3EGHA

Crystal structure of a complex between protein phosphatase 1 alpha (pp1), the pp1 binding and pdz domains of spinophilin and the small natural molecular toxin nodularin-r
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
total genus 107
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3eghA00
2NXFA 1FJMA 3DSCA 5C1VA 1T71A 3C9FA 1V73A 2IE3C 1MF8A 3E7AA 3P71C 4UT3B 4FBQA 2QFPA 2QJCA 1T70A 4F0ZA 1M63A 1JK7A 2BQ8X 2YVTA 3RL3A 2WDCA 4O43A 2Z72A 4UWQA 2ZBMA 4H1YP 3GVEA 4I5LC 3AV0A 4FCXA 3QG5C 4Q7FA 4J6OA 2JOGA 4G9JA 4O4KA 5EQVA 1USHA 3H62B 2HYPA 2BDXA 1Z2XA 3H60A 1S8EA 4DHLA 3EGGA 4MOYA 2Q8UA 1Z2WA 2HYOA 4LTYA 3LL8A 3PSOA 4LACC 5HPEA 4I5NC 2USHA 3EGHA 4TUGA 4TUIA 1HO5A 2Z1AA 5GTUA 3H67A 2Z06A 4FBWA 1NNWA 3H66A 4MOVA 3K7WC 2NYLC 4ZX2A 2QFRA 3AUZA 4JA9A 4XPNA 3ZU0A 1UTEA 3IVEA 3C5WC 4ORAA 3IB7A 1S3LA 2IE4C 3T1IA 1U32A 2A22A 4H2GA 3RL4A 1QFCA 2GJUA 4H2FA 1TCOA 2KKNA 3K7VC 4KKZA 2O8GA 1II7A 4H1SA 2NYMC 1OIDA 2BCDA 4OR9A 3THNA 3H64A 4ORCA 3CK2A 3THOB 4ORBA 1AUIA 2WDFA 1WARA 3RL5A 1OIEA 3ICFA 4H2BA 3QFKA 1XM7A 3FGAC 4MP0A 4LU9A 2DFJA 4ZVZA 4B2OA 4O24A 1HPUA 3HVQA 4UT3A 1XZWA 2NPPC 4WWLA 1W24A 5INBA 1OI8A 1WAO1 2R17A 3ZTVA 5IOHA 1S70A 3E7BA 3JYFA 2P6BA 4V0WA 4HD0A 3DW8C 1G5BA 3N5UA 2AHDA 4O5GA 1QHWA 3TGHA 4DSYA 1S95A 5JPEA 4V0VA 2O8AA 4H2IA 1KBPA 3H69A 3PSNA 2HY1A 5JPFA 3H61A 3QFOA 1SU1A 4UT2A 4FBKA 2WDEA 5JJTA 3H63A 1S3NA 4YKEA 2CV9A 1UF3A 4NZVA 3QFMA 5DNYA 3DSDA 5F3WA 3IVDA 4IL1A 4V0XA 4JA7A 4M0VA 2XMOA 1S3MA 4IYPC 2WDDA 3V4YA 3KBPA 3QFNA 5B8IA 4KBPA 1HP1A 1IT6A 3RQZA 2IAEC 5J28A 3H68A 3IB8A 4DT2A
chains in the Genus database with same CATH superfamily
2NXFA 1FJMA 2DXNA 3DSCA 5C1VA 1T71A 1V73A 2IE3C 3C9FA 1MF8A 3E7AA 3P71C 4UT3B 4FBQA 2QFPA 2QJCA 1T70A 4F0ZA 1M63A 1JK7A 2BQ8X 2YVTA 3RL3A 2WDCA 4O43A 2Z72A 4UWQA 2ZBMA 4H1YP 3GVEA 4I5LC 3AV0A 4FCXA 3QG5C 4Q7FA 4J6OA 2JOGA 4G9JA 4O4KA 5EQVA 1USHA 3H62B 2HYPA 2BDXA 1Z2XA 3H60A 1S8EA 4DHLA 3EGGA 4MOYA 2DXLA 2Q8UA 1Z2WA 2HYOA 4LTYA 3LL8A 3PSOA 4LACC 5HPEA 4I5NC 2USHA 3EGHA 3E0JA 4TUGA 4TUIA 1HO5A 2Z1AA 5GTUA 3H67A 2Z06A 