55A 4X3EA 3AL9A 5CXCA 2IUQA 3T3PA 1GG2B 3UVOA 3OW8A 3UVLA 5I5MA 3UKRC 1GOGA 1OMWB 2H14A 4ERZA 2QC5A 1NR0A 1TYEA 4CI3A 2OK4A 4CC9A 4A0AA 5AFU3 3OL2A 3EI3A 2J57G 3AL8B 3ULEC 4O2WA 5EMLB 3EG6A 3CIKB 3O4JA 3VGZA 4GM8A 5E6SA 3RSEC 5SXMA 5GXHA 4HDJA 1YR2A 4QAMA 2AH1A 4JSNC 1MG2A 4AN1A 5AJAA 3SBQA 3NIFA 2G9AA 2H68A 3SMRA 3UR4A 1XKSA 4FA9D 5HE1B 4J81A 3AL8A 1T2XA 4Z7QA 3W15A 4QT8A 4O3TB 4E5ZA 3MXXA 4XYHA 1C9IA 3L4MD 2P9IC 4NC4A 4GQ2P 1K32A 3GD1I 3MKQA 2IUVA 3SN6B 4BH6A 5EM2B 4GM9A 1B9YA 4J77A 5GSAA 3OKYB 2IWFA 2Z2PA 2B5MA 3MUOA 4J8BA 4NBMA 1S4UX 3U4YA 4CY3A 2CN2A 3SBRA 3B7FA 3A0FA 3JAMg 3PE7A 2VDNA 3SFZA 2GC7A 3ZDXA 4GM3A 3RLMD 3EU7A 5FFOA 4PBYA 4JXMA 3OKYA 3UKUC 4O02A 2VDOA 4X61B 4CZYA 1QFMA 4XEIC 2EIEA 4JD2C 2H6NA 1VZ3A 2YB8B 4G1MA 4ESGA 2HYEA 3SLED 4IA9A 4A08A 3SVWD 4BP9A 4BCDA 5EMJB 3V4VA 3K6SA 4MMXA 4FAVD 4CI1A 3IUJA 2P9PC 1UOPA 3IJ0A 2HXCA 3ZE1A 3RMZD 4K3JB 2P9NC 4X63B 3K26A 3DM0A 5C2VB 1VE7A 3F3FA 5IGQA 2HU8A 3MKSB 2IUPA 1MDAH 2HJBA 2Z2OA 5B4WA 3PXWD 4N14A 3MUNA 4BCBA 4G56B 5M5TA 2VDPA 4GQ1A 5IC7A 1H2XA 2QZPA 3OKWA 1ERJA 3I8EA 5CYKA 3AFCA 3I8CA 5EMKB 3J80g 1GOFA 3KRWB 3P4FA 1PGUA 3IUQA 3JRPA 3MZKA 1A12A 2CN3A 3I7KA 4LG8A 3IURA 5JWZA 4O3UB 2GNQA 4MK0B 2CNXA 2WQ8A 1MG3A 2HKRA 4X60B 4Y5RD 2XU7A 4GGCA 2H6KA 4QRJA 4WK4A 1P22A 2EIBA 5FQDA 5EMMB 5HYNB 5HE3B 3BG1A 5IJ7E 4Z7NA 5C86A 3ZDZA 3NVQA 5HE2B 1B9XA 1Q47A 2AGYA 4A7JA 2AGLA 4J73A 4U7AA 5FKQA 1U4CA 4G1EA 2I3TA 3FRXA 5H1MA 3F3GA 4RE5A 4J87A 3IUNA 1VYHC 4AOWA 4UM8A 1BPOA 2Z2NA 3GREA 4QQEA 1E5TA 4CI2A 4AX4A 3NVXA 2EBSA 3VH0A 3O4GA 4AMZA 2OVQB 4FAND 1N6FA 3N0DA 2B4EA 3F3PA 4R7AB 3EI1A 2B5NA 3UVNA 1UOQA 5EAMA 3EQ9A 4MMZA 5TEEA 5AMSA 1XHMA 2VDQA 3ZDYA 4Z8LA 4KFMB 4GGAA 3DSMA 2VDKA 3FCSA 4ZOYA 5GMKn 2OJYA 4PSWB 4UM9A 2QR5A 4CZVA 1L0QA 2PM6B 3RN0D 5IT9g 3BWSA 4EWRA 5M5SA 3SXTD 3AH8B 1YFQA 5FXYA 2G99A 4D6VA 3DDUA 4FWWA 2IWKA 3EI1B 3ZWLB
chains in the Genus database with same CATH topology
2PBIB 4K3ID 4JSPC 4A0BB 2YBAA 3PSCB 5I5JA 4UI9R 3IKOA 4J86A 4O9DA 4IMMA 2HJ4A 2AH0A 4LG9A 2B5LA 2PM9A 2AGZA 5K19A 3IIYA 4OZUA 3SJLD 5IJ8E 2AGXA 2CE8A 4ERQA 4O45A 4YVDA 4ZN4A 1R5MA 2CO0C 2MTAH 2Q7QA 5FKSA 4A08B 4E5ZB 1FWXA 5K1CC 1N6EA 2H6QA 4FB1D 5EALA 4A09A 3KRXB 3ODTA 3C99A 2PM7B 5HQGA 3HFQA 4TZ4A 1TBGA 2OVPB 3GFCA 3I89A 3OKTA 1U2VC 4J0XA 5H14A 4D0KA 3C75H 3I7OA 4ZOVA 2H9PA 4A11A 1GOTB 5IGOA 3JROA 4J84A 1NEXB 3E0CA 3VA6A 4FA5D 2I0RA 3EI2A 4J82A 4L9OA 5GXIA 2P9UC 4U1EI 2YNOA 5FKTA 5CXBB 2XYIA 3PVWB 5KDOB 3C5MA 3K27A 2H9LA 2AQ5A 4CZXA 4L3GD 3I7LA 4PXWA 1GXRA 4NSXA 4PC0A 4GMBA 3EI2B 1JOFA 1JMXB 5FA5B 3RFGA 3RN1D 1SHYB 2XL2A 2I3SA 2H9MA 4ZOXA 3MZLA 