3EGFA

Solution structure of murine epidermal growth factor determined by nmr spectroscopy and refined by energy minimization with restraints
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
53
structure length
53
Chain Sequence
NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of murine epidermal growth factor determined by NMR spectroscopy and refined by energy minimization with restraints.
pubmed doi rcsb
source organism Mus musculus
molecule tags Growth factor
molecule keywords EPIDERMAL GROWTH FACTOR
total genus 6
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1992-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 3egfA00
1HT8A 2KV4A 1JL9A 3HO4A 3HPTA 5I46L 5JB9E 5FDQA 2Y5GL 2XBYL 3IJEB 2I9AA 1IQJL 4ISHL 5F1AA 1W7XL 3LIWB 5EGMB 2NPRA 2P93L 3FCSB 4CUDA 3KL6B 1EQHA 1YUGA 2W2QE 3QH0A 1RFNB 2FLRL 2H9EL 1FAXL 1COUA 3TZIA 2OYUP 2J2UB 2P26A 1L3YA 4C16A 4XL1A 4ISIL 2G00L 4PH9A 2VVCK 1EPJA 3KK6A 2WG3C 3FBYA 1KLOA 1G1RA 3LN1A 3M36L 4BTTA 2P3FL 1FJSL 3GISX 2WPME 2WYGB 1EPHA 1HZ8A 2BQWA 2JKHL 1Z6EL 3F6UL 4BTIA 4RRXA 3SOVA 4YZUB 3TK6B 3ASIA 2AYLA 4YT7L 4D0FA 3KQBL 1EMOA 1G2MB 1MQ5L 5CISA 1IP0A 1PGEA 1OB1C 1WU1B 4D90A 1CCFA 2M74A 4ZH8B 1DDXA 1IQLL 2J34B 2W3KB 2FZZL 1Q4GA 4Y71B 1HX2A 2J95B 3LAQA 4NG9L 4XBMA 3TBDA 4AQTA 2PUQL 1V3XB 3NTGA 4Y76B 3KRKA 4D0EA 2WFXB 4JZDL 1HCGB 5KIRA 1WHFA 3SOQA 1UZJA 4CUEA 1LPKA 1EMNA 1KLIL 2EI6B 2XC5L 1HAEA 1PFXL 2VJ3A 2CJIB 2P16L 1G1QA 1K37A 2UWLB 4RRYA 3ELAL 1EAIC 1B9WA 3OLTA 1F7MA 2GD4A 1MQ6L 2VWOL 2BZ6L 1IJQA 1NFYB 4RS0A 3BPSE 1C5MF 1YUFA 3HS6A 5JBCE 1XKBA 3HS7A 3CA7A 3QCWA 2XBWL 4OTYA 2WG4B 1LQDA 1XKAL 2P3FN 1UZPA 2UWOB 2PR3B 3ZYGA 1FE2A 2VVUL 2WPIE 1U67A 4BXSA 5JVZA 1IOXA 1CQEA 3RR3A 1ZAQA 2P94L 3MQEA 2VH0B 3KQDL 1DQBA 1EGFA 3LC3B 1TOZA 3QMOA 2F9BL 3TH3L 2TGFA 1UZQA 3R05A 4M11A 3NTBA 1G2LB 4RRZA 2WPKE 1KSNB 3CFWA 1P0SL 1XDTR 2W2OE 4RUTA 2VWMK 1NFWB 1P9JA 5IKQA 2P3UA 1IGZA 4A7IA 1URKA 3N8VA 3N8YB 2RHPA 5JBBE 2J94B 5E8DA 3TK5B 1XFEA 2Q1JB 2XBXL 1HAFA 3LN0A 2BOKL 3POYA 1LMJA 4Z0KB 2W2NE 2J38B 2VVVL 2Y7XB 1YO8A 4Y7AB 3Q7DA 2P3TA 1IQHL 1IQNL 2ADXA 3N8ZA 4Y79B 1EPIA 1UZKA 2EI7B 3BT2A 3SW2A 4ZAEB 1HT5A 4MMZB 4YT6L 5L2ZL 1LPGA 2YGOA 3U73A 1NFUB 2FD6A 3HS5A 2XC0L 1I0UA 5IKVA 4TGFA 1EQGA 3KQEL 1PTHA 3GCWE 4JZFL 2XBVL 1KLJL 2K2TA 1FAKL 1GK5A 2Y81B 1IQGL 1FFMA 1N7DA 1ATBA 2WPHE 3F1SB 3LC5B 2W86A 2W2ME 3N8WA 3K9XA 4O02B 2BO2A 3MDLA 4X8TL 3BT1A 4Z0LA 3U7UG 2PHBB 1IQKL 4X8UL 3C9AC 1EZQB 3N8XA 1DIYA 4COXA 2D1JB 2W2PE 3KCGL 1NPEB 5L30L 1EBVA 3LTGD 3V65B 1CVUA 2W3IB 1NFXB 3IITB 2KL7A 2Y5HL 1M1XB 4JYUL 1WHEA 5F19A 1QFKL 2KB9A 1CCVA 2VH6B 1CEJA 4LORA 5JVYA 2Y80B 1ADXA 1BF9A 3NT1A 1DVAL 5L2YL 3HO5A 5IKTA 4BTUA 2Y5FL 3PGHA 1L5GB 1J9CL 2BQ7A 4ZXYL 3NJPC 4XLWA 1ATAA 3HO3A 4E1GA 1A3PA 2MGRA 6COXA 2Y82B 2XC4L 3M37L 4FM5A 5KN5C 3KQCL 2FLBL 4CSYA 2VWNL 4JYVL 3TGFA 1FSBA 1X7AL 5JB8E 4BDWA 2RA0L 4CUFA 1IQEL 3SOBB 2J4IB 1Z6CA 1JV2B 2B7DL 1LPZA 1YGCL 3ZYJB 4Y7BB 2MHPA 