3EG6A

Structure of wdr5 bound to mll1 peptide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Structure of WDR5 bound to mixed lineage leukemia protein-1 peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 104
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3eg6A00
3AL8B 4A2MA 4CY2A 1JOFA 3IJ0A 1NR0A 5TF2A 2I0SA 3SWSD 1P22A 4GZ8A 4FAVD 2AH1A 2H14A 3N0DA 5GSAA 3C9CA 3IIYA 2BCJB 4N14A 1U4CA 3N0EA 3AL8A 4ERYA 3PXTD 2UZYB 2AQ5A 1SQJA 2AGLA 3SFZA 3J81g 4A0BB 2CO0A 3I7OA 4ESGA 2YNPA 5C9ZB 5IC7A 3F3PA 2IWFA 4FHLA 4GQBB 3MKQA 4CZXA 2HKMA 3SN6B 4XEIC 4XYHA 4X61B 5EARA 5FA5B 4A0BA 4Z8LA 2P9KC 4PC0A 5IGQA 2GNQA 5EAPA 4TZ4A 1JJUB 4CY5A 4AEZA 4CZYA 4AOWA 5EM2B 2HYEA 4ZN4A 3RN0D 4JSNC 4PNKB 3OW8A 4YVDA 3BG1A 3EI2A 5EM2A 3UKRC 4JXMA 5AJAA 2I0RA 3C99A 3VA6A 4GM3A 3ULEC 4J79A 4FB1D 2IUPA 1SQ9A 3MZKA 5HE2B 5TEFA 4A11A 3K27A 3EI4A 3JAMg 2PBIB 4GGDA 2OK4A 4O9DA 4PSXB 2H9NA 3I7HA 2IURA 5TEEA 2OVQB 4L3GD 3SHFA 2G9AA 2Q7QA 3JRPA 2P9NC 3AFCA 4GGCA 4X3EA 5FKTA 5KDOB 2HJBA 5TDHB 4IA9A 1GP2B 3A0FA 1NEXB 3RFHA 2PM6B 4R7AB 1MG2A 3MKSB 2H6KA 1XHMA 4FA5D 3DM0A 4I79A 4A09A 1QNIA 5CYKA 4QT8A 3RLMD 3SBRA 4E54B 4A08B 2I0TA 3V9FA 4CY3A 1B9XA 2H9LA 2IUVA 3UVOA 3BWSA 3VH0A 4J82A 1JMZB 3JZGA 3NVNA 4E54A 4ERQA 4A08A 3C75H 3GREA 5B4WA 2IWKA 1N6DA 4L9OA 2AGWA 4CI8A 4FA1D 3PVUB 2OVPB 3RRMC 1YFQA 2B5MA 1MDAH 2XL2A 4GQ2P 4U7AA 4D6VA 3ORVD 2AGZA 2J55H 2B4EA 3EG6A 4L3HD 4CC9A 1B9YA 4X63B 3IIWA 1XIPA 1OMWB 2PM7B 4D0KA 2UZXB 2I3TA 4LG8A 2QC5A 4QL1A 4ZOVA 1A0RB 3I7PA 1GXRA 3OKTA 5HE3B 1FWXA 5EMJB 3SVWD 1PGUA 3GFCA 3SLED 2P9SC 4JSPC 5FKQA 4HDJA 3SCYA 5I5IA 2GC7A 4A0AA 5I5MA 3EI2B 4UI9R 2I3SA 4NSXA 3FGBA 4J86A 5HQGA 4XYIA 4JT6C 3RN1D 3E0CA 4J78A 1GOTB 2XU7A 1N6EA 3F3GA 4J87A 3UVNA 3BG0A 5HE1B 3ZWLB 3FM0A 4A11B 3EI4B 3L4MD 1XKSA 4PSWB 4PBZA 4ZOXA 2AGXA 4J73A 3SBPA 2H6QA 3PSLA 3CIKB 4PBYA 3ODTA 3JZNA 5EMLB 5IJ7E 2B5NA 4OWRA 3CFVA 1RI6A 2CN3A 4GM9A 4G56B 3UKUC 1PI6A 3I7KA 2EBSA 4A09B 1PBYB 5JWZA 3EMHA 4GMBA 2OVRB 2IUQA 5CYKB 2OK6A 5EMMB 5GXHA 4FA9D 5K1CC 4GQ1A 4ERZA 4BH6A 4J8GA 4J0WA 2CNXA 4FAND 3IJ1A 3OL2A 4L1QD 2J56H 2CE8A 2G99A 4X60B 3SBQA 1ERJA 1MG3A 3RSEC 3NVQA 4Y5RD 3PVWB 5CXCB 5CXBA 4Y7RA 3UVMA 5K19A 4JSXC 4E5ZA 2TRCB 3J80g 1TYQC 5CXCA 3MZLA 4A7JA 2HESX 3CFSB 3P4FA 4K3ID 4CI3A 3DXMC 1N6FA 1K8KC 1GG2B 3JZHA 5HYNB 3KRWB 2OIZA 3U4YA 5SXMA 5AMSA 3I2NA 1VYHC 3I8EA 4JT5C 4PXWA 4IMMA 2XYIA 2OJYA 5FXYA 3FRXA 3UVLA 4LGNA 2HXCA 3L4OD 1K32A 2YNOA 3I7NA 5AFU3 3W15A 2YNNA 4MK0B 2CE9A 2PM9B 3OTTA 2Z2OA 5A2Qg 2H13A 1S4UX 4J0XA 4A0AB 3SXTD 3AH8B 4JD2C 4J8BA 2PM9A 3PSCB 1Q47A 4O3UB 4O1QD 2AGYA 4O3TB 2H6NA 5IJ8E 2P9UC 3C5MA 3RMZD 4KFMB 3NVXA 5I5JA 4CI2A 3EWEA 5IT9g 5FQDA 2H68A 4J81A 2YBAA 5EMKB 5EALA 3MXXA 4GM8A 2HJ4A 1PEVA 5EAMA 4OZUA 3RFGA 3VGZA 5C2VB 1SHYB 5H1MA 3I8CA 3IKOA 2CN2A 5FKRA 4BL0A 2H9PA 1OLZA 3MMYA 4J77A 4A2LA 3PXSD 3PE7A 4JSVC 3SJLD 1L0QA 2IAAA 4GGAA 2H3XA 5C2WB 3EI1B 2J57G 3V7DB 4FWWA 4ZOYA 4O45A 2O9KA 3OL2B 2H9MA 5GXIA 3SMRA 1TBGA 4U1EI 5H14A 3EI1A 4CY1A 2XL3A 3PXWD 2H47A 3B7FA 3F3FA 2GC4A 5CXBB 1R5MA 5FKSA 3EI3B 3KRXB 3I89A 4H5JA 4QRJA 1JMXB 3K26A 4E5ZB 4CZVA 4ZOZA 2YMUA 3I7LA 2QXVA 4K3JB 3OKWA 5H17A 3EI3A 4QQEA 3JB9L 2Z2NA 2BBKH 1U2VC 5IGOA 3JPXA 3UR4A 3DSMA 5FLXg 4LG9A 4EWRA 2W18A 2MTAH 2CO0C 4BUJC 4ES0A 2HKRA 3IJCA 2B5LA 3HFQA 5HE0B 3JROA 5GMKn 5THAA 2Z2PA 2AH0A 3DWLC 4H5IA 2P9IC 3OKYB 2P9LC 2YB8B 3UVKA 3DXKC 2P9PC 4FA4D 4J84A 4CI1A 3AL9A 3OKYA 3V5WB 3EU7A