3V7DB 3C9CA 2IAAA 4J0WA 3RRMC 4BUJC 5I5IA 2OVRB 5CXCB 4ES0A 4JT5C 4AEZA 1SQ9A 3SBPA 2OK6A 5H17A 1SQJA 4O1QD 1N6DA 2P9SC 1GP2B 2QXVA 3PXTD 4L1QD 2IURA 5EAPA 2AGWA 5TDHB 1JJUB 5FKRA 4L3HD 3EI4B 4A2MA 4H5IA 3EMHA 4FA4D 4CY1A 3SCYA 2BBKH 3EI4A 3IIWA 3OTTA 2H47A 3CFSB 2UZYB 5CXBA 3PXSD 1JMZB 3N0EA 5HE0B 2P9KC 1TYQC 3UVMA 4FA1D 4GQBB 4JT6C 2O9KA 1K8KC 3DWLC 3JPXA 3EI3B 4CI8A 3UVKA 4BL0A 3FM0A 1XIPA 3I7NA 4Y7RA 3I2NA 4E54A 2XL3A 3OL2B 4PNKB 1OLZA 4H5JA 4CY5A 5A2Qg 5C2WB 2HESX 4FHLA 5EARA 5C9ZB 4ZOZA 1QNIA 2OIZA 2YNPA 1PEVA 1RI6A 3V5WB 2YNNA 2W18A 3J81g 4PBZA 3JZNA 5CYKB 5TF2A 4J79A 2TRCB 4GZ8A 5EM2A 3SHFA 4A09B 3NVNA 4A0AB 4CY2A 2PM9B 3IJ1A 2J56H 2P9LC 4A2LA 4E54B 3PVUB 3BG0A 4J78A 3JZHA 1PI6A 4PSXB 3ORVD 3I7PA 3I7HA 3IJCA 2UZXB 3RFHA 3SWSD 2H13A 2J55H 2H3XA 3FGBA 2CE9A 2I0SA 3DXKC 3MMYA 4QL1A 5FLXg 5TEFA 4GGDA 4LGNA 3JZGA 3V9FA 2BCJB 4ERYA 2HKMA 2I0TA 3PSLA 4OWRA 4A11B 4A0BA 2YMUA 4J8GA 3L4OD 4I79A 2H9NA 4XYIA 2GC4A 1PBYB 3JB9L 2CO0A 3CFVA 3EWEA 4JSVC 1A0RB 3DXMC 4JSXC 5THAA 5CXCA 4X3EA 3AL9A 2IUQA 3UVOA 1GG2B 3OW8A 3UVLA 5I5MA 3UKRC 1OMWB 2H14A 4ERZA 2QC5A 1NR0A 4CI3A 2OK4A 4CC9A 4A0AA 5AFU3 3OL2A 3EI3A 2J57G 3AL8B 3ULEC 5EMLB 3EG6A 3CIKB 3VGZA 4GM8A 3RSEC 5SXMA 5GXHA 4HDJA 2AH1A 4JSNC 1MG2A 5AJAA 3SBQA 2G9AA 2H68A 3SMRA 3UR4A 1XKSA 4FA9D 5HE1B 4J81A 3AL8A 3W15A 4QT8A 4O3TB 4E5ZA 3MXXA 4XYHA 3L4MD 2P9IC 4GQ2P 1K32A 3MKQA 2IUVA 3SN6B 4BH6A 5EM2B 4GM9A 1B9YA 4J77A 5GSAA 2IWFA 2Z2PA 3OKYB 2B5MA 4J8BA 1S4UX 3U4YA 4CY3A 2CN2A 3SBRA 3B7FA 3A0FA 3JAMg 3PE7A 3SFZA 2GC7A 4GM3A 3RLMD 3EU7A 4PBYA 4JXMA 3OKYA 3UKUC 4X61B 4CZYA 4XEIC 4JD2C 2H6NA 2YB8B 2HYEA 4ESGA 3SLED 4IA9A 4A08A 3SVWD 5EMJB 4FAVD 4CI1A 2P9PC 3IJ0A 2HXCA 3RMZD 4K3JB 2P9NC 4X63B 3K26A 3DM0A 5C2VB 3F3FA 5IGQA 3MKSB 2IUPA 1MDAH 2HJBA 2Z2OA 5B4WA 3PXWD 4N14A 4G56B 5IC7A 4GQ1A 3OKWA 1ERJA 3I8EA 5CYKA 3AFCA 3I8CA 5EMKB 3J80g 3KRWB 3P4FA 1PGUA 3JRPA 3MZKA 2CN3A 3I7KA 4LG8A 5JWZA 4O3UB 2GNQA 4MK0B 2CNXA 1MG3A 2HKRA 4X60B 4Y5RD 2XU7A 4GGCA 2H6KA 4QRJA 1P22A 5FQDA 5EMMB 5HYNB 5HE3B 3BG1A 5IJ7E 3NVQA 5HE2B 1B9XA 1Q47A 2AGYA 4A7JA 2AGLA 4J73A 4U7AA 5FKQA 1U4CA 2I3TA 3FRXA 5H1MA 3F3GA 4J87A 1VYHC 4AOWA 2Z2NA 3GREA 4QQEA 4CI2A 3NVXA 2EBSA 3VH0A 2OVQB 4FAND 1N6FA 3N0DA 2B4EA 3F3PA 4R7AB 3EI1A 2B5NA 3UVNA 5EAMA 5TEEA 5AMSA 1XHMA 4Z8LA 4KFMB 4GGAA 3DSMA 4ZOYA 5GMKn 2OJYA 4PSWB 4CZVA 1L0QA 2PM6B 3RN0D 5IT9g 3BWSA 4EWRA 3SXTD 3AH8B 1YFQA 5FXYA 2G99A 4D6VA 4FWWA 2IWKA 3EI1B 3ZWLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBI B;  4K3I D;  4JSP C;  4A0B B;  2YBA A;  3PSC B;  5I5J A;  4UI9 R;  3IKO A;  4J86 A;  4O9D A;  4IMM