3EG6A

Structure of wdr5 bound to mll1 peptide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Structure of WDR5 bound to mixed lineage leukemia protein-1 peptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 104
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3eg6A00
5TDHB 1OMWB 2PM7B 1NEXB 5I5IA 4FHLA 2Z2PA 3MKSB 5FKQA 3SVWD 2IAAA 3SXTD 2OVRB 3P4FA 3BWSA 2AQ5A 1OLZA 2J56H 3A0FA 4A08B 4A0BB 3SCYA 2AGLA 3I7PA 2B5NA 3MKQA 4QL1A 3EI2A 3CIKB 2P9PC 3OW8A 2EBSA 4Y5RD 3IIYA 5EALA 2HJBA 4BUJC 5CYKB 2I0RA 3AL8A 2PBIB 5HQGA 4ERZA 5EMMB 3J81g 2W18A 3VH0A 1S4UX 2Q7QA 4CY2A 2H13A 3SLED 4A0AB 2PM9B 3JZGA 3SFZA 3AFCA 3I8EA 3PXTD 4GM9A 3SWSD 3UR4A 2HJ4A 1N6FA 1FWXA 1JMZB 4IA9A 5CXBB 4PBZA 3NVXA 3ZWLB 4E54A 1B9XA 3UVKA 3KRWB 1QNIA 4LG8A 4E5ZA 4QT8A 5FKTA 3JROA 3RSEC 2J55H 2HKMA 2CE9A 2P9NC 4CI2A 4H5JA 2CE8A 3ORVD 4ES0A 4GMBA 2P9LC 5TF2A 3C99A 3AL9A 3I7LA 4FAVD 4GZ8A 4ZOXA 1U2VC 1N6DA 3SBQA 4J78A 2QC5A 3OKTA 5TEEA 1P22A 4FWWA 4PSXB 5EMJB 3UKRC 2AGXA 5B4WA 2I0SA 4YVDA 5C9ZB 5IGOA 5A2Qg 4FB1D 3VGZA 2IUPA 5CXCB 3I2NA 5H17A 4J8GA 3MZKA 3RFGA 4ZN4A 1SQ9A 4U7AA 1JOFA 3IKOA 5I5MA 2QXVA 3BG1A 5KDOB 5EARA 4ESGA 3EWEA 3F3PA 5AJAA 2P9UC 2YNOA 4AEZA 4QRJA 3OKYA 1Q47A 4J81A 3EMHA 4L9OA 2P9IC 4PSWB 1NR0A 3K27A 3OL2A 3DWLC 4K3ID 4R7AB 5GSAA 3V9FA 5HYNB 5THAA 2OVPB 3RLMD 3DM0A 4ZOVA 3EI2B 4BH6A 4J0WA 4ZOZA 5FA5B 5H1MA 4XYIA 2P9KC 4CC9A 5FXYA 4X61B 3EI1A 4CI3A 3F3FA 5HE1B 1MDAH 2GC4A 3I7NA 5TEFA 3HFQA 4A09A 4I79A 2J57G 4MK0B 4GGDA 4CI1A 2HXCA 4FAND 3SN6B 3ULEC 4L3HD 1XHMA 3V5WB 4LGNA 4ZOYA 1N6EA 4CZVA 4Z8LA 5C2WB 5EMLB 5K1CC 4KFMB 3PE7A 3IJ0A 1R5MA 4E54B 1ERJA 3RMZD 3I8CA 4JSVC 2HESX 3DSMA 4XYHA 1K8KC 3N0DA 3L4MD 3FGBA 5HE3B 4ERQA 4E5ZB 5GMKn 4PBYA 1GOTB 5EM2A 5GXIA 3EG6A 2AH0A 1GP2B 3ODTA 2IWKA 4JXMA 2H9NA 2CN3A 4CZYA 4JSPC 3EI3B 5FLXg 3F3GA 3IJ1A 2H9MA 3JZNA 4A11B 1PGUA 3BG0A 4J77A 4D0KA 3RN1D 4J0XA 4JT5C 2AGWA 4NSXA 4A0AA 2XYIA 1JJUB 2H3XA 5GXHA 4QQEA 3J80g 2B4EA 4J73A 2OK6A 3JRPA 3UVMA 4HDJA 3NVNA 5CXBA 3FM0A 2H47A 3CFVA 3FRXA 3I89A 3OKWA 5EAMA 3EU7A 5AMSA 1TBGA 3GFCA 5HE2B 4JT6C 2UZYB 5EMKB 4GQ1A 3EI4B 1K32A 3C9CA 3B7FA 3OL2B 1GG2B 3DXMC 3PXSD 5AFU3 4X60B 3JPXA 3MXXA 3PXWD 2IWFA 4GGCA 3C5MA 3JAMg 5IT9g 4PC0A 4J79A 4JSNC 3U4YA 5IC7A 3JB9L 2PM6B 1YFQA 3PSLA 4CZXA 2YMUA 5CXCA 3EI1B 3W15A 3C75H 2MTAH 5JWZA 4U1EI 4X63B 4CI8A 2H14A 4LG9A 4L1QD 4A09B 3MMYA 4O1QD 3JZHA 3SJLD 2AH1A 3AH8B 4JD2C 4O9DA 2BCJB 4O45A 2CN2A 3NVQA 4N14A 3CFSB 1A0RB 2H6KA 5FKSA 3AL8B 3GREA 4J82A 4JSXC 4J86A 2IURA 2UZXB 5I5JA 4D6VA 2CO0C 2AGYA 1VYHC 3K26A 3UVOA 2O9KA 4X3EA 2H6QA 2HYEA 2IUQA 5FQDA 3PSCB 5HE0B 2P9SC 4J87A 4ERYA 4PNKB 3V7DB 4A08A 4A0BA 2YNNA 5EM2B 4GQBB 1RI6A 3UKUC 5SXMA 5C2VB 3VA6A 3E0CA 4OWRA 4EWRA 2GC7A 4FA9D 1GXRA 3UVNA 1TYQC 2TRCB 4GM8A 3DXKC 2XL3A 1XIPA 3L4OD 2GNQA 4GGAA 3PVUB 5CYKA 4J84A 3MZLA 2B5LA 4H5IA 4A7JA 2OIZA 3I7HA 3RRMC 2Z2NA 4IMMA 2H9PA 3KRXB 4L3GD 3SHFA 5IGQA 4A2LA 4OZUA 4UI9R 2HKRA 2XL2A 5IJ7E 2PM9A 2IUVA 4XEIC 2H6NA 5H14A 4PXWA 4A2MA 3SBPA 4AOWA 4BL0A 1JMXB 3PVWB 2YBAA 5FKRA 2H9LA 3SBRA 1PI6A 3I7OA 2Z2OA 1MG3A 2OVQB 2XU7A 2AGZA 4Y7RA 3EI3A 4GM3A 4K3JB 1SQJA 3IJCA 2CNXA 3SMRA 2H68A 4A11A 3OKYB 4GQ2P 4FA1D 1PBYB 2I0TA 3RN0D 3OTTA 2G99A 4O3TB 4FA5D 4J8BA 2YNPA 4CY1A 4CY5A 4G56B 4TZ4A 3UVLA 5K19A 2I3SA 1SHYB 5EAPA 2B5MA 1B9YA 1L0QA 2BBKH 4FA4D 4O3UB 3N0EA 3I7KA 3IIWA 1MG2A 1PEVA 2G9AA 1XKSA 2CO0A 2OK4A 5IJ8E 2I3TA 4CY3A 3EI4A 2YB8B 3RFHA 2OJYA 1U4CA