chains in the Genus database with same CATH superfamily
3AL8B 4A2MA 4CY2A 1JOFA 3IJ0A 1NR0A 5TF2A 2I0SA 3SWSD 1P22A 4GZ8A 4FAVD 2AH1A 2H14A 3N0DA 4AMZA 5GSAA 3C9CA 3IIYA 2BCJB 4N14A 1U4CA 4Z7QA 3N0EA 3AL8A 4ERYA 3PXTD 2UZYB 2AQ5A 1SQJA 2AGLA 4NBMA 1UOPA 1GOFA 3SFZA 3J81g 4A0BB 2CO0A 3I7OA 4ESGA 2YNPA 5C9ZB 5IC7A 3F3PA 2IWFA 4FHLA 4G55A 3O4HA 4BCCA 4GQBB 3MKQA 3T3PA 4CZXA 2HKMA 3SN6B 4XEIC 4XYHA 4X61B 5EARA 1U8CA 1VE6A 2XDWA 5FA5B 4A0BA 4Z8LA 2P9KC 4PC0A 5IGQA 2GNQA 5EAPA 4TZ4A 1JJUB 4CY5A 4AEZA 4CZYA 4AOWA 5EM2B 2HYEA 4ZN4A 3RN0D 4JSNC 4PNKB 3OW8A 4YVDA 3BG1A 3EI2A 3NIFA 4AMYA 3ZE1A 1H2WA 2XE4A 3IUQA 1A12A 5EM2A 3UKRC 4JXMA 3EQ7A 5AJAA 2EIDA 2I0RA 3C99A 4RE5A 3VA6A 4GM3A 3ULEC 4J79A 4FB1D 2IUPA 1SQ9A 3MZKA 5HE2B 5TEFA 2VDOA 4A11A 3K27A 3EI4A 3IJEA 3JAMg 2PBIB 4GGDA 2OK4A 4O9DA 4PSXB 1VE7A 1H2ZA 2H9NA 3I7HA 2IURA 3MUOA 5TEEA 2OVQB 4L3GD 3SHFA 1GOGA 2VDQA 2G9AA 5M5VA 2Q7QA 3JRPA 3ZE2A 2P9NC 3AFCA 4GGCA 4X3EA 5FKTA 5KDOB 2HJBA 5TDHB 4IA9A 3FCUA 4G1EA 1GP2B 3A0FA 1NEXB 3RFHA 2PM6B 4MMZA 4R7AB 1MG2A 3MKSB 2H6KA 1XHMA 4FA5D 3DM0A 4I79A 4A09A 1QNIA 5CYKA 3GC3B 3O4IA 4QT8A 1H2XA 3RLMD 4AN1A 2XZGA 3SBRA 4DNWA 3KCIA 4E54B 4A08B 2I0TA 3V9FA 4CY3A 1B9XA 2H9LA 2IUVA 4JHNA 3OF7A 3UVOA 2HU5A 3BWSA 3VH0A 3IUNA 4J82A 1JMZB 3JZGA 3NVNA 4E54A 1M1XA 5E6UA 4ERQA 4A08A 3C75H 3ZE0A 3GREA 5B4WA 4WK4A 2IWKA 1N6DA 1UOOA 3VI4A 4L9OA 2AGWA 3QHYB 4CI8A 4QAMA 4FA1D 2VDMA 2OVPB 3PVUB 1UTCA 3RRMC 1YFQA 2B5MA 1MDAH 2XL2A 3V4PA 4GQ2P 4U7AA 4D6VA 3ORVD 2AGZA 2J55H 2B4EA 3EG6A 4L3HD 4CC9A 1B9YA 4X63B 3IIWA 1GOHA 1XIPA 1OMWB 2PM7B 4D0KA 2UZXB 2I3TA 4WK2A 4UM8A 4LG8A 3K71A 2QC5A 5M5RA 4QL1A 4ZOVA 1A0RB 3I7PA 1BPOA 1GXRA 4BP9A 3OKTA 5HE3B 3GD1I 1FWXA 5EMJB 3SVWD 1PGUA 3GFCA 3SLED 2VDNA 4Z7NA 4NENA 2P9SC 3QI0A 4JSPC 5FKQA 1E8MA 4HDJA 3SCYA 5I5IA 2GC7A 4A0AA 4JHPC 5I5MA 3EI2B 4UI9R 2I3SA 3IUJA 4NSXA 3ZDXA 3FGBA 4J86A 5HQGA 4XYIA 4JT6C 1QFSA 2WQ8A 3RN1D 3E0CA 5FFOA 4J78A 5M61A 1GOTB 2XU7A 1N6EA 4BCDA 3F3GA 2EICA 4J87A 3UVNA 3BG0A 5C86A 5HE1B 3ZWLB 3FM0A 4A11B 3EI4B 3L4MD 1XKSA 1T2XA 4PSWB 4PBZA 4ZOXA 2HU7A 2AGXA 4J73A 3SBPA 2H6QA 3DDUA 3PSLA 2VZ1A 3CIKB 4PBYA 4DNVA 3ODTA 3JZNA 5EMLB 4IRZA 5IJ7E 3VI3A 2B5NA 5HDBA 4OWRA 3CFVA 1RI6A 2CN3A 3MVDK 4GM9A 4G56B 3UKUC 1PI6A 3I7KA 4MMXA 2EBSA 4A09B 1PBYB 5JWZA 3EMHA 4GMBA 2OVRB 2IUQA 5CYKB 2OK6A 5EMMB 5GXHA 4FA9D 4WK0A 4NC4A 5K1CC 4GQ1A 4ERZA 2EIBA 4BH6A 4J8GA 3ZDYA 4J0WA 2CNXA 4FAND 3IJ1A 1C9LA 3OL2A 2J56H 3K72A 4L1QD 4WJKA 2QZPA 2CE8A 2G99A 4X60B 3SBQA 1ERJA 1MG3A 1VZ2A 3RSEC 4NAAA 3NVQA 4Y5RD 4O2WA 3PVWB 5CXCB 5CXBA 2VDLA 2BKLA 5M5UA 4Y7RA 3UVMA 5K19A 4JSXC 4E5ZA 2TRCB 3J80g 1TYQC 5CXCA 3MZLA 4A7JA 2HESX 3CFSB 3P4FA 4K3ID 4CI3A 3DXMC 2VDRA 3NIDA 1N6FA 1K8KC 3EQ9A 1L5GA 1GG2B 3JZHA 5HYNB 3KRWB 2OIZA 3U4YA 1TYEA 5SXMA 5AMSA 3I2NA 1VYHC 3I8EA 3MUNA 4JT5C 4PXWA 4IMMA 2XYIA 2OJYA 5FXYA 3FCSA 3FRXA 3UVLA 4LGNA 2HXCA 3L4OD 5C92A 1K32A 2YNOA 3I7NA 2VDKA 5AFU3 3IURA 3W15A 2YNNA 4MK0B 2CE9A 2PM9B 2HU8A 3OTTA 2Z2OA 5A2Qg 4DNUA 2H13A 1S4UX 4J0XA 4A0AB 1C9IA 3SXTD 3AH8B 4D9SA 4JD2C 4J8BA 3IVMA 2PM9A 5M5SA 1I2MB 1UOQA 2JKXA 3PSCB 1Q47A 2QR5A 4O3UB 4O1QD 2VDPA 2AGYA 4O3TB 2H6NA 4UM9A 3V4VA 2P9UC 5IJ8E 1YR2A 3C5MA 3RMZD 4MMYA 4KFMB 2VC2A 3ZDZA 3NVXA 5I5JA 4CI2A 1QFMA 