A;  2HJ4 A;  2AH0 A;  4LG9 A;  2B5L A;  2PM9 A;  2AGZ A;  5K19 A;  3IIY A;  4OZU A;  3SJL D;  5IJ8 E;  2AGX A;  2CE8 A;  4ERQ A;  4O45 A;  4YVD A;  4ZN4 A;  1R5M A;  2CO0 C;  2MTA H;  2Q7Q A;  5FKS A;  4A08 B;  4E5Z B;  1FWX A;  5K1C C;  1N6E A;  2H6Q A;  4FB1 D;  5EAL A;  4A09 A;  3KRX B;  3ODT A;  3C99 A;  2PM7 B;  5HQG A;  3HFQ A;  4TZ4 A;  1TBG A;  2OVP B;  3GFC A;  3I89 A;  3OKT A;  1U2V C;  4J0X A;  5H14 A;  4D0K A;  3C75 H;  3I7O A;  4ZOV A;  2H9P A;  4A11 A;  1GOT B;  5IGO A;  3JRO A;  4J84 A;  1NEX B;  3E0C A;  3VA6 A;  4FA5 D;  2I0R A;  3EI2 A;  4J82 A;  4L9O A;  5GXI A;  2P9U C;  4U1E I;  2YNO A;  5FKT A;  5CXB B;  2XYI A;  3PVW B;  5KDO B;  3C5M A;  3K27 A;  2H9L A;  2AQ5 A;  4CZX A;  4L3G D;  3I7L A;  4PXW A;  1GXR A;  4NSX A;  4PC0 A;  4GMB A;  3EI2 B;  1JOF A;  1JMX B;  5FA5 B;  3RFG A;  3RN1 D;  1SHY B;  2XL2 A;  2I3S A;  2H9M A;  4ZOX A;  3MZL A;  3V7D B;  3C9C A;  2IAA A;  4J0W A;  3RRM C;  4BUJ C;  5I5I A;  2OVR B;  5CXC B;  4ES0 A;  4JT5 C;  4AEZ A;  1SQ9 A;  3SBP A;  2OK6 A;  5H17 A;  1SQJ A;  4O1Q D;  1N6D A;  2P9S C;  1GP2 B;  2QXV A;  3PXT D;  4L1Q D;  2IUR A;  5EAP A;  2AGW A;  5TDH B;  1JJU B;  5FKR A;  4L3H D;  3EI4 B;  4A2M A;  4H5I A;  3EMH A;  4FA4 D;  4CY1 A;  3SCY A;  2BBK H;  3EI4 A;  3IIW A;  3OTT A;  2H47 A;  3CFS B;  2UZY B;  5CXB A;  3PXS D;  1JMZ B;  3N0E A;  5HE0 B;  2P9K C;  1TYQ C;  3UVM A;  4FA1 D;  4GQB B;  4JT6 C;  2O9K A;  1K8K C;  3DWL C;  3JPX A;  3EI3 B;  4CI8 A;  3UVK A;  4BL0 A;  3FM0 A;  1XIP A;  3I7N A;  4Y7R A;  3I2N A;  4E54 A;  2XL3 A;  3OL2 B;  4PNK B;  1OLZ A;  4H5J A;  4CY5 A;  5A2Q g;  5C2W B;  2HES X;  4FHL A;  5EAR A;  5C9Z B;  4ZOZ A;  1QNI A;  2OIZ A;  2YNP A;  1PEV A;  1RI6 A;  3V5W B;  2YNN A;  2W18 A;  3J81 g;  4PBZ A;  3JZN A;  5CYK B;  5TF2 A;  4J79 A;  2TRC B;  4GZ8 A;  5EM2 A;  3SHF A;  4A09 B;  3NVN A;  4A0A B;  4CY2 A;  2PM9 B;  3IJ1 A;  2J56 H;  2P9L C;  4A2L A;  4E54 B;  3PVU B;  3BG0 A;  4J78 A;  3JZH A;  1PI6 A;  4PSX B;  3ORV D;  3I7P A;  3I7H A;  3IJC A;  2UZX B;  3RFH A;  3SWS D;  2H13 A;  2J55 H;  2H3X A;  3FGB A;  2CE9 A;  2I0S A;  3DXK C;  3MMY A;  4QL1 A;  5FLX g;  5TEF A;  4GGD A;  4LGN A;  3JZG A;  3V9F A;  2BCJ B;  4ERY A;  2HKM A;  2I0T A;  3PSL A;  4OWR A;  4A11 B;  4A0B A;  2YMU A;  4J8G A;  3L4O D;  4I79 A;  2H9N A;  4XYI A;  2GC4 A;  1PBY B;  3JB9 L;  2CO0 A;  3CFV A;  3EWE A;  4JSV C;  1A0R B;  3DXM C;  4JSX C;  5THA A;  5CXC A;  4X3E A;  3AL9 A;  2IUQ A;  3UVO A;  1GG2 B;  3OW8 A;  3UVL A;  5I5M A;  3UKR C;  1OMW B;  2H14 A;  4ERZ A;  2QC5 A;  1NR0 A;  4CI3 A;  2OK4 A;  4CC9 