3EGOA

Crystal structure of probable 2-dehydropantoate 2-reductase pane from bacillus subtilis
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
292
structure length
292
Chain Sequence
SLKIGIIGGGSVGLLCAYYLSLYHDVTVVTRRQEQAAAIQSEGIRLYKGGEEFRADCSADTSINSDFDLLVVTVKQHQLQSVFSSLERIGKTNILFLQNGMGHIHDLKDWHVGHSIYVGIVEHGAVRKSDTAVDHTGLGAIKWSAFDDAEPDRLNILFQHNHSDFPIYYETDWYRLLTGKLIVNACINPLTALLQVKNGELLTTPAYLAFMKLVFQEACRILKLENEEKAWERVQAVCGQTKENRSSMLVDVIGGRQTEADAIIGYLLKEASLQGLDAVHLEFLYGSIKALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable 2-dehydropantoate 2-reductase
publication title Crystal structure of Probable 2-dehydropantoate 2-reductase panE from Bacillus Subtilis
rcsb
source organism Bacillus subtilis
total genus 102
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 1.1.1.169: 2-dehydropantoate 2-reductase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02558 ApbA Ketopantoate reductase PanE/ApbA
A PF08546 ApbA_C Ketopantoate reductase PanE/ApbA C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3egoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3egoA01
4D7AA 3RBVA 4KDFA 5A5FA 2VTEA 4WLOA 3I1JA 3U62A 1L1FA 4CLDA 1ADBA 1EVZA 4XQ9A 3BZUA 3WG9A 2P91A 3WQRA 2EWMA 4XIJA 4LN1A 4R3NA 3CMMA 3E18A 5KWEA 3D1LA 5G4KA 3KYCA 2PZMA 4ND2A 2B0JA 2ZJ1A 3HFSA 2IZZA 4FGSA 3VH4A 2I3AA 4UAGA 1DLIA 2EKPA 1YOVA 5U9CA 4W7HA 2PZKA 5TC4A 1VSVA 4U6QA 4BO3A 3GH3A 2Y67A 3VPHA 4XDYA 4B4OA 1IYZA 4MVJD 4AJIA 1IZ9A 3C1OA 4KDEA 4BO4A 3RUEA 4E4YA 3AY3A 4H3VA 3EVNA 4DIBA 5KJFA 2JKVA 4EUHA 2CY0A 5TX7A 4CMIB 2FZEA 2YFQA 4O0LA 2GZ1A 4CUJA 4JJIA 2GO1A 4OXKA 1LSSA 3EC7A 3NAQA 2PY6A 2NU6A 2ZTVA 3GVIA 3G49A 5BQFA 4J4BA 4BNTA 4FOOA 4W82A 3UF0A 4J91A 1LLQA 1HDYA 1DFHA 4NMHA 4A10A 2NSDA 5JY1A 2EF1A 2E82A 4RPHA 2CVZA 4ALJA 1ISHA 2UUPA 4BUCA 2HMWA 4PLZA 4HFRA 5CPFA 3ZW8A 1U4OA 5U1PA 4IIVA 3GMSA 4IDCA 3GGGA 3C7AA 5KOIA 4QFDA 4NG5A 2Q49A 1DHRA 1QP8A 3M2PA 3COSA 3GZNB 1I3MA 4J1SA 4NJMA 2QRLA 1PZFA 2VWQA 4OKNA 4CM6A 5L53A 1LU9A 2DLDA 3HFGA 4Q3BA 3RIHA 4M49A 3MJEA 1X1EA 1T4DA 3A1NA 3HDQA 2IEBA 4R9RA 2W90A 4HFJA 2C59A 4LVCA 3KETA 4G2NA 1DC4A 4WEOA 1A9YA 3GT0A 4EDFA 1XYGA 2QZZA 3WBFA 1LC0A 3GOHA 1QV6A 3D3EA 4F6CA 1DRWA 4Y6RA 4DMLA 2O48X 2YV2A 4ZGWA 2VZ0A 1C0PA 4BNIA 4HFNA 5ICMA 5IZ4A 1CEQA 1P44A 1N9GB 2VT3A 3ROKA 2Q1UA 4LCJA 1YBAA 3DO5A 3P19A 2I76A 2J5QA 2YV3A 2PGJA 4P38A 3Q1LA 3INRA 4MVJH 3RJ5A 1NP3A 2Y1CA 3E6AA 4MVJG 3ZDFA 5DDIP 1NPDA 2EKQA 1CDOA 3TFQA 2VTDA 1SPXA 3VPXA 2RH4A 2Y0EA 3H5NA 1JWAB 4DA9A 3DDNA 3EVTA 4ALMA 4ZJUA 3QWFA 2OMEA 3ICCA 4DRYA 4NK4A 1OC2A 1FDUA 3QWAA 1XHLA 3SXPA 1EFKA 1EUCA 4NBUA 2EV9A 1ZCJA 5JY6A 2O3TA 3BHMA 2GERA 3ETDA 4RVGA 4YPOA 5JAIA 4GKVA 3TFOA 4BO5A 2X58A 3PDJA 1PJCA 5HS6A 2VRCA 2JFFA 3VAZA 3DAPA 4P4NA 4QUKA 4DWVA 3PFWO 3ZWVA 3GVXA 4NFYA 4BNWA 1X15A 1WZEA 2NLOA 4A26A 1KYQA 4FDAA 3IUSA 3V1TC 1EUDA 1BDMA 1TT5B 3E48A 3EY4A 4CMIA 4PGFA 4AJKA 2OHXA 4JIGA 1PJ3A 1R0KA 1M75A 4MDHA 1HL3A 4XYBA 5L95A 2DPGA 1KEUA 2B4QA 1NBOA 4ZA2A 4JLWA 4BO8A 1QV7A 2OBYA 3VZQA 5GZ6A 3PXXA 3ROQA 3H2SA 3F46A 1MC5A 1EBFA 1GZ3A 4O5OA 4XDZA 4RZHA 3U4HA 4AJEA 4MP6A 4GWKA 4MVJF 4WASA 3ANNA 5DOVA 3RAJA 3EZYA 5DF1A 3JQGB 3VKVA 5JNLA 1YKFA 5BNIA 1EZ4A 3KOUA 1D4FA 1I5RA 1BHSA 4GLOA 4BVAA 4CMEA 3A06A 1QKIA 3LK7A 4RLSA 4Z9XA 1CQJA 4ALIA 3WX0A 1TVEA 4D0SA 4ZVVA 1U5CA 4P4GA 1PS0A 4R68A 2PLAA 2HRZA 3JQ9C 3ASVA 3F47A 3NGLA 1N7GA 1NWHA 1OBFO 4TKLA 2W4QA 4AJ2A 3WFIA 3GAZA 3E8XA 1XCBA 4FC7A 1T2CA 1GUYA 1SEVA 2Y93A 2X1HA 3FRJA 1SNYA 1RM5A 3PWZA 4ZHSA 5FI5A 2NNLD 3ETGA 3JSAA 2DC1A 3ZV6A 1E1KA 3D4OA 2GGSA 2DAPA 3INGA 4F3YA 4CL3A 4GMFA 4YYZA 2HKIA 3UN1A 1N9GA 4CLEA 1T24A 3W1VA 3DFZA 5FFFA 2C07A 3DMTA 1YB5A 4NFHA 4PLFA 4RVHA 1UAYA 2FPIA 4J43A 2Y0CA 1E6EA 2PR2A 4XQEA 1HLPA 3S2EA 1V3UA 2WD7A 2HMTA 4OJNA 3OQBA 4Z0PA 4Z9YA 4TRJA 1UXGA 3DAGA 1VL8A 1E7YA 3AOEA 4XWYA 3EK2A 1WMAA 3RC7A 4BNZA 1W8DA 3CH6A 4XYLA 1X7GA 3QVWA 1V3TA 3WB9A 1B8PA 1Q2XA 4PLWA 4NU5A 1NQTA 4F45A 2X23A 3G17A 3INTA 1DFIA 4FFOA 3BTVA 4L0QA 2IYOA 5F5NA 4JP3A 3K30A 3OHSX 4RF3A 5HBRA 4TROA 3U4DA 4C7JA 4IGFA 3WYEA 3VVBA 4B4WA 4KUHA 3PLRA 4RV9A 4RF2A 3WWYA 4WOJA 4IDBA 3RCBA 1TT5A 4NIMA 2BI7A 3LT0A 1NQOA 1ULUA 4XIYA 2VWPA 3JD4A 3NTRA 1ZZEA 2IXAA 1VI2A 1MUUA 2FR0A 3DQPA 3WGOA 1PR3A 3KSDO 3ZNNA 4NBRA 1K5HA 5CEFA 4LRSB 4BGUA 3ROPA 1W4ZA 1I2CA 4R41A 5C7IO 3KSZO 5A9TA 4IDGA 2FZWA 4NDNE 4OAQA 4WLVA 1Z73A 4EJ6A 2BELA 5AVOA 3KLPX 1C3VA 3O26A 1P1HA 3VZPA 3FBGA 3D3WA 3JQGA 3I9OA 5KVQA 3EMKA 2VHYA 4I5EA 3I83A 4XKJA 3DEYX 4U0JA 1BWSA 4MP3A 1LSJA 5TGDA 3GR6A 1HLDA 5GY7A 3WNQA 4HV4A 3AFMA 1KIFA 4R4JA 1U3WA 3ONEA 4YVFA 1YJQA 1X0XA 4B79A 4I9HA 1JVSA 2O3SA 3V1UA 1YO6A 3I23A 1DOHA 1E7RA 2ET6A 2H1SA 3ZV4A 4FQ8A 3ICPA 1PGJA 4B3JA 4NH4A 4RLHA 3PGXA 1R4MA 5BSFA 4N18A 3R3SA 4GKBA 3RFXA 4J2OA 5B37A 3FI9A 1H6CA 1GFSA 1GZ4A 3K73O 3WIEA 1M6WA 2EIHA 2DBRA 3IMFA 5CDYA 3LVFO 2VHXA 2E4AA 4XYMA 1ZBQA 4IDAA 1UAGA 3GC6A 4ZICA 3RUDA 3QQPA 1LDYA 2X5JO 2X86A 3DR3A 4OOEA 4YEDA 2ZYAA 5GMOA 2BHLA 1OAAA 1WDLA 3JD2A 1LJ8A 4TZKA 3FNFA 3DXFA 2HCTA 4OHUA 1NNUA 3DBHA 1GTMA 1ZJZA 3OF2A 5G0SA 4LGVA 4B3HA 4I08A 3ZHZA 8ADHA 2GF2A 4S1VA 3ZWOA 