3EWEA 4RE6A 5IT9g 5FQDA 2H68A 3O4GA 4J81A 2YBAA 5EMKB 5EALA 3MXXA 4GM8A 2HJ4A 1PEVA 5EAMA 1E8NA 4OZUA 3RFGA 3VGZA 5C2VB 1SHYB 3O4JA 4AX4A 1H2YA 5H1MA 3I8CA 1E5TA 3IKOA 2CN2A 3IULA 5FKRA 4BL0A 4Z7OA 2H9PA 1OLZA 3MMYA 4J77A 4A2LA 3PXSD 3PE7A 4L1MA 4JSVC 3SJLD 1L0QA 2IAAA 4GGAA 2H3XA 5C2WB 3EI1B 2J57G 3V7DB 4FWWA 4ZOYA 4O45A 2O9KA 1VZ3A 3OL2B 2H9MA 3NIGA 5GXIA 3SMRA 1TBGA 4U1EI 5H14A 3EI1A 4AN0A 4CY1A 1O6FA 2XL3A 3PXWD 3IUMA 4G1MA 2H47A 3B7FA 2EIEA 3F3FA 4O02A 2GC4A 5CXBB 1JTDB 1R5MA 5FKSA 3EI3B 3KRXB 5M5TA 3I89A 4H5JA 4QRJA 1JMXB 3K26A 4E5ZB 4CZVA 4ZOZA 2YMUA 5FFGA 3I7LA 1O6GA 2QXVA 4K3JB 3OKWA 2VZ3A 5H17A 3EI3A 4QQEA 3JB9L 2Z2NA 2BBKH 1U2VC 5IGOA 3JPXA 3UR4A 3DSMA 5FLXg 4LG9A 4EWRA 2W18A 2MTAH 2CO0C 4BUJC 4ES0A 3T3MA 2HKRA 3IJCA 2B5LA 3HFQA 5HE0B 3K6SA 3JROA 4BCBA 5GMKn 5THAA 2Z2PA 2AH0A 3DWLC 1JV2A 4H5IA 2P9IC 3OKYB 2P9LC 2YB8B 3UVKA 3DXKC 4BP8A 2P9PC 4FA4D 3EQ8A 4J84A 5E6RA 4CI1A 3AL9A 5E6SA 1K3IA 3OKYA 3V5WB 3EU7A
chains in the Genus database with same CATH topology
3AL8B 4A2MA 4CY2A 1JOFA 3IJ0A 1NR0A 5TF2A 2I0SA 3SWSD 1P22A 4GZ8A 4FAVD 2AH1A 2H14A 3N0DA 5GSAA 3C9CA 3IIYA 2BCJB 4N14A 1U4CA 3N0EA 3AL8A 4ERYA 3PXTD 2UZYB 2AQ5A 1SQJA 2AGLA 3SFZA 3J81g 4A0BB 2CO0A 3I7OA 4ESGA 2YNPA 5C9ZB 5IC7A 3F3PA 2IWFA 4FHLA 4GQBB 3MKQA 4CZXA 2HKMA 3SN6B 4XEIC 4XYHA 4X61B 5EARA 5FA5B 4A0BA 4Z8LA 2P9KC 4PC0A 5IGQA 2GNQA 5EAPA 4TZ4A 1JJUB 4CY5A 4AEZA 4CZYA 4AOWA 5EM2B 2HYEA 4ZN4A 3RN0D 4JSNC 4PNKB 3OW8A 4YVDA 3BG1A 3EI2A 5EM2A 3UKRC 4JXMA 5AJAA 2I0RA 3C99A 3VA6A 4GM3A 3ULEC 4J79A 4FB1D 2IUPA 1SQ9A 3MZKA 5HE2B 5TEFA 4A11A 3K27A 3EI4A 3JAMg 2PBIB 4GGDA 2OK4A 4O9DA 4PSXB 2H9NA 3I7HA 2IURA 5TEEA 2OVQB 4L3GD 3SHFA 2G9AA 2Q7QA 3JRPA 2P9NC 3AFCA 4GGCA 4X3EA 5FKTA 5KDOB 2HJBA 5TDHB 4IA9A 1GP2B 3A0FA 1NEXB 3RFHA 2PM6B 4R7AB 1MG2A 3MKSB 2H6KA 1XHMA 4FA5D 3DM0A 4I79A 4A09A 1QNIA 5CYKA 4QT8A 3RLMD 3SBRA 4E54B 4A08B 2I0TA 3V9FA 4CY3A 1B9XA 2H9LA 2IUVA 3UVOA 3BWSA 3VH0A 4J82A 1JMZB 3JZGA 3NVNA 4E54A 4ERQA 4A08A 3C75H 3GREA 5B4WA 2IWKA 1N6DA 4L9OA 2AGWA 4CI8A 4FA1D 3PVUB 2OVPB 3RRMC 1YFQA 2B5MA 1MDAH 2XL2A 4GQ2P 4U7AA 4D6VA 3ORVD 2AGZA 2J55H 2B4EA 3EG6A 4L3HD 4CC9A 1B9YA 4X63B 3IIWA 1XIPA 1OMWB 2PM7B 4D0KA 2UZXB 2I3TA 4LG8A 2QC5A 4QL1A 4ZOVA 1A0RB 3I7PA 1GXRA 3OKTA 5HE3B 1FWXA 5EMJB 3SVWD 1PGUA 3GFCA 3SLED 2P9SC 4JSPC 5FKQA 4HDJA 3SCYA 5I5IA 2GC7A 4A0AA 5I5MA 3EI2B 4UI9R 2I3SA 4NSXA 3FGBA 4J86A 5HQGA 4XYIA 4JT6C 3RN1D 3E0CA 4J78A 1GOTB 2XU7A 1N6EA 3F3GA 4J87A 3UVNA 3BG0A 5HE1B 3ZWLB 3FM0A 4A11B 3EI4B 3L4MD 1XKSA 4PSWB 4PBZA 4ZOXA 2AGXA 4J73A 3SBPA 2H6QA 3PSLA 3CIKB 4PBYA 3ODTA 3JZNA 5EMLB 5IJ7E 2B5NA 4OWRA 3CFVA 1RI6A 2CN3A 4GM9A 4G56B 3UKUC 1PI6A 3I7KA 2EBSA 4A09B 1PBYB 5JWZA 3EMHA 4GMBA 2OVRB 2IUQA 5CYKB 2OK6A 5EMMB 5GXHA 4FA9D 5K1CC 4GQ1A 4ERZA 4BH6A 4J8GA 4J0WA 2CNXA 4FAND 3IJ1A 3OL2A 4L1QD 2J56H 2CE8A 2G99A 4X60B 3SBQA 1ERJA 1MG3A 3RSEC 3NVQA 4Y5RD 3PVWB 5CXCB 5CXBA 4Y7RA 3UVMA 5K19A 4JSXC 4E5ZA 2TRCB 3J80g 1TYQC 5CXCA 3MZLA 4A7JA 2HESX 3CFSB 3P4FA 4K3ID 4CI3A 3DXMC 1N6FA 1K8KC 1GG2B 3JZHA 5HYNB 3KRWB 2OIZA 3U4YA 5SXMA 5AMSA 3I2NA 1VYHC 3I8EA 4JT5C 4PXWA 4IMMA 2XYIA 2OJYA 5FXYA 3FRXA 3UVLA 4LGNA 2HXCA 3L4OD 1K32A 2YNOA 3I7NA 5AFU3 3W15A 2YNNA 4MK0B 2CE9A 2PM9B 3OTTA 2Z2OA 5A2Qg 2H13A 1S4UX 4J0XA 4A0AB 3SXTD 3AH8B 4JD2C 4J8BA 2PM9A 3PSCB 1Q47A 4O3UB 4O1QD 2AGYA 4O3TB 