3EGHA

Crystal structure of a complex between protein phosphatase 1 alpha (pp1), the pp1 binding and pdz domains of spinophilin and the small natural molecular toxin nodularin-r
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
total genus 107
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3eghA00
4M0VA 3K7VC 1T71A 1II7A 4KKZA 1WARA 1W24A 2A22A 4MOVA 2Z06A 3T1IA 1SU1A 3H67A 3JYFA 5JJTA 1Z2WA 2Q8UA 4FCXA 4DSYA 3LL8A 3GVEA 2USHA 4H2IA 5JPFA 3KBPA 2R17A 3CK2A 4UT3A 4UT3B 4O5GA 2P6BA 2WDDA 4FBWA 3P71C 3TGHA 2HY1A 4I5NC 1V73A 2WDFA 3E7BA 1QFCA 2BCDA 4MP0A 3QG5C 4V0XA 3DSCA 3IB7A 4DT2A 4H1SA 5F3WA 2NYMC 2Z1AA 5EQVA 3H64A 4F0ZA 3K7WC 4LU9A 2NPPC 4H2FA 4ORBA 4DHLA 2XMOA 3H62B 4JA9A 2O8AA 4H2GA 1TCOA 3QFOA 2WDEA 4OR9A 3THNA 2IE4C 3THOB 2IAEC 1S95A 3RL3A 5INBA 1UF3A 4HD0A 4V0VA 2JOGA 4MOYA 1S70A 4FBKA 4LTYA 4JA7A 4TUGA 2ZBMA 5GTUA 2BDXA 2GJUA 1HO5A 3H69A 2HYOA 3IVDA 1G5BA 1JK7A 3EGGA 4IYPC 4H1YP 3IB8A 1S3NA 3IVEA 1IT6A 1MF8A 2QJCA 1HP1A 2HYPA 2Z72A 3AV0A 4J6OA 4Q7FA 3RL5A 1OIEA 4WWLA 3DW8C 1XM7A 2NXFA 4XPNA 5JPEA 5C1VA 1UTEA 1U32A 3QFNA 4O24A 4V0WA 3H68A 4H2BA 3H63A 1FJMA 1NNWA 3C5WC 1WAO1 3N5UA 3FGAC 1QHWA 1S8EA 3E7AA 2AHDA 3ICFA 2WDCA 1USHA 2YVTA 5J28A 3H61A 4ZX2A 3ZU0A 4TUIA 1OI8A 2KKNA 2IE3C 4FBQA 5B8IA 4B2OA 5IOHA 1XZWA 3DSDA 1OIDA 2O8GA 5HPEA 1T70A 4ORCA 2CV9A 3V4YA 2DFJA 4I5LC 3C9FA 4LACC 3AUZA 4NZVA 2QFPA 2BQ8X 1Z2XA 4IL1A 3HVQA 4UT2A 4O4KA 2QFRA 4G9JA 4ZVZA 1HPUA 2NYLC 1AUIA 1S3LA 4KBPA 3PSOA 3PSNA 4O43A 4UWQA 3RQZA 3ZTVA 4YKEA 3H66A 1M63A 3EGHA 4ORAA 1KBPA 1S3MA 3H60A 3QFMA 3QFKA 5DNYA 3RL4A
chains in the Genus database with same CATH superfamily
4M0VA 3K7VC 1T71A 1II7A 4KKZA 1WARA 1W24A 2A22A 4MOVA 2Z06A 3T1IA 1SU1A 3H67A 3JYFA 5JJTA 1Z2WA 2Q8UA 4FCXA 4DSYA 3LL8A 3GVEA 2USHA 4H2IA 5JPFA 3KBPA 2R17A 3CK2A 4UT3A 4UT3B 4O5GA 2P6BA 2WDDA 4FBWA 3P71C 3TGHA 2HY1A 4I5NC 1V73A 2WDFA 2ZO9B 1QFCA 3E7BA 2BCDA 4MP0A 3QG5C 4V0XA 3DSCA 3IB7A 4DT2A 4H1SA 5F3WA 2NYMC 2Z1AA 5EQVA 3D03A 3H64A 4F0ZA 3K7WC 4LU9A 2NPPC 4H2FA 4ORBA 4DHLA 2XMOA 3H62B 4JA9A 2O8AA 4H2GA 1TCOA 3QFOA 