3H8VA 1NFFA 1XQ1A 3OJFA 3ZHBA 1GQQA 4ZQFA 5A9SB 3PZBA 4R1SA 3HDHA 5HRUA 2BFOA 3GDOA 2WYVA 2A92A 3D5QA 1D3AA 4IQ8A 4L4XA 3WMWA 3QVXA 4QECA 4L76A 3V5NA 4HX5A 3ONFA 1E5QA 4CLXA 3ST7A 1SAYA 1LSUA 1Y5RA 3G1UA 2PKQP 2VZ9A 1HDZA 4YR9A 4CM9D 2DTEA 1TI7A 3LF1A 1KOLA 4JROA 3RBXA 4A5OA 3PJEA 2AG5A 1VLLA 2BD0A 4RVFA 1YRLA 1Q7CA 1FDTA 1MXHA 2HLPA 3JTMA 4LCEA 3UVEA 4PG8A 5JDIC 3IAHA 5L7YA 4JN6B 2DBVO 2PK3A 3U4CA 1V35A 4KTTE 5JYDA 3P7MA 2ZTMA 1Q7GA 2DU8A 3QY9A 4P22A 3ZWMA 4CQLB 2BGLA 4FPXA 4BNNA 4CR8A 1LLUA 1F8FA 4RPGA 1DFGA 1K6JA 3MJVA 3JQDA 5DOZA 2B69A 5JO9A 4B7UA 2DM6A 3GMDA 3GGPA 5C7LO 4YDRA 5T5QA 2EP5A 3ZH2A 4YRBA 4ND5A 4ID9A 1PGNA 2DFDA 4M8SA 2HU2A 3MZ0A 4ZQGA 5CG1A 3RC2A 4IZHA 2OORA 1UXIA 4XGIA 2V6MA 1DO8A 5ER6A 5L40A 5HWSA 2UV8A 3WS7A 4YQZA 3N58A 1T2FA 5KJ1A 1IPEA 3GUCA 2DKNA 3FSRA 3AY7A 1AHIA 5L7TA 1Q1NA 4EGFA 4NR0A 1TA4A 1IHYA 2OUIA 2B83A 2NACA 4GWGA 1YJ8A 3BMCB 2C7VA 1F17A 1ENYA 4GSKA 5B4VA 5ENVA 1ONPA 1I0ZA 4ZQBA 4WK6A 4UEKA 3ZWYA 3AUAA 3WFJA 5LDGA 4YWJA 1ZMTA 4DC0A 1QSGA 1VKNA 1R0SA 1U4SA 2EHDA 1XWFA 2CVQA 2FWMX 1PJQA 2R6JA 4GVXA 4FJ1A 2NQ8A 1DIBA 3HN2A 1O95A 2XAAA 2AQIA 4RORA 3HE3A 3RQSA 3QW2A 2EJWA 2DTDA 2NUAA 4JJFA 1ULSA 4WLFA 1UUFA 2BFMA 5C37A 3NTOA 4PN3A 3ZNQA 5TJ9A 5TT1A 2GASA 2NU9A 3GF4A 5A9SA 5KTKA 1YB4A 2QHXA 1GDHA 5K0ZA 1LQTA 1VJ0A 3SEFA 2FSVA 3RVDA 4A73A 3WDSA 3G1TA 3AJRA 3DBRA 5ILGA 3U5TA 1OC4A 4L8VA 4B8WA 3M1LA 2JAHA 4BNKA 4PLGA 1HXHA 3IIEA 4FFNA 1B8VA 2EJVA 4LSMA 1MV8A 1A72A 2PD6A 4CL8A 4CQMD 2X5OA 2NVUA 1BXGB 1E1MA 1DLJA 1GCOA 3I9MA 1OMOA 4YBZA 3ZHYA 1EVIA 4EUFA 2CUKA 3ITDA 3JYNA 3U4IA 5JMWA 5THQA 4CQLA 3VPGA 2R2GA 1MFZA 4N5LA 2J3HA 4QEDA 1D1SA 4NK5A 4IMRA 3UXYA 3AI2A 3JQ9A 1UR5A 4W7IA 4YT8A 4B8ZA 1Y8QA 1ZK2A 4CR7A 3I4FA 1YGYA 4NFSA 4PLVA 5H82A 4ALKA 4MJLA 1ENOA 5EN4A 2P4HX 1P1JA 4CODB 4E13A 1UP6A 2O3QA 4W9NC 3VTFA 1IZ0A 3SX2A 1HSOA 2WM3A 3QVTA 3UCEA 3KXDA 1GV0A 4LK3A 3UOGA 4LISA 5H83A 1T2EA 3WLFA 2Y1EA 2G76A 2B4RO 3B1KA 2QYTA 4MIYA 1A7KA 1AN9A 3H9JA 2D0IA 3WGIA 2BI8A 4JBIA 4RVSA 3RC9A 4DBZA 1YOVB 3TZHA 1RYEA 4ZD6A 3SVTA 4KQWA 3JV7A 3NJ4A 3A28A 2OXIA 2G17A 4NBTA 3VDQA 3GVPA 5A04A 3MJSA 3OIDA 5EIOA 2JCXA 4U8GA 1MLDA 1XG5A 3H65A 3W6UA 4LMRA 1EFLA 5L51A 5DBGA 4ROSA 4DPLA 4E33A 1P1KA 4CM4B 1ISFA 1FK8A 3PLNA 5KJCA 4D44A 4ND3A 5G0VA 4MVJP 2NTJA 5TNXA 1I3NA 3HJAA 1B8UA 4RL6A 5B12A 3M1AA 1GY8A 4D42A 3GK3A 4NBWA 5IXSA 3HSKA 2EGGA 3KO8A 1HZZA 4RDIA 5JFOA 4IINA 4GX2A 2PTGA 2J3JA 3E9QA 1QYVA 4RCVA 1ZO8A 5KVVA 1A7AA 1T1SA 5G0TA 4YJGB 1AXEA 2ZATA 3HN7A 2J6IA 3JQAD 3U49A 3RUIA 2NTNA 3ZV5A 4AJHA 1GCUA 3MTGA 4MINA 5DT9A 4QTZA 3JCZA 3GZ4A 1NAHA 4DMMA 1ZMOA 1D1TA 3NDRA 2GN6A 1N1GA 1ZSNA 1BXGA 3WJ7A 1KERA 2AQHA 1EMDA 4DTIA 5T64A 3PJDA 4L74A 3DAFA 2GD1O 2WYWA 4C4OA 1I32A 2YQ4A 4A03A 3RC1A 3ULKA 2G1UA 1ZIDA 1E3IA 1GYPA 2P2SA 4II2A 4YB8A 1H2BA 2WWRA 2H5LA 2UVDA 3SBOA 2YFHA 4BNHA 1ARZA 3JYOA 3KEOA 5DCYA 3L6OO 1XLTA 4J1TA 4CM7A 1YE3A 3H9QA 1PGPA 1DIHA 1Q0LA 1IY8A 2HMSA 2X9GA 3S2FA 1NFQA 1YL5A 2X6TA 3JD1A 3OMLA 3PQEA 3HB5X 1GQYA 3CTVA 4PG6A 1JW9B 5F1PA 2PD4A 3NKLA 3RROA 1F0YA 3WGTA 3ZU5A 2D3TA 4Z3DA 1O8CA 2AEFA 1KVSA 4WPGA 2G5CA 3WQSB 1B26A 3F1LA 4UVDA 4AJOA 1JKIA 2CMDA 3KTDA 1YL7A 5JXWA 3K2EA 5I7SA 1PJLA 2VNSA 2ZQYA 1IOLA 2Q99A 3FNGA 2H63A 1HDGO 4RF5A 2RCYA 1HF3A 1UXJA 3T4EA 3O8QB 2Q2VA 4FFLA 2J5RA 4AJPA 3CINA 4R3WA 4XB2A 2P5UA 3AWDA 1JLLA 3NEPX 2PA3A 4Q3CA 3OETA 3LZ6A 2VYVD 1GAEO 4CM4A 3PHGA 4OH1A 5B4TA 2GCGA 1VKOA 1VJ1A 1E7SA 1PSDA 3ZCXA 1M2WA 5T57A 4CLRA 2D5CA 3GG2A 3WBBA 3PDUA 1DEHA 1ZXBA 1QR6A 4XJSA 1CRWG 3TRIA 2C2XA 1WAMA 2X0JA 3CZRA 3TL2A 2C20A 1H6AA 2HSDA 2UUOA 4GL4A 4YJGA 1K6IA 4BHTA 3BHJA 5JDIA 3FWZA 1ADGA 1PEDA 2GN9A 3KM0A 1RPNA 5IDQA 2IRWA 4NU6A 4A27A 3WXBA 3RUHA 5CEEA 1Q0HA 4AFNA 3KLMX 2X5KO 3AUTA 5TIIA 2EW2A 1PZGA 3E5MA 4GLLA 4D43A 1PJBA 2FSSA 1ML3A 3FTPA 1NHWA 2CVOA 2BGMA 4NJOA 3I6IA 2F00A 2ZB4A 3DHEA 2J3KA 3W8EA 1H2HA 2Y1GA 2ZKLA 4H7PA 4Z0HO 4BNMA 3F3SA 1P0FA 3HDYA 1LRKA 1B7GO 1E6UA 3S1LA 2I3GA 3NUGA 4Z6KA 3DONA 3HG7A 4DC1A 4RQTA 5I7VA 3I3OA 4DVJA 4Y67A 1Z7BA 2R00C 3OP4A 2H6EA 1LDNA 1CYDA 4TRRA 1PR9A 1PQPA 3H2ZA 1XQ6A 4WCDA 4B4VA 4D41A 2ZYGA 2GUGA 2WD7B 5DBIA 2RHCA 4BNXA 3H6KA 3EDMA 4J9UE 3BA1A 4PG7A 2V6GA 1P31A 2FPPA 1NASA 4CV0A 2Q1SA 1CWUA 3ROMA 3HNPA 5TT0A 1RM3A 1P1IA 3QSGA 3I9NA 1YONA 3JQBC 3LC7O 2DTXA 4BO0A 5EPOA 4XRGA 1SC6A 5F3RA 4PLYA 1IUKA 4CV2A 5F1OA 4XD2A 2ZIZA 2AA3A 4LMPA 3O8QA 2OGUA 1IHXA 4M86A 2I66A 4K28A 4IGEA 5AXCA 2DBZA 2OOSA 2V6BA 4JCOA 1PGQA 3W6ZA 1N2SA 5FYDA 3JYLA 4DYVA 3EUWA 4Z9FA 1UXKA 1DPGA 1LSOA 3GEGA 3IOYA 4BB5A 4YAIA 4PLTA 2YQ5A 2EXXA 3BXXA 2C29D 5I9LA 4ZQEA 3NV9A 4O59O 4OL9A 1I2BA 3KUXA 5ILOA 1FJHA 2GPTA 4IS2A 3NT5A 3BMQA 4GAEA 3AM3A 3TZ6A 4D79A 1D8AA 1O94A 3RJ9A 4BOYA 4J2HA 5CAEA 3C8MA 4B4UA 4QO8A 5L4LA 2VNAA 4QX6A 1Z82A 5DNAA 4YRDA 1NFRA 4IUYA 2Q4BA 5A3VA 3IS3A 1U2GA 5JS6A 5FWNA 2JAPA 3X2FA 1TXGA 3NDIA 4TWRA 1KBZA 2JD2A 2NVWA 3RUCA 2J8ZA 3D3WB 3HQ4O 4KOAA 5HS4A 1I3KA 1P1RA 1BXZA 1MG0A 4TVOA 2BMAA 2B5WA 4I9UA 2ZQZA 4TRNA 2UDPA 2Y1OA 4CMAA 1X14A 3GUYA 4JBHA 1HDXA 1Q0QA 2AQKA 4L4SA 4BO7A 4D3FA 1FDSA 5AXDA 5BT9A 1LX6A 2O23A 2VRCD 1KEVA 2E48A 2A9FA 3KHUA 4AJNA 1LTHR 