3EGHA

Crystal structure of a complex between protein phosphatase 1 alpha (pp1), the pp1 binding and pdz domains of spinophilin and the small natural molecular toxin nodularin-r
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 107
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3eghA00
3PSNA 1U32A 2BQ8X 5GTUA 5JPFA 2Q8UA 3CK2A 3E7BA 3HVQA 4DSYA 4ORAA 3IB8A 4ZX2A 1QHWA 1OIEA 1WAO1 4H2FA 3IB7A 1Z2WA 2BDXA 1QFCA 1OI8A 2BCDA 3ICFA 4V0VA 3V4YA 2HYOA 3H62B 3H68A 4UT2A 3ZU0A 2HYPA 5INBA 5EQVA 2QJCA 1HPUA 4DT2A 1WARA 1II7A 4DHLA 3H66A 3DSCA 4ORBA 3KBPA 2QFRA 3AUZA 2R17A 1S3NA 3EGHA 3H63A 3PSOA 3DW8C 4KBPA 2HY1A 4IL1A 3N5UA 2NPPC 3TGHA 5DNYA 4Q7FA 1MF8A 4G9JA 2KKNA 4O43A 4H1YP 3LL8A 4ZVZA 2WDFA 4H2GA 4F0ZA 3QFNA 3P71C 4XPNA 3QFMA 4FCXA 2USHA 4UT3A 1T70A 5HPEA 3C9FA 4LTYA 4JA7A 4UT3B 4TUGA 4I5LC 1Z2XA 3C5WC 2NXFA 4FBWA 2O8GA 4B2OA 4M0VA 4O24A 1S95A 2IAEC 3RQZA 1T71A 1USHA 4H2IA 3RL5A 4TUIA 2IE4C 2O8AA 1OIDA 1HO5A 1JK7A 3IVDA 5B8IA 5JPEA 2Z72A 4LACC 3JYFA 2GJUA 3THNA 5IOHA 1S70A 2YVTA 4FBKA 4UWQA 2Z1AA 4MP0A 2WDCA 3RL4A 3RL3A 4V0WA 1W24A 1UTEA 2WDDA 2DFJA 3FGAC 1NNWA 4MOYA 3AV0A 2ZBMA 1M63A 4JA9A 4KKZA 2P6BA 3H64A 4H2BA 3ZTVA 1FJMA 1V73A 5JJTA 1AUIA 2QFPA 3H69A 4WWLA 4I5NC 3GVEA 2JOGA 1HP1A 4FBQA 3EGGA 3K7WC 2NYMC 2A22A 3QFOA 1XM7A 4V0XA 1IT6A 3DSDA 4J6OA 3QFKA 4YKEA 1S3LA 1TCOA 2CV9A 3E7AA 3H67A 4HD0A 4O5GA 5C1VA 3H61A 2NYLC 2Z06A 3T1IA 1G5BA 5J28A 1XZWA 1S8EA 1SU1A 4IYPC 4NZVA 4MOVA 4H1SA 2IE3C 4ORCA 3THOB 1S3MA 3IVEA 1UF3A 4O4KA 4LU9A 2AHDA 5F3WA 4OR9A 3QG5C 2WDEA 2XMOA 3K7VC 3H60A 1KBPA
chains in the Genus database with same CATH superfamily
3PSNA 1U32A 2BQ8X 5GTUA 5JPFA 2Q8UA 3CK2A 3E7BA 3HVQA 4DSYA 4ORAA 2DXLA 3IB8A 4ZX2A 1QHWA 1OIEA 1WAO1 4H2FA 3IB7A 1Z2WA 2BDXA 1QFCA 1OI8A 2BCDA 3ICFA 4V0VA 3V4YA 2HYOA 3H62B 3H68A 4UT2A 3ZU0A 2HYPA 5INBA 5EQVA 2QJCA 1HPUA 4DT2A 1WARA 1II7A 4DHLA 3H66A 3DSCA 4ORBA 3KBPA 2QFRA 3AUZA 2R17A 1S3NA 3EGHA 3H63A 3PSOA 3DW8C 4KBPA 2HY1A 4IL1A 3N5UA 2NPPC 3TGHA 5DNYA 4Q7FA 1MF8A 4G9JA 2KKNA 4O43A 4H1YP 3LL8A 4ZVZA 2WDFA 4H2GA 4F0ZA 