chains in the Genus database with same CATH superfamily
1L5GA 5TDHB 1OMWB 4IRZA 5C92A 2PM7B 4DNVA 1NEXB 2WQ8A 5I5IA 4FHLA 2Z2PA 3MKSB 5FKQA 3SVWD 2IAAA 3SXTD 2OVRB 3P4FA 3BWSA 2AQ5A 1OLZA 2J56H 3A0FA 4A08B 4A0BB 3SCYA 3IURA 2AGLA 3I7PA 2B5NA 3MKQA 4QL1A 3FCSA 3EI2A 3CIKB 2P9PC 3OW8A 2EBSA 4Y5RD 2VZ1A 3IIYA 3VI3A 3QHYB 4UM8A 5EALA 2HJBA 4BUJC 5CYKB 2I0RA 1T2XA 3AL8A 2PBIB 5HQGA 5M5UA 4ERZA 5EMMB 3J81g 2W18A 3VH0A 1S4UX 2Q7QA 4CY2A 2H13A 3SLED 4A0AB 2PM9B 2VDQA 3JZGA 4JHNA 3SFZA 3AFCA 4BP9A 3I8EA 5C86A 3PXTD 3GD1I 4GM9A 3SWSD 3UR4A 2HJ4A 1N6FA 1FWXA 1JMZB 4IA9A 5CXBB 4PBZA 3NVXA 3ZWLB 5M5RA 4E54A 1B9XA 3IJEA 3UVKA 3KRWB 1QNIA 3NIFA 3ZE2A 4Z7QA 4LG8A 3K72A 4WK4A 4E5ZA 3IUJA 4QT8A 5FKTA 3JROA 3RSEC 2J55H 2HKMA 2CE9A 2P9NC 4CI2A 4H5JA 2CE8A 3ORVD 4NC4A 4ES0A 1GOHA 4D9SA 4GMBA 2P9LC 5TF2A 3C99A 2QZPA 3AL9A 4MMXA 3I7LA 4FAVD 4GZ8A 4ZOXA 1U2VC 1N6DA 3SBQA 4J78A 2QC5A 4Z7NA 3OKTA 2EIDA 5TEEA 1P22A 4FWWA 4PSXB 5EMJB 3UKRC 2AGXA 3O4HA 5B4WA 2I0SA 1GOGA 4YVDA 5C9ZB 4QAMA 5IGOA 5A2Qg 4FB1D 3VGZA 2IUPA 1H2WA 5CXCB 3IUNA 3I2NA 5H17A 1JTDB 4J8GA 2HU5A 3V4VA 3MZKA 3RFGA 4ZN4A 1GOFA 1SQ9A 4U7AA 1JOFA 4DNUA 3O4IA 3IKOA 5I5MA 2QXVA 3BG1A 4Z7OA 5KDOB 5EARA 4ESGA 4AN0A 3EWEA 3F3PA 4JHPC 5AJAA 2HU7A 2P9UC 2YNOA 4AEZA 2VDRA 4QRJA 3OKYA 1Q47A 1UTCA 4J81A 3EMHA 4BCCA 4L9OA 2P9IC 4PSWB 1NR0A 3K27A 3OL2A 3DWLC 4K3ID 2XZGA 4R7AB 5GSAA 3V9FA 5HDBA 5HYNB 5THAA 2OVPB 3RLMD 3DM0A 2VZ3A 4ZOVA 3EI2B 4BH6A 3O4GA 4J0WA 4ZOZA 5FA5B 5H1MA 3IUQA 4XYIA 2P9KC 4CC9A 1H2XA 4WK0A 5FXYA 4X61B 3EI1A 4CI3A 3F3FA 5HE1B 1MDAH 2GC4A 3I7NA 5TEFA 3HFQA 4A09A 4I79A 2J57G 4MK0B 2VDMA 4DNWA 4GGDA 2EIBA 1K3IA 2HXCA 3DDUA 1C9LA 3O4JA 4MMYA 4CI1A 4FAND 4NAAA 3SN6B 3ULEC 4L3HD 1XHMA 3V5WB 4G55A 4LGNA 4ZOYA 1H2YA 4WK2A 1N6EA 4CZVA 3FCUA 4Z8LA 5C2WB 4AN1A 5EMLB 5K1CC 4KFMB 3PE7A 3IJ0A 1R5MA 4E54B 1ERJA 3RMZD 3I8CA 3V4PA 4JSVC 2HESX 3DSMA 4XYHA 1K8KC 3N0DA 3L4MD 3FGBA 5HE3B 4ERQA 4E5ZB 5GMKn 4PBYA 3GC3B 1GOTB 5EM2A 2BKLA 4BCBA 5GXIA 3EG6A 2AH0A 1GP2B 1VZ2A 3ODTA 4RE6A 2IWKA 4JXMA 4RE5A 5E6RA 2H9NA 5E6UA 2CN3A 4CZYA 3T3PA 4JSPC 3EI3B 5FLXg 3F3GA 3IJ1A 5E6SA 2H9MA 3JZNA 4A11B 1PGUA 3BG0A 4J77A 4D0KA 3RN1D 4J0XA 4JT5C 2AGWA 4NSXA 4A0AA 1BPOA 2XYIA 1JJUB 3EQ9A 1TYEA 1E8MA 2H3XA 5GXHA 4QQEA 3J80g 4O2WA 2B4EA 4J73A 3NIGA 2OK6A 2VDOA 3JRPA 3T3MA 3UVMA 4HDJA 3NVNA 5CXBA 3FM0A 1U8CA 2H47A 3KCIA 4BP8A 3CFVA 3FRXA 3I89A 3OKWA 5EAMA 3EU7A 5AMSA 1TBGA 3GFCA 5HE2B 4JT6C 2UZYB 1O6FA 1VZ3A 5EMKB 2VDPA 4GQ1A 3ZE1A 3K71A 2VC2A 3EI4B 2EICA 1K32A 3C9CA 1QFSA 3B7FA 3OL2B 1GG2B 3DXMC 3PXSD 2VDLA 5AFU3 4X60B 3JPXA 3MXXA 3PXWD 2IWFA 4GGCA 3C5MA 3QI0A 3JAMg 5IT9g 4PC0A 4BCDA 4J79A 5FFGA 1UOPA 1I2MB 4JSNC 3U4YA 5IC7A 3JB9L 2PM6B 1YFQA 3MVDK 3PSLA 4CZXA 2YMUA 5CXCA 3EI1B 3W15A 3C75H 2MTAH 5JWZA 4U1EI 4X63B 3IVMA 1UOQA 1A12A 4CI8A 2H14A 4LG9A 4L1QD 4A09B 3MMYA 4O1QD 3JZHA 3SJLD 4G1EA 2AH1A 3AH8B 4JD2C 4O9DA 1M1XA 2BCJB 4O45A 2CN2A 3NVQA 4N14A 5M61A 3CFSB 1A0RB 2H6KA 5FKSA 3AL8B 3GREA 4J82A 4WJKA 2XE4A 4JSXC 4J86A 2IURA 2UZXB 3OF7A 5I5JA 4D6VA 1C9IA 2CO0C 2QR5A 2AGYA 1VYHC 3K26A 3UVOA 2O9KA 4X3EA 3NIDA 2H6QA 2HYEA 2IUQA 5FQDA 4L1MA 3PSCB 5HE0B 2P9SC 4J87A 3ZDXA 4ERYA 4PNKB 3V7DB 4A08A 5M5SA 4A0BA 2YNNA 5EM2B 4GQBB 1RI6A 3IUMA 3UKUC 5SXMA 5C2VB 