3FLOA 4FBWA 1NNWA 2ZOAA 3H66A 4MOVA 3K7WC 2NYLC 4ZX2A 2QFRA 3AUZA 4JA9A 4XPNA 3ZU0A 1UTEA 3IVEA 3C5WC 4ORAA 3IB7A 1S3LA 2IE4C 3T1IA 1U32A 2A22A 4H2GA 3RL4A 1QFCA 2GJUA 4H2FA 1TCOA 2KKNA 3K7VC 4KKZA 2O8GA 1II7A 4H1SA 2NYMC 1OIDA 2BCDA 4OR9A 3THNA 3H64A 4ORCA 3CK2A 3THOB 4ORBA 1AUIA 2WDFA 1WARA 3RL5A 1OIEA 3ICFA 4H2BA 3QFKA 1XM7A 3FGAC 4MP0A 4LU9A 2DFJA 4ZVZA 4B2OA 4O24A 1HPUA 3D03A 3HVQA 4UT3A 1XZWA 2NPPC 4WWLA 1W24A 5INBA 1OI8A 1WAO1 2R17A 3ZTVA 5IOHA 1S70A 3E7BA 3JYFA 2YEQA 2P6BA 4V0WA 4HD0A 3DW8C 1G5BA 3N5UA 2AHDA 4O5GA 1QHWA 3TGHA 4DSYA 1S95A 5JPEA 4V0VA 2O8AA 4H2IA 1KBPA 3H69A 3PSNA 2HY1A 5JPFA 3H61A 3QFOA 1SU1A 4UT2A 4FBKA 2WDEA 5JJTA 3H63A 1S3NA 4YKEA 2CV9A 1UF3A 4NZVA 3QFMA 5DNYA 3DSDA 5F3WA 3IVDA 4IL1A 4V0XA 4JA7A 4M0VA 2XMOA 1S3MA 4IYPC 2WDDA 3V4YA 3KBPA 3QFNA 5B8IA 4KBPA 1HP1A 1IT6A 3RQZA 2IAEC 5J28A 3H68A 2ZO9B 3IB8A 4DT2A
chains in the Genus database with same CATH topology
2NXFA 1FJMA 2DXNA 3DSCA 5C1VA 1T71A 1V73A 2IE3C 3C9FA 1MF8A 3E7AA 3P71C 4UT3B 4FBQA 2QFPA 2QJCA 1T70A 4F0ZA 1M63A 1JK7A 2BQ8X 2YVTA 3RL3A 2WDCA 4O43A 2Z72A 4UWQA 2ZBMA 4H1YP 3GVEA 4I5LC 3AV0A 4FCXA 3QG5C 4Q7FA 4J6OA 2JOGA 4G9JA 4O4KA 5EQVA 1USHA 3H62B 2HYPA 2BDXA 1Z2XA 3H60A 1S8EA 4DHLA 3EGGA 4MOYA 2DXLA 2Q8UA 1Z2WA 2HYOA 4LTYA 3LL8A 3PSOA 4LACC 5HPEA 4I5NC 2USHA 3EGHA 3E0JA 4TUGA 4TUIA 1HO5A 2Z1AA 5GTUA 3H67A 2Z06A 3FLOA 4FBWA 1NNWA 2ZOAA 3H66A 4MOVA 3K7WC 2NYLC 4ZX2A 2QFRA 3AUZA 4JA9A 4XPNA 3ZU0A 1UTEA 3IVEA 3C5WC 4ORAA 3IB7A 1S3LA 2IE4C 3T1IA 1U32A 2A22A 4H2GA 3RL4A 1QFCA 2GJUA 4H2FA 1TCOA 2KKNA 3K7VC 4KKZA 2O8GA 1II7A 4H1SA 2NYMC 1OIDA 2BCDA 4OR9A 3THNA 3H64A 4ORCA 3CK2A 3THOB 4ORBA 1AUIA 2WDFA 1WARA 3RL5A 1OIEA 3ICFA 4H2BA 3QFKA 1XM7A 3FGAC 4MP0A 4LU9A 2DFJA 4ZVZA 4B2OA 4O24A 1HPUA 3D03A 3HVQA 4UT3A 1XZWA 2NPPC 4WWLA 1W24A 5INBA 1OI8A 1WAO1 2R17A 3ZTVA 5IOHA 1S70A 3E7BA 3JYFA 2YEQA 2P6BA 4V0WA 4HD0A 3DW8C 1G5BA 3N5UA 2AHDA 4O5GA 1QHWA 3TGHA 4DSYA 1S95A 5JPEA 4V0VA 2O8AA 4H2IA 1KBPA 3H69A 3PSNA 2HY1A 5JPFA 3H61A 3QFOA 1SU1A 4UT2A 4FBKA 2WDEA 5JJTA 3H63A 1S3NA 4YKEA 2CV9A 1UF3A 