1PJTA 4CMKA 5MDHA 2HK9A 1XDWA 1YB1A 2NQTA 4IM7A 1R4MB 3GEMA 4KWIA 1EEHA 1PL8A 5KKAA 2PGLA 3B70A 4BKPA 2FPGA 1DB3A 1QYCA 3EGOA 2YV1A 4K1LA 3PFFA 1YDWA 1MX3A 1FMCA 1JVBA 1I3LA 4W9NA 1ONOA 1CQIA 2O4CA 1GADO 4AJLA 4O6VA 4YA6A 1QLHA 3QRWA 3VDRA 4FSHA 1CERA 2IXBA 3KYDB 4ONEA 3IKTA 3TZKA 1EE9A 3VZRA 3HWRA 4W6ZA 3DBHB 1E0DA 1SO8A 2AQ8A 1P0CA 3HZZA 1QMGA 1MFPA 2AEJA 4J16A 2VN8A 2ZJ0A 5I9MA 4M1QA 3WICA 3PYMA 4IMPA 2RHRA 3TPCA 1PL7A 3F5QA 4C7KA 1ZK1A 3TSCA 5IXYA 5JE8A 2BGKA 3K31A 3PJGA 3F5SA 3S8MA 2VWGA 2YDYA 4WCFC 3KB6A 2D5AA 3WTCA 4TQGA 4BQPA 1E92A 4MVJM 3UGKA 3GRKA 1E77A 3WGQA 3AI3A 3CXRA 1Y9AA 1PQWA 2HAEA 2GZ3A 4DQVA 5CFZA 4YT5A 2J5KA 2E49A 5CDSA 7MDHA 4FR5A 1QRRA 4PFJA 1U3VA 4RQUA 4BB6A 1K6XA 4BNYA 1ZKMA 3CTMA 1YS4A 2PZJA 1XU7A 1AHHA 4ALNA 4Q3EA 2FR8A 4EUEA 2TMGA 2FY8A 2FMUA 4N5NA 5G0UA 1NVGA 2XF8A 2I67A 3DZKA 3VH2A 2O3UA 4E31A 3RKUA 2YY7A 3WMXA 3GLQA 3BTSA 1JAXA 3NTQA 4DIFA 2EGHA 4D46A 3CMCO 4TVBA 5F1KA 5DP2A 2EEZA 3GVCA 4XX0A 2OFPA 4IXWA 4B7CA 1R6DA 3PGJA 3Q9UA 3RWBA 4LVUA 4EEZA 2A94A 3QLJA 2I6TA 5CHEA 1KVTA 5CG2A 1E3LA 4PG5A 1VE9A 3PI7A 4RPKA 3WLEA 2EP7A 2DUUA 1G6KA 3GNTA 3GFGA 4R5MA 1AGNA 4E2ZA 5JMPA 5C7OO 5BSEA 3NX4A 4M55A 2Y0DA 3H3FA 3NJ8A 3D0OA 1JWBB 3VC7A 2GLXA 4I9NA 3MCVA 1WDMA 3GPIA 2GZ2A 3IL2A 2PH5A 1YL6A 5JYEA 2A4KA 1C0KA 2I65A 4UREA 1J0XO 4A0SA 1GR0A 1DC6A 3UCFA 4R01A 3RBZA 1WDKA 1F12A 1QYWA 2BRUA 4OXNA 1YXMA 4PCVA 2OBNA 1UH5A 3FBTA 1D7OA 1E7QA 4YAKA 3OICA 4U7WA 1IE3A 3K96A 1T1RA 4CM3A 4EEXA 3KYDA 3OJEA 4J49A 2NTVA 3AM5A 2PNFA 4BNVA 4CV1A 4QQRA 1A4IA 1S7CA 4I5DA 4CPDA 2GN4A 2O7QA 4PRKA 1N5DA 1HDOA 5EESA 3GNSA 3QA9A 1VL6A 5AQ1A 4UVHA 2HK8A 4Q3NA 3R1IA 3K6JA 2DT5A 1NHGA 1ZH8A 5TSDA 5I9NA 5ADHA 5JO0A 1NXQA 4AVYA 1Y8RB 2GRAA 1U1IA 1ZK4A 3K2BA 1GZ6A 2DQ4A 4WE3A 2VOEA 2C5AA 5JCXA 1N7HA 5EERA 5KVSA 3DBRB 4PZCA 4UUNA 2HDHA 1HETA 2ILTA 1VC2A 3FR7A 3S2IA 1R15A 4FC6A 5I8ZA 1ISMA 3AU8A 1KS9A 3NYWA 4LSWA 3IP3A 3FHLA 3QIVA 1RM4A 1R66A 4IJUA 1WVGA 2NVUB 4X54A 1PX0A 4BNFA 4E6PA 2Z5LA 1LDEA 4RZIA 4W4TA 1V8BA 1JAYA 1B0AA 2WYUA 3JQ7B 2CDAA 4MVJI 2VHZA 2WJPA 4E5KA 2CD9A 3P2YA 5DCWA 3GVHA 4D0RA 2B37A 1Y1PA 4H15A 2XOXA 3PQFA 4FS3A 1GYRA 1N8KA 3ADPA 5EINA 3SC6A 3ONDA 4ZRMA 1BVUA 4UEJA 1PWXA 1RWBA 1LI4A 1Y8QB 4KUEA 3GRPA 3TN7A 3QVSA 1JQBA 3G0OA 2HJSA 2OP1A 1FF9A 3PYXA 1NQ5A 2P68A 3UKOA 5DULA 1Y6JA 5JCJA 2ZB7A 2NU8A 3Q9NA 3ZWAA 4K9DA 3LC2O 4OM8A 3VOSA 3ANLA 1J6UA 1VPDA 1MA0A 5EQFA 2RH8A 5IAAA 5A3JA 1H9AA 3IP1A 1AUPA 4MIEA 1W73A 3JD3A 4CMBA 1GEEA 4ITUA 2R00A 2X0NA 5C3MA 4HXYA 4CMGA 2CNBA 2JD1A 4PRLA 1T26A 2VUTA 3JD0A 1PQUA 1I30A 2JFHA 5A02A 5AOVA 3W4JA 4PVCA 2AHRA 3SJ7A 2PKRA 1K0UA 2VRBA 2B5VA 1KVQA 4GGPA 1L7DA 3JQBA 3D4PA 5CDUA 1WP4A 3H9EO 5LCXA 4G81A 1HSZA 2UAGA 4NBVA 3FCOA 3ZNOA 3VHRA 1JN0A 5THKA 3ON5A 2OZPA 3E9MA 1NR1A 4UUPA 3TF5A 1Y8RA 4BNLA 3IDSA 4WLNA 5BNTA 3L4BC 5IN4A 2YUTA 4K6CA 1LEHA 4GX1A 3D64A 3Q11A 4EITA 3C85A 4R9SA 3ZWWA 2LDBA 5KJEA 1KY5A 5KNLA 2AXQA 4MO2A 2O2YA 3ZU2A 3JQ8B 4JJGA 4J7UA 4IZIA 3A9WA 3QJ5A 1Y5MA 4EJ0A 2VYNA 4DQXA 5EL0A 3AU9A 4N5MA 4TKMA 2NWQA 2Y1FA 4HY3A 2Y66A 3GN1A 2X0RA 2X0IA 1L7EA 4CM1A 4J4HA 5A9RA 1E1NA 3O9ZA 3OJLA 3OJ0A 4R1NA 3JQ7A 1ENPA 2XPCA 1DAOA 1S6YA 3Q0EA 4BNGA 2X8LA 4DREA 4DLLA 2AMFA 5CDTA 4GSLA 7ADHA 1N92A 3FWNA 1GPDG 3AW9A 3B6ZA 3ENKA 3LT1A 4NHEA 3RFTA 3SC4A 9LDBA 5L4SA 2CFCA 4A7PA 4EI2A 2Q46A 1ID1A 2ZTUA 3PK0A 4OO3A 4XR4A 4OOFA 3I9JA 1U3TA 2E37A 1YWGO 3OA2A 4R54A 5TQVA 3ZGYA 3H7AA 3SLGA 3U0BA 6ADHA 2WE8A 4XJTA 3HADA 1ISGA 3H4VA 1WWKA 4QSMA 4IPTA 4BS9A 3CUKA 4FCCA 3ADOA 4FJ2A 3F6YA 2PH3A 4KTVE 1OFGA 1WZIA 4NZ9A 5JC1A 1E1LA 1HZJA 3DTYA 5GZ3A 4BGVA 4L9RA 1IULA 1LDBA 4WOKA 4DYDA 3RUFA 4CR6A 1EK6A 3DFUA 5IJZA 1MB4A 3BHIA 3HDJA 3M6IA 5H81A 1B15A 5G4LA 1YQXA 1ZEMA 3ZWBA 4GVLA 5IFLA 4DQUA 2UYYA 4ALLA 1ZK3A 4MKRA 5BR7A 3VVCA 2Y99A 4IDDA 3TQHA 4WCFA 3WJAA 1DRUA 3B1FA 5EJ2A 5F5LA 4PIVA 3OQ6A 3VH3A 3WGHA 4CLRB 1GPJA 3MWDB 2W2LA 2P9CA 3LU1A 4MPDA 4CMCA 1LXCA 3K9QO 1YVEI 4E21A 3MJCA 3PIDA 1E7WA 2EG9A 1ZSVA 3ENNA 3GAFA 2WD8A 3U09A 2W8ZA 1XKQA 3DOJA 3O4RA 2FRDA 1ADCA 4RPJA 3FR8A 4MVJE 5DP1A 1M76A 2WSBA 3GDFA 4O63O 1A71A 1X1TA 1EVJA 3TZCA 3AM4A 5A06A 3JQ8A 1KVRA 4RJTA 5K9ZA 4P8RA 3KV3O 4CUKA 1F8GA 4UUMA 4HBGA 5ITVA 3L4SO 4KWHA 1B3BA 2B4TO 2HMUA 4WECA 2Q2WA 4BO2A 3OFSA 4BGIA 2AE2A 4YXFA 3FTNA 4FFRA 3UAGA 3I9LA 4Y6SA 2VWHA 3U9LA 1O5IA 4IDFA 3MJTA 2QZ9A 5JC8A 1ENZA 1PJSA 2W2LD 4EZBA 3T4XA 5KIAA 1SEPA 3FF4A 2O2SA 2P9EA 5EMHA 1ZEJA 2CZCA 3OEWA 2AE1A 2DFVA 4WKGA 1U9JA 2E6UX 4YAJA 5ES3A 2WMDA 1ZW1A 4MVJA 5AYVA 4G65A 5DZSA 5L4NA 1A9ZA 1XEAA 4IJWA 3GG9A 2Q50A 4CMJA 1BVRA 3GGOA 3ZW9A 5IN5A 3Q6IA 5LC1A 1I33A 1N1EA 1ZNQO 4CLOA 5HM8A 4BV9A 1UXHA 4YRAA 1T2DA 1M6HA 5B4UA 1HE2A 4ZU3A 1E3WB 4R5HA 1ADFA 1GL3A 4UVGA 3OA0A 3DTTA 2TMDA 3BMNA 3NDJA 1ZFNA 4WLEA 4OSPA 3IC5A 1NM5A 4II3A 1WXDA 3ITKA 3DZIA 2OL4A 3MJ4A 4HNGA 1G0OA 2O3JA 4PLHA 3RSHA 3DBLA 3TWOA 1P3DA 1YQDA 2D8AA 5ENDA 2P9GA 4CLHA 2Q1TA 3PQDA 3IJPA 4BO6A 1EVYA 5G0WA 3BMQB 3L6EA 3WGGA 4BQRA 1C1XA 2BFPA 5DN9A 4YAGA 1DIGA 5J23A 1NVMB 4IJVA 1DHTA 3H5RA 4WUVA 4GGOA 1ZK0A 2AEMA 1Y7TA 1GEGA 2RAFA 4J0EA 4CM8B 2JCYA 1P9LA 3RKRA 3X2EA 1Y81A 3C1TA 4R69A 