2H6NA 5IJ8E 2P9UC 3C5MA 3RMZD 4KFMB 3NVXA 5I5JA 4CI2A 3EWEA 5IT9g 5FQDA 2H68A 4J81A 2YBAA 5EMKB 5EALA 3MXXA 4GM8A 2HJ4A 1PEVA 5EAMA 4OZUA 3RFGA 3VGZA 5C2VB 1SHYB 5H1MA 3I8CA 3IKOA 2CN2A 5FKRA 4BL0A 2H9PA 1OLZA 3MMYA 4J77A 4A2LA 3PXSD 3PE7A 4JSVC 3SJLD 1L0QA 2IAAA 4GGAA 2H3XA 5C2WB 3EI1B 2J57G 3V7DB 4FWWA 4ZOYA 4O45A 2O9KA 3OL2B 2H9MA 5GXIA 3SMRA 1TBGA 4U1EI 5H14A 3EI1A 4CY1A 2XL3A 3PXWD 2H47A 3B7FA 3F3FA 2GC4A 5CXBB 1R5MA 5FKSA 3EI3B 3KRXB 3I89A 4H5JA 4QRJA 1JMXB 3K26A 4E5ZB 4CZVA 4ZOZA 2YMUA 3I7LA 2QXVA 4K3JB 3OKWA 5H17A 3EI3A 4QQEA 3JB9L 2Z2NA 2BBKH 1U2VC 5IGOA 3JPXA 3UR4A 3DSMA 5FLXg 4LG9A 4EWRA 2W18A 2MTAH 2CO0C 4BUJC 4ES0A 2HKRA 3IJCA 2B5LA 3HFQA 5HE0B 3JROA 5GMKn 5THAA 2Z2PA 2AH0A 3DWLC 4H5IA 2P9IC 3OKYB 2P9LC 2YB8B 3UVKA 3DXKC 2P9PC 4FA4D 4J84A 4CI1A 3AL9A 3OKYA 3V5WB 3EU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AL8 B;  4A2M A;  4CY2 A;  1JOF A;  3IJ0 A;  1NR0 A;  5TF2 A;  2I0S A;  3SWS D;  1P22 A;  4GZ8 A;  4FAV D;  2AH1 A;  2H14 A;  3N0D A;  5GSA A;  3C9C A;  3IIY A;  2BCJ B;  4N14 A;  1U4C A;  3N0E A;  3AL8 A;  4ERY A;  3PXT D;  2UZY B;  2AQ5 A;  1SQJ A;  2AGL A;  3SFZ A;  3J81 g;  4A0B B;  2CO0 A;  3I7O A;  4ESG A;  2YNP A;  5C9Z B;  5IC7 A;  3F3P A;  2IWF A;  4FHL A;  4GQB B;  3MKQ A;  4CZX A;  2HKM A;  3SN6 B;  4XEI C;  4XYH A;  4X61 B;  5EAR A;  5FA5 B;  4A0B A;  4Z8L A;  2P9K C;  4PC0 A;  5IGQ A;  2GNQ A;  5EAP A;  4TZ4 A;  1JJU B;  4CY5 A;  4AEZ A;  4CZY A;  4AOW A;  5EM2 B;  2HYE A;  4ZN4 A;  3RN0 D;  4JSN C;  4PNK B;  3OW8 A;  4YVD A;  3BG1 A;  3EI2 A;  5EM2 A;  3UKR C;  4JXM A;  5AJA A;  2I0R A;  3C99 A;  3VA6 A;  4GM3 A;  3ULE C;  4J79 A;  4FB1 D;  2IUP A;  1SQ9 A;  3MZK A;  5HE2 B;  5TEF A;  4A11 A;  3K27 A;  3EI4 A;  3JAM g;  2PBI B;  4GGD A;  2OK4 A;  4O9D A;  4PSX B;  2H9N A;  3I7H A;  2IUR A;  5TEE A;  2OVQ B;  4L3G D;  3SHF A;  2G9A A;  2Q7Q A;  3JRP A;  2P9N C;  3AFC A;  4GGC A;  4X3E A;  5FKT A;  5KDO B;  2HJB A;  5TDH B;  4IA9 A;  1GP2 B;  3A0F A;  1NEX B;  3RFH A;  2PM6 B;  4R7A B;  1MG2 A;  3MKS B;  2H6K A;  1XHM A;  4FA5 D;  3DM0 A;  4I79 A;  4A09 A;  1QNI A;  5CYK A;  4QT8 A;  3RLM D;  3SBR A;  4E54 B;  4A08 B;  2I0T A;  3V9F A;  4CY3 A;  1B9X A;  2H9L A;  2IUV A;  3UVO A;  3BWS A;  3VH0 A;  4J82 A;  1JMZ B;  3JZG A;  3NVN A;  4E54 A;  4ERQ A;  4A08 A;  3C75 H;  3GRE A;  5B4W A;  2IWK A;  1N6D A;  4L9O A;  2AGW A;  4CI8 A;  4FA1 D;  3PVU B;  2OVP B;  3RRM C;  1YFQ A;  2B5M A;  1MDA H;  2XL2 A;  4GQ2 P;  4U7A A;  4D6V A;  3ORV D;  2AGZ A;  2J55 H;  2B4E A;  3EG6 A;  4L3H D;  4CC9 A;  1B9Y A;  4X63 B;  3IIW A;  1XIP A;  1OMW B;  2PM7 B;  4D0K A;  2UZX B;  2I3T A;  4LG8 A;  2QC5 A;  4QL1 A;  4ZOV A;  1A0R B;  3I7P A;  1GXR A;  3OKT A;  5HE3 B;  1FWX A;  5EMJ B;  3SVW D;  1PGU A;  3GFC A;  3SLE D;  2P9S C;  4JSP C;  5FKQ A;  4HDJ A;  3SCY A;  5I5I A;  2GC7 A;  4A0A A;  5I5M A;  3EI2 B;  4UI9 R;  2I3S A;  4NSX A;  3FGB A;  4J86 A;  5HQG A;  4XYI A;  4JT6 C;  3RN1 D;  3E0C A;  4J78 A;  1GOT B;  2XU7 A;  1N6E A;  3F3G A;  4J87 A;  3UVN A;  3BG0 A;  5HE1 B;  3ZWL B;  3FM0 A;  4A11 B;  3EI4 B;  3L4M D;  1XKS A;  4PSW B;  4PBZ A;  4ZOX A;  2AGX A;  4J73 A;  3SBP A;  2H6Q A;  3PSL A;  3CIK B;  4PBY A;  3ODT A;  3JZN A;  5EML B;  5IJ7 E;  2B5N A;  4OWR A;  3CFV A;  1RI6 A;  2CN3 A;  4GM9 A;  4G56 B;  3UKU C;  