4NZVA 3QFMA 5DNYA 3DSDA 5F3WA 3IVDA 4IL1A 4V0XA 4JA7A 4M0VA 2XMOA 1S3MA 4IYPC 2WDDA 3V4YA 3KBPA 3QFNA 5B8IA 4KBPA 1HP1A 1IT6A 3RQZA 2IAEC 5J28A 3H68A 2ZO9B 3IB8A 4DT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXF A;  1FJM A;  3DSC A;  5C1V A;  1T71 A;  3C9F A;  1V73 A;  2IE3 C;  1MF8 A;  3E7A A;  3P71 C;  4UT3 B;  4FBQ A;  2QFP A;  2QJC A;  1T70 A;  4F0Z A;  1M63 A;  1JK7 A;  2BQ8 X;  2YVT A;  3RL3 A;  2WDC A;  4O43 A;  2Z72 A;  4UWQ A;  2ZBM A;  4H1Y P;  3GVE A;  4I5L C;  3AV0 A;  4FCX A;  3QG5 C;  4Q7F A;  4J6O A;  2JOG A;  4G9J A;  4O4K A;  5EQV A;  1USH A;  3H62 B;  2HYP A;  2BDX A;  1Z2X A;  3H60 A;  1S8E A;  4DHL A;  3EGG A;  4MOY A;  2Q8U A;  1Z2W A;  2HYO A;  4LTY A;  3LL8 A;  3PSO A;  4LAC C;  5HPE A;  4I5N C;  2USH A;  3EGH A;  4TUG A;  4TUI A;  1HO5 A;  2Z1A A;  5GTU A;  3H67 A;  2Z06 A;  4FBW A;  1NNW A;  3H66 A;  4MOV A;  3K7W C;  2NYL C;  4ZX2 A;  2QFR A;  3AUZ A;  4JA9 A;  4XPN A;  3ZU0 A;  1UTE A;  3IVE A;  3C5W C;  4ORA A;  3IB7 A;  1S3L A;  2IE4 C;  3T1I A;  1U32 A;  2A22 A;  4H2G A;  3RL4 A;  1QFC A;  2GJU A;  4H2F A;  1TCO A;  2KKN A;  3K7V C;  4KKZ A;  2O8G A;  1II7 A;  4H1S A;  2NYM C;  1OID A;  2BCD A;  4OR9 A;  3THN A;  3H64 A;  4ORC A;  3CK2 A;  3THO B;  4ORB A;  1AUI A;  2WDF A;  1WAR A;  3RL5 A;  1OIE A;  3ICF A;  4H2B A;  3QFK A;  1XM7 A;  3FGA C;  4MP0 A;  4LU9 A;  2DFJ A;  4ZVZ A;  4B2O A;  4O24 A;  1HPU A;  3HVQ A;  4UT3 A;  1XZW A;  2NPP C;  4WWL A;  1W24 A;  5INB A;  1OI8 A;  1WAO 1;  2R17 A;  3ZTV A;  5IOH A;  1S70 A;  3E7B A;  3JYF A;  2P6B A;  4V0W A;  4HD0 A;  3DW8 C;  1G5B A;  3N5U A;  2AHD A;  4O5G A;  1QHW A;  3TGH A;  4DSY A;  1S95 A;  5JPE A;  4V0V A;  2O8A A;  4H2I A;  1KBP A;  3H69 A;  3PSN A;  2HY1 A;  5JPF A;  3H61 A;  3QFO A;  1SU1 A;  4UT2 A;  4FBK A;  2WDE A;  5JJT A;  3H63 A;  1S3N A;  4YKE A;  2CV9 A;  1UF3 A;  4NZV A;  3QFM A;  5DNY A;  3DSD A;  5F3W A;  3IVD A;  4IL1 A;  4V0X A;  4JA7 A;  4M0V A;  2XMO A;  1S3M A;  4IYP C;  2WDD A;  3V4Y A;  3KBP A;  3QFN A;  5B8I A;  4KBP A;  1HP1 A;  1IT6 A;  3RQZ A;  2IAE C;  5J28 A;  3H68 A;  3IB8 A;  4DT2 A; 