2WDEA 4OR9A 3THNA 2IE4C 3THOB 2IAEC 1S95A 3RL3A 2DXLA 5INBA 1UF3A 4HD0A 4V0VA 2JOGA 4MOYA 1S70A 4FBKA 4LTYA 4JA7A 4TUGA 2ZBMA 5GTUA 2BDXA 2GJUA 1HO5A 3H69A 2HYOA 3IVDA 1G5BA 1JK7A 3EGGA 4IYPC 4H1YP 3IB8A 1S3NA 3IVEA 1IT6A 1MF8A 2QJCA 1HP1A 2HYPA 2Z72A 2ZOAA 3AV0A 4J6OA 4Q7FA 3RL5A 1OIEA 4WWLA 3DW8C 1XM7A 2NXFA 4XPNA 5JPEA 5C1VA 1UTEA 1U32A 3QFNA 4O24A 4V0WA 3H68A 4H2BA 3H63A 2YEQA 1FJMA 1NNWA 3C5WC 1WAO1 3N5UA 3FGAC 1QHWA 1S8EA 3E7AA 2AHDA 3ICFA 2WDCA 1USHA 2YVTA 5J28A 3H61A 4ZX2A 3ZU0A 4TUIA 1OI8A 2KKNA 2IE3C 4FBQA 5B8IA 4B2OA 5IOHA 1XZWA 3DSDA 1OIDA 2O8GA 5HPEA 1T70A 4ORCA 2CV9A 3E0JA 3V4YA 2DFJA 4I5LC 3C9FA 4LACC 3FLOA 3AUZA 4NZVA 2QFPA 2BQ8X 1Z2XA 4IL1A 3HVQA 4UT2A 4O4KA 2QFRA 4G9JA 4ZVZA 1HPUA 2NYLC 1AUIA 1S3LA 4KBPA 3PSOA 3PSNA 4O43A 4UWQA 3RQZA 3ZTVA 4YKEA 3H66A 1M63A 3EGHA 4ORAA 1KBPA 1S3MA 3H60A 3QFMA 3QFKA 5DNYA 3RL4A 2DXNA
chains in the Genus database with same CATH topology
4M0VA 3K7VC 1T71A 1II7A 4KKZA 1WARA 1W24A 2A22A 4MOVA 2Z06A 3T1IA 1SU1A 3H67A 3JYFA 5JJTA 1Z2WA 2Q8UA 4FCXA 4DSYA 3LL8A 3GVEA 2USHA 4H2IA 5JPFA 3KBPA 2R17A 3CK2A 4UT3A 4UT3B 4O5GA 2P6BA 2WDDA 4FBWA 3P71C 3TGHA 2HY1A 4I5NC 1V73A 2WDFA 2ZO9B 1QFCA 3E7BA 2BCDA 4MP0A 3QG5C 4V0XA 3DSCA 3IB7A 4DT2A 4H1SA 5F3WA 2NYMC 2Z1AA 5EQVA 3D03A 3H64A 4F0ZA 3K7WC 4LU9A 2NPPC 4H2FA 4ORBA 4DHLA 2XMOA 3H62B 4JA9A 2O8AA 4H2GA 1TCOA 3QFOA 2WDEA 4OR9A 3THNA 2IE4C 3THOB 2IAEC 1S95A 3RL3A 2DXLA 5INBA 1UF3A 4HD0A 4V0VA 2JOGA 4MOYA 1S70A 4FBKA 4LTYA 4JA7A 4TUGA 2ZBMA 5GTUA 2BDXA 2GJUA 1HO5A 3H69A 2HYOA 3IVDA 1G5BA 1JK7A 3EGGA 4IYPC 4H1YP 3IB8A 1S3NA 3IVEA 1IT6A 1MF8A 2QJCA 1HP1A 2HYPA 2Z72A 2ZOAA 3AV0A 4J6OA 4Q7FA 3RL5A 1OIEA 4WWLA 3DW8C 1XM7A 2NXFA 4XPNA 5JPEA 5C1VA 1UTEA 1U32A 3QFNA 4O24A 4V0WA 3H68A 4H2BA 3H63A 2YEQA 1FJMA 1NNWA 3C5WC 1WAO1 3N5UA 3FGAC 1QHWA 1S8EA 3E7AA 2AHDA 3ICFA 2WDCA 1USHA 2YVTA 5J28A 3H61A 4ZX2A 3ZU0A 4TUIA 1OI8A 2KKNA 2IE3C 4FBQA 5B8IA 4B2OA 5IOHA 1XZWA 3DSDA 1OIDA 2O8GA 5HPEA 1T70A 4ORCA 2CV9A 3E0JA 3V4YA 2DFJA 4I5LC 3C9FA 4LACC 3FLOA 3AUZA 4NZVA 2QFPA 2BQ8X 1Z2XA 4IL1A 3HVQA 4UT2A 