1PI6 A;  3I7K A;  2EBS A;  4A09 B;  1PBY B;  5JWZ A;  3EMH A;  4GMB A;  2OVR B;  2IUQ A;  5CYK B;  2OK6 A;  5EMM B;  5GXH A;  4FA9 D;  5K1C C;  4GQ1 A;  4ERZ A;  4BH6 A;  4J8G A;  4J0W A;  2CNX A;  4FAN D;  3IJ1 A;  3OL2 A;  4L1Q D;  2J56 H;  2CE8 A;  2G99 A;  4X60 B;  3SBQ A;  1ERJ A;  1MG3 A;  3RSE C;  3NVQ A;  4Y5R D;  3PVW B;  5CXC B;  5CXB A;  4Y7R A;  3UVM A;  5K19 A;  4JSX C;  4E5Z A;  2TRC B;  3J80 g;  1TYQ C;  5CXC A;  3MZL A;  4A7J A;  2HES X;  3CFS B;  3P4F A;  4K3I D;  4CI3 A;  3DXM C;  1N6F A;  1K8K C;  1GG2 B;  3JZH A;  5HYN B;  3KRW B;  2OIZ A;  3U4Y A;  5SXM A;  5AMS A;  3I2N A;  1VYH C;  3I8E A;  4JT5 C;  4PXW A;  4IMM A;  2XYI A;  2OJY A;  5FXY A;  3FRX A;  3UVL A;  4LGN A;  2HXC A;  3L4O D;  1K32 A;  2YNO A;  3I7N A;  5AFU 3;  3W15 A;  2YNN A;  4MK0 B;  2CE9 A;  2PM9 B;  3OTT A;  2Z2O A;  5A2Q g;  2H13 A;  1S4U X;  4J0X A;  4A0A B;  3SXT D;  3AH8 B;  4JD2 C;  4J8B A;  2PM9 A;  3PSC B;  1Q47 A;  4O3U B;  4O1Q D;  2AGY A;  4O3T B;  2H6N A;  5IJ8 E;  2P9U C;  3C5M A;  3RMZ D;  4KFM B;  3NVX A;  5I5J A;  4CI2 A;  3EWE A;  5IT9 g;  5FQD A;  2H68 A;  4J81 A;  2YBA A;  5EMK B;  5EAL A;  3MXX A;  4GM8 A;  2HJ4 A;  1PEV A;  5EAM A;  4OZU A;  3RFG A;  3VGZ A;  5C2V B;  1SHY B;  5H1M A;  3I8C A;  3IKO A;  2CN2 A;  5FKR A;  4BL0 A;  2H9P A;  1OLZ A;  3MMY A;  4J77 A;  4A2L A;  3PXS D;  3PE7 A;  4JSV C;  3SJL D;  1L0Q A;  2IAA A;  4GGA A;  2H3X A;  5C2W B;  3EI1 B;  2J57 G;  3V7D B;  4FWW A;  4ZOY A;  4O45 A;  2O9K A;  3OL2 B;  2H9M A;  5GXI A;  3SMR A;  1TBG A;  4U1E I;  5H14 A;  3EI1 A;  4CY1 A;  2XL3 A;  3PXW D;  2H47 A;  3B7F A;  3F3F A;  2GC4 A;  5CXB B;  1R5M A;  5FKS A;  3EI3 B;  3KRX B;  3I89 A;  4H5J A;  4QRJ A;  1JMX B;  3K26 A;  4E5Z B;  4CZV A;  4ZOZ A;  2YMU A;  3I7L A;  2QXV A;  4K3J B;  3OKW A;  5H17 A;  3EI3 A;  4QQE A;  3JB9 L;  2Z2N A;  2BBK H;  1U2V C;  5IGO A;  3JPX A;  3UR4 A;  3DSM A;  5FLX g;  4LG9 A;  4EWR A;  2W18 A;  2MTA H;  2CO0 C;  4BUJ C;  4ES0 A;  2HKR A;  3IJC A;  2B5L A;  3HFQ A;  5HE0 B;  3JRO A;  5GMK n;  5THA A;  2Z2P A;  2AH0 A;  3DWL C;  4H5I A;  2P9I C;  3OKY B;  2P9L C;  2YB8 B;  3UVK A;  3DXK C;  2P9P C;  4FA4 D;  4J84 A;  4CI1 A;  3AL9 A;  3OKY A;  3V5W B;  3EU7 A; 
#chains in the Genus database with same CATH topology
 3AL8 B;  4A2M A;  4CY2 A;  1JOF A;  3IJ0 A;  1NR0 A;  5TF2 A;  2I0S A;  3SWS D;  1P22 A;  4GZ8 A;  4FAV D;  2AH1 A;  2H14 A;  3N0D A;  4AMZ A;  5GSA A;  3C9C A;  3IIY A;  2BCJ B;  4N14 A;  1U4C A;  4Z7Q A;  3N0E A;  3AL8 A;  4ERY A;  3PXT D;  2UZY B;  2AQ5 A;  1SQJ A;  2AGL A;  4NBM A;  1UOP A;  1GOF A;  3SFZ A;  3J81 g;  4A0B B;  2CO0 A;  3I7O A;  4ESG A;  2YNP A;  5C9Z B;  5IC7 A;  3F3P A;  2IWF A;  4FHL A;  4G55 A;  3O4H A;  4BCC A;  4GQB B;  3MKQ A;  3T3P A;  4CZX A;  2HKM A;  3SN6 B;  4XEI C;  4XYH A;  4X61 B;  5EAR A;  1U8C A;  1VE6 A;  2XDW A;  5FA5 B;  4A0B A;  4Z8L A;  2P9K C;  4PC0 A;  5IGQ A;  2GNQ A;  5EAP A;  4TZ4 A;  1JJU B;  4CY5 A;  4AEZ A;  4CZY A;  4AOW A;  5EM2 B;  2HYE A;  4ZN4 A;  3RN0 D;  4JSN C;  4PNK B;  3OW8 A;  4YVD A;  3BG1 A;  3EI2 A;  3NIF A;  4AMY A;  3ZE1 A;  1H2W A;  2XE4 A;  3IUQ A;  1A12 A;  5EM2 A;  3UKR C;  4JXM A;  3EQ7 A;  5AJA A;  2EID A;  2I0R A;  3C99 A;  4RE5 A;  3VA6 A;  4GM3 A;  3ULE C;  4J79 A;  4FB1 D;  2IUP A;  1SQ9 A;  3MZK A;  5HE2 