2YGPA 4Z6AL 2OYEP 2BOHA 4NGAL 1G1SA 3GCXE 5IKRA 1TPGA 2WPLE 1K36A 4M10A 4BDXA 3LTFB 4BXWA 1PXXA 2K2SB 5CKQA 1IQFL 1CX2A 2I9BA 1HJ7A 1KIGL 4G1MB 2UWPB 4JZEL 2P28B 1IVOC 1IOEL 1U8CB 1YUKB 5COXA 1G1TA 4X8VL 2WFTA 3OLUA 2VWLL 2EI8B 2WPJE 4MMXB 4ZXXL 5CKMA 3ENSA 2WYJB 3P5BL 1TLEA 1IQIL 2FLGA 1F7EA 5JW1A 1PRHA 3DEMA 2RNLA 2BMGA 4MMYB 3FFGL 2BOXA 3ZYIB 4OTJA 1JBUL 3Q3KB 1IGXA 3EGFA 1DX5I 1W8BL 1MOXC 3H5CB 1CVWL 5K0HB 4ZHAB 2P95L 1APQA 2W26B 4O1ZA 1AUTL 1N1IA 3CS7L 1HREA 1ATEA 1F0RB 1NZIA 2Y38A 4X8SL 1ATDA 1APOA 1O5DL 4RRWA 5CKNA 1F0SB 4LMFA 4Y6DB 2BOUA 2MGPA 1IQML 1NT0A 1SZBA 1HRFA 1EPGA 1FF7A 3V64C 3CENL 2DDUA 1NQLB 3N8WB 3N8YA 4NA9L 2Y7ZB 2BQ6A 5JBAE
chains in the Genus database with same CATH superfamily
1HT8A 2KV4A 1JL9A 3HO4A 3HPTA 5I46L 5JB9E 2JJLA 5FDQA 2Y5GL 2XBYL 3IJEB 2I9AA 1IQJL 4ISHL 5F1AA 1W7XL 3LIWB 5EGMB 2NPRA 2P93L 3FCSB 4CUDA 3KL6B 1EQHA 1YUGA 2W2QE 3QH0A 1RFNB 2FLRL 2H9EL 1FAXL 1COUA 3TZIA 2OYUP 2J2UB 2P26A 1L3YA 4C16A 4XL1A 4ISIL 2G00L 4PH9A 1LMMA 2VVCK 1EPJA 3KK6A 2WG3C 3FBYA 1KLOA 1G1RA 3LN1A 3M36L 4BTTA 4A94C 2P3FL 1FJSL 3GISX 2WPME 4GU3A 2WYGB 1EPHA 1HZ8A 2BQWA 2JKHL 1Z6EL 3F6UL 4BTIA 4RRXA 3SOVA 4YZUB 3TK6B 3ASIA 2AYLA 4YT7L 4D0FA 3KQBL 1EMOA 1G2MB 1MQ5L 5CISA 1IP0A 1PGEA 1OB1C 1WU1B 4D90A 1CCFA 2M74A 4ZH8B 1DDXA 1IQLL 2J34B 2W3KB 2FZZL 1Q4GA 4Y71B 1HX2A 2J95B 3LAQA 4NG9L 4XBMA 3TBDA 4AQTA 2PUQL 1V3XB 3NTGA 4Y76B 3KRKA 4D0EA 2WFXB 4JZDL 1HCGB 5KIRA 1WHFA 3SOQA 1UZJA 4CUEA 1LPKA 1EMNA 1KLIL 2EI6B 2XC5L 1HAEA 1PFXL 2VJ3A 2CJIB 2P16L 1G1QA 1K37A 2UWLB 4RRYA 3ELAL 1EAIC 2BT7A 1B9WA 3OLTA 1F7MA 2GD4A 1MQ6L 2VWOL 2BZ6L 1IJQA 1NFYB 4RS0A 3BPSE 1C5MF 1YUFA 3HS6A 5JBCE 1XKBA 3HS7A 3CA7A 3QCWA 2XBWL 4OTYA 2WG4B 1LQDA 1XKAL 2P3FN 1UZPA 2UWOB 2PR3B 3ZYGA 1FE2A 2VVUL 2WPIE 1U67A 4BXSA 5JVZA 1IOXA 1CQEA 2HOXA 3RR3A 1ZAQA 2P94L 3MQEA 2VH0B 3KQDL 1DQBA 1EGFA 3LC3B 1TOZA 3QMOA 2F9BL 3TH3L 2TGFA 1UZQA 3R05A 4M11A 3NTBA 1G2LB 4RRZA 2WPKE 1KSNB 3CFWA 1P0SL 1XDTR 2W2OE 4RUTA 2VWMK 1NFWB 1P9JA 5IKQA 2P3UA 1IGZA 4A7IA 1URKA 3N8VA 3N8YB 2RHPA 5JBBE 2YGQA 2J94B 5E8DA 3TK5B 1XFEA 2Q1JB 2XBXL 1HAFA 3LN0A 2HORA 2BOKL 3POYA 1LMJA 4Z0KB 2W2NE 2J38B 2VVVL 2Y7XB 1YO8A 4Y7AB 3Q7DA 2P3TA 1IQHL 1IQNL 2ADXA 3N8ZA 4Y79B 1EPIA 1UZKA 2EI7B 3BT2A 3SW2A 4ZAEB 1HT5A 4MMZB 4YT6L 5L2ZL 1LPGA 2YGOA 3U73A 1NFUB 2FD6A 3HS5A 2XC0L 1I0UA 5IKVA 4TGFA 1EQGA 3KQEL 1PTHA 3GCWE 2XBVL 1KLJL 2K2TA 4JZFL 1FAKL 1GK5A 2Y81B 1IQGL 1FFMA 1N7DA 1ATBA 2WPHE 3F1SB 3LC5B 2W86A 2W2ME 3N8WA 3K9XA 4O02B 2BO2A 3MDLA 4X8TL 3BT1A 4Z0LA 3U7UG 2PHBB 1IQKL 4X8UL 3C9AC 1EZQB 3N8XA 1DIYA 4COXA 2D1JB 2W2PE 3KCGL 1NPEB 5L30L 1EBVA 3LTGD 3V65B 1CVUA 2W3IB 1NFXB 3IITB 2KL7A 2Y5HL 1M1XB 4JYUL 1WHEA 5F19A 1QFKL 2KB9A 1CCVA 2VH6B 1CEJA 4LORA 5JVYA 2Y80B 1ADXA 1BF9A 1KKEA 3NT1A 1DVAL 5L2YL 3HO5A 3S6XA 5IKTA 4BTUA 2Y5FL 3PGHA 1L5GB 1J9CL 2BQ7A 4ZXYL 3NJPC 4XLWA 1ATAA 3HO3A 4E1GA 1A3PA 2MGRA 6COXA 2Y82B 2XC4L 3M37L 2BSFA 4FM5A 5KN5C 4GU4A 3KQCL 