5FFOA 3VA6A 3E0CA 4OWRA 4AX4A 4EWRA 2GC7A 4FA9D 1GXRA 1E5TA 4MMZA 3UVNA 1TYQC 5M5VA 2TRCB 4GM8A 5M5TA 3DXKC 2XL3A 1XIPA 3L4OD 2GNQA 3ZE0A 3MUOA 3PVUB 4GGAA 5CYKA 4J84A 3MZLA 2B5LA 4H5IA 4A7JA 4G1MA 2OIZA 3MUNA 3I7HA 3RRMC 2Z2NA 4IMMA 2H9PA 3KRXB 4L3GD 3SHFA 5IGQA 4A2LA 1H2ZA 4OZUA 4UI9R 2HKRA 2XL2A 4NENA 3IULA 5IJ7E 4AMZA 2PM9A 3ZDZA 2IUVA 1YR2A 4XEIC 2H6NA 5H14A 4PXWA 4A2MA 3EQ7A 3SBPA 4AOWA 4BL0A 1JMXB 3PVWB 2YBAA 5FKRA 2H9LA 3SBRA 3K6SA 1VE6A 1PI6A 3I7OA 2Z2OA 1MG3A 2HU8A 2EIEA 2OVQB 4UM9A 2XU7A 2AGZA 2VDKA 4Y7RA 3EQ8A 3EI3A 4GM3A 4K3JB 1SQJA 3IJCA 1QFMA 2CNXA 3SMRA 2H68A 4A11A 1JV2A 3OKYB 4GQ2P 4NBMA 4O02A 3ZDYA 4FA1D 1PBYB 2I0TA 3RN0D 3OTTA 2G99A 4O3TB 4FA5D 4J8BA 2YNPA 4CY1A 4CY5A 4G56B 4TZ4A 3UVLA 1E8NA 5K19A 1O6GA 2I3SA 1SHYB 1VE7A 5EAPA 2B5MA 1B9YA 1L0QA 2BBKH 2XDWA 4FA4D 4O3UB 3N0EA 1UOOA 3I7KA 3IIWA 1MG2A 2JKXA 4AMYA 1PEVA 2G9AA 3VI4A 1XKSA 2CO0A 2OK4A 5IJ8E 2I3TA 2VDNA 4CY3A 3EI4A 2YB8B 3RFHA 2OJYA 1U4CA
chains in the Genus database with same CATH topology
5TDHB 1OMWB 2PM7B 1NEXB 5I5IA 4FHLA 2Z2PA 3MKSB 5FKQA 3SVWD 2IAAA 3SXTD 2OVRB 3P4FA 3BWSA 2AQ5A 1OLZA 2J56H 3A0FA 4A08B 4A0BB 3SCYA 2AGLA 3I7PA 2B5NA 3MKQA 4QL1A 3EI2A 3CIKB 2P9PC 3OW8A 2EBSA 4Y5RD 3IIYA 5EALA 2HJBA 4BUJC 5CYKB 2I0RA 3AL8A 2PBIB 5HQGA 4ERZA 5EMMB 3J81g 2W18A 3VH0A 1S4UX 2Q7QA 4CY2A 2H13A 3SLED 4A0AB 2PM9B 3JZGA 3SFZA 3AFCA 3I8EA 3PXTD 4GM9A 3SWSD 3UR4A 2HJ4A 1N6FA 1FWXA 1JMZB 4IA9A 5CXBB 4PBZA 3NVXA 3ZWLB 4E54A 1B9XA 3UVKA 3KRWB 1QNIA 4LG8A 4E5ZA 4QT8A 5FKTA 3JROA 3RSEC 2J55H 2HKMA 2CE9A 2P9NC 4CI2A 4H5JA 2CE8A 3ORVD 4ES0A 4GMBA 2P9LC 5TF2A 3C99A 3AL9A 3I7LA 4FAVD 4GZ8A 4ZOXA 1U2VC 1N6DA 3SBQA 4J78A 2QC5A 3OKTA 5TEEA 1P22A 4FWWA 4PSXB 5EMJB 3UKRC 2AGXA 5B4WA 2I0SA 4YVDA 5C9ZB 5IGOA 5A2Qg 4FB1D 3VGZA 2IUPA 5CXCB 3I2NA 5H17A 4J8GA 3MZKA 3RFGA 4ZN4A 1SQ9A 4U7AA 1JOFA 3IKOA 5I5MA 2QXVA 3BG1A 5KDOB 5EARA 4ESGA 3EWEA 3F3PA 5AJAA 2P9UC 2YNOA 4AEZA 4QRJA 3OKYA 1Q47A 4J81A 3EMHA 4L9OA 2P9IC 4PSWB 1NR0A 3K27A 3OL2A 3DWLC 4K3ID 4R7AB 5GSAA 3V9FA 5HYNB 5THAA 2OVPB 3RLMD 3DM0A 4ZOVA 3EI2B 4BH6A 4J0WA 4ZOZA 5FA5B 5H1MA 4XYIA 2P9KC 4CC9A 5FXYA 4X61B 3EI1A 4CI3A 3F3FA 5HE1B 1MDAH 2GC4A 3I7NA 5TEFA 3HFQA 4A09A 4I79A 2J57G 4MK0B 4GGDA 4CI1A 2HXCA 4FAND 3SN6B 3ULEC 4L3HD 1XHMA 3V5WB 4LGNA 4ZOYA 1N6EA 4CZVA 4Z8LA 5C2WB 5EMLB 5K1CC 4KFMB 3PE7A 3IJ0A 1R5MA 4E54B 1ERJA 3RMZD 3I8CA 4JSVC 2HESX 3DSMA 4XYHA 1K8KC 3N0DA 3L4MD 3FGBA 5HE3B 4ERQA 4E5ZB 5GMKn 4PBYA 1GOTB 5EM2A 5GXIA 3EG6A 2AH0A 1GP2B 3ODTA 2IWKA 4JXMA 2H9NA 2CN3A 4CZYA 4JSPC 3EI3B 5FLXg 3F3GA 3IJ1A 2H9MA 3JZNA 4A11B 1PGUA 3BG0A 4J77A 4D0KA 3RN1D 4J0XA 4JT5C 2AGWA 4NSXA 4A0AA 2XYIA 1JJUB 2H3XA 5GXHA 4QQEA 3J80g 2B4EA 4J73A 2OK6A 3JRPA 3UVMA 4HDJA 3NVNA 5CXBA 3FM0A 2H47A 3CFVA 3FRXA 3I89A 3OKWA 5EAMA 3EU7A 5AMSA 1TBGA 3GFCA 5HE2B 4JT6C 2UZYB 5EMKB 4GQ1A 3EI4B 1K32A 3C9CA 3B7FA 3OL2B 1GG2B 3DXMC 3PXSD 5AFU3 4X60B 3JPXA 3MXXA 3PXWD 2IWFA 4GGCA 3C5MA 3JAMg 5IT9g 4PC0A 4J79A 4JSNC 3U4YA 5IC7A 3JB9L 2PM6B 1YFQA 3PSLA 4CZXA 2YMUA 5CXCA 3EI1B 3W15A 3C75H 2MTAH 5JWZA 4U1EI 4X63B 4CI8A 2H14A 4LG9A 4L1QD 4A09B 3MMYA 4O1QD 3JZHA 3SJLD 2AH1A 3AH8B 4JD2C 4O9DA 2BCJB 4O45A 2CN2A 3NVQA 4N14A 3CFSB 1A0RB 2H6KA 5FKSA 3AL8B 3GREA 4J82A 4JSXC 4J86A 2IURA 2UZXB 5I5JA 4D6VA 2CO0C 2AGYA 1VYHC 3K26A 3UVOA 2O9KA 4X3EA 2H6QA 2HYEA 2IUQA 5FQDA 3PSCB 