4XGNA 4AICA 3H5AA 3GDGA 3UICA 1DIRA 4ZN6A 5IZCC 2PV7A 1NPTO 1EK5A 4IXTA 4U5QA 3GFBA 4CMHA 2DBQA 5C5IA 5IDWA 3L07A 4Q3AA 1SCUA 5GZ1A 5ER9A 1W6UA 4JXKA 4DPKA 1ZVMA 4DGSA 1O6ZA 3DOOA 4R1TA 4Q39A 2YW9A 2NADA 2HMVA 3FPLA 5KJ6A 1ORRA 1SB8A 2CSUA 5JAQA 1EBUA 2HO5A 2JHFA 3TJRA 1V3VA 1WLYA 2IYPA 2DPHA 2AW5A 5T6BA 3M2TA 1K89A 4RO0A 5TJHA 1PU2A 1QXSA 2BH9A 1X7DA 1BW9B 3ZWPA 1JDJA 1R4NA 1ZSYA 1LLCA 1B14A 4UUOA 1DC3A 1T25A 4RDHA 1NR7A 3C7CB 3VKUA 3WWZA 2A35A 1QYDA 1VSUA 8LDHA 1MC4A 4W99A 2B35A 2GSDA 4E5MA 1NVTA 1V6AA 1XU9A 5CPBA 1CIVA 3C7DB 1P1FA 1CJCA 1I24A 1TB4A 3BMOB 3PPIA 2QG4A 4QO7A 5B1YA 3KRTA 3CKYA 1DIAA 3WSWA 3WTBA 3OSUA 2HK7A 5BSGA 3K5PA 2VUUA 3RU9A 3PEFA 1RYDA 3DWFA 1E3WA 2O7SA 4K26A 4MKXA 3JQCA 4GX5A 3F4LA 5K6AA 1HYGA 1YBVA 3TDKA 3ZU3A 4IS3A 1KEPA 4MIOA 1HTBA 3GY0A 1RJWA 1H94A 2ZK7A 2GR9A 5KKCA 4B3IA 1MXFA 1DJNA 5JDCC 3DHNA 3LT4A 3PYLA 4E2XA 1O89A 1U7TA 3L4BA 4J9VA 4WNIA 4YJDA 4TMFA 2O3RA 2WTBA 4KUGA 5A5EA 2QW8A 3JYQA 3PHLA 5IG2A 2C2YA 3OIGA 4UVIA 1P74A 2D59A 3I5MA 3UUWA 5ICSA 1XELA 4ESOA 1RM0A 2IE0A 1HDRA 5IF3A 5HTOA 3JQFC 1AXGA 1BRMA 2ZB8A 4E0BA 1XA0A 3E82A 4DPMA 4CM8A 2IODA 3PWSA 5A4DA 2XXBA 3CPSA 1HT0A 2Z1MA 4M89A 2OO5A 4R51A 2GNAA 1I2ZA 2B36A 4E5YA 1KVUA 4OMUA 4F6LA 4DL9A 3LSYA 5JAZA 4YACA 2VCYA 4XEHA 1YQGA 4H16A 3E9NA 3WQQA 3IJRA 5TRTA 4D45A 3EAGA 1M67A 2C54A 1U8FO 5DBFA 4J1QA 3KBOA 5I7EA 1P33A 2CDBA 3SJUA 6LDHA 4JX8A 1J5PA 3PTZA 2NVBA 4IBOA 2D1YA 1PJ2A 2IDZA 3Q3CA 3V2UA 3FN4A 4OQZA 1KEWA 1UZMA 2ZB3A 3GZNA 4E5NA 5TLSA 3BAZA 1VRWA 1HE5A 3GHHA 3MTJA 1UDAA 4TZTA 1F14A 1RKXA 2X7HA 3G79A 2WEKA 4FFMA 1Z45A 1NX6A 4E32A 1HYEA 2Y68A 1VJTA 3H3JA 4BKQA 4BO1A 3BIOA 4PLCA 1BW9A 4XYEA 4YAEA 3HUDA 4Z0TA 1P45A 2YDXA 4PZEA 4GI2A 3NT2A 4FBGA 1WPQA 4M54A 5COAA 2SCUA 2ZTLA 4RPLA 5CDGA 1LLDA 3Q2IA 3K92A 4DUPA 1NWCA 4J1NA 2EW8A 4YCAA 2QRKA 3PP8A 1DC5A 3PRJA 2YZ7A 1Z6ZA 3F1KA 1E3SA 2Z95A 3BMOA 2QX7A 3LF2A 3ZU4A 3DZGA 2D4AA 3F9IA 1C1DB 3AFNA 3MOGA 4AJ4A 1QLJA 4PZDA 3PHHA 4XR9A 1GU7A 1H5QA 1JU9A 1H9BA 3UW3A 4BMSA 3I4CA 1EDZA 1BSVA 5A03A 1DRVA 2C7GA 2H9IA 3LQFA 4EW6A 3QWBA 1G0NA 1Q7BA 4YTEA 4E3ZA 4DIOA 3A4VA 2NU7A 4J6FA 1PZHA 3RFVA 1O0SA 1AE1A 1GUFA 2Q45A 3R6DA 3NGXA 2FP4A 3WNVA 4DBVO 1GYQA 3NT4A 1LA2A 1PL6A 3WIDA 4PLPA 4IQ0A 4BNUA 1GUZA 1U8XX 3MOIA 3B1JA 1WW8A 1X0VA 3DZFA 3WOHA 4AG3A 3KYBA 4JBGA 3WYCA 3S2GA 5IDXA 3ABIA 4QT0A 1CETA 1CF2O 1BXKA 2VHWA 3PWKA 3CZMA 3AOGA 1EQ2A 1R16A 2YJZA 3CEAA 2DVMA 5T67A 3KEQA 4YJHB 2GYYA 1LQUA 1GQ2A 3L0DA 1HEUA 3T7CA 2Z1NA 4GPD1 4YQYA 4EJMA 1NPYA 3SLKA 1JKFA 1O9BA 1B2LA 1PWZA 1R0LA 4LW8A 1UDBA 1EE2A 1XR3A 2RBEA 4U6SA 4IJKA 1QORA 1LUAA 1OOEA 4N7RA 4K6FA 1PS8A 1LDMA 4OKIA 5JBIA 3EZLA 3ZWXA 3A14A 3RASA 4MP8A 5KCZA 3C24A 5A05A 5T8KC 3UHAA 3DHYA 4J0FA 4BGEA 2ZCVA 3ETEA 4IQGA 4MKZA 4L73A 1PJ4A 3ZNPA 1PTJA 3FD8A 4J7XA 3AY6A 3KVOA 3E03A 4DXHA 4AL4A 3OJOA 3C3XA 4FGWA 1DXYA 1MGOA 1KC1A 1A4UA 4CQMB 4CM9A 1BTOA 5TF4A 1OZAA 2PFGA 2C82A 4GQAA 4E30A 2BF7A 1IB6A 4IDEA 3STHA 2F1KA 4URFA 1BGVA 1DDOA 1ZXLA 2HQ1A 4YT4A 1A27A 2I5PO 3D5TA 4J7CA 3L9XA 4ZQHA 1EUZA 2DUWA 2IZ0A 1C1DA 3KZVA 3DZHA 4JQCA 2HUNA 4WJZA 2O4UX 2PKQO 5JW6A 3OM9A 5DCUA 2ZCUA 5TS3A 1B3RA 3GN2A 4JK3A 2YHUA 1QYXA 5JLAA 3N7UA 1SZJG 1C0LA 3AUSA 1J4AA 3KSUA 3CSDA 1TLTA 3IKVA 1DAPA 4ZRNA 2P5YA 1ISIA 3CE6A 4BKRA 2G0TA 4KMSA 3LDHA 4OYRA 4IIUA 5L3ZA 4YJFB 1U5AA 2PD3A 1E6WA 1LRLA 4CUZA 1H93A 3EYWA 2J3IA 3TL3A 2JHGA 1YBMA 5LDHA 1M66A 2ZYDA 3NRCA 4O1MA 4XRRA 5AXBA 5IZCA 5FF9A 4FJ0A 1LDGA 1B16A 3GA0A 1I8TA 5I8WA 2PZLA 3OQ1A 3F4BA 4J4TA 3EW7A 3TZQA 2W98A 4FW8A 4Q9NA 4D3DA 4P4LA 1H6DA 4XA8A 4Y6PA 4UULA 3UH1A 4NNJA 1F06A 3AK4A 4E2YA 3UCXA 4OIMA 4XCVA 1YH3A 4D3SA 2JJYA 2V65A 3ORFA 1HRDA 1R37A 3PZRA 4Y8VA 3DZJA 4A2CA 3R3JA 3QP9A 1QG6A 2Y05A 1I36A 1T2AA 4KZPA 4QFCA 3GEDA 2FN7A 1H0KA 4L75A 3MEQA 3QV1A 4J3FA 3TOXA 2X9NA 1XIVA 4YJHA 3RU7A 3LC1O 2V6FA 5CP8A 2IZ1A 3E1KA 1UP4A 4LRTB 4WLUA 4BIIA 5JAMA 1HYHA 3R0IA 1JA9A 3GHYA 1VM6A 4J90A 3LLSA 4RVUA 1EDOA 1HE3A 2HRBA 5U4QA 2WDZA 1NAIA 3DB2A 5BSHA 4RGBA 4OXYA 2O50A 4OSOA 1U3UA 2BLLA 1NTOA 2POQX 4I5GA 1BDBA 4HADA 3IUPA 3OEYA 1IL0A 3ZN2A 3JYPA 3JQAB 4XQGA 1FDVA 1JKJA 2JL1A 2NV6A 5F21A 4OGWA 4HNHA 2FOIA 3QWIA 4S3MA 2NM0A 2YYYA 4KQXA 4TRMA 1C0IA 4WCFB 3ASUA 5K6AC 3D7LA 2VT2A 3JQEA 3L9WA 1UDCA 3QVOA 4XQCA 4CQMA 1E3JA 1BG6A 5BNFA 2GN8A 1FXSA 1E5LA 1JTVA 1KC3A 2Y1DA 4HFMA 4B7XA 3QE3A 4Z3KA 2W2KB 3DOCA 3P2OA 5FI3A 4AJJA 5G2OA 5JCJD 3DC2A 1FDWA 1NQAO 1UZNA 2X4GA 1PS9A 3H9UA 4HWKA 5JDCA 1IPFA 1H6BA 4QXMA 2G82A 3LLVA 4HP8A 4N54A 5A1TA 2P4QA 2VOJA 3I9KA 3V2GA 1SMKA 3W4IA 3TNLA 3L77A 1ISJA 5IDYA 3V2HA 1U7HA 4HUJA 9LDTA 1G1AA 1Z74A 1SB9A 1OI7A 5L45A 1K2WA 2AG8A 1R12A 3EHEA 3JQFA 4RVDA 4BV8A 2EERA 2BFAA 3LT2A 1VL0A 4ILKA 2FHSA 3RI3A 1PIWA 3IQDB 1NYTA 3W8FA 4YJFA 3D4NA 4BKUA 4F46A 3AI1A 4FIZA 4U0KA 3GPDG 4JGBA 3OECA 4OQYA 1PZEA 2I9PA 1C14A 5COQA 5ITWA 3MWEB 5L9AA 3I6QA 5CEJA 2FR1A 4NI5A 1HWYA 3HB4X 4R1UA 5L7WA 4GMGA 4Y98A 3ZI0A 1U2DA 4NPCA 5AXAA 5JPIA 3VPFA 4CM5A 2YHIB 1UP7A 3Q2KA 3WYBA 5EQDA 2VUSA 3WGZA 1LBEA 3VPSA 2BKAA 4GH5A 3OH8A 4I8XA 1HE4A 3DBVO 4CMEC 4DLBA 5JSFA 4XZ3A 3FNHA 1TEHA 3O38A 3PIIA 4E5PA 4CLOB 4BKOA 5MGBA 4PVDA 