#chains in the Genus database with same CATH topology
 2NXF A;  1FJM A;  2DXN A;  3DSC A;  5C1V A;  1T71 A;  1V73 A;  2IE3 C;  3C9F A;  1MF8 A;  3E7A A;  3P71 C;  4UT3 B;  4FBQ A;  2QFP A;  2QJC A;  1T70 A;  4F0Z A;  1M63 A;  1JK7 A;  2BQ8 X;  2YVT A;  3RL3 A;  2WDC A;  4O43 A;  2Z72 A;  4UWQ A;  2ZBM A;  4H1Y P;  3GVE A;  4I5L C;  3AV0 A;  4FCX A;  3QG5 C;  4Q7F A;  4J6O A;  2JOG A;  4G9J A;  4O4K A;  5EQV A;  1USH A;  3H62 B;  2HYP A;  2BDX A;  1Z2X A;  3H60 A;  1S8E A;  4DHL A;  3EGG A;  4MOY A;  2DXL A;  2Q8U A;  1Z2W A;  2HYO A;  4LTY A;  3LL8 A;  3PSO A;  4LAC C;  5HPE A;  4I5N C;  2USH A;  3EGH A;  3E0J A;  4TUG A;  4TUI A;  1HO5 A;  2Z1A A;  5GTU A;  3H67 A;  2Z06 A;  3FLO A;  4FBW A;  1NNW A;  2ZOA A;  3H66 A;  4MOV A;  3K7W C;  2NYL C;  4ZX2 A;  2QFR A;  3AUZ A;  4JA9 A;  4XPN A;  3ZU0 A;  1UTE A;  3IVE A;  3C5W C;  4ORA A;  3IB7 A;  1S3L A;  2IE4 C;  3T1I A;  1U32 A;  2A22 A;  4H2G A;  3RL4 A;  1QFC A;  2GJU A;  4H2F A;  1TCO A;  2KKN A;  3K7V C;  4KKZ A;  2O8G A;  1II7 A;  4H1S A;  2NYM C;  1OID A;  2BCD A;  4OR9 A;  3THN A;  3H64 A;  4ORC A;  3CK2 A;  3THO B;  4ORB A;  1AUI A;  2WDF A;  1WAR A;  3RL5 A;  1OIE A;  3ICF A;  4H2B A;  3QFK A;  1XM7 A;  3FGA C;  4MP0 A;  4LU9 A;  2DFJ A;  4ZVZ A;  4B2O A;  4O24 A;  1HPU A;  3D03 A;  3HVQ A;  4UT3 A;  1XZW A;  2NPP C;  4WWL A;  1W24 A;  5INB A;  1OI8 A;  1WAO 1;  2R17 A;  3ZTV A;  5IOH A;  1S70 A;  3E7B A;  3JYF A;  2YEQ A;  2P6B A;  4V0W A;  4HD0 A;  3DW8 C;  1G5B A;  3N5U A;  2AHD A;  4O5G A;  1QHW A;  3TGH A;  4DSY A;  1S95 A;  5JPE A;  4V0V A;  2O8A A;  4H2I A;  1KBP A;  3H69 A;  3PSN A;  2HY1 A;  5JPF A;  3H61 A;  3QFO A;  1SU1 A;  4UT2 A;  4FBK A;  2WDE A;  5JJT A;  3H63 A;  1S3N A;  4YKE A;  2CV9 A;  1UF3 A;  4NZV A;  3QFM A;  5DNY A;  3DSD A;  5F3W A;  3IVD A;  4IL1 A;  4V0X A;  4JA7 A;  4M0V A;  2XMO A;  1S3M A;  4IYP C;  2WDD A;  3V4Y A;  3KBP A;  3QFN A;  5B8I A;  4KBP A;  1HP1 A;  1IT6 A;  3RQZ A;  2IAE C;  5J28 A;  3H68 A;  2ZO9 B;  3IB8 A;  4DT2 A; 