4O4KA 2QFRA 4G9JA 4ZVZA 1HPUA 2NYLC 1AUIA 1S3LA 4KBPA 3PSOA 3PSNA 4O43A 4UWQA 3RQZA 3ZTVA 4YKEA 3H66A 1M63A 3EGHA 4ORAA 1KBPA 1S3MA 3H60A 3QFMA 3QFKA 5DNYA 3RL4A 2DXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M0V A;  3K7V C;  1T71 A;  1II7 A;  4KKZ A;  1WAR A;  1W24 A;  2A22 A;  4MOV A;  2Z06 A;  3T1I A;  1SU1 A;  3H67 A;  3JYF A;  5JJT A;  1Z2W A;  2Q8U A;  4FCX A;  4DSY A;  3LL8 A;  3GVE A;  2USH A;  4H2I A;  5JPF A;  3KBP A;  2R17 A;  3CK2 A;  4UT3 A;  4UT3 B;  4O5G A;  2P6B A;  2WDD A;  4FBW A;  3P71 C;  3TGH A;  2HY1 A;  4I5N C;  1V73 A;  2WDF A;  3E7B A;  1QFC A;  2BCD A;  4MP0 A;  3QG5 C;  4V0X A;  3DSC A;  3IB7 A;  4DT2 A;  4H1S A;  5F3W A;  2NYM C;  2Z1A A;  5EQV A;  3H64 A;  4F0Z A;  3K7W C;  4LU9 A;  2NPP C;  4H2F A;  4ORB A;  4DHL A;  2XMO A;  3H62 B;  4JA9 A;  2O8A A;  4H2G A;  1TCO A;  3QFO A;  2WDE A;  4OR9 A;  3THN A;  2IE4 C;  3THO B;  2IAE C;  1S95 A;  3RL3 A;  5INB A;  1UF3 A;  4HD0 A;  4V0V A;  2JOG A;  4MOY A;  1S70 A;  4FBK A;  4LTY A;  4JA7 A;  4TUG A;  2ZBM A;  5GTU A;  2BDX A;  2GJU A;  1HO5 A;  3H69 A;  2HYO A;  3IVD A;  1G5B A;  1JK7 A;  3EGG A;  4IYP C;  4H1Y P;  3IB8 A;  1S3N A;  3IVE A;  1IT6 A;  1MF8 A;  2QJC A;  1HP1 A;  2HYP A;  2Z72 A;  3AV0 A;  4J6O A;  4Q7F A;  3RL5 A;  1OIE A;  4WWL A;  3DW8 C;  1XM7 A;  2NXF A;  4XPN A;  5JPE A;  5C1V A;  1UTE A;  1U32 A;  3QFN A;  4O24 A;  4V0W A;  3H68 A;  4H2B A;  3H63 A;  1FJM A;  1NNW A;  3C5W C;  1WAO 1;  3N5U A;  3FGA C;  1QHW A;  1S8E A;  3E7A A;  2AHD A;  3ICF A;  2WDC A;  1USH A;  2YVT A;  5J28 A;  3H61 A;  4ZX2 A;  3ZU0 A;  4TUI A;  1OI8 A;  2KKN A;  2IE3 C;  4FBQ A;  5B8I A;  4B2O A;  5IOH A;  1XZW A;  3DSD A;  1OID A;  2O8G A;  5HPE A;  1T70 A;  4ORC A;  2CV9 A;  3V4Y A;  2DFJ A;  4I5L C;  3C9F A;  4LAC C;  3AUZ A;  4NZV A;  2QFP A;  2BQ8 X;  1Z2X A;  4IL1 A;  3HVQ A;  4UT2 A;  4O4K A;  2QFR A;  4G9J A;  4ZVZ A;  1HPU A;  2NYL C;  1AUI A;  1S3L A;  4KBP A;  3PSO A;  3PSN A;  4O43 A;  4UWQ A;  3RQZ A;  3ZTV A;  4YKE A;  3H66 A;  1M63 A;  3EGH A;  4ORA A;  1KBP A;  1S3M A;  3H60 A;  3QFM A;  3QFK A;  5DNY A;  3RL4 A; 