A;  4A0A A;  5AFU 3;  3OL2 A;  3EI3 A;  2J57 G;  3AL8 B;  3ULE C;  5EML B;  3EG6 A;  3CIK B;  3VGZ A;  4GM8 A;  3RSE C;  5SXM A;  5GXH A;  4HDJ A;  2AH1 A;  4JSN C;  1MG2 A;  5AJA A;  3SBQ A;  2G9A A;  2H68 A;  3SMR A;  3UR4 A;  1XKS A;  4FA9 D;  5HE1 B;  4J81 A;  3AL8 A;  3W15 A;  4QT8 A;  4O3T B;  4E5Z A;  3MXX A;  4XYH A;  3L4M D;  2P9I C;  4GQ2 P;  1K32 A;  3MKQ A;  2IUV A;  3SN6 B;  4BH6 A;  5EM2 B;  4GM9 A;  1B9Y A;  4J77 A;  5GSA A;  2IWF A;  2Z2P A;  3OKY B;  2B5M A;  4J8B A;  1S4U X;  3U4Y A;  4CY3 A;  2CN2 A;  3SBR A;  3B7F A;  3A0F A;  3JAM g;  3PE7 A;  3SFZ A;  2GC7 A;  4GM3 A;  3RLM D;  3EU7 A;  4PBY A;  4JXM A;  3OKY A;  3UKU C;  4X61 B;  4CZY A;  4XEI C;  4JD2 C;  2H6N A;  2YB8 B;  2HYE A;  4ESG A;  3SLE D;  4IA9 A;  4A08 A;  3SVW D;  5EMJ B;  4FAV D;  4CI1 A;  2P9P C;  3IJ0 A;  2HXC A;  3RMZ D;  4K3J B;  2P9N C;  4X63 B;  3K26 A;  3DM0 A;  5C2V B;  3F3F A;  5IGQ A;  3MKS B;  2IUP A;  1MDA H;  2HJB A;  2Z2O A;  5B4W A;  3PXW D;  4N14 A;  4G56 B;  5IC7 A;  4GQ1 A;  3OKW A;  1ERJ A;  3I8E A;  5CYK A;  3AFC A;  3I8C A;  5EMK B;  3J80 g;  3KRW B;  3P4F A;  1PGU A;  3JRP A;  3MZK A;  2CN3 A;  3I7K A;  4LG8 A;  5JWZ A;  4O3U B;  2GNQ A;  4MK0 B;  2CNX A;  1MG3 A;  2HKR A;  4X60 B;  4Y5R D;  2XU7 A;  4GGC A;  2H6K A;  4QRJ A;  1P22 A;  5FQD A;  5EMM B;  5HYN B;  5HE3 B;  3BG1 A;  5IJ7 E;  3NVQ A;  5HE2 B;  1B9X A;  1Q47 A;  2AGY A;  4A7J A;  2AGL A;  4J73 A;  4U7A A;  5FKQ A;  1U4C A;  2I3T A;  3FRX A;  5H1M A;  3F3G A;  4J87 A;  1VYH C;  4AOW A;  2Z2N A;  3GRE A;  4QQE A;  4CI2 A;  3NVX A;  2EBS A;  3VH0 A;  2OVQ B;  4FAN D;  1N6F A;  3N0D A;  2B4E A;  3F3P A;  4R7A B;  3EI1 A;  2B5N A;  3UVN A;  5EAM A;  5TEE A;  5AMS A;  1XHM A;  4Z8L A;  4KFM B;  4GGA A;  3DSM A;  4ZOY A;  5GMK n;  2OJY A;  4PSW B;  4CZV A;  1L0Q A;  2PM6 B;  3RN0 D;  5IT9 g;  3BWS A;  4EWR A;  3SXT D;  3AH8 B;  1YFQ A;  5FXY A;  2G99 A;  4D6V A;  4FWW A;  2IWK A;  3EI1 B;  3ZWL B; 
#chains in the Genus database with same CATH topology
 2PBI B;  4K3I D;  4JSP C;  5HDB A;  4A0B B;  2YBA A;  3PSC B;  1H2W A;  2EIC A;  5I5J A;  4UI9 R;  3IKO A;  4J86 A;  4O9D A;  3VI4 A;  4IMM A;  5C92 A;  2HJ4 A;  2AH0 A;  4LG9 A;  2B5L A;  2PM9 A;  2AGZ A;  3VI3 A;  5K19 A;  3IIY A;  4OZU A;  3SJL D;  1K3I A;  5IJ8 E;  2AGX A;  2CE8 A;  3IUM A;  4ERQ A;  4O45 A;  4YVD A;  4ZN4 A;  1R5M A;  2CO0 C;  2MTA H;  2Q7Q A;  5FKS A;  4A08 B;  3IVM A;  4E5Z B;  1FWX A;  2XDW A;  5K1C C;  1N6E A;  4L1M A;  2H6Q A;  4FB1 D;  3FCU A;  5EAL A;  4A09 A;  1H2Z A;  1E8M A;  3KRX B;  3ODT A;  4Z7O A;  3C99 A;  2PM7 B;  