3EGEA

Crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
247
structure length
247
Chain Sequence
SQTRVPDIRIVNAIINLLNLPKGSVIADIGAGTGGYSVALANQGLFVYAVEPSIVMRQQAVVHPQVEWFTGYAENLALPDKSVDGVISILAIHHFSHLEKSFQEMQRIIRDGTIVLLTFDIRLAQRIWLYDYFPFLWEDALRFLPLDEQINLLQENTKRRVEAIPFLLPHDLSDLFAAAAWRRPELYLKAEVRAGISSFALANQDLVEKGLELLTADLNNGEWIRKYGEIHHLQEIDIGYRFIYTTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative methyltransferase from antibiotic biosynthesis pathway (YP_324569.1) from ANABAENA VARIABILIS ATCC 29413 at 2.40 A resolution
rcsb
source organism Anabaena variabilis atcc 29413
molecule tags Transferase
molecule keywords Putative methyltransferase from antibiotic biosynthesis path
total genus 86
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3egeA00
2R3SA 5DXAA 5FQOA 2YR0A 1XDZA 4R8RA 3DP7A 4OA5A 3KR0A 1U2ZA 3JWGA 2CMGA 4PINA 2C7PA 4EKGA 5HOQA 3H2BA 4F85A 2A14A 3G8BA 2QYOA 3AXTA 3TRKA 5MHTA 4HSGA 1WS6A 2JJQA 3KR9A 1EIZA 1DUSA 1O9GA 5GIPE 3KQPA 2KW5A 4L7VA 5K05A 3EEOA 3CJTA 3UZUA 3LGAA 4QQNA 5K03A 1VP3A 3DOUA 2OB1A 3TM5A 4ER6A 2XBMA 4R6WA 3REOA 4FGZA 4RSRA 2ZCJA 3HVIA 4ER7A 3LBYA 3UJ7A 1EJ0A 3THSA 4RTQA 2R6ZA 3ANXA 3B5IA 3CCFA 3HP7A 4RWZA 3NVKI 2GA9A 1KHHA 1G6Q1 4AUKA 3P2KA 4JXJA 3LKDA 2YQZA 4DQ0A 5FA5A 2PX4A 4FP9A 3G7UA 3OU7A 2UZ4A 1D2HA 5GM2A 1JSZA 2NXEA 2LD4A 2Q41A 2O06A 4FSDA 1SUSA 2BZGA 4PNEA 2Z6AA 3IV6A 4PYJA 2YX1A 3FTCA 2JHCA 2NXCA 2OXTA 3T7RA 1YB2A 3QOWA 5K0BA 3OFJA 3LSTA 5EHGA 3EGEA 3G88A 2B2CA 2GAFA 3ER8A 3R6TA 4GOOD 1G55A 3A26A 5P8WA 5K0LA 4X61A 2HTEA 3MAGA 1EG2A 3JWHA 5FHRA 3BZBA 3KKZA 5T6BA 5U4XA 5K0FA 1H1DA 4Z2YA 5ICEA 3FZGA 1Q0TA 3K0BA 1D2GA 3GRRA 4YV1A 1KR5A 2YTZA 3HCAA 4X63A 2PT9A 3VSEA 2ZIGA 1JG2A 2WK1A 2K4MA 5H02A 5HIMA 3SMQA 1R74A 4C08A 1VP9A 3PX2A 4MIKA 3DLCA 3O7WA 4RTPA 2ZSUA 4YUXA 5K01A 3ERCA 4YV2A 5E1DA 1UFKA 3EVFA 2IDJA 3THRA 4GEKA 4RTNA 4CKEA 3M4XA 3M6VA 3B3FA 1EJ6A 3HA5A 3TLJA 2PLWA 3HVKA 3P9KA 3UJ8A 4BP3A 2BH2A 4PYMA 4PGHA 3GRZA 5EGSA 4E32A 2FYTA 3FYCA 2UYQA 2OYRA 5D1HA 3AWIA 5GWXA 2PWYA 1TW2A 2AN3A 2P3OA 2VP3A 3JWJA 2NNWB 1RJFA 2P7HA 4EKIA 2FHPA 5HILA 5FUBA 3P9CA 1YFJA 4YV0A 3FTDA 3ELUA 2F8LA 3UA4A 1XCLA 1P39A 3GDHA 5F2OA 2P7IA 4GF5A 3LCCA 3OU6A 1XTPA 2EJUA 3G2OA 3NW9A 3M70A 5LSAA 3PLAE 1X1BA 2OBFA 4QVKA 5E2AA 4RTOA 2Y1WA 5ICFA 2OO3A 3R3HA 2ZLBA 3E05A 1O9HA 1NV8A 4X60A 5FULA 2ZIFA 5DX1A 3V97A 3UJ6A 4BLVA 2GPYA 3EVGA 4PYQA 4WXHA 3MERA 2YUIA 4EVIA 4DZRA 1FP1D 5KYGA 5E9JA 4DA4A 5CUQA 4O29A 4CKBA 3UJ9A 4E70A 5HIIA 1PRYA 3DUWA 3LX6A 4QVGA 4CXMA 1DCTA 2IBTA 3G2PA 3CC8A 1JG4A 1TPYA 2C7RA 3A7EA 4CKCA 5E8RA 4AZSA 1VQ1A 1NT2A 4YMHA 5BXYA 3GXOA 3ME5A 3SSOA 3VC2A 4M36A 1L3BA 5IKMA 3ORHA 4KVZA 5K0EA 2OKCA 4NECA 2BM9A 5CCBA 3AXSA 3FPJA 4YUWA 1JQ3A 1UIRA 3DMHA 1G60A 3BWYA 3NWBA 5GOZA 1FPQA 5EHIA 2VDVE 2AN5A 3EEYA 4BY9E 2XVAA 3NTVA 1Z3CA 5K09A 2FPOA 4RTLA 3G5TA 1YFLA 4ATNA 5BP7A 2AOTB 4AZTA 3PVCA 1RI4A 2NXJA 2ZWVA 2NP6A 2XVMA 1IM8A 1EQAA 3PX3A 1G38A 2AN4A 2YXLA 2OPBA 3ELDA 3GJYA 3P9NA 3RODA 1WZNA 2OY0A 2VDWA 1NBHA 3HCCA 2JHAA 4XCXA 5FWAA 2ZZMA 3ID6C 2XYVA 3F4KA 3G8AA 2ZTHA 2QE6A 3BGDA 1VIDA 4P7KA 1NV9A 3I58A 3KQOA 3TOSA 3BT7A 2IH4A 1SQFA 3BWMA 4IKPA 4QPPA 3SM3A 4QQKA 5E1MA 1VBFA 3CJQA 1M6YA 1NW6A 1ZGJA 4YMGA 3LHDA 5EKUA 3A7DA 1N2XA 3P2EA 3B3GA 1KIAA 1KPHA 5HIJA 1YUBA 4AZVA 2C7QA 2BR5A 3E8SA 3MCZA 4DM3A 1BHJA 2VDUE 4EMSA 3CJRA 1XDUA 1XDSA 4FSXA 4RVFA 2AOUB 3I9FA 2YVLA 5EVJA 2O07A 3G89A 4ER3A 5EPEA 3FTFA 1VLMA 3P9IA 4RTMA 1AV6A 4Y2HA 5JR3A 1HNNA 4WVLA 4HGYA 3LDGA 2ZWAA 3C6KA 1WY7A 2ESRA 3OE5A 2AOVA 3ELYA 5DSXA 3UA3A 2XYRA 5DTRA 4QDKA 4X1OA 4OA8A 3M6UA 5C9ZA 2AS0A 2BR3A 4CTKA 3SR4A 3KPWA 2PVCA 5BW5A 4KRGA 1JTFA 4H0NA 4RTRA 3DXXA 1T43A 5LQCA 3AJDA 2UYCA 3QV2A 5GINE 4E2XA 4OQDA 5E8JA 1D2CA 4CWAA 3HNRA 2PX8A 1JQEA 1XVAA 3I5UA 4KIGA 5EMMA 2ONYA 1NBIA 1TW3A 3KU1A 2JH8A 3MB5A 2HR1A 2O57A 1YZHA 2IDKA 2O05A 2P35A 3FUVA 5EIFA 3GGDA 3LDFA 3NDIA 3UBTA 3MQ2A 2AVNA 2G72A 4DKJA 3LBFA 3BWBA 4GBED 1WXXA 3DULA 3EGIA 5EIWA 2IBSA 1L9KA 3AY0A 5DLYA 1JSXA 4DCMA 2I62A 1SKMA 4PYNA 1QAMA 5KS2A 2I7CA 2ERCA 3CKKA 3HEMA 3GRVA 4PYLA 4V0RA 3DMFA 3FRIA 3UJCA 3GIWA 4LWPA 1L1EA 4KW7A 4OBXA 4XUDA 5FHQA 3T7SA 4BP1A 3MTEA 2XYQA 3OZRA 2N47A 3R0QA 9MHTA 3S68A 2AOWA 5EQJB 3SSMA 4PCAA 2FK8A 4KIFA 3UJAA 4YUYA 3QOXA 5DT2A 4R6XA 3A25A 5D1NA 5LQUA 3EMBA 1VPTA 3EVDA 3B89A 3CGGA 3JWIA 5HIKA 5KQSA 3ELWA 2H11A 3KQYA 2QRVA 4KDRA 3NJRA 2EJTA 3VC1A 1XXLA 5DPMA 4M7RA 2IP2A 1XCJA 2PXXA 4C04A 2IGTA 3NWEA 3R24A 3DLIA 3KPJA 4U7TB 5GM1A 4FS8A 5CD1A 2I6GA 3WSTA 1G8SA 1VE3A 3NDJA 3FPGA 1QAQA 3PFHA 2DULA 2P3LA 3DXYA 2PGXA 4RVDA 3UFBA 1YZ3A 5FCDA 4LECA 3SGLA 5EEGA 1DL5A 5CVJA 4EQZA 2P8JA 4C06A 4HRAA 3Q7EA 3IEIA 4GQBA 4E2WA 2PBFA 4YUZA 7MHTA 5EKXA 2AOTA 3KQTA 1KYWA 2G8NA 2H00A 1INLA 3TQSA 2GS9A 5DM4A 2ZBQA 3M6XA 3P2IA 5EOVA 2ZW9A 2B9EA 3MGGA 5G02A 4A6EA 1G8AA 1N7JA 2AOUA 2FK7A 3EPPA 2VS1A 2PX2A 2PKWA 3CBGA 5BW4A 5K0GA 3P71T 5E9WA 4RTJA 2PJDA 4LG1A 4C03A 4C4AA 1QANA 1F38A 2AVDA 3BUSA 3C0KA 1L3CA 2VZ9A 1NW8A 3EGVA 1SVUA 3KR2A 5DWQA 3T7TA 5IH3A 4PCLA 1ZG3A 1FBNA 2ZULA 5E1BA 3EVBA 4QTUB 5E9QA 2HV9A 2PY6A 