#chains in the Genus database with same CATH topology
 4M0V A;  3K7V C;  1T71 A;  1II7 A;  4KKZ A;  1WAR A;  1W24 A;  2A22 A;  4MOV A;  2Z06 A;  3T1I A;  1SU1 A;  3H67 A;  3JYF A;  5JJT A;  1Z2W A;  2Q8U A;  4FCX A;  4DSY A;  3LL8 A;  3GVE A;  2USH A;  4H2I A;  5JPF A;  3KBP A;  2R17 A;  3CK2 A;  4UT3 A;  4UT3 B;  4O5G A;  2P6B A;  2WDD A;  4FBW A;  3P71 C;  3TGH A;  2HY1 A;  4I5N C;  1V73 A;  2WDF A;  2ZO9 B;  1QFC A;  3E7B A;  2BCD A;  4MP0 A;  3QG5 C;  4V0X A;  3DSC A;  3IB7 A;  4DT2 A;  4H1S A;  5F3W A;  2NYM C;  2Z1A A;  5EQV A;  3D03 A;  3H64 A;  4F0Z A;  3K7W C;  4LU9 A;  2NPP C;  4H2F A;  4ORB A;  4DHL A;  2XMO A;  3H62 B;  4JA9 A;  2O8A A;  4H2G A;  1TCO A;  3QFO A;  2WDE A;  4OR9 A;  3THN A;  2IE4 C;  3THO B;  2IAE C;  1S95 A;  3RL3 A;  2DXL A;  5INB A;  1UF3 A;  4HD0 A;  4V0V A;  2JOG A;  4MOY A;  1S70 A;  4FBK A;  4LTY A;  4JA7 A;  4TUG A;  2ZBM A;  5GTU A;  2BDX A;  2GJU A;  1HO5 A;  3H69 A;  2HYO A;  3IVD A;  1G5B A;  1JK7 A;  3EGG A;  4IYP C;  4H1Y P;  3IB8 A;  1S3N A;  3IVE A;  1IT6 A;  1MF8 A;  2QJC A;  1HP1 A;  2HYP A;  2Z72 A;  2ZOA A;  3AV0 A;  4J6O A;  4Q7F A;  3RL5 A;  1OIE A;  4WWL A;  3DW8 C;  1XM7 A;  2NXF A;  4XPN A;  5JPE A;  5C1V A;  1UTE A;  1U32 A;  3QFN A;  4O24 A;  4V0W A;  3H68 A;  4H2B A;  3H63 A;  2YEQ A;  1FJM A;  1NNW A;  3C5W C;  1WAO 1;  3N5U A;  3FGA C;  1QHW A;  1S8E A;  3E7A A;  2AHD A;  3ICF A;  2WDC A;  1USH A;  2YVT A;  5J28 A;  3H61 A;  4ZX2 A;  3ZU0 A;  4TUI A;  1OI8 A;  2KKN A;  2IE3 C;  4FBQ A;  5B8I A;  4B2O A;  5IOH A;  1XZW A;  3DSD A;  1OID A;  2O8G A;  5HPE A;  1T70 A;  4ORC A;  2CV9 A;  3E0J A;  3V4Y A;  2DFJ A;  4I5L C;  3C9F A;  4LAC C;  3FLO A;  3AUZ A;  4NZV A;  2QFP A;  2BQ8 X;  1Z2X A;  4IL1 A;  3HVQ A;  4UT2 A;  4O4K A;  2QFR A;  4G9J A;  4ZVZ A;  1HPU A;  2NYL C;  1AUI A;  1S3L A;  4KBP A;  3PSO A;  3PSN A;  4O43 A;  4UWQ A;  3RQZ A;  3ZTV A;  4YKE A;  3H66 A;  1M63 A;  3EGH A;  4ORA A;  1KBP A;  1S3M A;  3H60 A;  3QFM A;  3QFK A;  5DNY A;  3RL4 A;  2DXN A; 