5HQG A;  3HFQ A;  4TZ4 A;  1TBG A;  4DNV A;  2OVP B;  3GFC A;  3I89 A;  3QI0 A;  3OKT A;  2HU7 A;  1U2V C;  2EID A;  4J0X A;  5H14 A;  4D0K A;  3C75 H;  3I7O A;  3IUL A;  4ZOV A;  2H9P A;  4A11 A;  1GOT B;  5IGO A;  3JRO A;  4J84 A;  3ZE0 A;  3NID A;  1NEX B;  3E0C A;  3VA6 A;  4FA5 D;  2I0R A;  3GC3 B;  3EI2 A;  4J82 A;  4L9O A;  5GXI A;  4DNW A;  2P9U C;  3NIG A;  4U1E I;  2YNO A;  5FKT A;  5CXB B;  2XYI A;  3PVW B;  5KDO B;  1H2Y A;  3C5M A;  3K27 A;  1UTC A;  2H9L A;  2AQ5 A;  4CZX A;  4L3G D;  2VC2 A;  1O6F A;  3I7L A;  4PXW A;  1GXR A;  4NSX A;  2VDM A;  3OF7 A;  4GMB A;  4PC0 A;  4AMY A;  5FFG A;  3EI2 B;  1JOF A;  4JHN A;  1JMX B;  5FA5 B;  1I2M B;  3RFG A;  1SHY B;  2VDL A;  3RN1 D;  2XL2 A;  2JKX A;  2I3S A;  2H9M A;  4ZOX A;  3MZL A;  3V7D B;  1GOH A;  3C9C A;  2IAA A;  4J0W A;  3RRM C;  4BUJ C;  2XZG A;  5I5I A;  2OVR B;  5CXC B;  1L5G A;  4ES0 A;  4JT5 C;  4AEZ A;  3EQ7 A;  1SQ9 A;  2XE4 A;  3SBP A;  2OK6 A;  5H17 A;  1SQJ A;  4O1Q D;  1N6D A;  2P9S C;  3ZE2 A;  1GP2 B;  5E6U A;  2QXV A;  3PXT D;  4L1Q D;  2IUR A;  5EAP A;  2AGW A;  5TDH B;  1JJU B;  1JV2 A;  5FKR A;  4L3H D;  3EI4 B;  4A2M A;  4H5I A;  4D9S A;  3EMH A;  4FA4 D;  4CY1 A;  3SCY A;  4IRZ A;  2BBK H;  4BCC A;  5M61 A;  1UOO A;  3EI4 A;  3IIW A;  3OTT A;  2VDR A;  2H47 A;  3CFS B;  4NEN A;  5M5V A;  3QHY B;  2UZY B;  1C9L A;  5CXB A;  3PXS D;  1JMZ B;  3N0E A;  5HE0 B;  2P9K C;  1TYQ C;  3UVM A;  4FA1 D;  4GQB B;  4JT6 C;  2O9K A;  1K8K C;  3DWL C;  3JPX A;  3EI3 B;  2HU5 A;  3KCI A;  4CI8 A;  3UVK A;  4BL0 A;  3FM0 A;  3T3M A;  1XIP A;  4RE6 A;  1QFS A;  3I7N A;  4Y7R A;  3I2N A;  4E54 A;  2XL3 A;  3OL2 B;  4PNK B;  1OLZ A;  4H5J A;  4CY5 A;  3K71 A;  4MMY A;  5A2Q g;  5M5U A;  5C2W B;  3MVD K;  2HES X;  4FHL A;  5EAR A;  5C9Z B;  4ZOZ A;  1QNI A;  2OIZ A;  2YNP A;  1PEV A;  1RI6 A;  5M5R A;  3V5W B;  2YNN A;  2W18 A;  3J81 g;  4PBZ A;  3JZN A;  5CYK B;  5TF2 A;  1VE6 A;  4J79 A;  2TRC B;  4GZ8 A;  5EM2 A;  3SHF A;  4AN0 A;  4A09 B;  3NVN A;  1VZ2 A;  1U8C A;  2VZ1 A;  4JHP C;  4A0A B;  4NAA A;  4CY2 A;  2PM9 B;  4BP8 A;  3IJ1 A;  2J56 H;  2P9L C;  4A2L A;  4E54 B;  3IJE A;  3PVU B;  3BG0 A;  3V4P A;  4J78 A;  3JZH A;  1PI6 A;  4PSX B;  3ORV D;  3I7P A;  3I7H A;  3IJC A;  2UZX B;  3RFH A;  3K72 A;  3SWS D;  2H13 A;  1M1X A;  2J55 H;  2H3X A;  3FGB A;  2CE9 A;  2I0S A;  2VZ3 A;  3DXK C;  3MMY A;  4WK2 A;  4QL1 A;  5FLX g;  5TEF A;  4GGD A;  4WK0 A;  2BKL A;  3O4I A;  3JZG A;  4LGN A;  2BCJ B;  3V9F A;  4ERY A;  2HKM A;  2I0T A;  1E8N A;  3PSL A;  4OWR A;  1O6G A;  1JTD B;  5E6R A;  4A11 