1I4WA 2ZFUA 2FRXA 2UYOA 3LKZA 4RYLA 4RVHA 4PGGA 1X1DA 3G5LA 2BM8A 1X1AA 2PXCA 2Y1XA 4RV9A 5GP1A 4AZWA 1HMYA 2OZVA 3B3JA 3UJDA 3HM2A 4HGZA 4E30A 3R9XB 2JG3A 3DMGA 3DXZA 1NE2A 1YF3A 2EFJA 1ZGAA 3E7PA 1NKVA 4FT2A 4OX9Y 3HVHA 2FCAA 1JG1A 1JR4A 5B1SA 4E2YA 5FTWA 5K0CA 2P1DA 2ZIEA 3T0IA 5K8VA 3EVAA 5FA8A 3A4TA 1M6EX 3RIEA 5KVAA 3B7PA 2IH2A 3KPUA 2O0LA 4OBWA 3BKWA 4E2ZA 2B78A 3OE4A 4DMGA 4QDJA 4RVGA 4DCGA 1JG3A 2AOXA 1KXZA 5DM0A 4RTKA 1P1BA 3IYLW 2CKDA 2G70A 1RJEA 1KP9A 1ZQ9A 3I53A 2QRVB 3O4FA 5LR6A 3HCDA 1RI2A 3OU2A 2I9KA 3LDUA 4HTFB 3LCUA 5EZQA 3M6WA 4YUVA 2ADMA 1QAOA 3BWCA 3KR1A 4P7GA 5DM1A 4E31A 2IH5A 1ORIA 2OB2A 4ER0A 1JQDA 4PIPA 2HWKA 1SUIA 2PX5A 4HH4A 1MHTA 2ONZA 5EEHA 5K0JA 8MHTA 3SSNA 3EVEA 3KQQA 2WA2A 5E1OA 1FJXA 4F86A 4PYOA 5DTMA 4PYKA 1KPGA 3EVZA 4X41A 4DF3A 3P97A 3I64A 5LQRA 2IFTA 1KYZA 1PJZA 4QTTB 3TR6A 4EK9A 2B3TA 3TM4A 5HEKA 3OPNA 2ZZNA 1WG8A 3G2MA 3OFKA 3PB3A 3X0DA 3FUWA 3EVCA 3BGVA 4KWCA 5FWDA 4M38A 4BLWA 3NVMB 1MJFA 1OR8A 5K0NA 1ZHFA 1I9GA 4GC9A 3MTIA 4B17A 3DTNA 1NW7A 3DH0A 3DR5A 2P41A 2WA1A 3OZSA 5LQJA 2UYHA 1R8XA 1QYRA 2Z6UA 3Q87B 4RTSA 2GH1A 2H1RA 2PWPA 1F3LA 5HZMA 3SVZA 5DSTA 3P8ZA 3O31A 4KDCA 5LQKA 1M0EA 2JH9A 4GUAA 5KQRA 3PT9A 1AQJA 2G71A 3MHTA 2ZBPA 2ZZKA 5DRTA 1ZKDA 4QPNA 3LECA 3FPEA 2EX4A 3KQSA 3FRHA 4GC5A 3IHTA 3FUUA 3C3PA 4IV8A 3GNLA 3OCJA 1VL5A 3PFGA 1O54A 2NXNA 1UWVA 2P3QA 5ERGB 3KPYA 4FT4A 1SG9A 3KQMA 2B25A 2JHPA 4IWNA 4OQEA 4Y30A 5M5BA 5DM2A 3HCEA 2P40A 4A6DA 1NW5A 1RI1A 1X19A 5E2BA 5EMLA 4FR0A 1I1NA 2QM3A 4FZVA 5DRYA 3MCTA 4GOMD 4ZTBA 5F2KA 5EMJA 4PYIA 3KQWA 1IY9A 3TPZA 2YXDA 4ER5A 1RJGA 1Q0SA 1RJDA 4IV0A 5EZSA 1WXWA 3G2QA 2V74B 5CCXA 3FYDA 5LQNA 4UOEA 1QZZA 2EG5A 3BGIA 5FQNA 2G1PA 3FUXA 3LL7A 5T64A 2CMHA 2IPXA 4HTFA 5DX0A 3UWPA 3HTXA 3PS9A 4U7PB 1BOOA 5HFJA 1P1CA 3OZTA 3FUTA 2GLUA 2V7EA 4G56A 3EMDA 2NP7A 3E23A 4MTLA 4M37A 3L8DA 3KQVA 5CVVA 5T67A 1FP2A 4ISCA 3NMUF 2GB4A 2HMYB 5CM2Z 3V8VA 1ORHA 1B42A 4BLUA 4C07A 2CL5A 5ICGA 5ICCA 3UJBA 3ER9A 3FPHA 3D2LA 2PXAA 5DTQA 3U81A 5C1IA 5CIYA 1V39A 3A27A 1AQIA 5EMKA 3RW9A 3TFWA 1P91A 3GU3A 3K6RA 4XUEA 4CTJA 4F84A 3HA7A 3KPVA 4LWOA 1EAMA 4HG2A 3GCZA 2ZVJA 3GO4A 5EC8A 3C6MA 2BR4A 2NYUA 3BXOA 3HVJA 2Z6QA 1R8YA 3HA3A 1AF7A 2PSSA 4XUCA 1RI5A 5CVUA 1BC5A 2PT6A 3GRUA 5DXJA 1RI3A 1IXKA 4GOLD 5CVEA 3FTEA 3HCFA 4P58A 1BKYA 3BKXA 4RX1A 1R18A 5EG5A 4R8SA 4V0QA 2C7OA 1SQGA 2E5WA 2QY6A 10MHA 3SX0A 3TMAA 4MQ4A 4C05A 1L3IA 2IIPA 3TKAA 4MHTA 2ORED 3CVOA 5JUWA 4P7FA 5LQAA 2CWWA 4P7JA 3FPFA 4GOND 2HNKA 3LPMA 3LCVB 4HC4A 2YXEA 3M33A 4MWZA 5C0OE 4PIMA 3TKYA 1X1CA 2ZBRA 1NW3A 5FADA 5F2NA 1R6AA 5GIOE 4PONA 3KHKA 3C3YA 1JTEA 1KPIA 4AX8A 3HCBA 1N7IA 3VYWA 4POOA 4R05A 2PV0A 2AZTA 5DX8A 3PTAA 4K6MA 3SXJA 3GRYA 4PWYA 3GWZA 2DPMA 5CVDA 2AR0A 1Y8CA 1R00A 1XJ5A 4E33A
chains in the Genus database with same CATH superfamily
1F8GA 1RQPA 3S7TA 5G40A 5KYUB 5BURA 2CLKB 3KR0A 1NR5A 1D07A 1F8UA 1N2IA 3AY3A 4UHBA 5JSYA 2C78A 3U0VA 2PN1A 4MVJD 3E5NA 5I5GA 3GJZA 1V95A 3KKLA 5EWMA 2QTFA 1E9AA 3B1KA 3HN2A 1VSQA 2V8OA 4HX5A 4X00A 4E09A 3U9LA 3HWRA 2A9OA 1SG6A 4LX0A 4A2WA 5JO0A 1X7ZA 4UHCA 1I5OA 1MW8X 1BDMA 1ZRSA 1NJ2A 1CFZA 1Z26A 2ENWA 1BEEA 5J59A 2GBLA 1E2QA 2JCYA 1PNOA 4PNPA 1T5DX 1TM5E 5DYYA 4EG4A 3JAKB 3UJ7A 4B34A 1NXTA 2ERYA 1Z4NA 1KMNA 2NU7A 3Q6MA 1KHHA 1FYVA 1R3DA 1TM4E 4EFDA 7MDHA 4F12A 1QHIA 1GQQA 1YTLA 1IB6A 1JHVA 4D46A 1P9RA 2JIPA 4FSDA 2LCIA 5LM3A 2NO6A 2NZ2A 5TF0A 4C7KA 5K4GA 1IJEA 3H3JA 2BIFA 3ZHQA 1JNYA 3I04A 1QV7A 3LSTA 5EP3A 3IDAA 1E2EA 3ER8A 5EFOA 5F9FA 3A26A 1PFQA 2WSSA 4WW0A 2PNJA 3P4UA 4KQJA 2QJRA 3WL8A 4IKEA 3HH8A 5IXJA 1PJLA 4WCFA 2AFHA 3PIIA 1GGVA 1PK8A 5GJBA 3JRNA 3ZU4A 2VDPB 2Q4EA 1WZCA 4PXAA 4BNVA 3OQMA 2LUOA 2YXNA 4ZJPA 1TPZA 1MH1A 5HIAA 3C3BA 4RPKA 3ETNA 4IDCA 2Q5QA 3R3WA 5FI3A 1JG2A 1RYHA 4TTRA 3ZVRA 3AIOA 1FYDA 1RKVA 2K4MA 3N8DA 4D41A 2R7NA 3OCVA 4PNZA 3G7NA 3AF1A 3INTA 2WICA 2Z4SA 2MSNA 4P3KA 3VOTA 4CL2A 3AM3A 2A1TS 4LDRA 4C0LA 4MGZR 4DJ5X 1SM4A 5E1DA 5C1BA 4CKEA 2J09A 3QJ5A 2A5JA 2CBGA 5AKXA 1IY2A 1IHUA 4MGYR 4H17A 2AUTA 3EFOB 3KVVA 4XJTA 4MKZA 4QSMA 3S70A 3HVKA 3ZDQA 4AECA 1RJ9B 3EJ6A 2VKQA 1Y3AA 3KVRA 4PYMA 1PR4A 4W8HA 4Y3UA 5THQA 3VKFA 3JZFA 2O2HA 3WIOA 1Z08A 4DPMA 1ZUNB 2VJQA 1NQTA 4K6OA 1Y1TA 2PWYA 1FYWA 4WOCA 3HRIA 1VCMA 3CEMA 2AXPA 4C7VA 1NZFA 3H4TA 1YC5A 3H8VA 4MWDA 2OV2A 4RZXA 3CKYA 1Q14A 3JRWA 4EFNA 3USCS 5JCJD 1YFJA 2NQ8A 1D09A 5KX5B 4H1VA 2A92A 1YZTA 3PC4A 4PGMA 3O4RA 3LGXA 2NAPA 3HGMA 4MUFA 4RKQA 3KP1A 4W5WA 3L6RA 2Y68A 1QU3A 3VHQA 5CLIA 1KVTA 1E69A 4LDQA 3TLXA 3WK7A 2V96A 2Q0SA 4YO7A 2MU1A 4QYSA 4PSDA 2L69A 1ZA2A 4LYAA 5F52A 1JSLA 3EYWA 1VRVA 1NLZA 4MINA 5B5SA 3JSXA 3PE4A 1K9SA 2HA2A 1AS0A 2J0UB 1NKTA 2A9QA 3R0JA 3SS9X 4BJ5A 4DZRA 3D0RA 2YNMD 2GEUA 4BXOB 4FFSA 3AEUB 3QPCA 3LX6A 4QDKA 1W59A 4BFXA 2V7QA 3GYGA 3PXDA 3TCKA 3Q85A 4R3UC 1T3ZA 2GEJA 1F7VA 3KXDA 1B7GO 2FGJA 1DB3A 1KVUA 4PZCA 3LY5A 2YHBA 5G1PA 1NT2A 3KOMA 3ME5A 4L9AA 1T8SA 2HWYA 3I2KA 3UJPA 2FPSA 5TGDA 1G6HA 1K3UB 2RB4A 3TG8A 4TLAA 4LJAA 4YJHA 5EIHA 3R5HA 1G60A 3EWNA 3ZHUA 4A5OA 1FU4A 1SOWA 3PXAA 2ZIXA 1HDYA 2FLVA 3MILA 3I8XA 3NTVA 