5HE0B 2P9SC 4J87A 4ERYA 4PNKB 3V7DB 4A08A 4A0BA 2YNNA 5EM2B 4GQBB 1RI6A 3UKUC 5SXMA 5C2VB 3VA6A 3E0CA 4OWRA 4EWRA 2GC7A 4FA9D 1GXRA 3UVNA 1TYQC 2TRCB 4GM8A 3DXKC 2XL3A 1XIPA 3L4OD 2GNQA 4GGAA 3PVUB 5CYKA 4J84A 3MZLA 2B5LA 4H5IA 4A7JA 2OIZA 3I7HA 3RRMC 2Z2NA 4IMMA 2H9PA 3KRXB 4L3GD 3SHFA 5IGQA 4A2LA 4OZUA 4UI9R 2HKRA 2XL2A 5IJ7E 2PM9A 2IUVA 4XEIC 2H6NA 5H14A 4PXWA 4A2MA 3SBPA 4AOWA 4BL0A 1JMXB 3PVWB 2YBAA 5FKRA 2H9LA 3SBRA 1PI6A 3I7OA 2Z2OA 1MG3A 2OVQB 2XU7A 2AGZA 4Y7RA 3EI3A 4GM3A 4K3JB 1SQJA 3IJCA 2CNXA 3SMRA 2H68A 4A11A 3OKYB 4GQ2P 4FA1D 1PBYB 2I0TA 3RN0D 3OTTA 2G99A 4O3TB 4FA5D 4J8BA 2YNPA 4CY1A 4CY5A 4G56B 4TZ4A 3UVLA 5K19A 2I3SA 1SHYB 5EAPA 2B5MA 1B9YA 1L0QA 2BBKH 4FA4D 4O3UB 3N0EA 3I7KA 3IIWA 1MG2A 1PEVA 2G9AA 1XKSA 2CO0A 2OK4A 5IJ8E 2I3TA 4CY3A 3EI4A 2YB8B 3RFHA 2OJYA 1U4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TDH B;  1OMW B;  2PM7 B;  1NEX B;  5I5I A;  4FHL A;  2Z2P A;  3MKS B;  5FKQ A;  3SVW D;  2IAA A;  3SXT D;  2OVR B;  3P4F A;  3BWS A;  2AQ5 A;  1OLZ A;  2J56 H;  3A0F A;  4A08 B;  4A0B B;  3SCY A;  2AGL A;  3I7P A;  2B5N A;  3MKQ A;  4QL1 A;  3EI2 A;  3CIK B;  2P9P C;  3OW8 A;  2EBS A;  4Y5R D;  3IIY A;  5EAL A;  2HJB A;  4BUJ C;  5CYK B;  2I0R A;  3AL8 A;  2PBI B;  5HQG A;  4ERZ A;  5EMM B;  3J81 g;  2W18 A;  3VH0 A;  1S4U X;  2Q7Q A;  4CY2 A;  2H13 A;  3SLE D;  4A0A B;  2PM9 B;  3JZG A;  3SFZ A;  3AFC A;  3I8E A;  3PXT D;  4GM9 A;  3SWS D;  3UR4 A;  2HJ4 A;  1N6F A;  1FWX A;  1JMZ B;  4IA9 A;  5CXB B;  4PBZ A;  3NVX A;  3ZWL B;  4E54 A;  1B9X A;  3UVK A;  3KRW B;  1QNI A;  4LG8 A;  4E5Z A;  4QT8 A;  5FKT A;  3JRO A;  3RSE C;  2J55 H;  2HKM A;  2CE9 A;  2P9N C;  4CI2 A;  4H5J A;  2CE8 A;  3ORV D;  4ES0 A;  4GMB A;  2P9L C;  5TF2 A;  3C99 A;  3AL9 A;  3I7L A;  4FAV D;  4GZ8 A;  4ZOX A;  1U2V C;  1N6D A;  3SBQ A;  4J78 A;  2QC5 A;  3OKT A;  5TEE A;  1P22 A;  4FWW A;  4PSX B;  5EMJ B;  3UKR C;  2AGX A;  5B4W A;  2I0S A;  4YVD A;  5C9Z B;  5IGO A;  5A2Q g;  4FB1 D;  3VGZ A;  2IUP A;  5CXC B;  3I2N A;  5H17 A;  4J8G A;  3MZK A;  3RFG A;  4ZN4 A;  1SQ9 A;  4U7A A;  1JOF A;  3IKO A;  5I5M A;  2QXV A;  3BG1 A;  5KDO B;  5EAR A;  4ESG A;  3EWE A;  3F3P A;  5AJA A;  2P9U C;  2YNO A;  4AEZ A;  4QRJ A;  3OKY A;  1Q47 A;  4J81 A;  3EMH A;  4L9O A;  2P9I C;  4PSW B;  1NR0 A;  3K27 A;  3OL2 A;  3DWL C;  4K3I D;  4R7A B;  5GSA A;  3V9F A;  5HYN B;  5THA A;  2OVP B;  3RLM D;  3DM0 A;  4ZOV A;  3EI2 B;  4BH6 A;  4J0W A;  4ZOZ A;  5FA5 B;  5H1M A;  4XYI A;  2P9K C;  4CC9 A;  5FXY A;  4X61 B;  3EI1 A;  4CI3 A;  3F3F A;  5HE1 B;  1MDA H;  2GC4 A;  3I7N A;  5TEF A;  3HFQ A;  4A09 A;  4I79 A;  2J57 G;  4MK0 B;  4GGD A;  4CI1 A;  2HXC A;  4FAN D;  3SN6 B;  3ULE C;  4L3H D;  1XHM A;  3V5W B;  4LGN A;  4ZOY A;  1N6E A;  4CZV A;  4Z8L A;  5C2W B;  5EML B;  5K1C C;  4KFM B;  3PE7 A;  3IJ0 A;  1R5M A;  4E54 B;  1ERJ A;  3RMZ D;  3I8C A;  4JSV C;  2HES X;  3DSM A;  4XYH A;  1K8K C;  3N0D A;  3L4M D;  3FGB A;  5HE3 B;  4ERQ A;  4E5Z B;  5GMK n;  4PBY A;  1GOT B;  5EM2 A;  5GXI A;  3EG6 A;  2AH0 A;  1GP2 B;  3ODT A;  2IWK A;  4JXM A;  2H9N A;  2CN3 A;  4CZY A;  4JSP C;  3EI3 B;  5FLX g;  3F3G A;  3IJ1 A;  2H9M A;  3JZN A;  4A11 B;  1PGU A;  3BG0 A;  4J77 A;  4D0K A;  3RN1 D;  4J0X A;  4JT5 C;  2AGW A;  4NSX A;  4A0A A;  2XYI A;  1JJU B;  2H3X A;  