1I01A 3T7EA 1V0JA 2EKLA 3ANMA 1U28A 2RIRA 3P5SA 3LYLA 2VYND 1SOVA 3E5RA 2Q2QA 2HJRA 1YDEA 4ND1A 4M87A 3W8DA 4CV3A 3BMNB 3OBBA 1X7HA 1MP0A 3UFXA 3V8BA 3ZWCA 4HKTA 4EYEA 1P77A 1Z7EA 3H9GA 4NQZA 3VTZA 3ZHXA 3JQ6A 1ZUD1 3JQAA 4EBFA 3DMTC 4FN4A 3KYCB 5G4KB 4YT2A 2Q4EA 1XGKA 3DBLB 3VZSA 4XB1A 1SBYA 4BO9A 1LC3A 5FEUA 1UZLA 2XXJA 3RUAA 3WSVA 4AJ1A 5KVCA 2PWZA 3BMCA 3ZWNA 3V1YA 4I5FA 1WMBA 1K3TA 3L6DA 3K8ZA 1C1XB 3DMYA 2CDCA 1A5ZA 3B20A 1KY4A 4PG4A 2CF5A 2LDXA 4IY1A 3AOEC 4BMNA 3PJFA 3WGYA 4KP7A 1ZJYA 1Y9EA 2W2KA 3ZZNA 1PGOA 3S55A 4BMVA 2QYSA 2VHVA 1XSEA 1HDCA 3DZBA 2CF6A 4GX0A 4ND4A 2VZ8A 2I99A 1GV1A 4L4RA 4RF4A 4WEQA 2QIOA 1X13A 2VQ3A 3U3XA 1HKUA 1GD1O 1LNQA 4FB5A 2IEDA 4JP2A 3HHPA 2OP0A 1EQUA 1ONNA 1TT7A 2QRJA 2WE7A 3BYZA 4FOSA 4JNKA 4Y9DA 1WNTA 3OIFA 1J49A 1DBVO 3BTOA 2D2IA 4UEOA 3WR5A 3GNQA 4TSKA 2JCVA 3QWHA 3ZV3A 1BMDA 3PHIA 1SOWA 1Z75A 4NJMB 5HA5A 4Q3DA 4XGKA 1E7MA 2X9VA 5I7FA 3W4KA 2C0CA 3C1AA 3QHAA 3FNEA 3DL2A 3GQVA 2YHIA 3PHJA 2C5EA 4G5HA 3O03A 1E3EA 4E2WA 1W0CA 3PVZA 5COBA 1R4NB 2Q3EA 4INAA 3G3EA 1T4BA 2Q1WA 2JFGA 3CIFA 4I1IA 3TOZA 3FPCA 3I52A 4WNCA 4BL5A 1UJMA 4WGGA 4GBJA 2GDZA 3RD5A 2QQ5A 2PGDA 4XYGA 3VH1A 4CJXA 3BTUA 2VYVA 2V7PA 4R16A 1V9LA 4UVEA 1LRJA 4FFPA 4DLAA 1MG5A 2JD0A 3N74A 5T8KA 4E12A 4FD3A 3AUUA 4BNJA 1KETA 1DSSG 1DJQA 2X22A 4MOWA 1I10A
chains in the Genus database with same CATH superfamily
3RBVA 1YIOA 1DI0A 3B3GA 1COWA 1FX0A 1IDOA 1SBQA 4WLOA 3GGJA 5A5FA 2ETVA 5J4VA 4W9MC 1OTXA 3TLXA 1ZGZA 3SDSA 1ZN9A 2X3FA 2J4CA 3BRQA 4NQRA 1OASA 4RMHA 1SWVA 1E2UA 2P91A 4W5QA 1DS6A 1DRJA 4OIFA 3I5XA 1K0FA 3BSSA 4MW4A 2PGOA 3DV0B 3H5WA 3CMMA 4GI1A 1PV2A 3A9UA 1V1MB 4RKQA 1QH1A 4L57A 1WUKS 5G4KA 4BV2A 1GSHA 1CY7A 2KJQA 4P92A 3KXIA 3QM1A 2IW1A 3VH4A 2P67A 1YOVA 5U9CA 2RK6A 2V0CA 1EUCB 2PZKA 1FQWA 2WUDA 1VSVA 3PL5A 4UHHA 4U6QA 5C1PA 3KTFA 2XB4A 1I7QB 1E94E 3O21A 2V4ZA 3PQ2A 3NHSA 1N7JA 1Z18A 3KFVA 4OQNA 4XDYA 3VC2A 5JASA 2R4UA 3NORA 4RZUA 1ODSA 2OLKA 3C1OA 3I32A 2QN9A 5K3BA 1T43A 4E4YA 1I2DA 3AY3A 4RKYA 3SD7A 3RK0A 1JPJA 2FFQA 5DM0A 4B6GA 2JVKA 2WFLB 1QRSA 2CY0A 3CNQS 4LHWA 1DAFA 1E0SA 2ATVA 2YFQA 4O0LA 3ETJA 1B1CA 1MJNA 4G97A 4JJIA 1LSSA 3EC7A 4JP1A 1QANA 4OXKA 1OZFA 2NU6A 2ZTVA 3GVIA 4RIFA 3VBCA 3KHKA 4ARUA 1WSDA 5KWIA 1U1CA 3L7YA 2GTHA 1OWNA 1LLQA 2WWFA 3CFYA 1DFHA 1EKXA 3IE1A 4N3CA 2EF1A 4FEAA 1P6UA 2E82A 1K8QA 1BE0A 3QUSA 3DWEX 1Z2DA 1ZGAA 4LHZA 4RMIA 5BYAA 2YR0A 1Z2AA 4RTKA 3ZW8A 4NBLA 5CPFA 4HDCA 1JHOA 4FFBA 5U1PA 1JJAA 3EDCA 1KMIY 2Q9BA 1UFQA 1F8UA 2Z9DA 3WBJA 3C7AA 4YRPA 1AF7A 4H7IA 1DHRA 1QP8A 2AYZA 3M2PA 4NG5A 5KBYA 4PSKA 3PRKE 4ITRC 2YMLA 4JJZA 4LVNA 3RS0A 4Q1FA 4J1SA 1KQ3A 1TX4B 2QRLA 1PZFA 1CQJB 3OZBA 2VWQA 4OKNA 4F3NA 5FUQA 1QGZA 2JGDB 2YCLA 1CULC 4KC0A 4RY9A 4HGRA 1KE1A 3HFGA 3CVUA 4MSUA 1E79D 2WFAA 4Z1OA 1T0UA 2Z2YA 3MJEA 1QNLA 1T4DA 2BHSA 3A1NA 2CB9A 4N5DA 5H4GA 3A4TA 3LUPA 4IMIB 1F2TA 3N39C 4LVCA 4HPWA 2XGOA 1KU0A 4WEOA 4CKCB 1A9YA 1BE1A 4TMVA 1XU4A 1NMEA 3FAKA 5D1NA 3WBFA 4EDFA 1LC0A 4EG7A 3NO4A 3WAKA 1QV6A 3PC6A 1K8RA 3D3EA 4QNMA 3DE0X 1RE0A 2WZBA 3PQ7A 4R7GA 2QRGA 4LMBA 1OZ0A 1IMOA 1ZWLA 4GIBA 4IG9A 4V0LA 2YV2A 5E6UB 3BQNB 3WWCA 4JX9A 5FFMA 2J4DA 2XUPA 3I1YA 4IIHA 3FDZA 1X8LA 2D1FA 4HFNA 4JB3A 3BK1A 4OXQA 3SM9A 2RJOA 1Y3HA 2ONKA 2NMVA 2Q1UA 1Z0JA 3PFGA 3QYJA 2J9RA 1G6Q1 1Q84A 2I76A 2J5QA 2OD2A 3P19A 5DHTA 5EP2A 4F9EA 2WQ7A 2YV3A 4A3SA 3ZW7A 3E6AA 1U2QA 3K1AA 3JALB 4MVJG 3ZVRA 3CF0A 1LQ2A 5DDIP 5KQLA 1G2QA 2VDUE 2GYVA 2W43A 1NN3A 4MWCA 3TFQA 1BN6A 3X1WA 1J0BA 4MDEA 1KU6A 2H18A 2Y0EA 3LYAA 5K3OA 4CQNA 4ASUD 1Y4UA 2QVCA 3EVTA 1PTKA 3FUWA 2XNHA 4ALMA 1EJBA 1G3RA 3BICA 1TZKA 3QWFA 2OMEA 2Q9CA 3CLTD 3T9FA 4C7MA 4LZZA 4DLRA 4ZHQF 3OZCA 3H19A 1OC2A 1FDUA 1PR6A 3QOWA 4TKUA 1POWA 1X70A 4K3UA 4ED9A 4B3RB 5F51A 4RXUA 3IPXA 1NJFA 1PZXA 2JLRA 3UK0A 5JY6A 4DUGD 2C4TA 3PDJA 5HS6A 3H2JA 3OFKA 5CD9A 1C7JA 3FOEC 1OT3A 3VAZA 1GT6A 3ZZMA 3DAPA 1D0SA 3ROFA 3AI7A 1X7ZA 3ZWVA 1IONA 1A98A 1X15A 2NLOA 4XVRA 4A26A 1TTQB 4B5LA 1KYQA 4YDQA 1G16A 1JXQA 1TT5B 2EZ9A 3EY4A 3HK2A 2PSFA 4G0UA 2XQVA 2BP7B 3LHSA 2IH5A 3KD2A 4JIGA 3N5CA 5A62A 3SXUA 4MDHA 4C22A 5BMVF 4MX8A 1P9RA 4MLZA 4ZGBA 5ALZA 2ZM5A 1B2RA 5G53C 1VG1A 2JFOA 4BFVA 4OMFG 4IDOA 4ZAYA 1YC2A 2RKBA 3FKQA 2PDAA 3TLKA 3H2SA 4EA6A 3RT9A 1Z0DA 4GPIB 1GZ3A 2R65A 4O5OA 3GRUA 1IDN1 1VBMA 3OHMA 4MAAA 1SCNE 3C45A 4MP6A 4AJEA 1ZR4A 2QR3A 2ZSAA 3NHJA 3OTIA 3SSOA 4GE3A 1BA2A 5DOVA 1SD5A 3STYA 1C4WA 3HJCA 2Q5CA 4AG6A 4B32A 4DCTA 1U1DA 4NCKA 4Q7QA 5BNIA 4DRZA 1ZRSA 3B8HA 3JZAA 4IH9A 3BZWA 4BVAA 4GLOA 1QHGA 1SXIA 4CMEA 4FHGA 3A06A 3LX6A 5HOQA 1LF0A 3C39A 1JG6A 2CNNA 4P4GA 3KWJA 3WRWA 5L3SB 2VF5X 5DEIA 2PLAA 5E2AA 2P69A 3VR4H 1ESMA 1Y3CE 3ASVA 5BXQC 2XKKA 1S7GA 4HYEA 2BBWA 1IZZA 3TQOA 1XQ9A 4BTLA 4FFVA 1R0ZA 5H59A 1XCBA 2CXXA 4FC7A 5KSZA 4U39A 1GUYA 4PBSA 1WXXA 4LOIA 3MT8A 2BDUA 2NVOA 1OTHA 1D2RA 4XGRA 4KITB 1USVA 1SNYA 2ABWA 4QSHA 1E2MA 5FI5A 1EESA 2C78A 3T12A 3KE9A 1XE3A 1V5IA 3TLJA 1UMCA 4Y0AA 4UNRA 1E69A 5KDDA 1SWWA 3ETGA 4IRMA 2QRMA 2DC1A 4Y2HA 5ETJA 2PZFA 4MRVA 3ZV6A 3R9XB 1XTBA 1TZMA 4LJ8A 4S35A 3GEBA 4C0LA 4QPCA 2OD9A 5FT9A 4FR2A 1QYIA 2EFYA 5EP1A 3U3OA 