3QFNA 3P71C 4XPNA 3QFMA 4FCXA 2USHA 4UT3A 1T70A 5HPEA 3C9FA 4LTYA 4JA7A 4UT3B 4TUGA 4I5LC 1Z2XA 3C5WC 2NXFA 4FBWA 2O8GA 4B2OA 4M0VA 4O24A 1S95A 2IAEC 2ZOAA 3RQZA 1T71A 1USHA 4H2IA 3RL5A 4TUIA 2IE4C 2O8AA 1OIDA 1HO5A 1JK7A 3IVDA 5B8IA 5JPEA 2Z72A 4LACC 3JYFA 2GJUA 3THNA 5IOHA 1S70A 2YVTA 4FBKA 4UWQA 2Z1AA 3FLOA 4MP0A 2WDCA 3RL4A 3RL3A 4V0WA 1W24A 1UTEA 2WDDA 3D03A 2ZO9B 2DFJA 2YEQA 3FGAC 1NNWA 4MOYA 3AV0A 2ZBMA 1M63A 4JA9A 4KKZA 2P6BA 3H64A 4H2BA 3ZTVA 1FJMA 1V73A 5JJTA 1AUIA 2QFPA 3H69A 4WWLA 4I5NC 3GVEA 2JOGA 1HP1A 4FBQA 3EGGA 3K7WC 2NYMC 2A22A 3QFOA 1XM7A 4V0XA 1IT6A 3DSDA 4J6OA 3QFKA 4YKEA 1S3LA 1TCOA 2CV9A 3E7AA 3H67A 4HD0A 4O5GA 5C1VA 3H61A 2NYLC 2DXNA 2Z06A 3T1IA 1G5BA 5J28A 1XZWA 1S8EA 1SU1A 4IYPC 4NZVA 4MOVA 4H1SA 2IE3C 4ORCA 3THOB 1S3MA 3IVEA 3E0JA 1UF3A 4O4KA 4LU9A 2AHDA 5F3WA 4OR9A 3QG5C 2WDEA 2XMOA 3K7VC 3H60A 1KBPA
chains in the Genus database with same CATH topology
3PSNA 1U32A 2BQ8X 5GTUA 5JPFA 2Q8UA 3CK2A 3E7BA 3HVQA 4DSYA 4ORAA 2DXLA 3IB8A 4ZX2A 1QHWA 1OIEA 1WAO1 4H2FA 3IB7A 1Z2WA 2BDXA 1QFCA 1OI8A 2BCDA 3ICFA 4V0VA 3V4YA 2HYOA 3H62B 3H68A 4UT2A 3ZU0A 2HYPA 5INBA 5EQVA 2QJCA 1HPUA 4DT2A 1WARA 1II7A 4DHLA 3H66A 3DSCA 4ORBA 3KBPA 2QFRA 3AUZA 2R17A 1S3NA 3EGHA 3H63A 3PSOA 3DW8C 4KBPA 2HY1A 4IL1A 3N5UA 2NPPC 3TGHA 5DNYA 4Q7FA 1MF8A 4G9JA 2KKNA 4O43A 4H1YP 3LL8A 4ZVZA 2WDFA 4H2GA 4F0ZA 3QFNA 3P71C 4XPNA 3QFMA 4FCXA 2USHA 4UT3A 1T70A 5HPEA 3C9FA 4LTYA 4JA7A 4UT3B 4TUGA 4I5LC 1Z2XA 3C5WC 2NXFA 4FBWA 2O8GA 4B2OA 4M0VA 4O24A 1S95A 2IAEC 2ZOAA 3RQZA 1T71A 1USHA 4H2IA 3RL5A 4TUIA 2IE4C 2O8AA 1OIDA 1HO5A 1JK7A 3IVDA 5B8IA 5JPEA 2Z72A 4LACC 3JYFA 2GJUA 3THNA 5IOHA 1S70A 2YVTA 4FBKA 4UWQA 2Z1AA 3FLOA 4MP0A 2WDCA 3RL4A 3RL3A 4V0WA 1W24A 1UTEA 2WDDA 3D03A 2ZO9B 2DFJA 2YEQA 3FGAC 1NNWA 4MOYA 3AV0A 2ZBMA 1M63A 4JA9A 4KKZA 2P6BA 3H64A 4H2BA 3ZTVA 1FJMA 1V73A 5JJTA 1AUIA 2QFPA 3H69A 4WWLA 4I5NC 3GVEA 2JOGA 1HP1A 4FBQA 3EGGA 3K7WC 2NYMC 2A22A 3QFOA 1XM7A 4V0XA 1IT6A 3DSDA 4J6OA 3QFKA 4YKEA 1S3LA 1TCOA 2CV9A 3E7AA 3H67A 4HD0A 4O5GA 5C1VA 3H61A 2NYLC 2DXNA 2Z06A 3T1IA 