1NG1A 4Y2YA 3G5TA 4U5QA 1FFSA 4LSMA 1Q17A 3B9PA 3H9BA 3KHUA 1RI4A 3BF8A 1DIHA 3H5LA 3Q3EA 3PX3A 1UL1X 3CUTA 2C9YA 2YXLA 4XJXA 4S1TA 4D0RA 1I6MA 3KT6A 1WBBA 1SVNA 2X19A 4NG4A 1CS4C 1L5GB 4XYGA 1IMJA 4WKNA 1VJ0A 4YCNA 5ADVA 2AN1A 2W6CX 2XYVA 3BTOA 2LPMA 4MV9A 1TQ6A 5DHUA 3UGKA 2Q1WA 3OTQA 4QDZA 4BVHA 1AXRA 2JASA 5T3YA 1P6UA 5EJ8A 3OE1A 4ZJZA 1E2HA 1G3UA 1DQYA 1FS4A 2LXNA 3DAHA 1ZGJA 4GKVA 3R3UA 1GPWB 2AX4A 2KE5A 2VHVA 5DU2A 5E4YA 3S4YA 3U1VA 2IELA 4ZAWA 3FCAA 1HO3A 3O2JA 2VEOA 3ENWA 4MUJA 4F2PA 2GJSA 2GBCA 5DCYA 1R15A 3DQQA 1Y4SA 1RTKA 3VO2A 1I3LA 1G8JA 2XIJA 2WHPA 1SHZA 1XZFA 1U0BB 2R8EA 1Z0IA 2QRMA 3JD0A 1IJFA 1NLMA 1WMEA 3QXXA 4NOJA 2VJOA 1IEVA 1XDWA 4KVAA 1I32A 1GPUA 1NMYA 2WF9A 3M4NA 4KITB 1NJ6A 1SHLA 2CXTA 3AF0A 1EESA 3FYUB 1MNQA 1E60A 5F1PA 1BMDA 1XD8A 3OQIB 5KYWA 4P4UA 4NK4A 4F3NA 2VDLB 3GJSA 2XYRA 2WP0A 1V16A 4MW4A 4BX3A 4AMUA 1ULAA 3CLUC 1MH9A 4UUMA 1KYXA 2G9VA 1HBJA 1V8FA 2SKCA 3UXMA 4C4XA 5DBOA 1VIYA 1Y4UA 5BW5A 2GOYA 1U5CA 2GKOA 4RVUA 4ME6A 1ECPA 4PPYA 1I2CA 1JTFA 1NQXA 4NS1A 1F0NA 1WCV1 3QV2A 5DV9A 2X1VA 2BFMA 1MFZA 2B7CA 3GBSA 3GJ4A 3NHBA 1W88B 3L6EA 3U3OA 4OHKA 3I5UA 1GL6A 3MM4A 1XR3A 2PYIA 2JBHA 2VKTA 4GXNA 1KEUA 2I5PO 3KZVA 4PG5A 3A28A 3AY6A 4D99A 3UK0A 1ECJA 2UAGA 1V9LA 4I1YA 1FQOA 3D3EA 2J5QA 4DCMA 2QAJA 4M7OA 2VH5R 1G0OA 3IFSA 4JB8A 4AP5A 2OCBA 3JQ8B 4JEIA 2GM3A 1WUTA 4L9RA 5B55A 1KAQA 3AO0B 3GRFA 3VH1A 1C9DB 1G2OA 1DEHA 3NH9A 1WUIS 2QAIA 3K9HA 3Q2OA 3KBOA 4F38A 5DT9A 4PZDA 1XZAA 1EFDN 1JH8A 3MQ4A 4NOKA 4AUNA 2O8FB 9MHTA 1J42A 2OZLA 1GFWA 5CA1F 3P9SA 2HSZA 2G67A 1J6UA 1M8JA 3D1VA 3OQHA 4QUHA 3WP0A 5BYAA 5DK4A 5HSGA 2BP7B 4EJFA 1NXSA 3FGOA 4MWSA 1GDDA 1EINA 1VPTA 4KZKA 1XLTA 2RONA 3JWIA 4OP2A 1AUQA 4RLQA 3H13A 4BN0A 2BFEA 3N28A 5LN1A 5DOZA 3CVVA 4GSKA 3LUHA 4Q3EA 1NN0A 2IZ6A 3LW8A 1IYZA 2H1CA 5DPMA 5IT4A 2IYYA 2ZJFA 3IAM1 4EJ0A 1FYFA 5EJGA 1S3FA 3W7AA 1QOPB 1O7JA 1USVA 1OFGA 1W52X 2BI8A 3BWVA 3H65A 1HEUA 3MBOA 3OPVA 1CY8A 2Q5IA 4PZYA 4QM7A 2BGMA 3TINA 1RAFA 3DCYA 3CZPA 3KJNA 4KV9A 2IEBA 3K0CA 3NBUA 4O2LA 4RACA 5KNDA 3KSAC 2Y6VA 1D1QA 2DE0X 3VTAA 5EEGA 4YCJA 3X43A 1M7GA 1YZVA 4K9KA 1U2PA 4MS4B 3E9DA 3A4LA 2Q9UA 5DKFA 1GGNA 1R16A 1TVCA 2AW5A 4XJVA 3VQTA 1TU4A 2CEKA 3BMQA 4FM9A 1DBIA 2L82A 1XELA 1GPAA 3L18A 1SKQA 3NETA 4GXQA 4KXUA 3HDJA 3QE4A 4G5SA 4ID3A 3ZWBA 2RKWA 3VSAA 1F14A 2ZQ5A 4DAOA 3WYNA 4B71A 3SZOA 3USES 4L4SA 4UAJA 4Q9IA 3UCFA 4EEKA 5EKSA 2H0AA 2IY9A 2VJBA 3IA2A 1CB0A 2NN3C 4HLDA 4PPGA 1PSWA 1QANA 3JQAA 4IO0A 2H1WA 3UK1A 1C2TA 2Z57A 1QKJA 4AP9A 2GZMA 1W4AA 2EQ5A 2YDXA 5KSYA 2HV9A 1RRKA 1M5TA 5JCPA 1YOVB 1DRVA 1NQWA 2FRXA 4MWEA 3GDGA 2ZJBA 5IYZA 4OMUA 5CW2A 2PGAA 3AVOA 3FMPB 1N8TA 2WM2A 3MD0A 1AKQA 5T8KA 1OH7A 2J3KA 3M3HA 1MBZA 3DFUA 2WPDA 2V0CA 5LBUA 2R8YA 4RWEA 3UKOA 3AUYA 3ET4A 4AY5A 2P1DA 4IWYA 2IHVA 3DBHB 4L16A 3ST7A 1DG1G 3T1TA 3QQPA 3PQCA 5T4FA 3DS8A 1BH2A 4JOBA 5AKKA 2JFPA 1NVWQ 1J56A 1PIWA 1Y1QA 2UUOA 3JX9A 1I9CA 2ALJA 3MF4A 4IJ5A 1DX9A 1S3GA 1PZGA 4L2IB 1QCDA 5TDHA 1OX6A 2WYWA 1T1GA 1W93A 2ZTSA 3I9LA 1RJEA 2EGGA 5ALLA 4DCJA 4FDVA 4JX9A 1Y1SA 2J5XA 3CIFA 1U0NA 4D4LA 5E3JA 4DM7A 3OWHA 4E46A 2W42A 3GNTA 4HTFB 4N3BA 1MW9X 4QXAA 4DRZA 5BQ3A 4PY2A 3V80A 4KWTA 2X9LA 4GKKB 2X8JA 3HSSA 1T6BY 3MTQA 5HM8A 1REQB 4BAZA 2HHJA 2CMKA 2HJHA 2C57A 3MWJA 3NONA 2OB2A 1GCUA 2HM7A 2X13A 2IUFA 4AZ3A 4ZYXA 3JD1A 4LZZA 4C3OB 1OXTA 2V9ZA 2X15A 1VPLA 3AUTA 2RIPA 5TGTA 4BNXA 2D2XA 3LUPA 3OX4A 3QSYA 4DF3A 1NRWA 2ZRKA 3EQZA 3JQBC 4JLDA 1Y6FA 4FYWA 1TEZA 3OETA 4I99A 1R0KA 1MVOA 2FCRA 4JI7B 2BFBB 3A2NA 2XUQA 2Z95A 3NAQA 2V59A 5DM70 3ZHOA 3EVCA 2XWJI 1WKVA 4IDDA 2ZE8A 3ESRA 4DBVO 2F43B 3PHLA 3A6LA 4Q1AA 1EI9A 1EVLA 2X5XA 4O4HB 4YJ3B 1QE0A 5K0NA 4F4CA 1NY6A 4KXLA 1DMSA 3W3AH 3KL4A 2HSDA 3DEYX 3TQQA 1JQAA 3BOSA 3OZSA 5DBEX 1H66A 1MQ9A 1ZKMA 3BGSA 3F97A 1DAGA 2V7BA 3TZCA 4BECA 4UFOA 4RTSA 4FBGA 2PMEA 3HY3A 3FYSA 2IPMA 1D0SA 1V16B 3PC8C 3ZCSA 2XMDA 4C7OB 1GU1A 2NTJA 4KVFA 3NNDA 4MVJG 4P22A 2FW6A 2G6TA 2ES4A 2G71A 1KHTA 4I50F 4BBAA 4L76A 5ITSA 3U5TA 3QJYA 3D4NA 2D5CA 1KFEB 2QTHA 3FPEA 3GLUA 4D3ZA 4DR1B 3INRA 5FTJA 1MTOA 3FUUA 3RSLA 3HABA 1GEEA 4KMRA 5AUNB 4OXYA 1ZISA 4M0DA 1RRFA 1TF2A 1G5PA 2CDNA 2GZ2A 4OQEA 4Z9AA 5KC8A 4NU8X 4ZQIA 1W4BA 1ST2A 1GA1A 4L3WA 2V3VA 3E18A 4M46A 2FX3A 1XO1A 3ZV5A 1K63A 4O1MA 4E4YA 5BQFA 5M2QA 4CIBA 1NYTA 4GOMD 3E9NA 2JDIA 3MWLA 4QLOA 1X7WA 3OVMA 1C2YA 1RJGA 2LZ0A 4LV6A 4P0TA 4A03A 5LMCA 3NDBB 1PV1A 4GM4A 3FYDA 3VOAA 3GLIA 2MIIA 4JSYA 4B4UA 1HZJA 4AO6A 2JA1A 2GAAA 4XJSA 5BN3B 2BONA 5MN5A 2X0FA 2IP1A 2GLUA 4ZCIA 5KCZA 1N3IA 3E23A 1R37A 1D7OA 3CVWA 5HZGA 1GXSB 1RRVA 2QX7A 2ZCVA 4AS3A 2XKAA 3U3JA 2FFQA 4YI5A 3TVDA 5CG2A 2CFTA 2CL5A 5C8YA 3TIFA 5K5EA 4CI9A 4TM8A 1T34A 1Q1QA 5CA1B 1AMOA 4INAA 1ZGZA 1M1XB 3L7MA 2IEDA 4B3CA 1V41E 3IEVA 5C7IO 5C32A 2R66A 3A05A 1JN0A 1TAUA 4GLBA 2W70A 2NVWA 2D0OB 4Q3AA 1QRSA 3C5WP 4TWBA 3N0TA 2MDTA 1ILWA 2C9DA 4Q15A 4QNNA 4KLCA 5L3ZA 1ZEJA 2OHIA 4C0QC 3RRYA 5ESWA 2YJ5A 4XYEA 1DI0A 1ZM9A 1R0XA 3QSGA 4OY3A 1NHWA 4WK0B 1R18A 2VI5A 3C1OA 2PGNA 1MZVA 4OMFG 2QY6A 4CLRB 5FOSA 5TPWB 4YYEA 2JAQA 3OHMA 1RMYA 1Q16A 3QW2A 