B;  4A0B A;  2YMU A;  4J8G A;  3EQ8 A;  3L4O D;  4I79 A;  2H9N A;  3O4H A;  4XYI A;  2GC4 A;  1PBY B;  3JB9 L;  2CO0 A;  3CFV A;  3EWE A;  4JSV C;  4DNU A;  1A0R B;  3DXM C;  4JSX C;  5THA A;  4WJK A;  4G55 A;  4X3E A;  3AL9 A;  5CXC A;  2IUQ A;  3T3P A;  1GG2 B;  3UVO A;  3OW8 A;  3UVL A;  5I5M A;  3UKR C;  1GOG A;  1OMW B;  2H14 A;  4ERZ A;  2QC5 A;  1NR0 A;  1TYE A;  4CI3 A;  2OK4 A;  4CC9 A;  4A0A A;  5AFU 3;  3OL2 A;  3EI3 A;  2J57 G;  3AL8 B;  3ULE C;  4O2W A;  5EML B;  3EG6 A;  3CIK B;  3O4J A;  3VGZ A;  4GM8 A;  5E6S A;  3RSE C;  5SXM A;  5GXH A;  4HDJ A;  1YR2 A;  4QAM A;  2AH1 A;  4JSN C;  1MG2 A;  4AN1 A;  5AJA A;  3SBQ A;  3NIF A;  2G9A A;  2H68 A;  3SMR A;  3UR4 A;  1XKS A;  4FA9 D;  5HE1 B;  4J81 A;  3AL8 A;  1T2X A;  4Z7Q A;  3W15 A;  4QT8 A;  4O3T B;  4E5Z A;  3MXX A;  4XYH A;  1C9I A;  3L4M D;  2P9I C;  4NC4 A;  4GQ2 P;  1K32 A;  3GD1 I;  3MKQ A;  2IUV A;  3SN6 B;  4BH6 A;  5EM2 B;  4GM9 A;  1B9Y A;  4J77 A;  5GSA A;  3OKY B;  2IWF A;  2Z2P A;  2B5M A;  3MUO A;  4J8B A;  4NBM A;  1S4U X;  3U4Y A;  4CY3 A;  2CN2 A;  3SBR A;  3B7F A;  3A0F A;  3JAM g;  3PE7 A;  2VDN A;  3SFZ A;  2GC7 A;  3ZDX A;  4GM3 A;  3RLM D;  3EU7 A;  5FFO A;  4PBY A;  4JXM A;  3OKY A;  3UKU C;  4O02 A;  2VDO A;  4X61 B;  4CZY A;  1QFM A;  4XEI C;  2EIE A;  4JD2 C;  2H6N A;  1VZ3 A;  2YB8 B;  4G1M A;  4ESG A;  2HYE A;  3SLE D;  4IA9 A;  4A08 A;  3SVW D;  4BP9 A;  4BCD A;  5EMJ B;  3V4V A;  3K6S A;  4MMX A;  4FAV D;  4CI1 A;  3IUJ A;  2P9P C;  1UOP A;  3IJ0 A;  2HXC A;  3ZE1 A;  3RMZ D;  4K3J B;  2P9N C;  4X63 B;  3K26 A;  3DM0 A;  5C2V B;  1VE7 A;  3F3F A;  5IGQ A;  2HU8 A;  3MKS B;  2IUP A;  1MDA H;  2HJB A;  2Z2O A;  5B4W A;  3PXW D;  4N14 A;  3MUN A;  4BCB A;  4G56 B;  5M5T A;  2VDP A;  4GQ1 A;  5IC7 A;  1H2X A;  2QZP A;  3OKW A;  1ERJ A;  3I8E A;  5CYK A;  3AFC A;  3I8C A;  5EMK B;  3J80 g;  1GOF A;  3KRW B;  3P4F A;  1PGU A;  3IUQ A;  3JRP A;  3MZK A;  1A12 A;  2CN3 A;  3I7K A;  4LG8 A;  3IUR A;  5JWZ A;  4O3U B;  2GNQ A;  4MK0 B;  2CNX A;  2WQ8 A;  1MG3 A;  2HKR A;  4X60 B;  4Y5R D;  2XU7 A;  4GGC A;  2H6K A;  4QRJ A;  4WK4 A;  1P22 A;  2EIB A;  5FQD A;  5EMM B;  5HYN B;  5HE3 B;  3BG1 A;  5IJ7 E;  4Z7N A;  5C86 A;  3ZDZ A;  3NVQ A;  5HE2 B;  1B9X A;  1Q47 A;  2AGY A;  4A7J A;  2AGL A;  4J73 A;  4U7A A;  5FKQ A;  1U4C A;  4G1E A;  2I3T A;  3FRX A;  5H1M A;  3F3G A;  4RE5 A;  4J87 A;  3IUN A;  1VYH C;  4AOW A;  4UM8 A;  1BPO A;  2Z2N A;  3GRE A;  4QQE A;  1E5T A;  4CI2 A;  4AX4 A;  3NVX A;  2EBS A;  3VH0 A;  3O4G A;  4AMZ A;  2OVQ B;  4FAN D;  1N6F A;  3N0D A;  2B4E A;  3F3P