1G5BA 5J28A 1XZWA 1S8EA 1SU1A 4IYPC 4NZVA 4MOVA 4H1SA 2IE3C 4ORCA 3THOB 1S3MA 3IVEA 3E0JA 1UF3A 4O4KA 4LU9A 2AHDA 5F3WA 4OR9A 3QG5C 2WDEA 2XMOA 3K7VC 3H60A 1KBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSN A;  1U32 A;  2BQ8 X;  5GTU A;  5JPF A;  2Q8U A;  3CK2 A;  3E7B A;  3HVQ A;  4DSY A;  4ORA A;  3IB8 A;  4ZX2 A;  1QHW A;  1OIE A;  1WAO 1;  4H2F A;  3IB7 A;  1Z2W A;  2BDX A;  1QFC A;  1OI8 A;  2BCD A;  3ICF A;  4V0V A;  3V4Y A;  2HYO A;  3H62 B;  3H68 A;  4UT2 A;  3ZU0 A;  2HYP A;  5INB A;  5EQV A;  2QJC A;  1HPU A;  4DT2 A;  1WAR A;  1II7 A;  4DHL A;  3H66 A;  3DSC A;  4ORB A;  3KBP A;  2QFR A;  3AUZ A;  2R17 A;  1S3N A;  3EGH A;  3H63 A;  3PSO A;  3DW8 C;  4KBP A;  2HY1 A;  4IL1 A;  3N5U A;  2NPP C;  3TGH A;  5DNY A;  4Q7F A;  1MF8 A;  4G9J A;  2KKN A;  4O43 A;  4H1Y P;  3LL8 A;  4ZVZ A;  2WDF A;  4H2G A;  4F0Z A;  3QFN A;  3P71 C;  4XPN A;  3QFM A;  4FCX A;  2USH A;  4UT3 A;  1T70 A;  5HPE A;  3C9F A;  4LTY A;  4JA7 A;  4UT3 B;  4TUG A;  4I5L C;  1Z2X A;  3C5W C;  2NXF A;  4FBW A;  2O8G A;  4B2O A;  4M0V A;  4O24 A;  1S95 A;  2IAE C;  3RQZ A;  1T71 A;  1USH A;  4H2I A;  3RL5 A;  4TUI A;  2IE4 C;  2O8A A;  1OID A;  1HO5 A;  1JK7 A;  3IVD A;  5B8I A;  5JPE A;  2Z72 A;  4LAC C;  3JYF A;  2GJU A;  3THN A;  5IOH A;  1S70 A;  2YVT A;  4FBK A;  4UWQ A;  2Z1A A;  4MP0 A;  2WDC A;  3RL4 A;  3RL3 A;  4V0W A;  1W24 A;  1UTE A;  2WDD A;  2DFJ A;  3FGA C;  1NNW A;  4MOY A;  3AV0 A;  2ZBM A;  1M63 A;  4JA9 A;  4KKZ A;  2P6B A;  3H64 A;  4H2B A;  3ZTV A;  1FJM A;  1V73 A;  5JJT A;  1AUI A;  2QFP A;  3H69 A;  4WWL A;  4I5N C;  3GVE A;  2JOG A;  1HP1 A;  4FBQ A;  3EGG A;  3K7W C;  2NYM C;  2A22 A;  3QFO A;  1XM7 A;  4V0X A;  1IT6 A;  3DSD A;  4J6O A;  3QFK A;  4YKE A;  1S3L A;  1TCO A;  2CV9 A;  3E7A A;  3H67 A;  4HD0 A;  4O5G A;  5C1V A;  3H61 A;  2NYL C;  2Z06 A;  3T1I A;  1G5B A;  5J28 A;  1XZW A;  1S8E A;  1SU1 A;  4IYP C;  4NZV A;  4MOV A;  4H1S A;  2IE3 C;  4ORC A;  3THO B;  1S3M A;  3IVE A;  1UF3 A;  4O4K A;  4LU9 A;  2AHD A;  5F3W A;  4OR9 A;  3QG5 C;  2WDE A;  2XMO A;  3K7V C;  3H60 A;  1KBP A; 