4D8WA 3MJTA 3D4IA 3RRMA 1ZZEA 2CWWA 3CZ5A 4IVPA 1XQ1A 1EK1A 2WKQA 3V34A 2GAJA 3SF8B 4CDGA 3K4PA 1O95C 2QRJA 4ZCTA 4PONA 4NXMB 3WK8A 3SBEA 3AI3A 1N7IA 4YJGA 5DX8A 1OWNA 3I5MA 4UREA 3UOAB 1Z38A 1ZCAA 3ON5A 4JELA 4NHEA 1UQTA 2AR0A 2I91A 1SC9A 4UZEA 3FROA 1MRSA 4B47A 3A3OA 4BNUA 4LJ8A 3OE7D 3HZRA 4LHVA 3JWGA 3L4SO 4G0QA 3M83A 3V7YA 4FQ8A 2A5GA 3EXFB 4LY6A 3UC9A 2QX9A 3TRKA 2DQ4A 2LNDA 1T6YA 4RQTA 4EENA 3K0FB 4L15A 4RF2A 3COJA 1FX1A 1S6YA 1WUHS 2BDEA 2RCNA 3D4OA 4O4IB 4IJUA 4CLOB 5MGNA 4TYYA 2XBMA 3IAEA 3SXPA 3ESCA 4OLHA 2X14A 4OIMA 4N5IX 1FMFA 4EW2A 1CUGA 2M1XA 5F3RA 4UFPA 3O03A 4TYPA 4RTQA 3LA8A 4Q0MA 4ZODA 3ZZUA 1NF9A 3MWEB 4FFMA 4KWHA 4EHIA 5J1TB 4XPIA 2QL9A 4ZIRA 4ZOQI 5IZCC 2Y4OA 3U7GA 1O08A 2WV7A 2PX4A 3RIXA 2OAEA 1AV6A 2G5TA 2VHCA 3LUGA 4MYSA 1RXYA 4H35A 3RFTA 5BQOA 2ZYUX 5HXAA 1FU8A 3UAWA 4CZ2A 4JYZA 2AUMA 4EVQA 1TI7A 4O8ZA 5AVZA 3OFJA 2PBZA 1YE3A 1ZICA 2QLTA 3OPQA 4HDNA 4Y6PA 3TJZA 3UEOA 3DOFA 4NCXA 5GJWC 5KSPA 4DMKA 3U4QA 4AMBA 3RVRA 1OX4B 2NAFA 3JWHA 3QYPA 3TEMA 2YRWA 3N8IA 2H1LA 1NPTO 1L5QA 3G0IA 4KLNA 3AR3A 1JYSA 3F1KA 4YP0A 4QGSA 3OTGA 1P0CA 4EK9A 1NONA 3STUA 2ZIZA 3KQNA 2YTZA 1IUNA 1LLUA 2CLLB 2OUIA 3GR6A 1AF4A 3KKMA 1AS2A 1IAQA 3JASA 4C43A 4QT4A 1E8DA 4JASB 4GPBA 3RH0A 4DE5A 5HOEA 3A1TA 1HDGO 5L3QA 3T3OA 3HHEA 3PX2A 2G3YA 3DLCA 4UUPA 1P0PA 4WKCA 4TSRA 5AVVA 4MI3A 3A06A 1UT5A 3G0DA 3IAS1 4M60A 5F7ZA 4H7HA 1GM5A 1Z5OA 1WXDA 5LL6P 4PAQA 3IBFA 2X5NA 3L05A 4TT3D 2YIVX 3VAAA 1WA5A 3V1MA 2XY4A 5AM5A 1QUFA 3WY9A 1AZLA 4D81A 1DXYA 3H5RA 2ZG6A 4N8EA 4EF5A 5JS1A 1ZWKA 1MXFA 4B3FX 1EFPB 3NT4A 1QIIA 1BJTA 1JDBC 1QR2A 5EZ5A 5BSRA 1PWXA 1RJFA 2P7HA 3I5XA 5T5QA 3D1LA 3H8WA 3ONEA 4RPIA 5REQA 5FUBA 1QRTA 3SHVA 3DVAB 5SYAA 4YV0A 4G9EA 2QROA 3QE3A 4UUNA 5FPHA 1NOIA 1CDZA 3BFKA 1MOPA 4DMFA 4BDSA 3NW9A 3PLAE 4TWJA 1C3OB 3A0UA 3ZWVA 3T3HA 1RYFA 2ZLBA 1ENYA 1DWUA 1XTQA 3D6NB 3MUEA 1T25A 3WLRA 1GU0A 1UDCA 3UJ6A 2H51A 2NO9A 4V39A 3IEMA 4LVUA 1TQ2A 1SUEA 4O3FA 4LY0A 5IHXA 2H2DA 3FUCA 3LV8A 1G5RA 4CKBA 5C46F 3GRKA 2R8BA 3E3LA 3V1YA 5E3HA 4RZQA 4CV1A 4G1FA 5CLQA 1UBUS 2VXOA 1PJRA 4RJJA 3N0RA 5E8RA 3UGJA 3K5WA 4UM7A 3H9QA 3GLGA 4ARIA 1YQTA 2G9RA 3GJTA 2YH2A 4LNHA 4TVOA 5JCOC 2A0UA 2PR2A 4TROA 1J8YF 2OD7A 3R75A 5IKMA 3G49A 5A9RA 5U4QA 3QP9A 1PQWA 3R5FA 2YFYA 3GFOA 3PQ5A 4YAKA 3CRRA 2AK3A 3A0RB 3DXFA 4A0QA 4D0NA 2VDOB 3Q3JB 1N6NA 3QENA 3AVTA 5GZ1A 2J3HA 3CB4A 3MC1A 1N25A 2GPSA 4A6XA 3L93A 3EOZA 3FFAA 4A82A 1YFLA 4QOJA 1EQ2A 2QTCA 2ZWVA 2DVMA 3HB9A 3RSGA 4UCQA 2EBUA 2J48A 3O4HA 4HNAA 3SHFA 1XC7A 3P9NA 2VJLA 4OU4A 2RAPA 4UBMA 5FWYB 2V4UA 1HUQA 3FLEA 3OF3A 3Q40A 1NBHA 3QLVC 5DNEA 3VNAA 3L43A 4D4JA 4N7RA 1PR1A 1SRRA 4XYLA 1Q1EA 2WKWA 1RCFA 4CM1A 4ZVPA 2QVXX 4N3AA 1SHTX 5AJVB 4DT1A 4GBGA 1MJHA 4QPPA 3U60B 1X74A 1P45A 1QYXA 1CJSA 1ORDA 4GICA 5HGJA 1XLUA 1Y7IA 3WV5A 4TOIA 5TQ2A 2FX2A 3CIOA 4OHZA 3QFSA 4WOPA 2OPHA 1W76A 3GFFA 3P2EA 1OAAA 1KPHA 3MELA 1IVYA 1UBCA 4RLFA 1DX6A 2E4UA 2H7CA 2PCJA 3BB3A 3KSDO 4IGEA 1QCYA 2FPXA 1KIFA 2W8BB 4ZTZB 1VIAA 4UXIA 3AL0C 3A1WA 4UE3S 4PZUA 1PZNA 2XJ4A 4HLUC 3OBIA 3JD3A 1KFKB 4JD5A 1MRZA 3RO7A 2O54A 1EP1B 5EVJA 3ICQB 4I2NA 4KSCA 2GHTA 3OC6A 1P19A 1R5NA 2MYTA 4Y2HA 3L4KA 1CUBA 3K2IA 3A3NA 2BPOA 1ZK1A 1ZD1A 2EEPA 4LCBA 5CB8A 1HGXA 4H1HA 2N0SA 3ELYA 3WXBA 1E5TA 1OH8A 3KQLA 3RLIA 3MJ4A 4KFSA 4UD2A 3B60A 4UBNA 2I33A 3IUBA 5A3JA 1Z17A 5T41A 1Y4DE 4WINA 5EP2A 4F4HA 2YKGA 4P4SA 1BWRA 5FO1A 5BSVA 1Q6ZA 2RGYA 2RGNA 4RTRA 5CNKA 1H05A 1T36A 2PT7A 3CRNA 3W5JA 4EJSB 4EZIA 1FNDA 3A6HA 5E8JA 5KIAA 8GPBA 2F55A 1VECA 4LTMA 2CLDX 3LP8A 2YZ2A 2FSVA 2GWHA 2I0FA 2JH8A 2O57A 3DHNA 3TTXA 4Z2AA 1TM2A 2XQGA 3OKCA 2DKNA 2X23A 2ZYTX 3AY7A 4L5BA 4UPDA 3MQ2A 1R4AA 4IVNA 3GQBA 5D00A 2OENG 1WWKA 2XAAA 4KPUA 1BXGB 5A9SB 1O03A 5EFZA 5BSKA 2VQFB 1TIBA 3HSYA 4GSYA 2YQ5A 1NBME 2AUNA 3A2LA 2K2WA 3LW7A 2QRUA 2BCGY 4M0UA 1XF1A 1TAGA 1FFAA 2DU8A 1WVMA 1WAMA 1X1TA 2GQ0A 4D80A 3VTFA 4EQ6B 1VMKA 2AOWA 3VR0A 5C51B 4GP6A 3OZ7A 3PR3A 4PBTA 4X45A 2QJFA 1XNRB 2F9MA 1ESZA 4I66A 4GOJA 1VMAA 1V7CA 2ZEJA 1M34B 3EVDA 3HRHA 5CGZA 2A5FA 5JE8A 4PN3A 5HIKA 5THXA 1P5HA 1YR9A 2Z5GA 4HXGA 1AHHA 2HSEA 1TK3A 4ND6A 2QTGA 2JGEA 2OGZA 4R8VA 4WCDA 4DSUA 1WMFA 4GZMA 1W36D 1XCJA 1Q0LA 4DNXA 4G0VA 3CEJA 3H0EA 2YV5A 1E1CB 1OZAA 3L7CA 2OHOA 2DR0A 4U7TB 2J7PA 2O7RA 3FMOB 1VE3A 4AKIA 1NJ1A 4I6GA 5L45A 3RVKA 4Y2GA 3T12A 3OSZA 3M4ZA 1K68A 1AKVA 3U56A 1GA4A 4CJXA 4OXRA 5TMPA 1GCOA 3KDPA 4EB6A 4CMBA 1EXWA 4UNNA 3IBYA 1M6NA 3V5NA 3EBPA 1WO8A 1L4KA 3RTCA 1PZXA 1U3UA 2H00A 4G2TA 5EXPA 4YEDA 1EPUA 2REQA 2ZBQA 2FEAA 4PZZA 4KGDA 1I2AA 4NTZA 4U3JB 3X1JA 2KJQA 3ZYZA 5IHPA 3EPPA 2JCBA 1HDCA 2DFTA 3RTDA 1FTQA 4A9AA 2J0QA 2XLCA 3BL6A 4K9OA 1O0CA 2ZR7A 1KJNA 2JANA 3ETGA 3P71T 4KFUA 4RSHA 4D57A 3FCYA 4PX3A 5I9NA 1QHGA 1LV7A 1F38A 2F3UA 2OGSA 2OQRA 1U63A 1FX0A 1L3CA 1MA0A 4K3UA 2PMDA 1GLVA 3T7TA 2QV7A 3TZKA 4JQSA 4JP2A 3JQ6A 2BSXA 2PHZA 1O4VA 3A4IA 3OLYA 4B6EA 1E1RA 2BMFA 3G85A 3IELA 3GD5A 3MGCA 3RGWS 2BM8A 4RJTA 1KIMA 4OK5A 1I36A 2GM5A 3R5JA 4LCJA 4RV9A 4Y6QA 1A4XA 1HMYA 2ANBA 3KBBA 4CFYA 3DLPX 5DGTA 2OBYA 421PA 3H2ZA 3GC6A 4WY5A 5ED0A 1MO6A 