A;  4R7A B;  3EI1 A;  2B5N A;  3UVN A;  1UOQ A;  5EAM A;  3EQ9 A;  4MMZ A;  5TEE A;  5AMS A;  1XHM A;  2VDQ A;  3ZDY A;  4Z8L A;  4KFM B;  4GGA A;  3DSM A;  2VDK A;  3FCS A;  4ZOY A;  5GMK n;  2OJY A;  4PSW B;  4UM9 A;  2QR5 A;  4CZV A;  1L0Q A;  2PM6 B;  3RN0 D;  5IT9 g;  3BWS A;  4EWR A;  5M5S A;  3SXT D;  3AH8 B;  1YFQ A;  5FXY A;  2G99 A;  4D6V A;  3DDU A;  4FWW A;  2IWK A;  3EI1 B;  3ZWL B; 
#chains in the Genus database with same CATH homology
 2PBI B;  4K3I D;  4JSP C;  4A0B B;  2YBA A;  3PSC B;  5I5J A;  4UI9 R;  3IKO A;  4J86 A;  4O9D A;  4IMM A;  2HJ4 A;  2AH0 A;  4LG9 A;  2B5L A;  2PM9 A;  2AGZ A;  5K19 A;  3IIY A;  4OZU A;  3SJL D;  5IJ8 E;  2AGX A;  2CE8 A;  4ERQ A;  4O45 A;  4YVD A;  4ZN4 A;  1R5M A;  2CO0 C;  2MTA H;  2Q7Q A;  5FKS A;  4A08 B;  4E5Z B;  1FWX A;  5K1C C;  1N6E A;  2H6Q A;  4FB1 D;  5EAL A;  4A09 A;  3KRX B;  3ODT A;  3C99 A;  2PM7 B;  5HQG A;  3HFQ A;  4TZ4 A;  1TBG A;  2OVP B;  3GFC A;  3I89 A;  3OKT A;  1U2V C;  4J0X A;  5H14 A;  4D0K A;  3C75 H;  3I7O A;  4ZOV A;  2H9P A;  4A11 A;  1GOT B;  5IGO A;  3JRO A;  4J84 A;  1NEX B;  3E0C A;  3VA6 A;  4FA5 D;  2I0R A;  3EI2 A;  4J82 A;  4L9O A;  5GXI A;  2P9U C;  4U1E I;  2YNO A;  5FKT A;  5CXB B;  2XYI A;  3PVW B;  5KDO B;  3C5M A;  3K27 A;  2H9L A;  2AQ5 A;  4CZX A;  4L3G D;  3I7L A;  4PXW A;  1GXR A;  4NSX A;  4PC0 A;  4GMB A;  3EI2 B;  1JOF A;  1JMX B;  5FA5 B;  3RFG A;  3RN1 D;  1SHY B;  2XL2 A;  2I3S A;  2H9M A;  4ZOX A;  3MZL A;  3V7D B;  3C9C A;  2IAA A;  4J0W A;  3RRM C;  4BUJ C;  5I5I A;  2OVR B;  5CXC B;  4ES0 A;  4JT5 C;  4AEZ A;  1SQ9 A;  3SBP A;  2OK6 A;  5H17 A;  1SQJ A;  4O1Q D;  1N6D A;  2P9S C;  1GP2 B;  2QXV A;  3PXT D;  4L1Q D;  2IUR A;  5EAP A;  2AGW A;  5TDH B;  1JJU B;  5FKR A;  4L3H D;  3EI4 B;  4A2M A;  4H5I A;  3EMH A;  4FA4 D;  4CY1 A;  3SCY A;  2BBK H;  3EI4 A;  3IIW A;  3OTT A;  2H47 A;  3CFS B;  2UZY B;  5CXB A;  3PXS D;  1JMZ B;  3N0E A;  5HE0 B;  2P9K C;  1TYQ C;  3UVM A;  4FA1 D;  4GQB B;  4JT6 C;  2O9K A;  1K8K C;  3DWL C;  3JPX A;  3EI3 B;  4CI8 A;  3UVK A;  4BL0 A;  3FM0 A;  1XIP A;  3I7N A;  4Y7R A;  3I2N A;  4E54 A;  2XL3 A;  3OL2 B;  4PNK B;  1OLZ A;  4H5J A;  4CY5 A;  5A2Q g;  5C2W B;  2HES X;  4FHL A;  5EAR A;  5C9Z B;  4ZOZ A;  1QNI A;  2OIZ A;  2YNP A;  1PEV A;  1RI6 A;  3V5W B;  2YNN A;  2W18 A;  3J81 g;  4PBZ A;  3JZN A;  5CYK B;  5TF2 A;  4J79 A;  2TRC B;  4GZ8 A;  5EM2 A;  3SHF A;  4A09 B;  3NVN A;  4A0A B;  4CY2 A;  2PM9 B;  3IJ1 A;  2J56 H;  2P9L C;  4A2L A;  4E54 B;  3PVU B;  3BG0 A;  4J78 A;  3JZH A;  1PI6 A;  4PSX B;  3ORV D;  3I7P A;  