B;  5TEF A;  2VDO A;  4A11 A;  3K27 A;  3EI4 A;  3IJE A;  3JAM g;  2PBI B;  4GGD A;  2OK4 A;  4O9D A;  4PSX B;  1VE7 A;  1H2Z A;  2H9N A;  3I7H A;  2IUR A;  3MUO A;  5TEE A;  2OVQ B;  4L3G D;  3SHF A;  1GOG A;  2VDQ A;  2G9A A;  5M5V A;  2Q7Q A;  3JRP A;  3ZE2 A;  2P9N C;  3AFC A;  4GGC A;  4X3E A;  5FKT A;  5KDO B;  2HJB A;  5TDH B;  4IA9 A;  3FCU A;  4G1E A;  1GP2 B;  3A0F A;  1NEX B;  3RFH A;  2PM6 B;  4MMZ A;  4R7A B;  1MG2 A;  3MKS B;  2H6K A;  1XHM A;  4FA5 D;  3DM0 A;  4I79 A;  4A09 A;  1QNI A;  5CYK A;  3GC3 B;  3O4I A;  4QT8 A;  1H2X A;  3RLM D;  4AN1 A;  2XZG A;  3SBR A;  4DNW A;  3KCI A;  4E54 B;  4A08 B;  2I0T A;  3V9F A;  4CY3 A;  1B9X A;  2H9L A;  2IUV A;  4JHN A;  3OF7 A;  3UVO A;  2HU5 A;  3BWS A;  3VH0 A;  3IUN A;  4J82 A;  1JMZ B;  3JZG A;  3NVN A;  4E54 A;  1M1X A;  5E6U A;  4ERQ A;  4A08 A;  3C75 H;  3ZE0 A;  3GRE A;  5B4W A;  4WK4 A;  2IWK A;  1N6D A;  1UOO A;  3VI4 A;  4L9O A;  2AGW A;  3QHY B;  4CI8 A;  4QAM A;  4FA1 D;  2VDM A;  2OVP B;  3PVU B;  1UTC A;  3RRM C;  1YFQ A;  2B5M A;  1MDA H;  2XL2 A;  3V4P A;  4GQ2 P;  4U7A A;  4D6V A;  3ORV D;  2AGZ A;  2J55 H;  2B4E A;  3EG6 A;  4L3H D;  4CC9 A;  1B9Y A;  4X63 B;  3IIW A;  1GOH A;  1XIP A;  1OMW B;  2PM7 B;  4D0K A;  2UZX B;  2I3T A;  4WK2 A;  4UM8 A;  4LG8 A;  3K71 A;  2QC5 A;  5M5R A;  4QL1 A;  4ZOV A;  1A0R B;  3I7P A;  1BPO A;  1GXR A;  4BP9 A;  3OKT A;  5HE3 B;  3GD1 I;  1FWX A;  5EMJ B;  3SVW D;  1PGU A;  3GFC A;  3SLE D;  2VDN A;  4Z7N A;  4NEN A;  2P9S C;  3QI0 A;  4JSP C;  5FKQ A;  1E8M A;  4HDJ A;  3SCY A;  5I5I A;  2GC7 A;  4A0A A;  4JHP C;  5I5M A;  3EI2 B;  4UI9 R;  2I3S A;  3IUJ A;  4NSX A;  3ZDX A;  3FGB A;  4J86 A;  5HQG A;  4XYI A;  4JT6 C;  1QFS A;  2WQ8 A;  3RN1 D;  3E0C A;  5FFO A;  4J78 A;  5M61 A;  1GOT B;  2XU7 A;  1N6E A;  4BCD A;  3F3G A;  2EIC A;  4J87 A;  3UVN A;  3BG0 A;  5C86 A;  5HE1 B;  3ZWL B;  3FM0 A;  4A11 B;  3EI4 B;  3L4M D;  1XKS A;  1T2X A;  4PSW B;  4PBZ A;  4ZOX A;  2HU7 A;  2AGX A;  4J73 A;  3SBP A;  2H6Q A;  3DDU A;  3PSL A;  2VZ1 A;  3CIK B;  4PBY A;  4DNV A;  3ODT A;  3JZN A;  5EML B;  4IRZ A;  5IJ7 E;  3VI3 A;  2B5N A;  5HDB A;  4OWR A;  3CFV A;  1RI6 A;  2CN3 A;  3MVD K;  4GM9 A;  4G56 B;  3UKU C;  1PI6 A;  3I7K A;  4MMX A;  2EBS A;  4A09 B;  1PBY B;  5JWZ A;  3EMH A;  4GMB A;  2OVR B;  2IUQ A;  5CYK B;  2OK6 A;  5EMM B;  5GXH A;  4FA9 D;  4WK0 A;  4NC4 A;  5K1C C;  4GQ1 A;  4ERZ A;  2EIB A;  4BH6 A;  4J8G A;  3ZDY A;  4J0W A;  2CNX A;  4FAN D;  3IJ1 A;  1C9L A;  3OL2 A;  2J56 H;  3K72 A;  4L1Q D;  4WJK A;  2QZP A;  2CE8 A;  2G99 A;  4X60 B;  3SBQ A;  1ERJ A;  1MG3 A;  1VZ2 A;  3RSE C;  4NAA A;  3NVQ A;  4Y5R D;  4O2W A;  3PVW B;  5CXC B;  5CXB A;  2VDL A;  2BKL A;  5M5U A;  4Y7R A;  3UVM A;  5K19 A;  4JSX C;  4E5Z A;  2TRC B;  3J80 g;  1TYQ C;  5CXC A;  3MZL A;  4A7J A;  2HES X;  3CFS B;  3P4F A;  4K3I D;  4CI3 A;  3DXM C;  2VDR A;  3NID A;  1N6F A;  1K8K C;  3EQ9 A;  1L5G A;  1GG2 B;  3JZH A;  5HYN B;  3KRW B;  2OIZ A;  3U4Y A;  1TYE A;  5SXM A;  5AMS A;  3I2N A;  1VYH C;  3I8E A;  3MUN A;  4JT5 C;  4PXW A;  4IMM A;  2XYI A;  2OJY A;  5FXY A;  3FCS A;  3FRX A;  3UVL A;  4LGN A;  2HXC A;  3L4O D;  5C92 A;  1K32 A;  2YNO A;  3I7N A;  2VDK A;  5AFU 3;  3IUR A;  3W15 A;  2YNN A;  4MK0 B;  2CE9 A;  2PM9 B;  2HU8 A;  3OTT A;  