2FLBL 4CSYA 2VWNL 4JYVL 3TGFA 1FSBA 1X7AL 5JB8E 4BDWA 2RA0L 4CUFA 1IQEL 3SOBB 2J4IB 1Z6CA 1JV2B 2B7DL 1LPZA 1YGCL 1V1IA 3ZYJB 4Y7BB 2MHPA 2YGPA 4Z6AL 2OYEP 2BOHA 4NGAL 1G1SA 3GCXE 5IKRA 1TPGA 2WPLE 1K36A 4M10A 4BDXA 3LTFB 4BXWA 2VRSA 1PXXA 2K2SB 2KNIA 5CKQA 1IQFL 1CX2A 2I9BA 1HJ7A 1KIGL 4G1MB 2H9EC 2UWPB 4JZEL 2P28B 1IVOC 1IOEL 1U8CB 1YUKB 5COXA 1G1TA 4X8VL 2WFTA 3OLUA 2WZPP 2VWLL 2EI8B 2WPJE 4MMXB 4ZXXL 5CKMA 3ENSA 2WYJB 3P5BL 1TLEA 1LK9A 1IQIL 2FLGA 1F7EA 5JW1A 1PRHA 3DEMA 2RNLA 2BMGA 4MMYB 3FFGL 2BOXA 3ZYIB 4OTJA 1JBUL 3Q3KB 1IGXA 3EGFA 1DX5I 1W8BL 1MOXC 3H5CB 1QIUA 1CVWL 5K0HB 4ZHAB 2P95L 1APQA 2W26B 4O1ZA 1AUTL 1N1IA 3CS7L 1HREA 1ATEA 1F0RB 1NZIA 2Y38A 4X8SL 1ATDA 1APOA 1O5DL 4RRWA 5CKNA 1F0SB 4LMFA 4Y6DB 2BOUA 2MGPA 1IQML 1NT0A 2BT8A 1SZBA 1HRFA 1EPGA 1FF7A 3V64C 3CENL 2DDUA 1NQLB 3N8WB 1V1HA 3N8YA 4NA9L 2Y7ZB 2BQ6A 5JBAE
chains in the Genus database with same CATH topology
1HT8A 2KV4A 1JL9A 3HO4A 3HPTA 5I46L 5JB9E 5FDQA 2Y5GL 2XBYL 3IJEB 2I9AA 1IQJL 4ISHL 5F1AA 1W7XL 3LIWB 5EGMB 2NPRA 2P93L 3FCSB 4CUDA 3KL6B 1EQHA 1YUGA 2W2QE 3QH0A 1RFNB 2FLRL 2H9EL 1FAXL 1COUA 3TZIA 2OYUP 2J2UB 2P26A 1L3YA 4C16A 4XL1A 4ISIL 2G00L 4PH9A 1LMMA 2VVCK 1EPJA 3KK6A 2WG3C 3FBYA 1KLOA 1G1RA 3LN1A 3M36L 4BTTA 4A94C 2P3FL 1FJSL 3GISX 2WPME 2WYGB 1EPHA 1HZ8A 2BQWA 2JKHL 1Z6EL 3F6UL 4BTIA 4RRXA 3SOVA 4YZUB 3TK6B 3ASIA 2AYLA 4YT7L 4D0FA 3KQBL 1EMOA 1G2MB 1MQ5L 5CISA 1IP0A 1PGEA 1OB1C 1WU1B 4D90A 1CCFA 2M74A 4ZH8B 1DDXA 1IQLL 2J34B 2W3KB 2FZZL 1Q4GA 4Y71B 1HX2A 2J95B 3LAQA 4NG9L 4XBMA 3TBDA 4AQTA 2PUQL 1V3XB 3NTGA 4Y76B 3KRKA 4D0EA 2WFXB 4JZDL 1HCGB 5KIRA 1WHFA 3SOQA 1UZJA 4CUEA 1LPKA 1EMNA 1KLIL 2EI6B 2XC5L 1HAEA 1PFXL 2VJ3A 2CJIB 2P16L 1G1QA 1K37A 2UWLB 4RRYA 3ELAL 1EAIC 1B9WA 3OLTA 1F7MA 2GD4A 1MQ6L 2VWOL 2BZ6L 1IJQA 1NFYB 4RS0A 3BPSE 1C5MF 1YUFA 3HS6A 5JBCE 1XKBA 3HS7A 3CA7A 3QCWA 2XBWL 4OTYA 2WG4B 1LQDA 1XKAL 2P3FN 1UZPA 2UWOB 2PR3B 3ZYGA 1FE2A 2VVUL 2WPIE 1U67A 4BXSA 5JVZA 1IOXA 1CQEA 3RR3A 1ZAQA 2P94L 3MQEA 2VH0B 3KQDL 1DQBA 1EGFA 3LC3B 1TOZA 3QMOA 2F9BL 3TH3L 2TGFA 1UZQA 3R05A 4M11A 3NTBA 1G2LB 4RRZA 2WPKE 1KSNB 3CFWA 1P0SL 1XDTR 2W2OE 4RUTA 2VWMK 1NFWB 1P9JA 5IKQA 2P3UA 1IGZA 4A7IA 1URKA 3N8VA 3N8YB 2RHPA 5JBBE 2YGQA 2J94B 5E8DA 3TK5B 1XFEA 2Q1JB 2XBXL 1HAFA 3LN0A 2BOKL 3POYA 1LMJA 4Z0KB 2W2NE 2J38B 2VVVL 2Y7XB 1YO8A 4Y7AB 3Q7DA 2P3TA 1IQHL 1IQNL 2ADXA 3N8ZA 4Y79B 1EPIA 1UZKA 2EI7B 3BT2A 3SW2A 4ZAEB 1HT5A 4MMZB 4YT6L 5L2ZL 1LPGA 2YGOA 3U73A 1NFUB 2FD6A 3HS5A 2XC0L 1I0UA 5IKVA 4TGFA 1EQGA 3KQEL 1PTHA 3GCWE 4JZFL 2XBVL 1KLJL 2K2TA 1FAKL 1GK5A 2Y81B 1IQGL 1FFMA 1N7DA 1ATBA 2WPHE 3F1SB 3LC5B 2W86A 2W2ME 3N8WA 3K9XA 4O02B 2BO2A 3MDLA 4X8TL 3BT1A 4Z0LA 3U7UG 2PHBB 1IQKL 4X8UL 3C9AC 1EZQB 3N8XA 1DIYA 4COXA 2D1JB 2W2PE 3KCGL 1NPEB 5L30L 1EBVA 3LTGD 3V65B 1CVUA 2W3IB 1NFXB 3IITB 2KL7A 2Y5HL 1M1XB 4JYUL 1WHEA 5F19A 1QFKL 2KB9A 1CCVA 2VH6B 1CEJA 4LORA 5JVYA 2Y80B 1ADXA 1BF9A 3NT1A 1DVAL 5L2YL 3HO5A 3S6XA 