1M0EA 3JZIA 2AKEA 5EZSA 1ECFA 3CNBA 4Z7JA 1H5NA 221PA 2OM6A 2Y0CA 4X8HA 4C3ZA 2PR2A 3KZMA 2WG0A 1HLPA 4DDUA 1D4ZA 1L8XA 1V3UA 4RZ3A 5IYZB 2HMTA 2VTKA 2YCBA 3D6VA 4Z0PA 4MB6A 1MIOA 5F2OA 1T10A 5FUWA 1E3TA 4HEA1 3KKQA 5LZ7A 3DAGA 2AVDA 4I5IA 5HZMA 1YK1A 2PHZA 3AOEA 4KAXA 1A9PA 1VIDA 2H4FA 3EK2A 3VR5A 4YUZA 5I7UA 5IKEA 5JADA 2M9MA 2XJ4A 1M2OA 2QTCA 1V3TA 2VLIA 4QYMA 1W59A 3LUFA 4IYJA 1V8ZA 3RAGA 1R0CA 3Q0IA 4NU5A 5AKZA 3WLTA 3I6ZA 2J0SA 3G17A 2R1VA 3P2JA 4FFOA 2IFTA 1X1BA 4QQKA 4EX6A 4JP3A 2CYAA 5FL7D 4ECEA 2H48A 3OHSX 2WNSA 4RF3A 4B73A 3USZA 4L5JA 4BMYA 4CBVA 2I0FA 1EE1A 2UZIR 3TIFA 4GEKA 3VVBA 2I3DA 1UINA 2GAAA 5EWLA 4B4WA 4FKZA 5JQWA 3PLRA 5FNVF 4RACA 2B2XA 4RJJA 3RCBA 3HV2A 1R6TA 3Q87B 3FGNA 2CEKA 1ULUA 3NHAA 1KOGA 4D6XA 1IN8A 5FTKA 4MHTA 1EJ2A 1W88B 2X14A 3NTRA 3AVWA 4F06A 3WK4A 5BV2P 4V1CB 1E58A 1EFVB 4JJ7A 3AKCA 2X9QA 3NFRA 2O8DA 1PR3A 5KZMB 3UA3A 5CEFA 4HPJB 1L5LA 2XY4A 3ROPA 3TKAA 3CVVA 1KEZA 4K2AA 4X1KB 4NDNE 4OAQA 4WLVA 3H5OA 3DOFA 3QEBZ 2C5LA 3G2LA 3TR6A 1KAMA 3QUBA 4MW6A 1FY2A 2BELA 3T1QA 4BN4A 4EJ6A 2RK3A 3KLPX 5K8TA 1C3VA 1QIFA 3CF6R 3OUZA 3I83A 2AOTB 3BXZA 3DE7X 5D85A 2JCBA 3K0KA 5FWXA 1LSJA 1Q16A 4HXGA 5BURA 1XTRA 3WNQA 3E23A 5GY7A 3U7QB 3AFMA 3UKDA 4HV4A 5CFPA 4HAIA 3X43A 4QODA 5KI6A 1YJQA 1UOQA 4B79A 1NNSA 1Y6ZA 4I9HA 3FWPA 2O3SA 2MHCA 2Z9BA 3V1UA 1SCAA 4PQEA 1E7RA 1D0IA 1CE8A 2ET6A 1JDNA 3E70C 3SQDA 3ZV4A 4ABYA 2ZUCA 2QVLA 2WNIA 4RPCA 1R4MA 5BSFA 1XFAA 4HYYA 4QDZA 3R3SA 1IJEA 1S3SA 3RFXA 5KQRA 1N2OA 3Q9LA 4BLSA 3IV7A 4EG0A 3HCNA 2IPLA 1O4WA 3SYRA 1FYDA 3I0ZA 5JIBA 1ZUHA 3LVFO 5CA1F 4GI7A 4F7WA 3GC6A 2NSLA 2PMDA 3OOWA 3OZFA 1LDYA 3DR3A 4RA9A 4JSTA 2C84A 1XEWY 2P62A 2JGJA 1WDLA 4K0RA 2CT8A 1Z4NA 2WSYB 2BGWA 2HCTA 4OQXA 3LK6A 4MA4A 1NW8A 2HMYB 3A0UA 3OF2A 4C21A 2G06A 4CG1A 4B3HA 4I08A 1XL0A 3C0KA 8ADHA 1YR6A 1T6XA 2WHPA 4HDAA 2HW8A 1NJ5A 4S1VA 1F2DA 4G1CA 1E4EA 2NUAB 5FRDA 1F2UA 1TMYA 1R5JA 2WSIA 1BMTA 4F4FA 3KWFA 2DY0A 1GQQA 4ZVRA 4UAJA 3U7GA 2FQYA 2ON6A 2BV3A 3HY6A 2BFOA 4L4XA 2IP2A 1HYBA 2CEAA 1YVUA 1KOJA 2HC9A 1KDOA 1KY2A 2A1UA 1DJMA 5HJ5A 1D2MA 4J07A 3TEJA 4CKBB 2AJCA 4NS1A 1G4HA 3AETA 4A9AA 1CZLA 3GP3A 5JJKA 2CUZA 2R96A 3D7SA 2K2QB 5AT1A 2X1LA 1LSUA 3LPMA 2W93A 2G9QA 4C6TA 3ZD7A 1Y5RA 3G1UA 3HKBB 5AUNB 1AKQA 4KEAA 4CM9D 2DTEA 1TI7A 2QMUA 5DKFA 1KOLA 3RBXA 2QVXX 1PWYE 3PJEA 1I13A 1VLLA 4B6SA 1NBAA 4UTOA 4DMHA 2V4UA 3WAGA 2FFBA 3IAHA 3AQIA 4QRIA 2VSNA 4MRSA 4QNRA 3AF0A 4JN6B 4Z5XA 2DBVO 2PK3A 4G0XA 1JR6A 4EG5A 4REQB 5HX7A 4KTTE 3BGSA 1Q7GA 2DU8A 4JVSB 4Q7EA 3ZWMA 4F93B 4MHSA 2JFPA 2BGLA 1ZCBA 3AJEA 2I55A 3GGCA 3LW8A 4V39A 4BNNA 2XADA 4OHOA 2IOFK 1T5BA 5I9SA 5HE8A 1LLUA 5ESWA 1XCJA 4JA0A 4G0YA 2XJ9A 4H6PA 1DFGA 1K6JA 1A9SA 4YLGA 5JO9A 3U39A 2I8LA 2B8TA 3GMDA 2BGRA 5LMUB 2QZJA 3IAXA 4N3AA 2CNDA 1FTSA 2FPWA 1ZI9A 3GJ5A 2EP5A 5EXTA 4YRBA 2HNAA 2HU2A 3Q6MA 4WXEA 4ER3A 1RMQA 2PFKA 2HZ7A 3NMUF 5KHAA 2CLOB 3H05A 3QY0A 1DO8A 1MDFA 1JEDA 1TD1A 1GHTA 3HY4A 3PC8A 3V7YA 3VPCA 1EH5A 2UV8A 3WS7A 4MGHA 3R77A 4CHGA 5KJ1A 2XA9A 3GUCA 4JBWA 4NZYA 2DKNA 4X6LA 3VO8A 4BVFA 2DULA 1AZTA 3TLGB 3ILSA 1SXPA 1E2QA 3PKZA 3MB5A 4FWIB 5CYPA 2C9MA 5CB0A 3ADCA 1IHYA 2OUIA 4YRFA 1CR2A 2GKSA 3HCFA 2GYWA 3ME5A 4PAWA 3WYGA 1YJ8A 2GJKA 5B4VA 1F17A 1ENYA 3O8NA 4MVYA 2Y4NA 2WWTA 3L5KA 2YASA 4G0PA 4WK6A 3MPUA 2NZ2A 4UEKA 2KSQA 4DRXB 4J75A 2AKAB 3V6MA 1RYBA 1VLVA 5KX5A 1QSGA 2PCJA 2PMBA 4WX2B 1R0SA 2XUOA 2EHDA 2Q7DA 3PC3A 2XZDA 5DTJA 3SEQA 4BIMA 1GGKA 2FWMX 1I7LA 2AWOA 4R31A 1KAOA 2R6JA 4F3RA 3ADDA 3LZDA 4YREA 3HN2A 1SU7A 2BL4A 2Q7XA 2KS6A 1QGYA 4Y9SA 2R4TA 5ARBA 4WFIA 5EE3A 5AVWA 3HE3A 3RQSA 1Q3HA 1Q74A 1MT3A 1TRKA 4DLKA 5HPYB 2P9JA 5IAOA 2PWBA 4B44A 2IQIA 4K81B 1ULSA 4WLFA 3KZKA 2BFMA 3HABA 5F5XA 4QJ4A 5JZBA 2RKWA 3R5KA 5FOTA 5TT1A 2E3JA 4N65A 1NQUA 5A9SA 5KTKA 2RGUA 1J2YA 3R44A 3W78A 4EZEA 5K0ZA 4N0DA 5HP4A 4RYDA 2QSUA 2FPOA 3FMPB 4WT7A 3SEFA 2DB3A 5JYCA 3PWTA 3CVJA 5JPDA 3WDSA 3G1TA 3AJRA 2J46A 2R8EA 1KO1A 2RGBA 4QJ3A 4S05A 4BNKA 2ZJ7A 1NUQA 4N0MA 2IQ5A 4Z1MD 5IH7A 1O94C 1B8VA 2EJVA 1YMVA 3IURA 4LSMA 4GG1A 2ZROA 1WSWA 4LMAA 2DQSA 2OK8A 2PD6A 2QTNA 3FMIA 4CQMD 1OPXA 4PAOA 1FFXB 4S0ZA 5A71A 3TCNA 4K9LA 2HR1A 1W76A 1WB6A 4DMKA 3DTVB 4F1KA 3RSQA 3DE3X 4GZ3A 1GCOA 1X80A 4KQ9A 1O0BA 1R0YA 1Q1QA 2EJCA 4B3FX 3TQTA 1GA1A 3F6BX 3VGPA 1EVIA 3WRYA 1V5WA 3HRHA 2ACKA 2C88A 3U4IA 9ATCA 2R5FA 4Z9BA 3AVYA 1HQDA 2FWAA 2GLTA 4BB9A 3ORYA 1VA5A 2ORWA 3E4CA 3BWBA 1XRJA 3WKBA 3L1JA 4G5OA 4CQLA 5I4CA 1JHPA 4M9QA 1CIJA 3GRCA 2ZJ5A 3EDYA 2PUFA 1SIOA 1YJ5A 2J3QA 4IMRA 3R74A 3UXYA 4JKYA 1Y8QA 4N49A 4CR7A 3X1ZA 2L19A 1X7YB 3MJRA 2LTAA 3P0EA 4MJLA 4ZT3A 1P1JA 5AKKA 3P94A 1F9EA 4JC4A 3C6BA 1FX0B 4GD3Q 4COOA 4W9NC 3VR6D 4MA5A 5B7QA 1YMQA 5FTNA 4L72A 3ORQA 3Q0TA 3HCWA 4LISA 4ZEVA 3O8CA 3OFNA 2G9ZA 1JQ3A 4B3DA 1IMJA 1P4HA 2A0YA 3B1KA 5E4JA 1QH1B 2WU0A 1RAHA 3W2EA 2R86A 4JLAA 5C1DA 1L5ZA 5AK4A 3RC9A 4YCSA 4RVSA 5KYYB 3IAM1 2GLUA 1YOVB 3ROGA 3TZHA 1NXPA 3ZZ0A 4BBJA 1MKYA 4LF7B 1G3QA 2YS7A 2QRVA 3BJZA 1M8JA 1UFKA 2IEAA 4KQWA 4XM2A 1MZPA 5ALXA 5FYQA 2LKDA 5IXJA 1OGIA 4G36A 2ZIFA 4DEVA 5KQGA 2W5UA 3GVPA 1Z2PX 2ZPUA 3MJSA 3C4QA 1CUSA 5EIOA 5CGZA 2UUAB 