2Z2O A;  5A2Q g;  4DNU A;  2H13 A;  1S4U X;  4J0X A;  4A0A B;  1C9I A;  3SXT D;  3AH8 B;  4D9S A;  4JD2 C;  4J8B A;  3IVM A;  2PM9 A;  5M5S A;  1I2M B;  1UOQ A;  2JKX A;  3PSC B;  1Q47 A;  2QR5 A;  4O3U B;  4O1Q D;  2VDP A;  2AGY A;  4O3T B;  2H6N A;  4UM9 A;  3V4V A;  2P9U C;  5IJ8 E;  1YR2 A;  3C5M A;  3RMZ D;  4MMY A;  4KFM B;  2VC2 A;  3ZDZ A;  3NVX A;  5I5J A;  4CI2 A;  1QFM A;  3EWE A;  4RE6 A;  5IT9 g;  5FQD A;  2H68 A;  3O4G A;  4J81 A;  2YBA A;  5EMK B;  5EAL A;  3MXX A;  4GM8 A;  2HJ4 A;  1PEV A;  5EAM A;  1E8N A;  4OZU A;  3RFG A;  3VGZ A;  5C2V B;  1SHY B;  3O4J A;  4AX4 A;  1H2Y A;  5H1M A;  3I8C A;  1E5T A;  3IKO A;  2CN2 A;  3IUL A;  5FKR A;  4BL0 A;  4Z7O A;  2H9P A;  1OLZ A;  3MMY A;  4J77 A;  4A2L A;  3PXS D;  3PE7 A;  4L1M A;  4JSV C;  3SJL D;  1L0Q A;  2IAA A;  4GGA A;  2H3X A;  5C2W B;  3EI1 B;  2J57 G;  3V7D B;  4FWW A;  4ZOY A;  4O45 A;  2O9K A;  1VZ3 A;  3OL2 B;  2H9M A;  3NIG A;  5GXI A;  3SMR A;  1TBG A;  4U1E I;  5H14 A;  3EI1 A;  4AN0 A;  4CY1 A;  1O6F A;  2XL3 A;  3PXW D;  3IUM A;  4G1M A;  2H47 A;  3B7F A;  2EIE A;  3F3F A;  4O02 A;  2GC4 A;  5CXB B;  1JTD B;  1R5M A;  5FKS A;  3EI3 B;  3KRX B;  5M5T A;  3I89 A;  4H5J A;  4QRJ A;  1JMX B;  3K26 A;  4E5Z B;  4CZV A;  4ZOZ A;  2YMU A;  5FFG A;  3I7L A;  1O6G A;  2QXV A;  4K3J B;  3OKW A;  2VZ3 A;  5H17 A;  3EI3 A;  4QQE A;  3JB9 L;  2Z2N A;  2BBK H;  1U2V C;  5IGO A;  3JPX A;  3UR4 A;  3DSM A;  5FLX g;  4LG9 A;  4EWR A;  2W18 A;  2MTA H;  2CO0 C;  4BUJ C;  4ES0 A;  3T3M A;  2HKR A;  3IJC A;  2B5L A;  3HFQ A;  5HE0 B;  3K6S A;  3JRO A;  4BCB A;  5GMK n;  5THA A;  2Z2P A;  2AH0 A;  3DWL C;  1JV2 A;  4H5I A;  2P9I C;  3OKY B;  2P9L C;  2YB8 B;  3UVK A;  3DXK C;  4BP8 A;  2P9P C;  4FA4 D;  3EQ8 A;  4J84 A;  5E6R A;  4CI1 A;  3AL9 A;  5E6S A;  1K3I A;  3OKY A;  3V5W B;  3EU7 A; 
#chains in the Genus database with same CATH homology
 3AL8 B;  4A2M A;  4CY2 A;  1JOF A;  3IJ0 A;  1NR0 A;  5TF2 A;  2I0S A;  3SWS D;  1P22 A;  4GZ8 A;  4FAV D;  2AH1 A;  2H14 A;  3N0D A;  5GSA A;  3C9C A;  3IIY A;  2BCJ B;  4N14 A;  1U4C A;  3N0E A;  3AL8 A;  4ERY A;  3PXT D;  2UZY B;  2AQ5 A;  1SQJ A;  2AGL A;  3SFZ A;  3J81 g;  4A0B B;  2CO0 A;  3I7O A;  4ESG A;  2YNP A;  5C9Z B;  5IC7 A;  3F3P A;  2IWF A;  4FHL A;  4GQB B;  3MKQ A;  4CZX A;  2HKM A;  3SN6 B;  4XEI C;  4XYH A;  4X61 B;  5EAR A;  5FA5 B;  4A0B A;  4Z8L A;  2P9K C;  4PC0 A;  5IGQ A;  2GNQ A;  5EAP A;  4TZ4 A;  1JJU B;  4CY5 A;  4AEZ A;  4CZY A;  4AOW A;  5EM2 B;  2HYE A;  4ZN4 A;  3RN0 D;  4JSN C;  4PNK B;  3OW8 A;  4YVD A;  3BG1 A;  3EI2 A;  5EM2 A;  3UKR C;  4JXM A;  5AJA A;  2I0R A;  3C99 A;  3VA6 A;  4GM3 A;  3ULE C;  4J79 A;  4FB1 D;  2IUP A;  1SQ9 A;  3MZK A;  5HE2 B;  5TEF A;  4A11 A;  3K27 A;  3EI4 A;  3JAM g;  2PBI B;  4GGD A;  2OK4 A;  4O9D A;  4PSX B;  2H9N A;  3I7H A;  2IUR A;  5TEE A;  2OVQ B;  4L3G D;  3SHF A;  2G9A A;  2Q7Q A;  3JRP A;  2P9N C;  3AFC A;  4GGC A;  4X3E A;  5FKT A;  5KDO B;  2HJB A;  5TDH B;  4IA9 A;  1GP2 B;  3A0F A;  1NEX B;  3RFH A;  2PM6 B;  4R7A B;  1MG2 A;  3MKS B;  2H6K A;  1XHM A;  4FA5 D;  3DM0 A;  4I79 A;  4A09 A;  1QNI A;  5CYK A;  4QT8 A;  3RLM D;  3SBR A;  4E54 B;  4A08 B;  2I0T A;  3V9F A;  4CY3 A;  1B9X A;  2H9L A;  2IUV A;  3UVO A;  3BWS A;  3VH0 A;  4J82 A;  1JMZ B;  3JZG A;  