5IKTA 4BTUA 2Y5FL 3PGHA 1L5GB 1J9CL 2BQ7A 4ZXYL 3NJPC 4XLWA 1ATAA 3HO3A 4E1GA 1A3PA 2MGRA 6COXA 2Y82B 2XC4L 3M37L 4FM5A 5KN5C 3KQCL 2FLBL 4CSYA 2VWNL 4JYVL 3TGFA 1FSBA 1X7AL 5JB8E 4BDWA 2RA0L 4CUFA 1IQEL 3SOBB 2J4IB 1Z6CA 1JV2B 2B7DL 1LPZA 1YGCL 3ZYJB 4Y7BB 2MHPA 2YGPA 4Z6AL 2OYEP 2BOHA 4NGAL 1G1SA 3GCXE 5IKRA 1TPGA 2WPLE 1K36A 4M10A 4BDXA 3LTFB 4BXWA 1PXXA 2K2SB 2KNIA 5CKQA 1IQFL 1CX2A 2I9BA 1HJ7A 1KIGL 4G1MB 2H9EC 2UWPB 4JZEL 2P28B 1IVOC 1IOEL 1U8CB 1YUKB 5COXA 1G1TA 4X8VL 2WFTA 3OLUA 2WZPP 2VWLL 2EI8B 2WPJE 4MMXB 4ZXXL 5CKMA 3ENSA 2WYJB 3P5BL 1TLEA 1IQIL 2FLGA 1F7EA 5JW1A 1PRHA 3DEMA 2RNLA 2BMGA 4MMYB 3FFGL 2BOXA 3ZYIB 4OTJA 1JBUL 3Q3KB 1IGXA 3EGFA 1DX5I 1W8BL 1MOXC 3H5CB 1CVWL 5K0HB 4ZHAB 2P95L 1APQA 2W26B 4O1ZA 1AUTL 1N1IA 3CS7L 1HREA 1ATEA 1F0RB 1NZIA 2Y38A 4X8SL 1ATDA 1APOA 1O5DL 4RRWA 5CKNA 1F0SB 4LMFA 4Y6DB 2BOUA 2MGPA 1IQML 1NT0A 1SZBA 1HRFA 1EPGA 1FF7A 3V64C 3CENL 2DDUA 1NQLB 3N8WB 3N8YA 4NA9L 2Y7ZB 2BQ6A 5JBAE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HT8 A;  2KV4 A;  1JL9 A;  3HO4 A;  3HPT A;  5I46 L;  5JB9 E;  5FDQ A;  2Y5G L;  2XBY L;  3IJE B;  2I9A A;  1IQJ L;  4ISH L;  5F1A A;  1W7X L;  3LIW B;  5EGM B;  2NPR A;  2P93 L;  3FCS B;  4CUD A;  3KL6 B;  1EQH A;  1YUG A;  2W2Q E;  3QH0 A;  1RFN B;  2FLR L;  2H9E L;  1FAX L;  1COU A;  3TZI A;  2OYU P;  2J2U B;  2P26 A;  1L3Y A;  4C16 A;  4XL1 A;  4ISI L;  2G00 L;  4PH9 A;  2VVC K;  1EPJ A;  3KK6 A;  2WG3 C;  3FBY A;  1KLO A;  1G1R A;  3LN1 A;  3M36 L;  4BTT A;  2P3F L;  1FJS L;  3GIS X;  2WPM E;  2WYG B;  1EPH A;  1HZ8 A;  2BQW A;  2JKH L;  1Z6E L;  3F6U L;  4BTI A;  4RRX A;  3SOV A;  4YZU B;  3TK6 B;  3ASI A;  2AYL A;  4YT7 L;  4D0F A;  3KQB L;  1EMO A;  1G2M B;  1MQ5 L;  5CIS A;  1IP0 A;  1PGE A;  1OB1 C;  1WU1 B;  4D90 A;  1CCF A;  2M74 A;  4ZH8 B;  1DDX A;  1IQL L;  2J34 B;  2W3K B;  2FZZ L;  1Q4G A;  4Y71 B;  1HX2 A;  2J95 B;  3LAQ A;  4NG9 L;  4XBM A;  3TBD A;  4AQT A;  2PUQ L;  1V3X B;  3NTG A;  4Y76 B;  3KRK A;  4D0E A;  2WFX B;  4JZD L;  1HCG B;  5KIR A;  1WHF A;  3SOQ A;  1UZJ A;  4CUE A;  1LPK A;  1EMN A;  1KLI L;  2EI6 B;  2XC5 L;  1HAE A;  1PFX L;  2VJ3 A;  2CJI B;  2P16 L;  1G1Q A;  1K37 A;  2UWL B;  4RRY A;  3ELA L;  1EAI C;  1B9W A;  3OLT A;  1F7M A;  2GD4 A;  1MQ6 L;  2VWO L;  2BZ6 L;  1IJQ A;  1NFY B;  4RS0 A;  3BPS E;  1C5M F;  1YUF A;  3HS6 A;  5JBC E;  1XKB A;  3HS7 A;  3CA7 A;  3QCW A;  2XBW L;  4OTY A;  2WG4 B;  1LQD A;  1XKA L;  2P3F N;  1UZP A;  2UWO B;  2PR3 B;  3ZYG A;  1FE2 A;  2VVU L;  2WPI E;  1U67 A;  4BXS A;  5JVZ A;  1IOX A;  1CQE A;  3RR3 A;  1ZAQ A;  2P94 L;  3MQE A;  2VH0 B;  3KQD L;  1DQB A;  1EGF A;  3LC3 B;  1TOZ A;  3QMO A;  2F9B L;  3TH3 L;  2TGF A;  1UZQ A;  3R05 A;  4M11 A;  3NTB A;  1G2L B;  4RRZ A;  2WPK E;  1KSN B;  3CFW A;  1P0S L;  1XDT R;  2W2O E;  4RUT A;  2VWM K;  1NFW B;  1P9J A;  5IKQ A;  2P3U A;  1IGZ A;  4A7I A;  1URK A;  3N8V A;  3N8Y B;  2RHP A;  5JBB