5GXH A;  4QQE A;  3J80 g;  2B4E A;  4J73 A;  2OK6 A;  3JRP A;  3UVM A;  4HDJ A;  3NVN A;  5CXB A;  3FM0 A;  2H47 A;  3CFV A;  3FRX A;  3I89 A;  3OKW A;  5EAM A;  3EU7 A;  5AMS A;  1TBG A;  3GFC A;  5HE2 B;  4JT6 C;  2UZY B;  5EMK B;  4GQ1 A;  3EI4 B;  1K32 A;  3C9C A;  3B7F A;  3OL2 B;  1GG2 B;  3DXM C;  3PXS D;  5AFU 3;  4X60 B;  3JPX A;  3MXX A;  3PXW D;  2IWF A;  4GGC A;  3C5M A;  3JAM g;  5IT9 g;  4PC0 A;  4J79 A;  4JSN C;  3U4Y A;  5IC7 A;  3JB9 L;  2PM6 B;  1YFQ A;  3PSL A;  4CZX A;  2YMU A;  5CXC A;  3EI1 B;  3W15 A;  3C75 H;  2MTA H;  5JWZ A;  4U1E I;  4X63 B;  4CI8 A;  2H14 A;  4LG9 A;  4L1Q D;  4A09 B;  3MMY A;  4O1Q D;  3JZH A;  3SJL D;  2AH1 A;  3AH8 B;  4JD2 C;  4O9D A;  2BCJ B;  4O45 A;  2CN2 A;  3NVQ A;  4N14 A;  3CFS B;  1A0R B;  2H6K A;  5FKS A;  3AL8 B;  3GRE A;  4J82 A;  4JSX C;  4J86 A;  2IUR A;  2UZX B;  5I5J A;  4D6V A;  2CO0 C;  2AGY A;  1VYH C;  3K26 A;  3UVO A;  2O9K A;  4X3E A;  2H6Q A;  2HYE A;  2IUQ A;  5FQD A;  3PSC B;  5HE0 B;  2P9S C;  4J87 A;  4ERY A;  4PNK B;  3V7D B;  4A08 A;  4A0B A;  2YNN A;  5EM2 B;  4GQB B;  1RI6 A;  3UKU C;  5SXM A;  5C2V B;  3VA6 A;  3E0C A;  4OWR A;  4EWR A;  2GC7 A;  4FA9 D;  1GXR A;  3UVN A;  1TYQ C;  2TRC B;  4GM8 A;  3DXK C;  2XL3 A;  1XIP A;  3L4O D;  2GNQ A;  4GGA A;  3PVU B;  5CYK A;  4J84 A;  3MZL A;  2B5L A;  4H5I A;  4A7J A;  2OIZ A;  3I7H A;  3RRM C;  2Z2N A;  4IMM A;  2H9P A;  3KRX B;  4L3G D;  3SHF A;  5IGQ A;  4A2L A;  4OZU A;  4UI9 R;  2HKR A;  2XL2 A;  5IJ7 E;  2PM9 A;  2IUV A;  4XEI C;  2H6N A;  5H14 A;  4PXW A;  4A2M A;  3SBP A;  4AOW A;  4BL0 A;  1JMX B;  3PVW B;  2YBA A;  5FKR A;  2H9L A;  3SBR A;  1PI6 A;  3I7O A;  2Z2O A;  1MG3 A;  2OVQ B;  2XU7 A;  2AGZ A;  4Y7R A;  3EI3 A;  4GM3 A;  4K3J B;  1SQJ A;  3IJC A;  2CNX A;  3SMR A;  2H68 A;  4A11 A;  3OKY B;  4GQ2 P;  4FA1 D;  1PBY B;  2I0T A;  3RN0 D;  3OTT A;  2G99 A;  4O3T B;  4FA5 D;  4J8B A;  2YNP A;  4CY1 A;  4CY5 A;  4G56 B;  4TZ4 A;  3UVL A;  5K19 A;  2I3S A;  1SHY B;  5EAP A;  2B5M A;  1B9Y A;  1L0Q A;  2BBK H;  4FA4 D;  4O3U B;  3N0E A;  3I7K A;  3IIW A;  1MG2 A;  1PEV A;  2G9A A;  1XKS A;  2CO0 A;  2OK4 A;  5IJ8 E;  2I3T A;  4CY3 A;  3EI4 A;  2YB8 B;  3RFH A;  2OJY A;  1U4C A; 
#chains in the Genus database with same CATH topology
 1L5G A;  5TDH B;  1OMW B;  4IRZ A;  5C92 A;  2PM7 B;  4DNV A;  1NEX B;  2WQ8 A;  5I5I A;  4FHL A;  2Z2P A;  3MKS B;  5FKQ A;  3SVW D;  2IAA A;  3SXT D;  2OVR B;  3P4F A;  3BWS A;  2AQ5 A;  1OLZ A;  2J56 H;  3A0F A;  4A08 B;  4A0B B;  3SCY A;  3IUR A;  2AGL A;  3I7P A;  2B5N A;  3MKQ A;  4QL1 A;  3FCS A;  3EI2 A;  3CIK B;  2P9P C;  3OW8 A;  2EBS A;  4Y5R D;  2VZ1 A;  3IIY A;  3VI3 A;  3QHY B;  4UM8 A;  5EAL A;  2HJB A;  4BUJ C;  5CYK B;  2I0R A;  1T2X A;  3AL8 A;  2PBI B;  5HQG A;  5M5U A;  4ERZ A;  5EMM B;  3J81 g;  2W18 A;  3VH0 A;  1S4U X;  2Q7Q A;  4CY2 A;  2H13 A;  3SLE D;  4A0A B;  2PM9 B;  2VDQ A;  3JZG A;  4JHN A;  3SFZ A;  3AFC A;  4BP9 A;  3I8E A;  5C86 A;  3PXT D;  3GD1 I;  4GM9 A;  3SWS D;  3UR4 A;  2HJ4 A;  1N6F A;  1FWX A;  1JMZ B;  4IA9 A;  5CXB B;  4PBZ A;  3NVX A;  3ZWL B;  5M5R A;  4E54 A;  1B9X A;  3IJE A;  3UVK A;  3KRW B;  1QNI A;  3NIF A;  3ZE2 A;  4Z7Q A;  4LG8 A;  3K72 A;  4WK4 A;  4E5Z A;  3IUJ A;  4QT8 A;  5FKT A;  3JRO A;  3RSE C;  2J55 H;  2HKM A;  2CE9 