1MLDA 1CU1A 3H65A 3W6UA 3OLXA 4DM4A 1EFLA 4UFPA 3AO0B 4QGSA 2VA8A 5E2IA 4RYLA 3FTCA 2HNBA 1UOEA 1NVKA 1ISFA 2RHGB 4L4YA 3EQZA 1B76A 3O7MA 4EK9A 1GAQA 2G25A 4ND3A 4UD2A 1HV8A 4ZT2A 3P2EA 2UZ0A 1KR2A 2LD4A 3ZHUA 4E5DA 4JHLA 1T6YA 2WIFA 1AZSC 3KPYA 3VHLB 3K5WA 3M1AA 4AWXA 4PIMA 4YRKA 1S2DA 4NBWA 3QU5A 1GVNB 4FU0A 1KSFX 5FOUA 1QRTA 1SXJC 2MSNA 4GECA 4RD2A 5E7JA 4CKWA 2FSUA 1QYVA 2FDCA 4N0EA 5KVVA 1T1SA 2J9YB 3VQTA 2D2XA 4QIHA 5G0TA 4YJGB 2BKLA 2C2GA 3M0EA 5IM5A 3U49A 1R50A 2H07A 1CBUA 2J6IA 3HN7A 3T15A 3HU2A 1DWPA 4IYRA 4ZO7A 1UPAA 1FS5A 3IVGA 1J9ZA 2XDWA 4QRHA 4TXNA 2V9ZA 1LVHA 4AJHA 3QKSA 4MINA 1L3IA 4WN9A 5BPFA 3TNDA 2VDMB 1RD4A 3WV4A 1ZMOA 5L3QA 3R5JA 4G0ZA 3ZH9B 4CIDA 4HDKA 4P53A 2NO4A 2GHIA 4YROA 3ZE9A 1ZSNA 2ZXEA 3IO3A 3MTQA 4QHYA 4W1PA 3WJ7A 1KERA 2PO5A 1D2EA 1YI1A 1QO0D 1E2FA 1ADYA 3PJDA 5GM2A 1RC0A 3O9MA 1GA6A 4C4OA 3DF9A 4DLYA 3O2SB 3A3NA 1I32A 2J1LA 1SZDA 3EIHA 2CLHB 1ONSA 3F96A 2ZGVA 2G1UA 5BMVA 3UWDA 5J58A 1ZIDA 4AU1A 1XV5A 4FNGA 4EFKA 4ZYVA 4AYTA 1T1EA 2EIXA 3HUEA 4QBTA 2ZAOA 1PSZA 4JFRA 2YFHA 4TTAA 4O1HA 6GPBA 2ZUFA 3ZLVA 3TLMA 3C2QA 4LI0A 1S0UA 3L6OO 5SYMA 5EUMA 3OI7A 1EM8B 1N6IA 1UKVY 1ZS9A 4YX9A 3MWFA 3J80A 1NDHA 5TMDA 1JEYB 3HRKA 1NFQA 2BRUC 3JD1A 3T54A 2AJDA 5C46F 4RIEA 1NX9A 3RJTA 2VL7A 1Y5LA 4N5HX 3E9ZA 1JW9B 3A6GA 2QDXA 2PD4A 1XMSA 3CZAA 3NKLA 3RROA 1F0YA 1T0PA 4M22A 4Z49A 1JIIA 1V2HE 4M8IA 5IKXA 1FS4A 3EE6A 2F9FA 5BSVA 1O8CA 3NOVA 4YRSA 3JWGA 1FL9A 3D8BA 3EGXA 4WPGA 2G5CA 4P36A 3HBFA 4TKUB 1VCIA 1B26A 3T6KA 1W2WB 4F5ZA 3D3QA 1PR2A 2XH8A 1JKIA 4RDCA 5KNDH 2CMDA 3BIJA 3CRW1 2HIGA 4OEHA 5I7SA 2O14A 2GPNA 1W19A 5B30A 2H63A 2UZ1B 3V7NA 1UXJA 3RF6A 3T4EA 3O8QB 4R05A 4FFLA 4KX5A 1V9CA 4PHFA 4KNWA 4WZBB 3GLHB 1X7ZB 8AT1A 2P5UA 1JLLA 4KSBA 3NEPX 2RI1A 3D0KA 4FLMA 3L8HA 4W6QA 1EGMB 2LW7A 1AKYA 1X1DA 4LF9B 4H17A 4DSOA 1SHKA 3KKZA 2VYVD 4W8OA 3PHGA 1C4XA 5B4TA 1UQTA 3SXUB 4JJ6A 4MRNA 2HWXA 2PKYX 1R8SA 4HQOA 5ALWA 2ZUVA 1ZINA 5AVQA 1IEVA 4OK5A 3F90A 1FZTA 3SOZA 1DAGA 4US2R 1R7RA 5ALSA 3OURA 3U4MA 2D5CA 1YU6A 3WBBA 3ZCSA 2QT1A 4DSAA 3PDUA 1B0ZA 2IITA 4X44A 3UJPA 2RC5A 2OA0A 1GPMA 2BUBA 2JANA 3TRIA 4GKAA 4B6RA 5CITA 2ZSJA 1WAMA 4LZOA 2F1OA 2QRHA 1PF7E 1USIA 2X0JA 4M9XA 2PH1A 1CFZA 2C20A 1AA6A 2NXJA 2WLTA 2HSDA 4GL4A 1RAEA 1FRZA 3F2IA 3TRFA 1L3BA 5KOHA 2AC2A 2GN9A 3KM0A 1RPNA 2OCIA 1E1YA 4NU6A 5EQTA 4FT4A 1Q0HA 2X5KO 1H4VB 3BXHA 2FPUA 1NR5A 1ATZA 3CX4A 1AURA 4NH0A 1APBA 4TQUS 1Z6XA 2GUWA 5DXAA 4HT3B 2ECOA 4GNRA 3FSJX 2FDXA 1AIPA 4K46A 3O9VA 2WD9A 5CJJA 3LWNA 4EYOA 3D2CA 3VR5D 1NHWA 4R8SA 4L0MA 3RSLA 1PT7A 1YU9A 1A4RA 3BVPA 3HS3A 3CZCA 4WKCA 1BKYA 4GXNA 2H57A 3DHEA 1I51A 3ND9A 5HKOA 1G59A 1GGMA 4H7PA 1H85A 2G77B 2X6QA 1ZOOA 5IULC 4TTQA 1P0FA 1A69A 1JH8A 4QULA 3GLHE 3CPJB 4WZBE 5K3EA 1E6UA 1F0KA 3S1LA 3HXOA 5DNEA 3OJCA 2R2AA 1S8OA 3NTLA 2DHDA 3O4HA 1BH2A 1Z7BA 3IALA 1P6QA 5JS8A 3NH9A 1CYDA 4OUDA 3OCJA 2AT1A 1KO8A 5HGJA 1P9OA 3BSFA 3DLTA 1T9ZA 4D41A 2GUGA 4B6QA 4BNXA 3H6KA 3EDMA 1QHNA 5AJHA 1Y3FE 1F38A 2V6GA 2CFRA 2FPPA 3K8QA 3JSXA 3SU8A 1NASA 4OY3A 3CCBA 1CWUA 3WXMA 4IMJB 1KI4A 2JBWA 3QX8A 4JYZA 2D6FA 1O95C 1RM3A 5TT0A 1FP7A 1M2OB 2V5UA 3QSGA 3EQ2A 2OG1A 3ZI7A 3JQBC 5LBUA 1CS0B 3LPCA 4JI3B 2DTXA 4BO0A 5EPOA 4A6DA 3E3NA 5K2MA 3ZDYB 1D5CA 1SC6A 2C3YA 3N0TA 2FU5C 1JQDA 3OO1A 3PR1A 2E4YA 1IUKA 1DBWA 4XH9B 1XJQA 5EI5A 4XD2A 4LMPA 2AA3A 3HGTA 2FMXA 4OKSA 2OGUA 4Q02A 1G18A 4Q00A 4CQJA 4M86A 5LZ4A 2I66A 4HLQB 2AX4A 2V8BA 3CSSA 3D6TB 2V6BA 4JCOA 5EWLB 2CNWA 5AXCA 4HEHA 5E6RA 4ZYLA 3RSOA 3QE0A 2H2HA 2GD0A 4G8BA 3IESA 4IL5A 5CA1A 3HM2A 2GO7A 4X3PA 4LYJA 5HFJA 3JWEA 1AY0A 4D9EA 2C29D 4G0WA 2VP2A 4PHHA 1TAGA 4C29A 4OL9A 3DS8A 3VPAA 1FJHA 2GPTA 4IS2A 3NT5A 5LU8A 1H69A 4G0VA 3AM3A 2C97A 2CGEA 1I80A 4FMCB 5F7ZA 4D79A 721PA 2Z6AA 2PGAA 5BW6B 4D0GA 4FKMA 3C8MA 3RM3A 2C42A 4QX6A 3Q72A 1CUXA 2QSJA 2VF2A 3C5EA 4QDJA 4YRDA 3GD7A 1FFAA 2Q0SA 4KQIA 3RNOA 1ZR2A 5JD5A 2DJIA 1HGXA 1K63A 2NVWA 1P91A 3OMWA 4LPKA 3RUCA 4EJSA 3TECE 3STTA 1T0HB 3D9QX 3DMPA 2QZPA 4KOAA 3TAXA 5SZKB 1GNRA 4BAZA 2GZSA 1BXZA 5FWXB 1G9SA 3QG1A 3VOAA 4TRNA 5AOCA 1NMQA 1VLZA 1X14A 1M2JA 4JBHA 4N7BA 4XSVA 1Q0QA 3NNDA 5E8JA 3RRFA 4TLBA 3FJYA 1MABB 2AQKA 3ACDA 4BO7A 4DAOA 5AXDA 5BT9A 3PD0A 1IXYA 1LX6A 2O23A 3KHUA 3TIIA 3EXFA 1YGPA 3GUZA 5MDHA 4R8RA 1XLVA 4QOFA 4BEJA 3T5AA 1R4MB 4YPFA 4EHKA 1IH8A 1IY2A 4XI9A 1EEHA 2BSQA 1PQ4A 1HEIA 3BJRA 2FPGA 2G40A 1TJ3A 4OXRA 4X5OA 2XVXA 3TD9A 4YV0A 1QHHA 4EB8A 1MX3A 2YC4C 1I3LA 4OPMA 4KFUA 1ONOA 1CQIA 2EWVA 3TQRA 1GADO 5IAKA 5AQEA 3EA5A 3LY9A 5ITSA 3BWXA 3VDRA 4FSHA 3EWIA 4Q18A 3KFXA 4DA0A 3KYDB 3EUAA 5DYNA 5HNKA 3VKGA 3TZKA 1WMSA 4F4IA 2O2JA 1LGYA 3HWRA 5JTTA 2VF7A 1SO8A 2CXTA 2AQ8A 2A86A 1U5BB 1P0CA 2JI7A 1QMGA 3HZZA 4LHSA 4Z7QB 5JS1A 3GRAA 3I72A 3EF0A 2I2AA 2RHWA 3B7GA 1XAHA 3BCHA 3DEJA 2AK3A 1C41A 1F2UB 1CLEA 1OQAA 3KUKA 4OBXA 4PBRA 3WGVA 1E9DA 4YCNA 3AV3A 1PFVA 3LX8A 1BS2A 3TPCA 3D6NB 1PL7A 2AXNA 4C7KA 3TSCA 5IXYA 1ZPDA 4YC7A 3UA4A 2BSXA 1OXMA 3V1TC 4UBJA 3PJGA 4XTRA 3I58A 4WCFC 2C4WA 3CF4A 1CEEA 3IBTA 4YGXB 4XJVA 4FX2A 2D5AA 2HN9A 3PXDA 2GT1A 4S1WA 3UMCA 4QL3A 2ZTHA 3GRKA 2WUVA 1E77A 3TSAA 4EFDA 4MS4B 