E;  2J94 B;  5E8D A;  3TK5 B;  1XFE A;  2Q1J B;  2XBX L;  1HAF A;  3LN0 A;  2BOK L;  3POY A;  1LMJ A;  4Z0K B;  2W2N E;  2J38 B;  2VVV L;  2Y7X B;  1YO8 A;  4Y7A B;  3Q7D A;  2P3T A;  1IQH L;  1IQN L;  2ADX A;  3N8Z A;  4Y79 B;  1EPI A;  1UZK A;  2EI7 B;  3BT2 A;  3SW2 A;  4ZAE B;  1HT5 A;  4MMZ B;  4YT6 L;  5L2Z L;  1LPG A;  2YGO A;  3U73 A;  1NFU B;  2FD6 A;  3HS5 A;  2XC0 L;  1I0U A;  5IKV A;  4TGF A;  1EQG A;  3KQE L;  1PTH A;  3GCW E;  4JZF L;  2XBV L;  1KLJ L;  2K2T A;  1FAK L;  1GK5 A;  2Y81 B;  1IQG L;  1FFM A;  1N7D A;  1ATB A;  2WPH E;  3F1S B;  3LC5 B;  2W86 A;  2W2M E;  3N8W A;  3K9X A;  4O02 B;  2BO2 A;  3MDL A;  4X8T L;  3BT1 A;  4Z0L A;  3U7U G;  2PHB B;  1IQK L;  4X8U L;  3C9A C;  1EZQ B;  3N8X A;  1DIY A;  4COX A;  2D1J B;  2W2P E;  3KCG L;  1NPE B;  5L30 L;  1EBV A;  3LTG D;  3V65 B;  1CVU A;  2W3I B;  1NFX B;  3IIT B;  2KL7 A;  2Y5H L;  1M1X B;  4JYU L;  1WHE A;  5F19 A;  1QFK L;  2KB9 A;  1CCV A;  2VH6 B;  1CEJ A;  4LOR A;  5JVY A;  2Y80 B;  1ADX A;  1BF9 A;  3NT1 A;  1DVA L;  5L2Y L;  3HO5 A;  5IKT A;  4BTU A;  2Y5F L;  3PGH A;  1L5G B;  1J9C L;  2BQ7 A;  4ZXY L;  3NJP C;  4XLW A;  1ATA A;  3HO3 A;  4E1G A;  1A3P A;  2MGR A;  6COX A;  2Y82 B;  2XC4 L;  3M37 L;  4FM5 A;  5KN5 C;  3KQC L;  2FLB L;  4CSY A;  2VWN L;  4JYV L;  3TGF A;  1FSB A;  1X7A L;  5JB8 E;  4BDW A;  2RA0 L;  4CUF A;  1IQE L;  3SOB B;  2J4I B;  1Z6C A;  1JV2 B;  2B7D L;  1LPZ A;  1YGC L;  3ZYJ B;  4Y7B B;  2MHP A;  2YGP A;  4Z6A L;  2OYE P;  2BOH A;  4NGA L;  1G1S A;  3GCX E;  5IKR A;  1TPG A;  2WPL E;  1K36 A;  4M10 A;  4BDX A;  3LTF B;  4BXW A;  1PXX A;  2K2S B;  5CKQ A;  1IQF L;  1CX2 A;  2I9B A;  1HJ7 A;  1KIG L;  4G1M B;  2UWP B;  4JZE L;  2P28 B;  1IVO C;  1IOE L;  1U8C B;  1YUK B;  5COX A;  1G1T A;  4X8V L;  2WFT A;  3OLU A;  2VWL L;  2EI8 B;  2WPJ E;  4MMX B;  4ZXX L;  5CKM A;  3ENS A;  2WYJ B;  3P5B L;  1TLE A;  1IQI L;  2FLG A;  1F7E A;  5JW1 A;  1PRH A;  3DEM A;  2RNL A;  2BMG A;  4MMY B;  3FFG L;  2BOX A;  3ZYI B;  4OTJ A;  1JBU L;  3Q3K B;  1IGX A;  3EGF A;  1DX5 I;  1W8B L;  1MOX C;  3H5C B;  1CVW L;  5K0H B;  4ZHA B;  2P95 L;  1APQ A;  2W26 B;  4O1Z A;  1AUT L;  1N1I A;  3CS7 L;  1HRE A;  1ATE A;  1F0R B;  1NZI A;  2Y38 A;  4X8S L;  1ATD A;  1APO A;  1O5D L;  4RRW A;  5CKN A;  1F0S B;  4LMF A;  4Y6D B;  2BOU A;  2MGP A;  1IQM L;  1NT0 A;  1SZB A;  1HRF A;  1EPG A;  1FF7 A;  3V64 C;  3CEN L;  2DDU A;  1NQL B;  3N8W B;  3N8Y A;  4NA9 L;  2Y7Z B;  2BQ6 A;  5JBA E; 
#chains in the Genus database with same CATH topology