#chains in the Genus database with same CATH topology
 3PSN A;  1U32 A;  2BQ8 X;  5GTU A;  5JPF A;  2Q8U A;  3CK2 A;  3E7B A;  3HVQ A;  4DSY A;  4ORA A;  2DXL A;  3IB8 A;  4ZX2 A;  1QHW A;  1OIE A;  1WAO 1;  4H2F A;  3IB7 A;  1Z2W A;  2BDX A;  1QFC A;  1OI8 A;  2BCD A;  3ICF A;  4V0V A;  3V4Y A;  2HYO A;  3H62 B;  3H68 A;  4UT2 A;  3ZU0 A;  2HYP A;  5INB A;  5EQV A;  2QJC A;  1HPU A;  4DT2 A;  1WAR A;  1II7 A;  4DHL A;  3H66 A;  3DSC A;  4ORB A;  3KBP A;  2QFR A;  3AUZ A;  2R17 A;  1S3N A;  3EGH A;  3H63 A;  3PSO A;  3DW8 C;  4KBP A;  2HY1 A;  4IL1 A;  3N5U A;  2NPP C;  3TGH A;  5DNY A;  4Q7F A;  1MF8 A;  4G9J A;  2KKN A;  4O43 A;  4H1Y P;  3LL8 A;  4ZVZ A;  2WDF A;  4H2G A;  4F0Z A;  3QFN A;  3P71 C;  4XPN A;  3QFM A;  4FCX A;  2USH A;  4UT3 A;  1T70 A;  5HPE A;  3C9F A;  4LTY A;  4JA7 A;  4UT3 B;  4TUG A;  4I5L C;  1Z2X A;  3C5W C;  2NXF A;  4FBW A;  2O8G A;  4B2O A;  4M0V A;  4O24 A;  1S95 A;  2IAE C;  2ZOA A;  3RQZ A;  1T71 A;  1USH A;  4H2I A;  3RL5 A;  4TUI A;  2IE4 C;  2O8A A;  1OID A;  1HO5 A;  1JK7 A;  3IVD A;  5B8I A;  5JPE A;  2Z72 A;  4LAC C;  3JYF A;  2GJU A;  3THN A;  5IOH A;  1S70 A;  2YVT A;  4FBK A;  4UWQ A;  2Z1A A;  3FLO A;  4MP0 A;  2WDC A;  3RL4 A;  3RL3 A;  4V0W A;  1W24 A;  1UTE A;  2WDD A;  3D03 A;  2ZO9 B;  2DFJ A;  2YEQ A;  3FGA C;  1NNW A;  4MOY A;  3AV0 A;  2ZBM A;  1M63 A;  4JA9 A;  4KKZ A;  2P6B A;  3H64 A;  4H2B A;  3ZTV A;  1FJM A;  1V73 A;  5JJT A;  1AUI A;  2QFP A;  3H69 A;  4WWL A;  4I5N C;  3GVE A;  2JOG A;  1HP1 A;  4FBQ A;  3EGG A;  3K7W C;  2NYM C;  2A22 A;  3QFO A;  1XM7 A;  4V0X A;  1IT6 A;  3DSD A;  4J6O A;  3QFK A;  4YKE A;  1S3L A;  1TCO A;  2CV9 A;  3E7A A;  3H67 A;  4HD0 A;  4O5G A;  5C1V A;  3H61 A;  2NYL C;  2DXN A;  2Z06 A;  3T1I A;  1G5B A;  5J28 A;  1XZW A;  1S8E A;  1SU1 A;  4IYP C;  4NZV A;  4MOV A;  4H1S A;  2IE3 C;  4ORC A;  3THO B;  1S3M A;  3IVE A;  3E0J A;  1UF3 A;  4O4K A;  4LU9 A;  2AHD A;  5F3W A;  4OR9 A;  3QG5 C;  2WDE A;  2XMO A;  3K7V C;  3H60 A;  1KBP A; 