A;  2P9N C;  4CI2 A;  4H5J A;  2CE8 A;  3ORV D;  4NC4 A;  4ES0 A;  1GOH A;  4D9S A;  4GMB A;  2P9L C;  5TF2 A;  3C99 A;  2QZP A;  3AL9 A;  4MMX A;  3I7L A;  4FAV D;  4GZ8 A;  4ZOX A;  1U2V C;  1N6D A;  3SBQ A;  4J78 A;  2QC5 A;  4Z7N A;  3OKT A;  2EID A;  5TEE A;  1P22 A;  4FWW A;  4PSX B;  5EMJ B;  3UKR C;  2AGX A;  3O4H A;  5B4W A;  2I0S A;  1GOG A;  4YVD A;  5C9Z B;  4QAM A;  5IGO A;  5A2Q g;  4FB1 D;  3VGZ A;  2IUP A;  1H2W A;  5CXC B;  3IUN A;  3I2N A;  5H17 A;  1JTD B;  4J8G A;  2HU5 A;  3V4V A;  3MZK A;  3RFG A;  4ZN4 A;  1GOF A;  1SQ9 A;  4U7A A;  1JOF A;  4DNU A;  3O4I A;  3IKO A;  5I5M A;  2QXV A;  3BG1 A;  4Z7O A;  5KDO B;  5EAR A;  4ESG A;  4AN0 A;  3EWE A;  3F3P A;  4JHP C;  5AJA A;  2HU7 A;  2P9U C;  2YNO A;  4AEZ A;  2VDR A;  4QRJ A;  3OKY A;  1Q47 A;  1UTC A;  4J81 A;  3EMH A;  4BCC A;  4L9O A;  2P9I C;  4PSW B;  1NR0 A;  3K27 A;  3OL2 A;  3DWL C;  4K3I D;  2XZG A;  4R7A B;  5GSA A;  3V9F A;  5HDB A;  5HYN B;  5THA A;  2OVP B;  3RLM D;  3DM0 A;  2VZ3 A;  4ZOV A;  3EI2 B;  4BH6 A;  3O4G A;  4J0W A;  4ZOZ A;  5FA5 B;  5H1M A;  3IUQ A;  4XYI A;  2P9K C;  4CC9 A;  1H2X A;  4WK0 A;  5FXY A;  4X61 B;  3EI1 A;  4CI3 A;  3F3F A;  5HE1 B;  1MDA H;  2GC4 A;  3I7N A;  5TEF A;  3HFQ A;  4A09 A;  4I79 A;  2J57 G;  4MK0 B;  2VDM A;  4DNW A;  4GGD A;  2EIB A;  1K3I A;  2HXC A;  3DDU A;  1C9L A;  3O4J A;  4MMY A;  4CI1 A;  4FAN D;  4NAA A;  3SN6 B;  3ULE C;  4L3H D;  1XHM A;  3V5W B;  4G55 A;  4LGN A;  4ZOY A;  1H2Y A;  4WK2 A;  1N6E A;  4CZV A;  3FCU A;  4Z8L A;  5C2W B;  4AN1 A;  5EML B;  5K1C C;  4KFM B;  3PE7 A;  3IJ0 A;  1R5M A;  4E54 B;  1ERJ A;  3RMZ D;  3I8C A;  3V4P A;  4JSV C;  2HES X;  3DSM A;  4XYH A;  1K8K C;  3N0D A;  3L4M D;  3FGB A;  5HE3 B;  4ERQ A;  4E5Z B;  5GMK n;  4PBY A;  3GC3 B;  1GOT B;  5EM2 A;  2BKL A;  4BCB A;  5GXI A;  3EG6 A;  2AH0 A;  1GP2 B;  1VZ2 A;  3ODT A;  4RE6 A;  2IWK A;  4JXM A;  4RE5 A;  5E6R A;  2H9N A;  5E6U A;  2CN3 A;  4CZY A;  3T3P A;  4JSP C;  3EI3 B;  5FLX g;  3F3G A;  3IJ1 A;  5E6S A;  2H9M A;  3JZN A;  4A11 B;  1PGU A;  3BG0 A;  4J77 A;  4D0K A;  3RN1 D;  4J0X A;  4JT5 C;  2AGW A;  4NSX A;  4A0A A;  1BPO A;  2XYI A;  1JJU B;  3EQ9 A;  1TYE A;  1E8M A;  2H3X A;  5GXH A;  4QQE A;  3J80 g;  4O2W A;  2B4E A;  4J73 A;  3NIG A;  2OK6 A;  2VDO A;  3JRP A;  3T3M A;  3UVM A;  4HDJ A;  3NVN A;  5CXB A;  3FM0 A;  1U8C A;  2H47 A;  3KCI A;  4BP8 A;  3CFV A;  3FRX A;  3I89 A;  3OKW A;  5EAM A;  3EU7 A;  5AMS A;  1TBG A;  3GFC A;  5HE2 B;  4JT6 C;  2UZY B;  1O6F A;  1VZ3 A;  5EMK B;  2VDP A;  4GQ1 A;  3ZE1 A;  3K71 A;  2VC2 A;  3EI4 B;  2EIC A;  1K32 A;  3C9C A;  1QFS A;  3B7F A;  3OL2 B;  1GG2 B;  3DXM C;  3PXS D;  2VDL A;  5AFU 3;  4X60 B;  3JPX A;  3MXX A;  3PXW D;  2IWF A;  4GGC A;  3C5M A;  3QI0 A;  3JAM g;  5IT9 g;  4PC0 A;  4BCD A;  4J79 A;  5FFG A;  1UOP A;  1I2M B;  4JSN C;  3U4Y A;  5IC7 A;  3JB9 L;  2PM6 B;  1YFQ A;  3MVD K;  3PSL A;  4CZX A;  2YMU A;  5CXC A;  3EI1 B;  3W15 A;  3C75 H;  2MTA H;  5JWZ A;  4U1E I;  4X63 B;  3IVM A;  1UOQ A;  1A12 A;  4CI8 A;  2H14 A;  4LG9 A;  4L1Q D;  4A09 B;  3MMY A;  4O1Q D;  3JZH A;  3SJL D;  4G1E A;  2AH1 A;  3AH8 B;  4JD2 C;  4O9D A;  1M1X A;  2BCJ B;  4O45 A;  2CN2 A;  3NVQ A;  4N14 A;  5M61 A;  3CFS B;  1A0R B;  2H6K A;  5FKS A;  3AL8 B;  3GRE A;  4J82 A;  