 1HT8 A;  2KV4 A;  1JL9 A;  3HO4 A;  3HPT A;  5I46 L;  5JB9 E;  2JJL A;  5FDQ A;  2Y5G L;  2XBY L;  3IJE B;  2I9A A;  1IQJ L;  4ISH L;  5F1A A;  1W7X L;  3LIW B;  5EGM B;  2NPR A;  2P93 L;  3FCS B;  4CUD A;  3KL6 B;  1EQH A;  1YUG A;  2W2Q E;  3QH0 A;  1RFN B;  2FLR L;  2H9E L;  1FAX L;  1COU A;  3TZI A;  2OYU P;  2J2U B;  2P26 A;  1L3Y A;  4C16 A;  4XL1 A;  4ISI L;  2G00 L;  4PH9 A;  1LMM A;  2VVC K;  1EPJ A;  3KK6 A;  2WG3 C;  3FBY A;  1KLO A;  1G1R A;  3LN1 A;  3M36 L;  4BTT A;  4A94 C;  2P3F L;  1FJS L;  3GIS X;  2WPM E;  4GU3 A;  2WYG B;  1EPH A;  1HZ8 A;  2BQW A;  2JKH L;  1Z6E L;  3F6U L;  4BTI A;  4RRX A;  3SOV A;  4YZU B;  3TK6 B;  3ASI A;  2AYL A;  4YT7 L;  4D0F A;  3KQB L;  1EMO A;  1G2M B;  1MQ5 L;  5CIS A;  1IP0 A;  1PGE A;  1OB1 C;  1WU1 B;  4D90 A;  1CCF A;  2M74 A;  4ZH8 B;  1DDX A;  1IQL L;  2J34 B;  2W3K B;  2FZZ L;  1Q4G A;  4Y71 B;  1HX2 A;  2J95 B;  3LAQ A;  4NG9 L;  4XBM A;  3TBD A;  4AQT A;  2PUQ L;  1V3X B;  3NTG A;  4Y76 B;  3KRK A;  4D0E A;  2WFX B;  4JZD L;  1HCG B;  5KIR A;  1WHF A;  3SOQ A;  1UZJ A;  4CUE A;  1LPK A;  1EMN A;  1KLI L;  2EI6 B;  2XC5 L;  1HAE A;  1PFX L;  2VJ3 A;  2CJI B;  2P16 L;  1G1Q A;  1K37 A;  2UWL B;  4RRY A;  3ELA L;  1EAI C;  2BT7 A;  1B9W A;  3OLT A;  1F7M A;  2GD4 A;  1MQ6 L;  2VWO L;  2BZ6 L;  1IJQ A;  1NFY B;  4RS0 A;  3BPS E;  1C5M F;  1YUF A;  3HS6 A;  5JBC E;  1XKB A;  3HS7 A;  3CA7 A;  3QCW A;  2XBW L;  4OTY A;  2WG4 B;  1LQD A;  1XKA L;  2P3F N;  1UZP A;  2UWO B;  2PR3 B;  3ZYG A;  1FE2 A;  2VVU L;  2WPI E;  1U67 A;  4BXS A;  5JVZ A;  1IOX A;  1CQE A;  2HOX A;  3RR3 A;  1ZAQ A;  2P94 L;  3MQE A;  2VH0 B;  3KQD L;  1DQB A;  1EGF A;  3LC3 B;  1TOZ A;  3QMO A;  2F9B L;  3TH3 L;  2TGF A;  1UZQ A;  3R05 A;  4M11 A;  3NTB A;  1G2L B;  4RRZ A;  2WPK E;  1KSN B;  3CFW A;  1P0S L;  1XDT R;  2W2O E;  4RUT A;  2VWM K;  1NFW B;  1P9J A;  5IKQ A;  2P3U A;  1IGZ A;  4A7I A;  1URK A;  3N8V A;  3N8Y B;  2RHP A;  5JBB E;  2YGQ A;  2J94 B;  5E8D A;  3TK5 B;  1XFE A;  2Q1J B;  2XBX L;  1HAF A;  3LN0 A;  2HOR A;  2BOK L;  3POY A;  1LMJ A;  4Z0K B;  2W2N E;  2J38 B;  2VVV L;  2Y7X B;  1YO8 A;  4Y7A B;  3Q7D A;  2P3T A;  1IQH L;  1IQN L;  2ADX A;  3N8Z A;  4Y79 B;  1EPI A;  1UZK A;  2EI7 B;  3BT2 A;  3SW2 A;  4ZAE B;  1HT5 A;  4MMZ B;  4YT6 L;  5L2Z L;  1LPG A;  2YGO A;  3U73 A;  1NFU B;  2FD6 A;  3HS5 A;  2XC0 L;  1I0U A;  5IKV A;  4TGF A;  1EQG A;  3KQE L;  1PTH A;  3GCW E;  2XBV L;  1KLJ L;  2K2T A;  4JZF L;  1FAK L;  1GK5 A;  2Y81 B;  1IQG L;  1FFM A;  1N7D A;  1ATB A;  2WPH E;  3F1S B;  3LC5 B;  2W86 A;  2W2M E;  3N8W A;  3K9X A;  4O02 B;  2BO2 A;  3MDL A;  4X8T L;  3BT1 A;  4Z0L A;  3U7U G;  2PHB B;  1IQK L;  4X8U L;  3C9A C;  1EZQ B;  3N8X A;  1DIY A;  4COX A;  2D1J B;  2W2P E;  3KCG L;  1NPE B;  5L30 L;  1EBV A;  3LTG D;  3V65 B;  1CVU A;  2W3I B;  1NFX B;  3IIT B;  2KL7 A;  2Y5H L;  1M1X B;  4JYU L;  1WHE A;  5F19 A;  1QFK L;  2KB9 A;  1CCV A;  2VH6 B;  1CEJ A;  4LOR A;  5JVY A;  2Y80 B;  1ADX A;  1BF9 A;  1KKE A;  3NT1 A;  1DVA L;  5L2Y L;  3HO5 A;  3S6X A;  5IKT A;  4BTU A;  2Y5F L;  3PGH A;  1L5G B;  1J9C L;  2BQ7 A;  4ZXY L;  3NJP C;  4XLW A;  1ATA A;  3HO3 A;  4E1G A;  1A3P A;  2MGR A;  6COX A;  2Y82 B;  2XC4 L;  3M37 L;  2BSF A;  4FM5 A;  5KN5 C;  4GU4 A;  3KQC L;  2FLB L;  4CSY A;  