5FL7A 3MGKA 4MS3A 4QGHA 4N5DA 1JEOA 1NFQA 1K6XA 5CW1A 3NP7A 1Z36A 2RAVA 4HJRA 4UDNA 4ALMA 5JWOA 2VCHA 4LZNA 4CDNA 6ADHA 5IN5A 4DOMA 4ZVTA 3C74A 1CQJA 1UDXA 3O74A 2I4MA 4E2ZA 1J8VA 1VDZA 2WUEA 4QYIB 3HLTA 4FGLA 3RABA 3UPTA 5LZ8A 4IIFA 1ZAYA 2PUFA 3S2EA 1QTIA 2AOXA 2XUOA 2OCGA 3CX7A 1G41A 4R1NA 4IJQA 721PA 4MRMB 1K92A 3WJAA 1OBVA 4W99A 1VJ1A 2IHJA 3OZBA 4HS9A 3R4CA 4KMMA 4HDRB 5FOTA 5IKOA 2WW8A 2E49A 3UK7A 2UZ0A 3ZW8A 5CEEA 2I9KA 1UBFA 1W0KA 1ESEA 2A9KA 2ZE5A 2ZSJA 3LDUA 2QN1A 4P5EA 4D97A 3KD3A 4RH0A 3DBRB 1E6MA 4P7GA 3N6RA 3TRFA 3ANLA 2OFOA 1MP0A 4U5XA 1ZO8A 4M7WA 4ZI7B 4R1QA 2RD2A 1GPNA 1HFKA 5IH7A 5BSEA 2G5GX 3CZ9A 3RTEA 2BF4A 1H0SA 4Z5XA 5LDDC 3TLCA 1UPAA 1FP6A 2FPPB 3CUWA 3C3EA 3K09A 3KQQA 5CM8B 3SSNA 3UTCA 2VJPA 4F86A 5JH7F 4RKWA 1R6UA 4DMUB 1T9KA 3PZRA 4ZT5A 3SZUA 5E9AA 2WU1A 2P4SA 2GKGA 4M1TA 2IYFA 1PNRA 3DZGA 1SXJE 1QYWA 1DKLA 1RYBA 3EG5A 3FRJA 3MJVA 3GV0A 3OPNA 4I8XA 5HEKA 3T61A 1RFGE 1Z3IX 1J1IA 9ABPA 4P7BA 3HGQA 4P31A 1LLQA 1RZRD 4DFDA 3A6PC 4A0SA 1K5DA 2BUCA 1XXHB 3H75A 2WZBA 3NOXA 4J0IA 1SIBE 4H2DA 3TTWA 2FJPA 3DHVA 4JXXA 3SC4A 3KD2A 1VL8A 2QDKA 1MJFA 2AWOA 3LP6A 3TMYA 1MV5A 5CK4A 5ENZA 3SX2A 4JK3A 4BFCA 2SICE 3GVXA 4ROSA 2P41A 2WA1A 2VZLA 4CKXA 3H1AA 3EA4A 1M6VB 4UJ3A 2VK2A 4FN5A 1H2AS 4WESA 4ZOLA 4EG8A 4W7IA 4DV7B 1A7UA 1NVEA 1QGED 4WGFA 2IYEA 1NDUA 2ODBA 3UMBA 3ZLJA 4R0NA 4WJKB 5L6LB 3E7FA 3F7MA 2AG0A 3RUIA 3DZHA 4K6HA 4QPNA 3WZLA 4C4ZA 4E3WA 4TXLA 3UT5B 1EM8B 4OTZA 1EFRD 1Z5WA 2BDUA 4NYMQ 3WQQA 4IQ4A 1C7JA 1K8XB 1VZ2A 4UC0A 1KFJB 5DHAA 1KY4A 4R2HA 4LOIA 4A8JB 4UBKA 3W7VA 1N0HA 2WABA 3BE5A 4JA0A 3KYCA 4MW0A 4E5KA 4CM8A 1Q95A 1G4HA 1K6EA 2XTJA 2X0IA 4KFTA 4MV8A 4HCJA 4CEIB 2CW5A 3G2QA 3NHRA 3SOZA 2HU5A 5CCXA 1O6FA 4BXOA 2YW2A 4G36A 1QZZA 2NO7A 3ESAA 2BMWA 1QGUA 2BW0A 2WJYA 2YIJA 2QTZA 4QXRA 3UWPA 3WDMA 3GH3A 4PHTA 4BLSA 2HT6A 1KE1A 1KI2A 5C53B 4ZDWA 3VRHA 1TJ5A 3HL4A 3PHGA 4NPAA 5HQ3A 2WF6A 3EWSA 3IHLA 2IBMA 4HGOA 4JJFA 1VI5A 4OHBA 4TKUA 5C7YA 3QWBA 2C5HA 4EECA 4YRCA 5AM3A 5IT0A 1KNXA 2Z4TA 3OIYA 3IH5A 4H08A 4RDXA 1XQVA 5ADHA 4KHZA 4DQXA 3UJBA 2OGUA 3U62A 2QV0A 4RK5A 3AF4A 1K5PA 2WAYA 1ZWLA 3A27A 2WFAA 3K0KA 2CUTA 2OYSA 2QTVB 3ZQ6A 4EYSA 4W8GA 3HK2A 1HX7A 4HAVA 2ZVPX 3S2UA 3E1SA 1VE1A 3NC1C 3ASVA 4M8IA 4WKGA 4YRGA 4TMVA 1WRBA 1KVQA 3HVJA 3JASB 5I9TA 1IIRA 1TKAA 1QQTA 2BHLA 3DAFA 1U2SA 1GY8A 2C04A 5F73A 5CVUA 1BC5A 3LX4A 3K09C 3PQ2A 3ANMA 1FFDA 4ZO8A 5FXMA 5DSZA 2C3OA 4LJ7A 2IW3A 2DPHA 3RG2A 2BHTA 3I92A 3PFWO 4K7JA 3WE7A 2Q4DA 4ZDKA 5CDHA 1SQGA 4M86A 3K0AA 1DSSG 5E3IA 1R4MA 2HCJB 4HN2A 4ZEOA 1PTJA 4FN4A 5CCDA 3S27A 4E22A 4AF7A 1YD7A 2BKEA 4X7PA 5AD1A 5CYGA 2JJ2A 5BV1A 3WLEA 1QGYA 2F3PA 3K0EA 3VR4D 5E6SB 5K51A 1A96A 4FDTA 2GAIA 1NI3A 1R6AA 4LYEA 3ZE6A 4IICA 5E95A 4ML3A 2ZBFA 4MPTA 3U17A 4CR7A 5CR9A 1EEXB 5FI5A 1FUKA 1G5QA 1YU9A 4K81B 4POOA 3GFTA 1XT6A 3PTAA 1NWCA 4TTVA 3OURA 4TN1A 3RJ9A 4UATA 1TYBE 5BOVA 3L4BA 1QIKA 5CBPB 1GR0A 1ZOLA 3K9FC 2HH9A 3G13A 3MGAA 4PLFA 5LD2C 3EC2A 1AQLA 4RZUA 3C45A 4RK0A 3R7BA 2H9YA 3VX3A 5B6IA 4D3FA 5CHYA 3N87A 2D2FA 3JXEA 3ICPA 5TNXA 5JBNA 5EIXA 821PA 3HVUA 1PR6A 3JTEA 1P2UA 3PRYA 3STWA 1EIZA 1V2GA 1Y42X 4E1AA 4A8JA 3CLRC 3CJTA 2JLRA 1J4AA 2P9CA 5B58T 2ZI4A 2IYNA 1EX9A 2QU8A 2GHQA 3SZ3A 3GIDA 3KZ1E 3HVIA 2R84A 3R09A 1NBMA 4FW9A 1J49A 2QK4A 5FF9A 4NMWA 5AFSA 2ZJ0A 2J0SA 3NVKI 1SURA 3NBZC 2XSZD 5K6TA 1AB5A 4L07A 3FWPA 5LB4A 1EDBA 2VJMA 4EG5A 3O90A 4DLUA 1M34E 3DR3A 1H2FA 5JECA 5LWQA 2IU6A 1X7XA 2CT8A 1VRCA 2IXAA 2W7TA 3PT5A 1CE8B 4XWTA 3UWMA 4YCLA 1CJKC 4JLKA 4Q4HA 4CQMB 1SQ5A 1G7CA 2V55B 1B76A 1UMBB 2GXQA 1AE1A 1SXGA 2H5IA 2NNLD 3HJHA 3ZPXA 2XCRB 2AEMA 1BHO1 3EZ7A 2JFHA 2AA3A 2EXXA 4MAMA 1YO6A 3FCXA 3HUTA 4AF8A 2JARA 1T9GS 2K6GA 3NKFA 3EXAA 1A9PA 2ECPA 2VT6A 3PC6A 1RBMA 2VLIA 2ZT6A 3GRRA 3O91A 3STHA 3CNQS 2R87A 2K87A 4WUVA 3JYPA 5G0UA 1RLIA 4PZEA 3VZPA 1P8JA 3QGMA 4JUBA 3DT6A 1L5SA 3IEUA 4JKYA 1SC1A 1Z6YA 4EX6A 4RTPA 2IIVA 1I7PA 1Q77A 3LBIA 1R0CA 3ENZA 2ID9A 3PU6A 1SQ6A 2AIRA 1XK7A 4P6VF 4P82A 5CRIA 1KI9A 5TJHA 3VPSA 3A2KA 4XB2A 5BMVA 3HGTA 4Q9DA 2D6FA 1U8AA 1VL6A 2I76A 3QUSA 3WWDA 3IQXA 3J81A 3PNKA 1QP7A 3KETA 4OKIA 4Q4JB 5C37A 1JZSA 3ZX4A 4FYMA 4LJRA 2X0EA 1XRNA 4R0VA 1CZNA 4P3NA 3RE1A 2ZUVA 1QQ7A 2B3DA 5DTJA 4COOA 1JG6A 1QK5A 4LJ5A 1JUDA 1I4EB 3EY9A 1SWVA 1TM1E 5G4LA 4PQEA 5BT9A 221PA 1QLHA 2V4MA 2YRXA 2BFFB 3FLBA 4A2QA 2VUHB 1IULA 1R2QA 3R7WB 4I4TF 3ZE9A 5JH7B 3UMYA 3ZK7A 4N5MA 4OX9B 4N76A 1O5TA 3SG0A 2ZRDA 4C20A 3WWPA 5J3JA 5H59A 5U9CA 4D56A 4GL2A 1FSFA 3CURA 5CX1A 1PDVA 2Q6LA 3U4DA 4WXHA 4RVOA 2WKRA 1WLYA 1FP1D 5FLYA 1HK7A 2EZ8A 3S81A 1S9HA 1G2QA 1Q6YA 3DUWA 3BIXA 1RWXA 3AV0B 3AVXA 3CC8A 2OFFA 2XMGA 4Q3LA 4R1SA 2QUBA 4CF5A 2DM6A 2JIDA 3C8DA 4JZKA 4L5AA 1P31A 4I5FA 2FMXA 3VI4B 5JQWA 4NBWA 3G82C 2P5SA 3VC2A 2P9QA 1UJMA 4L4RA 4C0BA 3ZY3A 2MTBA 3BWYA 1XEAA 3PUYA 2PUHA 3R76A 3EEYA 4YPVA 3PA8A 1WP4A 1FFXA 4IIXA 5HYVA 5J58A 2H3EA 4YDSA 2Q0XA 1PZEA 5CVTA 4AZTA 1VKHA 2FPMA 2FTKE 2JGKA 3QRWA 4E07A 1H8EA 4IMJB 5HF6A 2AN4A 2VJKA 3WSWA 1FZTA 1MORA 5E6UA 2XA2A 4BDTA 4LXQA 4J7CA 1BE1A 4P80A 2GAOA 2OE2A 3X1XA 3OO0A 1NRJB 1U2RA 