3S70A 4RQAA 1HZZC 2ZJ6A 4N0QA 5DSZA 1N5JA 1T9GS 1U3VA 4BNYA 2WMOB 4LWQA 1XU7A 3VYUB 1UM8A 2FRDC 4M9CA 5AVYA 2FMHA 3VPDA 2G7MC 3TUZC 3DE5X 2B6HA 5I7OA 3HI6A 3ZY3A 3MCAA 1NVGA 4GFDA 2XF8A 2YZNA 2I67A 2RI6A 4EGSA 1YZVA 2OHGA 2O3UA 3WJ2A 4DEXA 5DMXA 2ZSEA 5ARCA 4WFQA 2D5BA 3NTQA 2K2WA 3AIKA 4WY5A 1U94A 1AQYA 1SBIA 1ZCAA 2EEZA 3D3JA 3GVCA 5F1KA 3TQIA 1USWA 5JMTA 4YYEA 1L6RA 2R87A 3EH1A 3KAQA 4IXWA 3PXEA 4B7CA 1E9FA 3WMGA 3JY6A 3RWBA 4LVUA 1Z13A 5DIZA 3ZUGA 2WV7A 1Z7YA 4TL9A 4WESB 5IARA 3WDLA 2PUWA 1RAGA 1NVXQ 3KR2A 3UPUA 2FUKA 3ADKA 1VE9A 1W4AA 1Z6GA 4J03A 1T1IA 4R7ZA 3T9AA 2EP7A 3IB3A 3MCZA 2DUUA 2HSJA 3A6EA 3N76A 1PLKA 1G1MA 2XWBF 5KTMA 4PZLA 4UZEA 4D4LA 5K3SA 2Y0DA 2B1QA 3NDPA 5AFSA 2ATIA 3D0OA 4J1TC 4PPGA 2O9JA 1Z5WA 1M54A 4I9NA 3I92A 2WM9B 3B6EA 1XLUA 3GPIA 5DASA 5TXGA 4B0PA 3NXKA 4UDXX 3I2IA 5IAEA 3O93A 5JYEA 4UREA 3OAAD 4IIDA 1J0XO 2R6FA 2WJ4A 4M38A 1IBLB 1B0UA 4RMGA 5DWVA 4OXNA 2G6TA 4IEFB 4PCVA 1MAVA 2ZYTX 2ZUUA 4CEIB 4FP9A 1N3YA 3FBTA 3GAAA 1D7OA 4P86A 5D2CA 3L7JA 4F2PA 4EY8A 5BVGB 1ATIA 2BHTA 1TJYA 2CC2A 3OICA 2WDPA 4U7WA 2APJA 3I8OA 1RI1A 5FDFA 3OQPA 1DQZA 5LP6A 1D03A 1JQKA 2QDKA 4CM3A 1YR2A 2PT5A 5A5GA 2NTVA 2ZJFA 2VDOB 3FYUA 3KZOA 4HAZA 1QF7A 4I5DA 3ZK7A 4LF5B 2CWDA 4MKGA 4CPDA 2FN3A 1O87A 3S7TA 4YP6A 1M2KA 2FCRA 4FINA 4OGLA 3LPDA 2O7QA 4ITVA 4PRKA 4X60A 5E3JA 4FOPA 3T1NA 1HH4A 1QS0B 5F3WB 3KELA 5AQ1A 1NM5C 2OSBA 2J9FA 2XNDA 1EJ0A 3K3PA 2DT5A 1KH1A 3MUEA 4I6JA 1X9IA 1BJTA 2OFXA 4KXNA 1NXQA 4AVYA 1E9RA 2KQUA 4IOLA 5J4HA 1HK7A 2WWGA 3CNNA 4HYTA 5ELLA 3GJQA 1KI2A 1U1EA 1WEKA 2CJYA 3IOCA 4LJ9A 1N7HA 1EJ6A 4HOYA 2QTVB 2G4CA 1JSRA 1MAHA 4D9HA 3PD7A 1BAPA 4TZ0A 1XI2A 4J0JA 3G0IA 1KP2A 5AP9A 1RWKA 5F7JA 1DKOA 5EHIA 3MXTA 2HDHA 4EVSA 2BI4A 2CLKB 1B23P 5GJBA 1GNSA 2D5IA 3FR7A 5K6TA 3DSRA 4PM4A 1R15A 4FC6A 5I8ZA 1ISMA 3NYWA 4S2UA 3EQ8A 1U0BB 2GWRA 2V58A 3IP3A 1DZIA 4C0SA 4TLEA 1N2JA 1R66A 4P84A 1WVGA 3WSTA 1NF8A 4F6RA 5JZ9A 3HXTA 4D5EA 4E6PA 4W4TA 3DA8A 1G60A 5FR2A 4KNYA 2BTEA 1N2CB 1JUDA 1NNI1 2F43A 1QV9A 4DWWA 4WINA 1PT8A 4HMQA 4QDOA 4MQ5A 3JXEA 4MVJI 2VHZA 1JFFB 1PUXA 3SBEA 4BMCA 3IP6A 2IP1A 2CD9A 3MNFA 3ZDRA 4C08A 3P2YA 2ZIAA 1T5DX 3L0ZA 1O96A 4H15A 1OF1A 1PG2A 2DETA 1RAFA 3S99A 1K27A 3TSOA 4FS3A 1GYRA 2JZNA 3SC6A 1DUVG 2Y8EA 3QI2A 4ND6A 3AFHA 2VBFA 3AUXA 1KAEA 1Y8QB 3ISVA 3PENA 3EGEA 2AS0A 3IVAA 3BRWA 4KUEA 3I9FA 5AVUA 5FOVA 3G0OA 1YZNA 1NOIA 4QQ8A 4TMYA 4U5XA 4CCWA 2P6PA 2OP1A 4I1UA 3CWQA 1YQQA 3JWIA 2QI9F 2DR2A 2IXDA 3B5IA 3SQMA 5F7OA 1YNSA 3K53A 5C31A 1IXRC 1OXTA 4FD2A 5LYJA 1UBUS 2O5VA 4Z7OB 4UU7A 1QTRA 4FEEA 4GC5A 1ZOLA 2GCPA 2TYSB 1EK2A 2OO3A 2ZB7A 2NU8A 3Q9NA 1P4SA 1HT2E 2QMZA 3T3OA 4I55F 4K9DA 3LC2O 1WXQA 2OHVA 4E08A 5EQFA 3OY7A 1OXVA 3KUUA 4EPXA 5LQJA 3GA7A 1N34B 4B40A 4QWMA 2KM1A 1YDMA 5CR9A 4HZUB 2BZ1A 2J3LA 4HXYA 3U6BA 5AUPB 2CNBA 4EAAA 2GK7A 3H13A 2EZ4A 3E7XA 1T26A 4LOLA 2OYRA 2OC4A 3ISTA 3I5UA 1IJBA 1D2HA 1GZ5A 1K92A 1PQUA 1Z0ZA 2JBAB 5FO1A 4P5DA 1E2NA 2NZUG 3ENZA 3QA3E 4H1UA 4RBNA 1DAMA 4AX4A 4OYHA 1S1MA 4DLUA 1BO6A 5JRZA 1XL1A 3VTAA 1DEXA 3PDWA 1J8QA 3GRVA 1U7OA 4PSUA 1CY0A 1AK1A 1KVQA 1N2CE 1P2DA 4JYBA 1L7DA 5K8LA 2YWBA 5L6LB 2VPPA 2LXNA 4TWAA 4GKKB 1WP4A 1J23A 2JIDA 4EF4A 2JASA 4D02A 2PQ6A 1SOMA 4POOA 2Y2UA 2ZRQA 1MOZA 3FCOA 5ELMA 4YHBA 4HH3C 4LRQA 2AF3C 4F2GA 4A6XA 8ATCA 1RHRA 4GMKA 5HDQA 5THKA 3V3TA 2IP4A 5KTSA 3E9MA 3L7IA 1Z83A 5J2UA 2H1OA 2VTVA 2FEXA 1V16A 2HIMA 2Q41A 1U6JA 3P32A 4CW7A 5IN4A 4K6CA 4OI0A 3RYCB 4Y6LA 2B8NA 5JQGA 2MOKA 2G4VA 3D64A 2ANCA 3GOQA 3GJRA 5J63A 1JB9A 3Q11A 4ZHQB 3LUAA 1IM8A 1W0JA 3HHEA 4EPYA 3UWKA 4WN9B 5EIWA 5KNLA 5KYXA 2AXQA 4QFBA 3EPKA 1ORHA 3JQ8B 3O4VA 4RTJA 4HDKB 3QJ5A 1WQ4A 1TQ6A 1F2VA 3G7UA 1XHEA 5EHQA 3KLOA 1NF2A 5EL0A 1YZFA 2W8BA 1G5PA 1YRBA 4DG8A 2Y66A 3GN1A 5AJWA 2X0IA 2YRFA 3O75A 3QVGB 4ERXA 3N7AA 3NH6A 2I7TA 1KK2A 1ADJA 3OJLA 4JYCA 4MVXA 1YJAA 5DJ5A 2R1TB 5FNZA 2O7VA 2C7OA 3WIOA 1O95D 3CSUA 3BJEA 4JLVA 3IMCA 2GK3A 3CO0S 2WT4A 5BMVB 2VAWA 1ZMXA 3JAMA 4DLLA 4YMUA 1VYTA 4BYMA 2O8BB 1WF3A 2V0GA 3Q3IA 2EFJA 7ADHA 2R47A 4MUGA 1N92A 3ENKA 1GPH1 3AW9A 2QN8A 4NPHA 4X45A 3SC4A 2CXHA 3VZBA 3PXGA 3SC2A 2NZJA 3KQQA 1IBKB 5A0VA 4M7PA 3ZCTA 2MSEB 2ZRPA 2PX2A 3GJ3A 4RKRA 4E14A 2M98A 2WA1A 3PK0A 4A4DA 1UK7A 1V37A 1DPFA 2H4HA 5CMLA 3VGJA 4OOFA 4X6XA 4EHFA 1L2TA 2E37A 1C7EA 1OB2A 1X77A 3ZGYA 3AL3A 4JU9A 6ADHA 3ID6C 4XJTA 3UJAA 1QF6A 2MINB 3OC0A 1WWKA 3QLVA 4UJ3A 2NN3C 2NPIA 2Q7OE 4Y2SA 5CB4A 3HGQA 5K01A 5PNTA 1FQJA 3EGXB 2PH3A 4WKOA 2IV7A 4RU1A 3IULA 4X7PA 3UTDA 3PGLA 5B57C 1QP0A 2AR9A 2IV2X 4F4UA 1P0IA 1OHHD 1QC5B 3P71T 1L4FA 4Q47A 4F21A 3DTYA 4C6HA 4DCVA 4BGVA 1JYEA 1DBQA 1QIIA 1NF9A 1PJZA 4Q3OA 3G8DA 3I3SR 4GPTA 4BVJA 4DYDA 4P3PA 1FNDA 1P0MA 4HLCA 4X1OA 1W36D 4W5OA 4TZ6A 1WPRA 1BROA 3MT9A 4P3OA 621PA 4ENPA 3AR8A 3M6IA 3P0IA 1B15A 2DH6A 1X1SA 3ZWBA 1R4ZA 1UZUA 2HIHA 3DWGA 2H2DA 1CUGA 1H2WA 3M34A 1QFZA 3PHCA 4KWEA 2OCXA 4DQUA 3NCTA 5BR7A 1L1EA 2JLBA 3BFVA 1VJCA 4IDDA 3TQHA 4PYRA 3B1FA 4C4AA 4RWZA 3U19A 1CUEA 1YFZA 3KOWA 5C53B 2R6AA 5T3UA 2ZIWB 4YRCA 2P9CA 3SIXA 3I2GA 3J81A 4X9XA 1LXCA 4GQIA 3KQYA 3K9QO 4N3GA 1FLNA 1P5RA 4V3BA 3RS4A 2C3MA 1PE0A 3MJCA