3NVN A;  4E54 A;  4ERQ A;  4A08 A;  3C75 H;  3GRE A;  5B4W A;  2IWK A;  1N6D A;  4L9O A;  2AGW A;  4CI8 A;  4FA1 D;  3PVU B;  2OVP B;  3RRM C;  1YFQ A;  2B5M A;  1MDA H;  2XL2 A;  4GQ2 P;  4U7A A;  4D6V A;  3ORV D;  2AGZ A;  2J55 H;  2B4E A;  3EG6 A;  4L3H D;  4CC9 A;  1B9Y A;  4X63 B;  3IIW A;  1XIP A;  1OMW B;  2PM7 B;  4D0K A;  2UZX B;  2I3T A;  4LG8 A;  2QC5 A;  4QL1 A;  4ZOV A;  1A0R B;  3I7P A;  1GXR A;  3OKT A;  5HE3 B;  1FWX A;  5EMJ B;  3SVW D;  1PGU A;  3GFC A;  3SLE D;  2P9S C;  4JSP C;  5FKQ A;  4HDJ A;  3SCY A;  5I5I A;  2GC7 A;  4A0A A;  5I5M A;  3EI2 B;  4UI9 R;  2I3S A;  4NSX A;  3FGB A;  4J86 A;  5HQG A;  4XYI A;  4JT6 C;  3RN1 D;  3E0C A;  4J78 A;  1GOT B;  2XU7 A;  1N6E A;  3F3G A;  4J87 A;  3UVN A;  3BG0 A;  5HE1 B;  3ZWL B;  3FM0 A;  4A11 B;  3EI4 B;  3L4M D;  1XKS A;  4PSW B;  4PBZ A;  4ZOX A;  2AGX A;  4J73 A;  3SBP A;  2H6Q A;  3PSL A;  3CIK B;  4PBY A;  3ODT A;  3JZN A;  5EML B;  5IJ7 E;  2B5N A;  4OWR A;  3CFV A;  1RI6 A;  2CN3 A;  4GM9 A;  4G56 B;  3UKU C;  1PI6 A;  3I7K A;  2EBS A;  4A09 B;  1PBY B;  5JWZ A;  3EMH A;  4GMB A;  2OVR B;  2IUQ A;  5CYK B;  2OK6 A;  5EMM B;  5GXH A;  4FA9 D;  5K1C C;  4GQ1 A;  4ERZ A;  4BH6 A;  4J8G A;  4J0W A;  2CNX A;  4FAN D;  3IJ1 A;  3OL2 A;  4L1Q D;  2J56 H;  2CE8 A;  2G99 A;  4X60 B;  3SBQ A;  1ERJ A;  1MG3 A;  3RSE C;  3NVQ A;  4Y5R D;  3PVW B;  5CXC B;  5CXB A;  4Y7R A;  3UVM A;  5K19 A;  4JSX C;  4E5Z A;  2TRC B;  3J80 g;  1TYQ C;  5CXC A;  3MZL A;  4A7J A;  2HES X;  3CFS B;  3P4F A;  4K3I D;  4CI3 A;  3DXM C;  1N6F A;  1K8K C;  1GG2 B;  3JZH A;  5HYN B;  3KRW B;  2OIZ A;  3U4Y A;  5SXM A;  5AMS A;  3I2N A;  1VYH C;  3I8E A;  4JT5 C;  4PXW A;  4IMM A;  2XYI A;  2OJY A;  5FXY A;  3FRX A;  3UVL A;  4LGN A;  2HXC A;  3L4O D;  1K32 A;  2YNO A;  3I7N A;  5AFU 3;  3W15 A;  2YNN A;  4MK0 B;  2CE9 A;  2PM9 B;  3OTT A;  2Z2O A;  5A2Q g;  2H13 A;  1S4U X;  4J0X A;  4A0A B;  3SXT D;  3AH8 B;  4JD2 C;  4J8B A;  2PM9 A;  3PSC B;  1Q47 A;  4O3U B;  4O1Q D;  2AGY A;  4O3T B;  2H6N A;  5IJ8 E;  2P9U C;  3C5M A;  3RMZ D;  4KFM B;  3NVX A;  5I5J A;  4CI2 A;  3EWE A;  5IT9 g;  5FQD A;  2H68 A;  4J81 A;  2YBA A;  5EMK B;  5EAL A;  3MXX A;  4GM8 A;  2HJ4 A;  1PEV A;  5EAM A;  4OZU A;  3RFG A;  3VGZ A;  5C2V B;  1SHY B;  5H1M A;  3I8C A;  3IKO A;  2CN2 A;  5FKR A;  4BL0 A;  2H9P A;  1OLZ A;  3MMY A;  4J77 A;  4A2L A;  3PXS D;  3PE7 A;  4JSV C;  3SJL D;  1L0Q A;  2IAA A;  4GGA A;  2H3X A;  5C2W B;  3EI1 B;  2J57 G;  3V7D B;  4FWW A;  4ZOY A;  4O45 A;  2O9K A;  3OL2 B;  2H9M A;  5GXI A;  3SMR A;  1TBG A;  4U1E I;  5H14 A;  3EI1 A;  4CY1 A;  2XL3 A;  3PXW D;  2H47 A;  3B7F A;  3F3F A;  2GC4 A;  5CXB B;  1R5M A;  5FKS A;  3EI3 B;  3KRX B;  3I89 A;  4H5J A;  4QRJ A;  1JMX B;  3K26 A;  4E5Z B;  4CZV A;  4ZOZ A;  2YMU A;  3I7L A;  2QXV A;  4K3J B;  3OKW A;  5H17 A;  3EI3 A;  4QQE A;  3JB9 L;  2Z2N A;  2BBK H;  1U2V C;  5IGO A;  3JPX A;  3UR4 A;  3DSM A;  5FLX g;  4LG9 A;  4EWR A;  2W18 A;  2MTA H;  2CO0 C;  4BUJ C;  4ES0 A;  2HKR A;  3IJC A;  2B5L A;  3HFQ A;  5HE0 B;  3JRO A;  5GMK n;  5THA A;  2Z2P A;  2AH0 A;  3DWL C;  4H5I A;  2P9I C;  3OKY B;  2P9L C;  2YB8 B;  3UVK A;  3DXK C;  2P9P C;  4FA4 D;  4J84 A;  4CI1 A;  3AL9 A;  3OKY A;  3V5W B;  3EU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...