4WJK A;  2XE4 A;  4JSX C;  4J86 A;  2IUR A;  2UZX B;  3OF7 A;  5I5J A;  4D6V A;  1C9I A;  2CO0 C;  2QR5 A;  2AGY A;  1VYH C;  3K26 A;  3UVO A;  2O9K A;  4X3E A;  3NID A;  2H6Q A;  2HYE A;  2IUQ A;  5FQD A;  4L1M A;  3PSC B;  5HE0 B;  2P9S C;  4J87 A;  3ZDX A;  4ERY A;  4PNK B;  3V7D B;  4A08 A;  5M5S A;  4A0B A;  2YNN A;  5EM2 B;  4GQB B;  1RI6 A;  3IUM A;  3UKU C;  5SXM A;  5C2V B;  5FFO A;  3VA6 A;  3E0C A;  4OWR A;  4AX4 A;  4EWR A;  2GC7 A;  4FA9 D;  1GXR A;  1E5T A;  4MMZ A;  3UVN A;  1TYQ C;  5M5V A;  2TRC B;  4GM8 A;  5M5T A;  3DXK C;  2XL3 A;  1XIP A;  3L4O D;  2GNQ A;  3ZE0 A;  3MUO A;  3PVU B;  4GGA A;  5CYK A;  4J84 A;  3MZL A;  2B5L A;  4H5I A;  4A7J A;  4G1M A;  2OIZ A;  3MUN A;  3I7H A;  3RRM C;  2Z2N A;  4IMM A;  2H9P A;  3KRX B;  4L3G D;  3SHF A;  5IGQ A;  4A2L A;  1H2Z A;  4OZU A;  4UI9 R;  2HKR A;  2XL2 A;  4NEN A;  3IUL A;  5IJ7 E;  4AMZ A;  2PM9 A;  3ZDZ A;  2IUV A;  1YR2 A;  4XEI C;  2H6N A;  5H14 A;  4PXW A;  4A2M A;  3EQ7 A;  3SBP A;  4AOW A;  4BL0 A;  1JMX B;  3PVW B;  2YBA A;  5FKR A;  2H9L A;  3SBR A;  3K6S A;  1VE6 A;  1PI6 A;  3I7O A;  2Z2O A;  1MG3 A;  2HU8 A;  2EIE A;  2OVQ B;  4UM9 A;  2XU7 A;  2AGZ A;  2VDK A;  4Y7R A;  3EQ8 A;  3EI3 A;  4GM3 A;  4K3J B;  1SQJ A;  3IJC A;  1QFM A;  2CNX A;  3SMR A;  2H68 A;  4A11 A;  1JV2 A;  3OKY B;  4GQ2 P;  4NBM A;  4O02 A;  3ZDY A;  4FA1 D;  1PBY B;  2I0T A;  3RN0 D;  3OTT A;  2G99 A;  4O3T B;  4FA5 D;  4J8B A;  2YNP A;  4CY1 A;  4CY5 A;  4G56 B;  4TZ4 A;  3UVL A;  1E8N A;  5K19 A;  1O6G A;  2I3S A;  1SHY B;  1VE7 A;  5EAP A;  2B5M A;  1B9Y A;  1L0Q A;  2BBK H;  2XDW A;  4FA4 D;  4O3U B;  3N0E A;  1UOO A;  3I7K A;  3IIW A;  1MG2 A;  2JKX A;  4AMY A;  1PEV A;  2G9A A;  3VI4 A;  1XKS A;  2CO0 A;  2OK4 A;  5IJ8 E;  2I3T A;  2VDN A;  4CY3 A;  3EI4 A;  2YB8 B;  3RFH A;  2OJY A;  1U4C A; 
#chains in the Genus database with same CATH homology
 5TDH B;  1OMW B;  2PM7 B;  1NEX B;  5I5I A;  4FHL A;  2Z2P A;  3MKS B;  5FKQ A;  3SVW D;  2IAA A;  3SXT D;  2OVR B;  3P4F A;  3BWS A;  2AQ5 A;  1OLZ A;  2J56 H;  3A0F A;  4A08 B;  4A0B B;  3SCY A;  2AGL A;  3I7P A;  2B5N A;  3MKQ A;  4QL1 A;  3EI2 A;  3CIK B;  2P9P C;  3OW8 A;  2EBS A;  4Y5R D;  3IIY A;  5EAL A;  2HJB A;  4BUJ C;  5CYK B;  2I0R A;  3AL8 A;  2PBI B;  5HQG A;  4ERZ A;  5EMM B;  3J81 g;  2W18 A;  3VH0 A;  1S4U X;  2Q7Q A;  4CY2 A;  2H13 A;  3SLE D;  4A0A B;  2PM9 B;  3JZG A;  3SFZ A;  3AFC A;  3I8E A;  3PXT D;  4GM9 A;  3SWS D;  3UR4 A;  2HJ4 A;  1N6F A;  1FWX A;  1JMZ B;  4IA9 A;  5CXB B;  4PBZ A;  3NVX A;  3ZWL B;  4E54 A;  1B9X A;  3UVK A;  3KRW B;  1QNI A;  4LG8 A;  4E5Z A;  4QT8 A;  5FKT A;  3JRO A;  3RSE C;  2J55 H;  2HKM A;  2CE9 A;  2P9N C;  4CI2 A;  4H5J A;  2CE8 A;  3ORV D;  4ES0 A;  4GMB A;  2P9L C;  5TF2 A;  3C99 A;  3AL9 A;  3I7L A;  4FAV D;  4GZ8 A;  4ZOX A;  1U2V C;  1N6D A;  3SBQ A;  4J78 A;  2QC5 A;  3OKT A;  5TEE A;  1P22 A;  4FWW A;  4PSX B;  5EMJ B;  3UKR C;  2AGX A;  5B4W A;  2I0S A;  4YVD A;  5C9Z B;  5IGO A;  5A2Q g;  4FB1 D;  3VGZ A;  2IUP A;  5CXC B;  3I2N A;  5H17 A;  4J8G A;  3MZK A;  3RFG A;  4ZN4 A;  1SQ9 A;  4U7A A;  1JOF A;  3IKO A;  5I5M A;  2QXV A;  3BG1 A;  5KDO B;  5EAR A;  4ESG A;  3EWE A;  3F3P A;  5AJA A;  2P9U C;  2YNO A;  4AEZ A;  4QRJ A;  3OKY A;  1Q47 A;  4J81 A;  3EMH A;  4L9O A;  