#chains in the Genus database with same CATH homology
 2NXF A;  1FJM A;  2DXN A;  3DSC A;  5C1V A;  1T71 A;  1V73 A;  2IE3 C;  3C9F A;  1MF8 A;  3E7A A;  3P71 C;  4UT3 B;  4FBQ A;  2QFP A;  2QJC A;  1T70 A;  4F0Z A;  1M63 A;  1JK7 A;  2BQ8 X;  2YVT A;  3RL3 A;  2WDC A;  4O43 A;  2Z72 A;  4UWQ A;  2ZBM A;  4H1Y P;  3GVE A;  4I5L C;  3AV0 A;  4FCX A;  3QG5 C;  4Q7F A;  4J6O A;  2JOG A;  4G9J A;  4O4K A;  5EQV A;  1USH A;  3H62 B;  2HYP A;  2BDX A;  1Z2X A;  3H60 A;  1S8E A;  4DHL A;  3EGG A;  4MOY A;  2DXL A;  2Q8U A;  1Z2W A;  2HYO A;  4LTY A;  3LL8 A;  3PSO A;  4LAC C;  5HPE A;  4I5N C;  2USH A;  3EGH A;  3E0J A;  4TUG A;  4TUI A;  1HO5 A;  2Z1A A;  5GTU A;  3H67 A;  2Z06 A;  3FLO A;  4FBW A;  1NNW A;  2ZOA A;  3H66 A;  4MOV A;  3K7W C;  2NYL C;  4ZX2 A;  2QFR A;  3AUZ A;  4JA9 A;  4XPN A;  3ZU0 A;  1UTE A;  3IVE A;  3C5W C;  4ORA A;  3IB7 A;  1S3L A;  2IE4 C;  3T1I A;  1U32 A;  2A22 A;  4H2G A;  3RL4 A;  1QFC A;  2GJU A;  4H2F A;  1TCO A;  2KKN A;  3K7V C;  4KKZ A;  2O8G A;  1II7 A;  4H1S A;  2NYM C;  1OID A;  2BCD A;  4OR9 A;  3THN A;  3H64 A;  4ORC A;  3CK2 A;  3THO B;  4ORB A;  1AUI A;  2WDF A;  1WAR A;  3RL5 A;  1OIE A;  3ICF A;  4H2B A;  3QFK A;  1XM7 A;  3FGA C;  4MP0 A;  4LU9 A;  2DFJ A;  4ZVZ A;  4B2O A;  4O24 A;  1HPU A;  3D03 A;  3HVQ A;  4UT3 A;  1XZW A;  2NPP C;  4WWL A;  1W24 A;  5INB A;  1OI8 A;  1WAO 1;  2R17 A;  3ZTV A;  5IOH A;  1S70 A;  3E7B A;  3JYF A;  2YEQ A;  2P6B A;  4V0W A;  4HD0 A;  3DW8 C;  1G5B A;  3N5U A;  2AHD A;  4O5G A;  1QHW A;  3TGH A;  4DSY A;  1S95 A;  5JPE A;  4V0V A;  2O8A A;  4H2I A;  1KBP A;  3H69 A;  3PSN A;  2HY1 A;  5JPF A;  3H61 A;  3QFO A;  1SU1 A;  4UT2 A;  4FBK A;  2WDE A;  5JJT A;  3H63 A;  1S3N A;  4YKE A;  2CV9 A;  1UF3 A;  4NZV A;  3QFM A;  5DNY A;  3DSD A;  5F3W A;  3IVD A;  4IL1 A;  4V0X A;  4JA7 A;  4M0V A;  2XMO A;  1S3M A;  4IYP C;  2WDD A;  3V4Y A;  3KBP A;  3QFN A;  5B8I A;  4KBP A;  1HP1 A;  1IT6 A;  3RQZ A;  2IAE C;  5J28 A;  3H68 A;  2ZO9 B;  3IB8 A;  4DT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...