2VWN L;  4JYV L;  3TGF A;  1FSB A;  1X7A L;  5JB8 E;  4BDW A;  2RA0 L;  4CUF A;  1IQE L;  3SOB B;  2J4I B;  1Z6C A;  1JV2 B;  2B7D L;  1LPZ A;  1YGC L;  1V1I A;  3ZYJ B;  4Y7B B;  2MHP A;  2YGP A;  4Z6A L;  2OYE P;  2BOH A;  4NGA L;  1G1S A;  3GCX E;  5IKR A;  1TPG A;  2WPL E;  1K36 A;  4M10 A;  4BDX A;  3LTF B;  4BXW A;  2VRS A;  1PXX A;  2K2S B;  2KNI A;  5CKQ A;  1IQF L;  1CX2 A;  2I9B A;  1HJ7 A;  1KIG L;  4G1M B;  2H9E C;  2UWP B;  4JZE L;  2P28 B;  1IVO C;  1IOE L;  1U8C B;  1YUK B;  5COX A;  1G1T A;  4X8V L;  2WFT A;  3OLU A;  2WZP P;  2VWL L;  2EI8 B;  2WPJ E;  4MMX B;  4ZXX L;  5CKM A;  3ENS A;  2WYJ B;  3P5B L;  1TLE A;  1LK9 A;  1IQI L;  2FLG A;  1F7E A;  5JW1 A;  1PRH A;  3DEM A;  2RNL A;  2BMG A;  4MMY B;  3FFG L;  2BOX A;  3ZYI B;  4OTJ A;  1JBU L;  3Q3K B;  1IGX A;  3EGF A;  1DX5 I;  1W8B L;  1MOX C;  3H5C B;  1QIU A;  1CVW L;  5K0H B;  4ZHA B;  2P95 L;  1APQ A;  2W26 B;  4O1Z A;  1AUT L;  1N1I A;  3CS7 L;  1HRE A;  1ATE A;  1F0R B;  1NZI A;  2Y38 A;  4X8S L;  1ATD A;  1APO A;  1O5D L;  4RRW A;  5CKN A;  1F0S B;  4LMF A;  4Y6D B;  2BOU A;  2MGP A;  1IQM L;  1NT0 A;  2BT8 A;  1SZB A;  1HRF A;  1EPG A;  1FF7 A;  3V64 C;  3CEN L;  2DDU A;  1NQL B;  3N8W B;  1V1H A;  3N8Y A;  4NA9 L;  2Y7Z B;  2BQ6 A;  5JBA E; 
#chains in the Genus database with same CATH homology
 1HT8 A;  2KV4 A;  1JL9 A;  3HO4 A;  3HPT A;  5I46 L;  5JB9 E;  5FDQ A;  2Y5G L;  2XBY L;  3IJE B;  2I9A A;  1IQJ L;  4ISH L;  5F1A A;  1W7X L;  3LIW B;  5EGM B;  2NPR A;  2P93 L;  3FCS B;  4CUD A;  3KL6 B;  1EQH A;  1YUG A;  2W2Q E;  3QH0 A;  1RFN B;  2FLR L;  2H9E L;  1FAX L;  1COU A;  3TZI A;  2OYU P;  2J2U B;  2P26 A;  1L3Y A;  4C16 A;  4XL1 A;  4ISI L;  2G00 L;  4PH9 A;  1LMM A;  2VVC K;  1EPJ A;  3KK6 A;  2WG3 C;  3FBY A;  1KLO A;  1G1R A;  3LN1 A;  3M36 L;  4BTT A;  4A94 C;  2P3F L;  1FJS L;  3GIS X;  2WPM E;  2WYG B;  1EPH A;  1HZ8 A;  2BQW A;  2JKH L;  1Z6E L;  3F6U L;  4BTI A;  4RRX A;  3SOV A;  4YZU B;  3TK6 B;  3ASI A;  2AYL A;  4YT7 L;  4D0F A;  3KQB L;  1EMO A;  1G2M B;  1MQ5 L;  5CIS A;  1IP0 A;  1PGE A;  1OB1 C;  1WU1 B;  4D90 A;  1CCF A;  2M74 A;  4ZH8 B;  1DDX A;  1IQL L;  2J34 B;  2W3K B;  2FZZ L;  1Q4G A;  4Y71 B;  1HX2 A;  2J95 B;  3LAQ A;  4NG9 L;  4XBM A;  3TBD A;  4AQT A;  2PUQ L;  1V3X B;  3NTG A;  4Y76 B;  3KRK A;  4D0E A;  2WFX B;  4JZD L;  1HCG B;  5KIR A;  1WHF A;  3SOQ A;  1UZJ A;  4CUE A;  1LPK A;  1EMN A;  1KLI L;  2EI6 B;  2XC5 L;  1HAE A;  1PFX L;  2VJ3 A;  2CJI B;  2P16 L;  1G1Q A;  1K37 A;  2UWL B;  4RRY A;  3ELA L;  1EAI C;  1B9W A;  3OLT A;  1F7M A;  2GD4 A;  1MQ6 L;  2VWO L;  2BZ6 L;  1IJQ A;  1NFY B;  4RS0 A;  3BPS E;  1C5M F;  1YUF A;  3HS6 A;  5JBC E;  1XKB A;  3HS7 A;  3CA7 A;  3QCW A;  2XBW L;  4OTY A;  2WG4 B;  1LQD A;  1XKA L;  2P3F N;  1UZP A;  2UWO B;  2PR3 B;  3ZYG A;  1FE2 A;  2VVU L;  2WPI E;  1U67 A;  4BXS A;  5JVZ A;  1IOX A;  1CQE A;  3RR3 A;  1ZAQ A;  2P94 