#chains in the Genus database with same CATH homology
 3PSN A;  1U32 A;  2BQ8 X;  5GTU A;  5JPF A;  2Q8U A;  3CK2 A;  3E7B A;  3HVQ A;  4DSY A;  4ORA A;  2DXL A;  3IB8 A;  4ZX2 A;  1QHW A;  1OIE A;  1WAO 1;  4H2F A;  3IB7 A;  1Z2W A;  2BDX A;  1QFC A;  1OI8 A;  2BCD A;  3ICF A;  4V0V A;  3V4Y A;  2HYO A;  3H62 B;  3H68 A;  4UT2 A;  3ZU0 A;  2HYP A;  5INB A;  5EQV A;  2QJC A;  1HPU A;  4DT2 A;  1WAR A;  1II7 A;  4DHL A;  3H66 A;  3DSC A;  4ORB A;  3KBP A;  2QFR A;  3AUZ A;  2R17 A;  1S3N A;  3EGH A;  3H63 A;  3PSO A;  3DW8 C;  4KBP A;  2HY1 A;  4IL1 A;  3N5U A;  2NPP C;  3TGH A;  5DNY A;  4Q7F A;  1MF8 A;  4G9J A;  2KKN A;  4O43 A;  4H1Y P;  3LL8 A;  4ZVZ A;  2WDF A;  4H2G A;  4F0Z A;  3QFN A;  3P71 C;  4XPN A;  3QFM A;  4FCX A;  2USH A;  4UT3 A;  1T70 A;  5HPE A;  3C9F A;  4LTY A;  4JA7 A;  4UT3 B;  4TUG A;  4I5L C;  1Z2X A;  3C5W C;  2NXF A;  4FBW A;  2O8G A;  4B2O A;  4M0V A;  4O24 A;  1S95 A;  2IAE C;  2ZOA A;  3RQZ A;  1T71 A;  1USH A;  4H2I A;  3RL5 A;  4TUI A;  2IE4 C;  2O8A A;  1OID A;  1HO5 A;  1JK7 A;  3IVD A;  5B8I A;  5JPE A;  2Z72 A;  4LAC C;  3JYF A;  2GJU A;  3THN A;  5IOH A;  1S70 A;  2YVT A;  4FBK A;  4UWQ A;  2Z1A A;  3FLO A;  4MP0 A;  2WDC A;  3RL4 A;  3RL3 A;  4V0W A;  1W24 A;  1UTE A;  2WDD A;  3D03 A;  2ZO9 B;  2DFJ A;  2YEQ A;  3FGA C;  1NNW A;  4MOY A;  3AV0 A;  2ZBM A;  1M63 A;  4JA9 A;  4KKZ A;  2P6B A;  3H64 A;  4H2B A;  3ZTV A;  1FJM A;  1V73 A;  5JJT A;  1AUI A;  2QFP A;  3H69 A;  4WWL A;  4I5N C;  3GVE A;  2JOG A;  1HP1 A;  4FBQ A;  3EGG A;  3K7W C;  2NYM C;  2A22 A;  3QFO A;  1XM7 A;  4V0X A;  1IT6 A;  3DSD A;  4J6O A;  3QFK A;  4YKE A;  1S3L A;  1TCO A;  2CV9 A;  3E7A A;  3H67 A;  4HD0 A;  4O5G A;  5C1V A;  3H61 A;  2NYL C;  2DXN A;  2Z06 A;  3T1I A;  1G5B A;  5J28 A;  1XZW A;  1S8E A;  1SU1 A;  4IYP C;  4NZV A;  4MOV A;  4H1S A;  2IE3 C;  4ORC A;  3THO B;  1S3M A;  3IVE A;  3E0J A;  1UF3 A;  4O4K A;  4LU9 A;  2AHD A;  5F3W A;  4OR9 A;  3QG5 C;  2WDE A;  2XMO A;  3K7V C;  3H60 A;  1KBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...