3HCCA 3L8HA 1DKQA 2P79A 5B6JA 1KMHA 4TPKA 2E18A 2YHSA 2ZVDA 1SC6A 2B4KA 1JJFA 1NV9A 3B5EA 3C6QA 3I58A 4JLPA 3UWSA 2VQEB 1V3UA 1YL7A 3TNLA 2R5WA 3BM5A 3RC1A 3DOEA 2LR0A 3NAGA 4BGDA 3GD7A 5K3AA 3AIKA 5F4ZA 2B8TA 1UMKA 2J6CA 2Z4RA 3A3YA 1T2DA 2JIOA 3AKDA 3MT8A 2EIXA 3FOEC 1WPXA 3Q7RA 1XAJA 2GVDC 5DYWA 5TGZA 2OWEA 2C98A 3V33A 1NJGA 2Z09A 3ZDDA 1N8SA 3ZVNA 2PMFA 2WQZA 3CLSC 4ZOCA 4QULA 4WDRA 2V8BA 2GYVA 1NVVQ 5EPEA 5C8ZA 3QNMA 4L6CA 1T24A 1QORA 3S28A 1YSCA 4IRUB 3P4YA 1WCYA 1PSDA 5CXQA 3SHOA 1KRHA 3I1YA 2ESRA 4BUCA 2M2IA 4PC6A 1RYEA 2FN4A 4WZAE 3B70A 3IMFA 1KK1A 2QG4A 1OA1A 4ENPA 5I6DA 2VF2A 4Q39A 4TS3A 3I28A 2PIAA 1ZONA 1JR3D 3VU0A 4EJMA 3D3WA 5KZMB 1O6BA 1PEDA 3L6UA 4W7SA 2ARKA 1VB5A 3KLPX 5LZ2A 3AJDA 3MRSA 3TXAA 5HF8A 4WBSA 3A1VA 3L1VA 4QDUA 1CLEA 3I6BA 4ZEXA 2XT9A 5LNK1 2PX8A 5FOUA 3RC3A 2A3RA 4BNTA 1NW9B 1H65A 5C5DA 3P2YA 4P4SB 2OBXA 1D4FA 4MA5A 3ZZTA 1GFZA 2R7LA 5JAQA 2OO5A 1UXHA 4PLVA 1NZDA 2QF7A 3DE3X 2HJSA 3LBFA 5CBPA 4GBED 1QGZA 1UMBA 4R54A 3H83A 2XTNA 2PD3A 4G01B 4D7AA 1JLSA 4Y9SA 4BNWA 3RK4A 4Q4HB 2CLEB 4CQMA 2IPOA 3OHSX 4OHWA 1W73A 3SEZA 1NUSA 2QT9A 2UZIR 1QP4A 3JQ8A 4KW7A 4WV3A 5FHQA 4F8EA 5AW2A 5J47A 1TYZA 1TCCA 4RIFA 3R0QA 4LBVA 1NMXA 3QPVA 1XL1A 3DW3X 4LRWA 4PLZA 5G0SA 4HO1X 5I9SA 3VHLB 4DXAA 5FLXA 2B99A 1ICEA 5FWXA 3WAJA 5A0TA 2V9PA 2RHGB 3B89A 3R7AA 5JI2E 5KQSA 4OUDA 4N03A 5JLAA 4BB6A 1TZ2A 3B2QA 3L41A 2WY2D 2P67A 5CA1A 5AJZA 2BRUC 1WETA 3LKVA 4R5MA 5GGYA 4KBYA 2PL1A 3T9AA 4PPQA 5LFAA 4KO8A 4WE3A 1T6XA 4AJOA 3ONNA 2Q5LA 1LZLA 1QAQA 1QGDA 1I51A 5FBHA 1OTXA 4MV4A 1ZYUA 3ABSB 3CF0A 1IH8A 4HQOA 5DTIA 2E37A 3Q10A 4R0MA 1KDZA 4Q7LA 4CYMA 2ACKA 4J0GA 4RDCA 2XUHA 4LRQA 3NWOA 1ECGA 1BX3A 4ZVKA 2G8NA 3AEKA 1V8BA 1ZSVA 1F51E 1OX5A 1A5SB 4L0MA 4M9SA 1SD1A 3H9GA 2P6OA 4O0MA 1XSEA 4QDOA 3OX1A 2EDAA 2A1TR 2O2GA 2BUBA 2VDNB 4LVNA 3B2NA 4UKDA 4F2HA 2H9IA 3VZSA 3QKIA 2XRZA 2XXAB 4DG8A 4BFYA 3IVGA 2UYYA 2ZIAA 3V8BA 1WY5A 4JSRA 3X1KA 2EC5A 2YOHA 4M9RA 2O50A 5FTNA 4A3SA 4BZXA 1EA5A 3BQMB 3EXHC 4QOSA 3BAFA 3QK7A 2YC2C 4AK9A 1CERA 1LDNA 4HV4A 2IT1A 5E1BA 5J9FA 1TK2A 3I6YA 2WJGA 5AVOA 3KYDB 2AV6A 3D6MA 3QWIA 4BV8A 4PGGA 4X3OA 3GDOA 9LDBA 1EWQA 1DQPA 2QN9A 3GXBA 1P2VA 2D4AA 1XD9A 4TSFD 3NTLA 3HM2A 1F0PA 1FMTA 4GX5A 3AEXA 1KSFX 3T7CA 4BJ3A 3S40A 4EMTA 1L5WA 1C3XA 2N9UA 2VHXA 4GUDA 3TRHA 4ZD6A 4EGSA 3I3OA 3N07A 1NKVA 3MT7A 1UBSB 4ZI3A 3U7FB 4XOUA 4TKLA 2O7NA 2WLSA 4HQNA 1QHFA 1RWKA 2B6NA 2K7ZA 5JRJA 4OGGA 2OAGA 3IT1A 1RC8A 2FVXA 1GKLA 3MJSA 3SE7A 4EHKA 2B78A 1GPLA 3OE4A 5E0OA 2WNHA 3I0NA 3IEXA 4LMBA 4DMGA 4PRYA 4O4JA 1YK1A 3QBEA 5JCJA 3B6JA 3IYLW 3Q3IA 2F7SA 2MSCB 1JAIA 1JB1A 3HKEB 5KOIA 4QOHA 2C8LA 2IX9A 2YCBA 1WBDA 1WDKA 5BNZA 2NQTA 1ZMXA 4ARAA 4AYXA 2QTVA 2EIHA 2ZRGA 3OT1A 3PCXA 1QTNA 3PTLA 1QAOA 2BHNA 2FSIA 3IUSA 4XI9A 4YUVA 4KR9A 4C6HA 5IT5A 2F9LA 3AW9A 3C7TA 4DRXA 4G65A 3I72A 3D5QA 1XVVA 4I1IA 3VR6D 1YQDA 1TJYA 1XEWX 5DGIA 3VU8A 4I1VA 5B3JA 1IBKB 2RK4A 3M4JA 1GUZA 3CR8A 3X1DA 2I4LA 5ECDA 5BN5B 4BZWA 4YQFA 2FR8A 4XGQA 3ZJTA 3BSYA 4BJ1A 1IHDA 5IULC 3CNEA 1Y9ZA 4TXJA 1D2RA 1JVNA 1PO7A 4JLNA 2D2EA 1E7SA 3ITEA 3WNVA 4Z7QB 1W5SA 2YYYA 3L82B 3OFKA 3PB3A 5BSFA 1LJ8A 4RIHA 2XYPA 2Q6VA 4JP1A 1PJCA 2DWPA 2PZFA 5LYYA 4L8WB 3TIIA 4QXMA 3UM9A 2RH9B 1JDJA 2COEA 4L85A 8ATCA 1DKPA 1H9CA 3MJHA 2FG7C 4IHKA 2FZCA 2Q21A 4ZU1X 5LU9A 5DNCA 1V1JA 5MFPA 1M1NA 4KQ6A 1Z6AA 1FZQA 2GH1A 1FDTA 5HS6A 4PSCA 2B5VA 2B7LA 2VPQA 1M74A 4RGVA 3KQUA 1Y0BA 1GUFA 4KQ2A 1T0JB 3F9CA 4UMDA 5FFMA 4E0BA 2BI7A 2HPVA 1OI3A 1V4BA 3HUEA 3THOA 1Z6ZA 1DDOA 3PJEA 3L0PA 1ZKDA 4IF6A 4E94A 3KE8A 3V9AA 2D1TA 1UOEA 1RDFA 4L0CA 5DN6A 5KKCA 5JO9A 3GPIA 1AH2A 4Z4HA 2P3QA 2VZ0A 1ZK3A 2GMWA 4IMIB 5DM2A 2R1TB 3U3DA 4CT5A 1SOAA 2HMSA 2HYIC 1QZUA 3QF4B 3TLYA 2HC9A 3NU1A 1WNTA 1YQXA 2GTIA 4DJJA 3IBGA 1YBMA 3P9RA 5EMJA 2C84A 1ZM7A 5JAIA 1J8DA 3TPZA 4YX9A 3M89A 2ONCA 5KMGA 2P68A 4A7PA 4PLPA 1XFAA 2JIMA 1BG6A 1YHNA 3AFMA 1DP4A 2C0PA 3CUYA 3NG1A 3C3KA 5EUCA 1LDYA 1DC7A 1OT5A 1G3MA 3TQHA 2EL9A 4EZEA 4NJMB 4JU8A 4E21A 2Y1KA 3I8OA 3WDKA 1XCMA 2QG9A 1JLLA 1CEQA 2V7EA 2XVYA 2NUBA 2ODTX 4J29A 4B40A 4CMIB 5K8JB 2VK1A 3CUVA 3BIOA 4MRMA 2C4MA 4ZV7A 2GCGA 4RMGA 1AKYA 2R8PA 4UASA 3TVTA 3V8VA 4FX2A 1SU6A 3KZCA 4H27A 3M8KA 4OUDB 5LPNA 4XDGA 4KAJA 3RHSA 4OJQA 3Q8KA 2QPLA 2VTKA 5KJEA 3AUFA 1MOSA 3GU3A 3K2EA 4RENA 5AKIA 4DCPA 1QLJA 3N8NA 4LWOA 2PKEA 5C31A 4ZHSA 4AI6A 3VKHA 1K7EB 3HR8A 4KUHA 3NWPA 4MKHA 5J2TF 3K2QA 3AGQA 4DV3B 2FEWB 3ADKA 5HR5A 1M2FA 1QHEA 2O1WA 4EH1A 1XCOA 1UAAA 1QGOA 1V1RB 4MI9A 3F5SA 2CDRA 4XUCA 3RUFA 1NVXQ 4G5XA 2AE1A 3VYRB 4D82A 3QPUA 4PE5B 5CVEA 4X1YB 4DLSA 2EZTA 4KUGA 2Y2VA 4Q48A 4RX1A 1X7HA 5IDVA 5A4FS 1WV1A 2NOAA 3UNXA 1ZMBA 4X54A 2QORA 3ZK9A 2Y1EA 1ODCA 2JEZA 3ORSA 4QODA 3RJMA 2L2QA 2XDAA 4IZOA 3ZTWA 2OXCA 2IHZA 4XUGB 4A0HA 1KDYA 4DMRA 4ZV4A 3UN1A 2FU5C 1YT5A 1TKCA 2O3RA 4PVCA 3WIVA 1FVHA 1EUDA 4LXXA 3IMGA 2PGIA 4Q4AA 4JU9A 5C0OE 1OREA 3LRXA 3FOAA 1THTA 4HI0E 4NFSA 3KEGA 2O2IA 4IAOA 3QLVA 4X84A 5FR1A 1ULBA 1Z15A 3OEEA 4IZHA 3PQEA 4R83A 1E3LA 5IYZB 1D1PA 1QXSA 5DB4A 3SXJA 2IYPA 1BVRA 1QC5B 2Y93A 5AI0A 1X38A 3KLOA 5CVDA 2XOKD 3TI7A 