#chains in the Genus database with same CATH homology
 4M0V A;  3K7V C;  1T71 A;  1II7 A;  4KKZ A;  1WAR A;  1W24 A;  2A22 A;  4MOV A;  2Z06 A;  3T1I A;  1SU1 A;  3H67 A;  3JYF A;  5JJT A;  1Z2W A;  2Q8U A;  4FCX A;  4DSY A;  3LL8 A;  3GVE A;  2USH A;  4H2I A;  5JPF A;  3KBP A;  2R17 A;  3CK2 A;  4UT3 A;  4UT3 B;  4O5G A;  2P6B A;  2WDD A;  4FBW A;  3P71 C;  3TGH A;  2HY1 A;  4I5N C;  1V73 A;  2WDF A;  2ZO9 B;  1QFC A;  3E7B A;  2BCD A;  4MP0 A;  3QG5 C;  4V0X A;  3DSC A;  3IB7 A;  4DT2 A;  4H1S A;  5F3W A;  2NYM C;  2Z1A A;  5EQV A;  3D03 A;  3H64 A;  4F0Z A;  3K7W C;  4LU9 A;  2NPP C;  4H2F A;  4ORB A;  4DHL A;  2XMO A;  3H62 B;  4JA9 A;  2O8A A;  4H2G A;  1TCO A;  3QFO A;  2WDE A;  4OR9 A;  3THN A;  2IE4 C;  3THO B;  2IAE C;  1S95 A;  3RL3 A;  2DXL A;  5INB A;  1UF3 A;  4HD0 A;  4V0V A;  2JOG A;  4MOY A;  1S70 A;  4FBK A;  4LTY A;  4JA7 A;  4TUG A;  2ZBM A;  5GTU A;  2BDX A;  2GJU A;  1HO5 A;  3H69 A;  2HYO A;  3IVD A;  1G5B A;  1JK7 A;  3EGG A;  4IYP C;  4H1Y P;  3IB8 A;  1S3N A;  3IVE A;  1IT6 A;  1MF8 A;  2QJC A;  1HP1 A;  2HYP A;  2Z72 A;  2ZOA A;  3AV0 A;  4J6O A;  4Q7F A;  3RL5 A;  1OIE A;  4WWL A;  3DW8 C;  1XM7 A;  2NXF A;  4XPN A;  5JPE A;  5C1V A;  1UTE A;  1U32 A;  3QFN A;  4O24 A;  4V0W A;  3H68 A;  4H2B A;  3H63 A;  2YEQ A;  1FJM A;  1NNW A;  3C5W C;  1WAO 1;  3N5U A;  3FGA C;  1QHW A;  1S8E A;  3E7A A;  2AHD A;  3ICF A;  2WDC A;  1USH A;  2YVT A;  5J28 A;  3H61 A;  4ZX2 A;  3ZU0 A;  4TUI A;  1OI8 A;  2KKN A;  2IE3 C;  4FBQ A;  5B8I A;  4B2O A;  5IOH A;  1XZW A;  3DSD A;  1OID A;  2O8G A;  5HPE A;  1T70 A;  4ORC A;  2CV9 A;  3E0J A;  3V4Y A;  2DFJ A;  4I5L C;  3C9F A;  4LAC C;  3FLO A;  3AUZ A;  4NZV A;  2QFP A;  2BQ8 X;  1Z2X A;  4IL1 A;  3HVQ A;  4UT2 A;  4O4K A;  2QFR A;  4G9J A;  4ZVZ A;  1HPU A;  2NYL C;  1AUI A;  1S3L A;  4KBP A;  3PSO A;  3PSN A;  4O43 A;  4UWQ A;  3RQZ A;  3ZTV A;  4YKE A;  3H66 A;  1M63 A;  3EGH A;  4ORA A;  1KBP A;  1S3M A;  3H60 A;  3QFM A;  3QFK A;  5DNY A;  3RL4 A;  2DXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...