L;  3MQE A;  2VH0 B;  3KQD L;  1DQB A;  1EGF A;  3LC3 B;  1TOZ A;  3QMO A;  2F9B L;  3TH3 L;  2TGF A;  1UZQ A;  3R05 A;  4M11 A;  3NTB A;  1G2L B;  4RRZ A;  2WPK E;  1KSN B;  3CFW A;  1P0S L;  1XDT R;  2W2O E;  4RUT A;  2VWM K;  1NFW B;  1P9J A;  5IKQ A;  2P3U A;  1IGZ A;  4A7I A;  1URK A;  3N8V A;  3N8Y B;  2RHP A;  5JBB E;  2YGQ A;  2J94 B;  5E8D A;  3TK5 B;  1XFE A;  2Q1J B;  2XBX L;  1HAF A;  3LN0 A;  2BOK L;  3POY A;  1LMJ A;  4Z0K B;  2W2N E;  2J38 B;  2VVV L;  2Y7X B;  1YO8 A;  4Y7A B;  3Q7D A;  2P3T A;  1IQH L;  1IQN L;  2ADX A;  3N8Z A;  4Y79 B;  1EPI A;  1UZK A;  2EI7 B;  3BT2 A;  3SW2 A;  4ZAE B;  1HT5 A;  4MMZ B;  4YT6 L;  5L2Z L;  1LPG A;  2YGO A;  3U73 A;  1NFU B;  2FD6 A;  3HS5 A;  2XC0 L;  1I0U A;  5IKV A;  4TGF A;  1EQG A;  3KQE L;  1PTH A;  3GCW E;  4JZF L;  2XBV L;  1KLJ L;  2K2T A;  1FAK L;  1GK5 A;  2Y81 B;  1IQG L;  1FFM A;  1N7D A;  1ATB A;  2WPH E;  3F1S B;  3LC5 B;  2W86 A;  2W2M E;  3N8W A;  3K9X A;  4O02 B;  2BO2 A;  3MDL A;  4X8T L;  3BT1 A;  4Z0L A;  3U7U G;  2PHB B;  1IQK L;  4X8U L;  3C9A C;  1EZQ B;  3N8X A;  1DIY A;  4COX A;  2D1J B;  2W2P E;  3KCG L;  1NPE B;  5L30 L;  1EBV A;  3LTG D;  3V65 B;  1CVU A;  2W3I B;  1NFX B;  3IIT B;  2KL7 A;  2Y5H L;  1M1X B;  4JYU L;  1WHE A;  5F19 A;  1QFK L;  2KB9 A;  1CCV A;  2VH6 B;  1CEJ A;  4LOR A;  5JVY A;  2Y80 B;  1ADX A;  1BF9 A;  3NT1 A;  1DVA L;  5L2Y L;  3HO5 A;  3S6X A;  5IKT A;  4BTU A;  2Y5F L;  3PGH A;  1L5G B;  1J9C L;  2BQ7 A;  4ZXY L;  3NJP C;  4XLW A;  1ATA A;  3HO3 A;  4E1G A;  1A3P A;  2MGR A;  6COX A;  2Y82 B;  2XC4 L;  3M37 L;  4FM5 A;  5KN5 C;  3KQC L;  2FLB L;  4CSY A;  2VWN L;  4JYV L;  3TGF A;  1FSB A;  1X7A L;  5JB8 E;  4BDW A;  2RA0 L;  4CUF A;  1IQE L;  3SOB B;  2J4I B;  1Z6C A;  1JV2 B;  2B7D L;  1LPZ A;  1YGC L;  3ZYJ B;  4Y7B B;  2MHP A;  2YGP A;  4Z6A L;  2OYE P;  2BOH A;  4NGA L;  1G1S A;  3GCX E;  5IKR A;  1TPG A;  2WPL E;  1K36 A;  4M10 A;  4BDX A;  3LTF B;  4BXW A;  1PXX A;  2K2S B;  2KNI A;  5CKQ A;  1IQF L;  1CX2 A;  2I9B A;  1HJ7 A;  1KIG L;  4G1M B;  2H9E C;  2UWP B;  4JZE L;  2P28 B;  1IVO C;  1IOE L;  1U8C B;  1YUK B;  5COX A;  1G1T A;  4X8V L;  2WFT A;  3OLU A;  2WZP P;  2VWL L;  2EI8 B;  2WPJ E;  4MMX B;  4ZXX L;  5CKM A;  3ENS A;  2WYJ B;  3P5B L;  1TLE A;  1IQI L;  2FLG A;  1F7E A;  5JW1 A;  1PRH A;  3DEM A;  2RNL A;  2BMG A;  4MMY B;  3FFG L;  2BOX A;  3ZYI B;  4OTJ A;  1JBU L;  3Q3K B;  1IGX A;  3EGF A;  1DX5 I;  1W8B L;  1MOX C;  3H5C B;  1CVW L;  5K0H B;  4ZHA B;  2P95 L;  1APQ A;  2W26 B;  4O1Z A;  1AUT L;  1N1I A;  3CS7 L;  1HRE A;  1ATE A;  1F0R B;  1NZI A;  2Y38 A;  4X8S L;  1ATD A;  1APO A;  1O5D L;  4RRW A;  5CKN A;  1F0S B;  4LMF A;  4Y6D B;  2BOU A;  2MGP A;  1IQM L;  1NT0 A;  1SZB A;  1HRF A;  1EPG A;  1FF7 A;  3V64 C;  3CEN L;  2DDU A;  1NQL B;  3N8W B;  3N8Y A;  4NA9 L;  2Y7Z B;  2BQ6 A;  5JBA E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...