3VYSB 4YACA 1Z33A 2I2AA 4B31A 5KDOA 1EGAA 5DULA 3SYTA 4CIDA 1N8NA 1CWUA 3KXLA 4IOKA 3SC2A 4BO9A 2IX3A 3ZHXA 1JILA 4POAA 1SVOA 3H2BA 4CF7A 1PQPA 3IXLA 3AXTA 1IPHA 1KZ6A 4TS4A 2WTBA 3H5OA 1Z5VA 1PT9A 1Q7BA 3EDMA 3HDGA 2NYAA 4LZJA 3RYHB 3KR9A 4F2DA 1T0HB 2FPLA 3GT3A 2RG7A 1BCSA 2XOEA 4MK4A 4FNMA 1PNQA 3KZNA 2H7XA 4WLNA 5GIPE 1NUHA 4UM9D 3LGAA 1HFJA 3SVLA 4XXHA 3WBKA 5I4KA 1S8OA 3DCJA 3OIDA 1I4LD 1NJ8A 3NIFB 2HCFA 4GW3A 1IEQA 4FUTA 1E32A 1XZQA 2J6HA 4PCUA 4RXTA 2HTFA 2PSFA 2GEDA 2QN8A 2WZDA 1O96B 3FBGA 1KL7A 3H87A 4BO0A 2GBGA 3HZOA 5ALQA 5FB3A 1GR1A 4HY3A 4AUKA 1QPGA 3RVJA 4H7JA 1HETA 2VUUA 5A7HA 4I4LA 2ZYRA 5KQLA 5EXSA 1Q5PA 3FNHA 5FBQB 3BMOA 4RFSB 5FUQA 1UFQA 2JKYA 2LD4A 2AQIA 2FJUA 3GP5A 1AHIA 1EFVB 4GG1A 2E9SA 5I3ZA 3HUDA 3JQAD 4D9BA 2JHCA 1I3KA 2PGLA 4G37A 4TTAA 3CUUA 4HT3B 2J6IA 1E2KA 3R9KA 3T1QA 1W85A 3G7SA 3WX0A 3D6VA 1Z0AA 2FW9A 2AF4C 1V4VA 4N3GA 5TV2A 1OLOA 3QYJA 2E7ZA 1O3YA 3THWB 5GJCA 4I46A 1DWOA 2TMGA 3WLPA 2YJNA 2G08A 3L1KA 2BGUA 3ZI4A 5ETJA 1NMSA 4JIMA 3NRJA 3TD2A 4UTPA 2AB0A 4UDYX 3GA5A 2WPDD 1TADA 4M3NA 1WX1A 4TRMA 5B7NA 2HQBA 2XODA 3FPAA 1NI4B 1OVGA 1L7EA 5ULLA 1CZUA 3VSEA 4AXBA 1FRVA 4ARBA 3EPHA 3WLMA 4WWHA 1XTTA 4MDYA 1FFWA 3EPRA 3TTUA 2EG9A 2WZCA 4YT5A 1ZD5A 4AQDA 2CY0A 3HC7A 3RFUA 1D4ZA 3QM1A 3V7NA 1WMSA 1KOFA 5DGXA 5EHQA 1E5DA 5AJHA 4ZEWA 5CH3A 3LYHA 2X76A 1MABB 2Z8YM 2YVAA 5JBQA 2W22A 2V7TA 5EJ5A 3I61A 1GTRA 2NZWA 3WKCA 3TGLA 3AEKB 2VF5X 3NBYC 3WL5A 1XMIA 2DUNA 1U9CA 2WZQA 5CP8A 2JC3A 4RABA 5CNIA 2GBLC 3D4LA 3MCAA 1DFHA 3QVGA 4MLPA 2B7BA 2PRIA 1IZYA 3LIIA 4ZVUA 2XMBA 4JNKA 3W06A 1OI2A 1II8B 1YI8A 1L8QA 1MHPA 2QUIA 4L51A 5H82A 4JX8A 3UENA 5GVRA 3ELUA 5HPYB 1V7QA 1AKUA 2FWMX 1XVTA 3CLRD 2ZUUA 4GF5A 2Q8NA 3ESBA 4B3TB 2HK8A 2RGBA 1JI3A 1GQFA 5JY1A 1XTPA 1YR1A 2IHTA 2YHUA 2XTAA 1A8UA 3KL2A 4FWBA 4N18A 4ZCLA 1VLHA 5FKJA 1S1CA 3U4AA 4HB3A 1CR2A 2Q27A 3IOEA 3RU9A 4NCJA 3UB3A 4IHAA 4NYJQ 4HMOA 3VYVA 4QTZA 5KYYA 2G82A 1KZ7B 3JR3A 2I6FA 2XT6A 1T9GR 3DE6X 4WK4B 5EXXA 3EC1A 2AK2A 2HQRA 2Y6UA 4RD3A 3ZCUA 1EK2A 2C5BA 5BUCA 1FW8A 1QDUA 2B5WA 4MQLA 3CU5A 5IX8A 3SIXA 1KBZA 4GYKA 3HPRA 3DB1A 3UJ9A 4CXMA 4RJ2A 3AR5A 3OA0A 4DADA 4XWAA 1T0UA 2XWSA 4FEGA 1ODSA 4K05A 2ATIA 3EQ9A 1ABBA 1K2WA 1DFIA 4MHSA 4EFKA 5I7FA 3R3YA 2PAAA 4DTIA 2NU9A 2VCYA 3GXOA 3GPCA 1UJNA 4M36A 4KX3A 1LPNA 2RC6A 1QO9A 1JE1A 4NECA 3ILYA 1ULZA 1QX4A 4RELA 3ZYCA 4WEQA 1HLFA 4NFYA 3M1AA 3KUXA 4XR9A 1YZGA 2FPOA 5H0IA 4P32A 3G59A 4R8LA 5DWVA 5BP7A 1VJCA 2A3NA 3Q1LA 1JWAB 1NNLA 1DV2A 3CW8X 1YJ5A 1GGKA 1P0IA 3K53A 4IUYA 4UU0A 2BL4A 1P72A 2HWXA 2OPBA 1AUOA 2AJLI 3I32A 3K3PA 3TEJA 2C3PA 3IHWA 2OY0A 5IF9A 3OBBA 5B7GA 1JT2A 3S1SA 2XQIA 3OJFA 5CVCA 1F0KA 1CRWG 5HKBA 2V5VA 4UVIA 2FZWA 4MQMA 1L7AA 1PL0A 3AJAA 1LTQA 4KQ1A 2JJMA 2PO7A 4A73A 1UBLS 4B5LA 5U1PA 1K8RA 1Y81A 1E79A 3LIPA 1E1KA 1V0JA 2PTGA 3C7AA 2BFEB 4FLEA 5AVKA 3ZWQA 4B8YA 4BMSA 4B7AA 3VMMA 3BXGA 1PJ3A 1N6PA 2ENUA 3U4IA 4C89A 1TT7A 3Q6IA 3RS7A 2XUFA 4LTDA 1XNJA 1YV9A 4IDAA 5NLLA 4GPTA 2EQBA 4K5QA 4XTCS 1FX0B 5HF5A 3UKDA 1UJBA 4FDUA 3ZV4A 2SBTA 2Z6VA 5LIPA 5LMNB 2V6GA 3MFYA 3TB6A 4DA8A 3G89A 2ZRJA 4AJJA 4EJ2A 5FTKA 4RTMA 1E6UA 4BPRA 5IEJA 1BWSA 1M2NA 2H9AA 4WVLA 2ZWAA 1KKLA 1MU0A 1PBNA 1ZGBA 2AOVA 5EZ6B 2OXIA 5KJCA 2ZXEA 5I8PA 1XLVA 1BNCA 5DTRA 5IBRA 1QVZA 5IVDA 1P3JA 4NEGA 4YRLA 1XEXA 3ADPA 5DNUA 3BGOS 1Y9JA 1G21E 1O96A 3SR4A 2EFCB 2WD7A 4LV8B 5BSTA 4BNDB 5DO9A 2FHSA 1SY7A 1K4KA 2LW7A 4FWTA 1KAHA 3GJQA 2J7PD 2IS6A 4OYRA 4RORA 5KREA 2Q5FA 2P9GA 3DUFA 4EG7A 4YRZA 4F1WA 5JMOA 4J7XA 1DBRA 5EMMA 2FMTA 5BVGA 3R8CA 1G7SA 3P9YA 2W2NA 1GN8A 2WTEA 4TV8B 4XOIA 4J4HA 3SJAA 3GGDA 3I45A 5EQTA 3SYLA 3QE0A 2ZUDA 4ERXA 4B33A 3OEHD 4I9GA 1ACMA 3DO6A 2PZKA 4DEYA 1PJ8A 2YVKA 2GZAA 1UPCA 1A69A 2I7CA 2ERCA 3CKKA 3EZYA 3IP8A 4FQ7A 5K3FA 5I3CA 3EEQA 2P65A 3CONA 4QL3A 4AG5A 4KHPB 1MIHA 1KO1A 2WSLA 1EGMB 3HDYA 3IEKA 1JXAA 3CF6R 1L4YA 5EYPA 4J3JA 2XA1A 3ASUA 5EQJB 3UG7A 4LDPA 3NB0A 3UJAA 3D1JA 5AI8A 4CQLA 4YUYA 1RXVA 4M99A 4MDHA 5DT2A 4YWJA 2QMQA 1KZYC 4FD2A 3D2CA 5ER6A 1N78A 1MAAA 2MYUA 2BMVA 4UXJA 1T2CA 4D96A 2VF4X 4Q9NA 2Q3FA 1U3WA 4H59A 4KQCA 1T91A 2WIBA 1LK7A 1W49A 2IZ5A 1OPXA 1JEYB 3HPQA 1J24A 1X0XA 4PEVA 1PFVA 3EAQA 4F0JA 1D8TA 2HHHB 3EDRA 1N2CA 4NMHA 4AP6A 4GFDA 4ZZ2A 4BLPA 1UZMA 3QVKA 1G8SA 2XTMA 4OF4A 4RVCA 3TLZA 4CU5A 1V3TA 3DXYA 4MJ3A 3RQSA 3Q3HA 1J23A 1RBZA 5ALUA 5GJVC 4JOQA 3HXQA 1U8FO 2QNIA 2IUYA 5L9AA 3WGQA 2DWCA 1RKUA 1DKOA 1N57A 2VHYA 2O8DB 2WU3A 4XLLA 1R6BX 1A8HA 3JARB 3A9UA 2QG6A 4CL3A 3A6KA 1Y9DA 4YMUA 4Y1EA 3DFFA 1NUAA 4LF7B 1L8XA 3C3DA 1USUA 4JB3A 4K9DA 5AW1A 5JXIA 3LYAA 3B6MA 5DHQA 4B32A 1II9A 5CJ2A 4BP8A 2HWUA 4V0ME 3HN7A 1I4TD 2DY0A 2Q4TA 4GGOA 3IV9A 4O25A 4IIYA 1DJQA 2BI4A 1KOJA 3DFZA 2F4VB 1ZG3A 2CXPA 1JHQA 3BJZA 2H08A 2WFLA 2BTQB 2ZULA 2ZIUB 1L4FA 3MZ0A 5H83A 2XCQA 2QRHA 4RVHA 1XF9A 3U7JA 2RGXA 5ES3A 4FXPA 4LGVA 1ZU5A 3KXIA 4M9UA 1P81A 2FXIA 4AZWA 3K5HA 1NUPA 3OPYA 1JX6A 3F4BA 4AKTA 3IOMA 3O3CA 1ZJ4A 3G9QA 4KN9S 1S9DA 1Y34E 1I2BA 1Q57A 2Y77A 1THMA 2XHEA 1CKEA 2XF2A 2YWHA 5A4DA 3WGKA 3ENKA 1ZN2A 3T3IA 1U7HA 2FQXA 1EWRA 4JJGA 1EFAA 2W2PA 3KEOA 