2P9I C;  4PSW B;  1NR0 A;  3K27 A;  3OL2 A;  3DWL C;  4K3I D;  4R7A B;  5GSA A;  3V9F A;  5HYN B;  5THA A;  2OVP B;  3RLM D;  3DM0 A;  4ZOV A;  3EI2 B;  4BH6 A;  4J0W A;  4ZOZ A;  5FA5 B;  5H1M A;  4XYI A;  2P9K C;  4CC9 A;  5FXY A;  4X61 B;  3EI1 A;  4CI3 A;  3F3F A;  5HE1 B;  1MDA H;  2GC4 A;  3I7N A;  5TEF A;  3HFQ A;  4A09 A;  4I79 A;  2J57 G;  4MK0 B;  4GGD A;  4CI1 A;  2HXC A;  4FAN D;  3SN6 B;  3ULE C;  4L3H D;  1XHM A;  3V5W B;  4LGN A;  4ZOY A;  1N6E A;  4CZV A;  4Z8L A;  5C2W B;  5EML B;  5K1C C;  4KFM B;  3PE7 A;  3IJ0 A;  1R5M A;  4E54 B;  1ERJ A;  3RMZ D;  3I8C A;  4JSV C;  2HES X;  3DSM A;  4XYH A;  1K8K C;  3N0D A;  3L4M D;  3FGB A;  5HE3 B;  4ERQ A;  4E5Z B;  5GMK n;  4PBY A;  1GOT B;  5EM2 A;  5GXI A;  3EG6 A;  2AH0 A;  1GP2 B;  3ODT A;  2IWK A;  4JXM A;  2H9N A;  2CN3 A;  4CZY A;  4JSP C;  3EI3 B;  5FLX g;  3F3G A;  3IJ1 A;  2H9M A;  3JZN A;  4A11 B;  1PGU A;  3BG0 A;  4J77 A;  4D0K A;  3RN1 D;  4J0X A;  4JT5 C;  2AGW A;  4NSX A;  4A0A A;  2XYI A;  1JJU B;  2H3X A;  5GXH A;  4QQE A;  3J80 g;  2B4E A;  4J73 A;  2OK6 A;  3JRP A;  3UVM A;  4HDJ A;  3NVN A;  5CXB A;  3FM0 A;  2H47 A;  3CFV A;  3FRX A;  3I89 A;  3OKW A;  5EAM A;  3EU7 A;  5AMS A;  1TBG A;  3GFC A;  5HE2 B;  4JT6 C;  2UZY B;  5EMK B;  4GQ1 A;  3EI4 B;  1K32 A;  3C9C A;  3B7F A;  3OL2 B;  1GG2 B;  3DXM C;  3PXS D;  5AFU 3;  4X60 B;  3JPX A;  3MXX A;  3PXW D;  2IWF A;  4GGC A;  3C5M A;  3JAM g;  5IT9 g;  4PC0 A;  4J79 A;  4JSN C;  3U4Y A;  5IC7 A;  3JB9 L;  2PM6 B;  1YFQ A;  3PSL A;  4CZX A;  2YMU A;  5CXC A;  3EI1 B;  3W15 A;  3C75 H;  2MTA H;  5JWZ A;  4U1E I;  4X63 B;  4CI8 A;  2H14 A;  4LG9 A;  4L1Q D;  4A09 B;  3MMY A;  4O1Q D;  3JZH A;  3SJL D;  2AH1 A;  3AH8 B;  4JD2 C;  4O9D A;  2BCJ B;  4O45 A;  2CN2 A;  3NVQ A;  4N14 A;  3CFS B;  1A0R B;  2H6K A;  5FKS A;  3AL8 B;  3GRE A;  4J82 A;  4JSX C;  4J86 A;  2IUR A;  2UZX B;  5I5J A;  4D6V A;  2CO0 C;  2AGY A;  1VYH C;  3K26 A;  3UVO A;  2O9K A;  4X3E A;  2H6Q A;  2HYE A;  2IUQ A;  5FQD A;  3PSC B;  5HE0 B;  2P9S C;  4J87 A;  4ERY A;  4PNK B;  3V7D B;  4A08 A;  4A0B A;  2YNN A;  5EM2 B;  4GQB B;  1RI6 A;  3UKU C;  5SXM A;  5C2V B;  3VA6 A;  3E0C A;  4OWR A;  4EWR A;  2GC7 A;  4FA9 D;  1GXR A;  3UVN A;  1TYQ C;  2TRC B;  4GM8 A;  3DXK C;  2XL3 A;  1XIP A;  3L4O D;  2GNQ A;  4GGA A;  3PVU B;  5CYK A;  4J84 A;  3MZL A;  2B5L A;  4H5I A;  4A7J A;  2OIZ A;  3I7H A;  3RRM C;  2Z2N A;  4IMM A;  2H9P A;  3KRX B;  4L3G D;  3SHF A;  5IGQ A;  4A2L A;  4OZU A;  4UI9 R;  2HKR A;  2XL2 A;  5IJ7 E;  2PM9 A;  2IUV A;  4XEI C;  2H6N A;  5H14 A;  4PXW A;  4A2M A;  3SBP A;  4AOW A;  4BL0 A;  1JMX B;  3PVW B;  2YBA A;  5FKR A;  2H9L A;  3SBR A;  1PI6 A;  3I7O A;  2Z2O A;  1MG3 A;  2OVQ B;  2XU7 A;  2AGZ A;  4Y7R A;  3EI3 A;  4GM3 A;  4K3J B;  1SQJ A;  3IJC A;  2CNX A;  3SMR A;  2H68 A;  4A11 A;  3OKY B;  4GQ2 P;  4FA1 D;  1PBY B;  2I0T A;  3RN0 D;  3OTT A;  2G99 A;  4O3T B;  4FA5 D;  4J8B A;  2YNP A;  4CY1 A;  4CY5 A;  4G56 B;  4TZ4 A;  3UVL A;  5K19 A;  2I3S A;  1SHY B;  5EAP A;  2B5M A;  1B9Y A;  1L0Q A;  2BBK H;  4FA4 D;  4O3U B;  3N0E A;  3I7K A;  3IIW A;  1MG2 A;  1PEV A;  2G9A A;  1XKS A;  2CO0 A;  2OK4 A;  5IJ8 E;  2I3T A;  4CY3 A;  3EI4 A;  2YB8 B;  3RFH A;  2OJY A;  1U4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...