3I7H A;  3IJC A;  2UZX B;  3RFH A;  3SWS D;  2H13 A;  2J55 H;  2H3X A;  3FGB A;  2CE9 A;  2I0S A;  3DXK C;  3MMY A;  4QL1 A;  5FLX g;  5TEF A;  4GGD A;  4LGN A;  3JZG A;  3V9F A;  2BCJ B;  4ERY A;  2HKM A;  2I0T A;  3PSL A;  4OWR A;  4A11 B;  4A0B A;  2YMU A;  4J8G A;  3L4O D;  4I79 A;  2H9N A;  4XYI A;  2GC4 A;  1PBY B;  3JB9 L;  2CO0 A;  3CFV A;  3EWE A;  4JSV C;  1A0R B;  3DXM C;  4JSX C;  5THA A;  5CXC A;  4X3E A;  3AL9 A;  2IUQ A;  3UVO A;  1GG2 B;  3OW8 A;  3UVL A;  5I5M A;  3UKR C;  1OMW B;  2H14 A;  4ERZ A;  2QC5 A;  1NR0 A;  4CI3 A;  2OK4 A;  4CC9 A;  4A0A A;  5AFU 3;  3OL2 A;  3EI3 A;  2J57 G;  3AL8 B;  3ULE C;  5EML B;  3EG6 A;  3CIK B;  3VGZ A;  4GM8 A;  3RSE C;  5SXM A;  5GXH A;  4HDJ A;  2AH1 A;  4JSN C;  1MG2 A;  5AJA A;  3SBQ A;  2G9A A;  2H68 A;  3SMR A;  3UR4 A;  1XKS A;  4FA9 D;  5HE1 B;  4J81 A;  3AL8 A;  3W15 A;  4QT8 A;  4O3T B;  4E5Z A;  3MXX A;  4XYH A;  3L4M D;  2P9I C;  4GQ2 P;  1K32 A;  3MKQ A;  2IUV A;  3SN6 B;  4BH6 A;  5EM2 B;  4GM9 A;  1B9Y A;  4J77 A;  5GSA A;  2IWF A;  2Z2P A;  3OKY B;  2B5M A;  4J8B A;  1S4U X;  3U4Y A;  4CY3 A;  2CN2 A;  3SBR A;  3B7F A;  3A0F A;  3JAM g;  3PE7 A;  3SFZ A;  2GC7 A;  4GM3 A;  3RLM D;  3EU7 A;  4PBY A;  4JXM A;  3OKY A;  3UKU C;  4X61 B;  4CZY A;  4XEI C;  4JD2 C;  2H6N A;  2YB8 B;  2HYE A;  4ESG A;  3SLE D;  4IA9 A;  4A08 A;  3SVW D;  5EMJ B;  4FAV D;  4CI1 A;  2P9P C;  3IJ0 A;  2HXC A;  3RMZ D;  4K3J B;  2P9N C;  4X63 B;  3K26 A;  3DM0 A;  5C2V B;  3F3F A;  5IGQ A;  3MKS B;  2IUP A;  1MDA H;  2HJB A;  2Z2O A;  5B4W A;  3PXW D;  4N14 A;  4G56 B;  5IC7 A;  4GQ1 A;  3OKW A;  1ERJ A;  3I8E A;  5CYK A;  3AFC A;  3I8C A;  5EMK B;  3J80 g;  3KRW B;  3P4F A;  1PGU A;  3JRP A;  3MZK A;  2CN3 A;  3I7K A;  4LG8 A;  5JWZ A;  4O3U B;  2GNQ A;  4MK0 B;  2CNX A;  1MG3 A;  2HKR A;  4X60 B;  4Y5R D;  2XU7 A;  4GGC A;  2H6K A;  4QRJ A;  1P22 A;  5FQD A;  5EMM B;  5HYN B;  5HE3 B;  3BG1 A;  5IJ7 E;  3NVQ A;  5HE2 B;  1B9X A;  1Q47 A;  2AGY A;  4A7J A;  2AGL A;  4J73 A;  4U7A A;  5FKQ A;  1U4C A;  2I3T A;  3FRX A;  5H1M A;  3F3G A;  4J87 A;  1VYH C;  4AOW A;  2Z2N A;  3GRE A;  4QQE A;  4CI2 A;  3NVX A;  2EBS A;  3VH0 A;  2OVQ B;  4FAN D;  1N6F A;  3N0D A;  2B4E A;  3F3P A;  4R7A B;  3EI1 A;  2B5N A;  3UVN A;  5EAM A;  5TEE A;  5AMS A;  1XHM A;  4Z8L A;  4KFM B;  4GGA A;  3DSM A;  4ZOY A;  5GMK n;  2OJY A;  4PSW B;  4CZV A;  1L0Q A;  2PM6 B;  3RN0 D;  5IT9 g;  3BWS A;  4EWR A;  3SXT D;  3AH8 B;  1YFQ A;  5FXY A;  2G99 A;  4D6V A;  4FWW A;  2IWK A;  3EI1 B;  3ZWL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...