3I2IA 4TZTA 3MCWA 3E1KA 1CUSA 4QKQA 1KJWA 1P3Y1 2X2FA 3G2JA 4RTKA 1AN9A 3NGLA 1VHLA 4HZUB 5L8VA 3H19A 1A9TA 1BE0A 5CX1B 4GR5A 3W8EA 4DARA 1WB5A 1MC5A 1JE0A 2PUGA 4N4AA 1TO6A 4U9UA 3ZGYA 1NBAA 2PYDA 4K9LA 3U4MA 1SEVA 1OGIA 2WJHA 3BWXA 4CETA 4E15A 2CXRA 5JJCA 5DM1A 5JNWA 3DA8A 3CRW1 5BWNA 2PRSA 2LIVA 5KOJB 1D0VA 1NNEA 3FZEA 4MVJE 4GP7A 3SQLA 4DPLA 521PA 5BNTA 4XFJA 2O0JA 4KGZA 3DMPA 3GBPA 3L1HA 4LQCA 1CT9A 1L7DA 5E1OA 5JW6A 3HJGA 2GPBA 4ITUA 3GMSA 4DR7B 1AS3A 3ESDA 4L57A 2PFSA 2IHUA 4MVJH 2Y27A 5HRAA 4QTTB 1CUCA 3NJ4A 4HOYA 4KWIA 4KNVA 2C77A 1BQ4A 2E2WA 4IEIA 1UQRA 3PDJA 3TGWA 4E5MA 4NCAA 5JH7A 2ZAYA 3W3AA 3FTPA 1YQEA 2DHCA 1YE8A 2GJ8A 3EZXA 4FSHA 3SNKA 1A4IA 1MABA 4G81A 1KI4A 2EW8A 2O6LA 3C85A 4QGBA 5DLPA 4BVAA 2C2YA 3SEAA 1QS0B 4EITA 4LDAA 2XCTB 1DQRA 3QUTA 2NU8B 2YFKA 1GZHB 3TZHA 4KDEA 1MAWA 1I9GA 3AVYA 1YR7A 3G5MA 1CW2B 2C1EA 2JJ1D 2MR6A 3HMKA 3QEAZ 5B2EA 4TWAA 5EE9A 3K32A 3DH0A 5B3KA 3SHTA 1HOXA 4S12A 3DNMA 2QNBA 3OP4A 3AUXA 1MC1A 4GRIA 1W48A 3JQCA 4MJLA 4O4HA 4U7FA 4XLZA 3NHWA 5FT9A 1XIVA 1ZUIA 3H8JA 4OHVA 4K8RB 1P9NA 2H4JA 5CYOA 1EZZA 2AEJA 5EUQB 2V5AA 3VYTB 2WSSD 4I9FA 1T10A 5E7IA 3NHAA 2CDCA 3A8TA 4G1UC 3C3PA 1KP2A 5E2IA 4Q3OA 2IIQA 2JD2A 3OCJA 5D8DA 2NXNA 1LNQA 5CB6A 1X1SA 5LU8A 4NBSA 4ON9A 4BB0A 2F3RA 3W4IA 2A67A 4OBBA 3WLHA 3EZNA 2FEXA 1UUFA 4DCNA 4B3JA 4M1WA 4XPZA 3SAJA 4CLHA 1UKCA 3KUDA 4URHA 3A1DA 2WJWA 5HNKA 4BWYA 1RJDA 1ZOOA 2QTMA 1L4HA 2WJ3A 1WXWA 5LWHA 3T3MB 4FI3F 4QEKA 4DA6A 5K9ZA 4PXSA 1P4AA 2XTZA 5I7WA 5D87A 1GTSA 2VNHA 3VOSA 2C29D 3AVWA 4D9EA 2R6DA 4Q82A 4GM1A 1P1CA 4G23A 3RC9A 3TZ6A 2WMNB 3CF2A 4G56A 2NP7A 2EJWA 4JYBA 4YP7A 1PFUA 4H0CA 4Y6LA 5LCXA 4KXFB 3U7IA 3VAYA 4DIBA 4YRIA 3GZNA 3LK7A 4LDZA 5SY4A 4ADSG 4ZA2A 1UPXA 2P91A 4TTJA 3HO1A 1RMQA 1J06A 3DDZX 3IKTA 2YINC 1DELA 4G2NA 2YHIB 1EA7A 3CVJA 4FHDA 4P8RA 4Z0TA 4KR2A 3NI2A 3ICEA 1F4PA 1O6ZA 1LF5A 1YH3A 3JPYA 4FOSA 4LXIA 3EIFA 5JXWA 3CLUD 5ECYA 5IKEA 2JLSA 3RYCB 5BR7A 5L3SA 1I10A 2XQKA 3P27A 1FXWF 5TC4A 1DPGA 3T41A 4OEHA 4KL8S 1YQ9A 5KI6A 2SKEA 4R01A 4A91A 5EG5A 4EY8A 3BA1A 1DHRA 2AZ4A 3FVVA 5DLQC 2ZRMA 4ZN6A 1AXEA 3LLSA 4ZGGA 2ID8A 2DHRA 4LFAB 3GUCA 5IAOA 4C05A 1BDIA 3CO5A 1T0BA 4I0WB 2MMGA 2PBRA 3A4YA 2GPTA 2ODAA 3KSUA 3I6MA 3RF6A 3RUCA 4P7FA 2WQ6A 1XEXB 2HA4A 3ICVA 3MMSA 2XF8A 2IDZA 3LCVB 4IXNA 4L9SA 4QOGA 2C9MA 4JT2A 5FBLB 3BX1A 4FMPA 3RUAA 4BNMA 3ZR4B 4UNRA 3GEGA 3NIGB 1EWTA 2CK3A 3WLQA 4DXHA 1C30A 1MB9A 3C8MA 1GPH1 3ZCRA 5E6SA 1QONA 3DUFB 1NN3A 4LHXA 1G21A 1Q19A 2Y67A 3SQDA 1Y8ZA 4QHYA 4F9TA 2E4XA 4BO6A 3ZHCA 1ZN9A 3VJMA 5FQOA 4QPCA 5E6RA 3PFKA 4YMIA 4PTLA 2CNBA 1QIFA 5I7AA 3R4VA 4M9CA 3KYJB 3DBOB 4JT4A 1Z2PX 3V6LA 2QJOA 4EUNA 1QHSA 2QYOA 1C4XA 1N5LA 3R44A 1HLPA 3BS4A 4N47A 3J80A 2JAXA 2JJQA 4GGMX 4CEIA 1ISFA 4MVXA 3TW8A 4QBKA 3T3PB 3EIOA 3W6PA 4MKXA 1XYYA 4BJHB 3DWGA 4EA9A 2HFJA 2ZCJA 1OIVA 1LKZA 3C5VA 4BGIA 5AI6A 2VPWA 3EGDB 1I80A 1G3IA 2DRIA 3FA2A 4WUTA 4JXJA 2PKXA 3UV7A 4FYKA 1KDTA 1SRQA 2FFJA 3F3KA 2G63A 2I67A 1LH0A 3D0KA 2UVPA 2Z6AA 1JEYA 2VBGA 4HB0A 3FNGA 4XE5A 4CL8A 2YUTA 3C7CB 1WXFA 2UZAA 3KFXA 1KTVA 3M2PA 2BISA 1DRKA 4EF6A 3THYB 3ZXSA 2MHCA 5DYTA 1OFHA 5IUNC 1UP4A 1BMQA 1XU9A 2WHYA 1MB2A 3A11A 4H7IA 4Q1DA 4FBMA 1EK5A 2HO5A 2CJXA 1VLVA 1VJRA 1EH5A 3ILHA 3PUHA 4RHUA 4V0KA 1ZJ6A 3REQB 2JHGA 2NUTB 3G1WA 3OMLA 2DPXA 4HH3C 4O4IA 4U0KA 5U4XA 1YRAA 4TM7A 3FBWA 4JJIA 1DTWB 1E64A 1KSHA 1ORVA 3HCAA 2I7VA 5EHZA 2V6FA 1I3NA 1V71A 2MSWA 3FNBA 3JQPA 1E9SA 1DAEA 2C4TA 3MWKA 1VL1A 1E0AA 1LPBB 1PAUA 2VPZA 3JYHA 2WINI 3OICA 3F8WA 1H2YA 2AFRA 3N58A 1RPNA 4JMLA 2BHRA 2I4RA 4HDQB 3HKCB 3L7IA 5F1YA 2GUWA 3ECCA 5K01A 2O59A 4GE3A 3W8FA 4EPTA 2GZDA 4QNRA 2R65A 3RHTA 3VMFA 1MLDA 2Z5FA 5KVVA 3PA6A 3TL3A 5LMUB 1X94A 2PLWA 2X0JA 3DPSA 3P9KA 1S4QA 2NVUB 5JZMA 1RS0A 4D9CA 7REQB 3X2SA 2AQ8A 2DQYA 2ZWMA 3A9VA 2QDXA 3CLTC 1RHQA 2ZYWX 3FYCA 3KZXA 3QTLA 1C8LA 1AOXA 4FYXA 4TS9A 2VNIA 2NM0A 4JH0A 3UV6A 3CWZA 4B6RA 3ENVA 1KEEA 2A9VA 1V11A 5IABA 3PDHA 3GLSA 5FLEX 4FE3A 2JFVA 1MGOA 1V5WA 2B2XA 2F1IA 3P9CA 2JFNA 3PHBE 4BQEA 1ZMTA 3FLAA 4Q12A 1K27A 4S1VA 4YRBA 4HQRA 2QYHA 1QLWA 5F2OA 5KAPA 1ARZA 3QELB 4RVNA 3IPXA 3CKMA 3L01A 4JHLA 2B34A 1PEYA 3GJ7A 3PPXA 1ZX1A 5K8TA 3BXPA 1OJLA 3WRYA 5ICFA 1NVGA 2R97A 1P8AA 3SC2B 2DQZA 2H2GA 3LP5A 5EMNA 4ND1A 4DR6B 3MMZA 1E8NA 4LVOA 4X60A 3OPMA 3QI7A 3U9TA 2W83A 1AKRA 1M8FA 1ZS9A 2QVZX 5TT1A 3DONA 2EAUA 5EKTA 3V97A 5AVUA 4OI0A 1GVHA 4B4DA 5IK2D 1G3RA 2O23A 5H9VA 2C59A 3Q7QA 4EVIA 5KYGA 2BEJA 1YNSA 2HCBA 2PH1A 4CUZA 4YV7A 4QVGA 1NOKA 1UBGA 3GUYA 3EMVA 4NH4A 4HVTA 4Z54A 3STVA 1KAOA 4FLMA 1P1RA 2JATA 1T2NA 1ZIDA 4HDOB 1VMEA 4TV8F 2ZROA 3U7RA 3TM4A 5PGMA 4Q19A 2QJWA 5DBGA 4B7ZA 3U4QB 2BMDA 3NJ8A 4C9BA 2JIZD 2PU7A 2ZKLA 3NYIA 4ZOAA 3E2PA 4H7PA 1M1YA 3I34X 2OHVA 2HREA 4BVFA 1OAOC 3M5WA 1VPDA 2FMHA 1CQXA 2FUG1 3F67A 4ND5A 4OAOA 4HN4B 1L4BA 2AN5A 1YRWA 1B43A 1YS2X 1MJNA 4CMKA 3AEQB 4MAAA 2I03A 1NUUA 4HWSA 1KYQA 2ZRLA 1UDBA 3PD0A 1DZIA 3N2EA 1H4VB 3DTVD 4HRYA 1W0JA 1LRLA 5B6PA 1GNTA 4WEOA 1AG9A 4HTAA 5T4HA 3VBEA 2OK8A 5EIBD 1G38A 2AFHE 3L9XA 1SXJA 3KSZO 1R4NB 3LO8A 4ZC1A 4MVWA 1FYXA 1KR2A