3EGOA

Crystal structure of probable 2-dehydropantoate 2-reductase pane from bacillus subtilis
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
292
structure length
292
Chain Sequence
b'SLKIGIIGGGSVGLLCAYYLSLYHDVTVVTRRQEQAAAIQSEGIRLYKGGEEFRADCSADTSINSDFDLLVVTVKQHQLQSVFSSLERIGKTNILFLQNGMGHIHDLKDWHVGHSIYVGIVEHGAVRKSDTAVDHTGLGAIKWSAFDDAEPDRLNILFQHNHSDFPIYYETDWYRLLTGKLIVNACINPLTALLQVKNGELLTTPAYLAFMKLVFQEACRILKLENEEKAWERVQAVCGQTKENRSSMLVDVIGGRQTEADAIIGYLLKEASLQGLDAVHLEFLYGSIKALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 2-dehydropantoate 2-reductase
publication title Crystal structure of Probable 2-dehydropantoate 2-reductase panE from Bacillus Subtilis
rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 102
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 1.1.1.169: 2-dehydropantoate 2-reductase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02558 ApbA Ketopantoate reductase PanE/ApbA
A PF08546 ApbA_C Ketopantoate reductase PanE/ApbA C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3egoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3egoA01
1V6AA 1FDVA 4BNUA 1ADFA 4Q39A 2CZCA 4XJTA 4DTIA 4OSPA 3FHLA 1QYCA 2DTDA 4Q3NA 2P2SA 3WJ7A 4Z0PA 4BIIA 1ENZA 2NU8A 2YV3A 4IJVA 2E48A 4ALJA 4IJUA 5T6BA 1XQ1A 4WLUA 4TZKA 1I8TA 2NM0A 3AI2A 4YTEA 3K73O 4ZU3A 3UF0A 3DBHA 3WGOA 4CV3A 2ILTA 4RGBA 3CXRA 4YAGA 4HNHA 3FNFA 2O48X 1P0CA 1I3KA 3Q11A 3M2TA 3GVHA 3GZNA 4RCVA 4XGKA 2GSDA 4CUKA 1C1XA 5L4SA 4BKQA 3PPIA 4OH1A 1U3VA 3PJEA 5TSDA 3KM0A 2JD1A 2IDZA 5L45A 1JN0A 1R0LA 4IDBA 3LK7A 4J3FA 3VPFA 2JCXA 4BMNA 4CUZA 4PLWA 4FQ8A 1HEUA 4BGIA 4BNIA 1LXCA 2IEBA 2Y67A 2QZ9A 3P2YA 4XQGA 4E5PA 2FHSA 1YS4A 4RQUA 2NTVA 2ZYAA 3O9ZA 1NXQA 3EUWA 2W8ZA 1YB1A 2PKQP 3ZU4A 4E6PA 1JDJA 3DONA 5LDGA 1IULA 1IY8A 1VI2A 1WDMA 4K6FA 4K6CA 1EEHA 4XRGA 1J6UA 3PDUA 1PX0A 2Q99A 4YB8A 5DOVA 1QLHA 3BA1A 1P1JA 3AY3A 1T2CA 3F3SA 1R4NA 1Z75A 5IFLA 2E37A 3DAFA 2HMWA 2C5EA 3BMCB 2Q1TA 1K3TA 3GG2A 4BO5A 5ICMA 2QRKA 4DQUA 4HWKA 5JSFA 1NFRA 3HDJA 1GQQA 3DAPA 3RJ9A 4AJIA 1NQOA 3U3XA 3DTYA 3LYLA 2W4QA 4NJMA 4WCFC 3DZBA 5KJEA 3LF2A 1M2WA 1YOVB 1ADCA 3JQAD 3GVPA 2J5RA 1C0LA 4OYRA 4JBHA 3TDKA 4ALMA 2EJVA 5I7SA 2VWGA 1U3TA 3P19A 4RF2A 4OXYA 3TNLA 4FJ2A 2O7SA 2RAFA 3UXYA 3WGTA 2VNSA 1JW9B 2C59A 3L4SO 4WLOA 3SC6A 3RBVA 4MVJE 4R9RA 1KY5A 1CIVA 2WYUA 4DA9A 1XQ6A 2NQTA 4J4TA 4AG3A 3IL2A 2HK7A 2RCYA 2GR9A 2DFDA 1LRLA 2YQ4A 3QIVA 4FJ0A 4IY1A 4W6ZA 4II3A 2FZWA 3PWKA 2EKQA 1PS8A 9LDTA 3TL3A 2RH4A 4YAKA 2OP1A 1MB4A 3NTRA 3AY6A 1EFLA 1JTVA 1LC0A 4IXWA 4M54A 4JJFA 4R68A 3OQ6A 4BMSA 2FMUA 1FDWA 4LGVA 3WTCA 1HDCA 1NBOA 4J6FA 2X58A 1E6EA 3K6JA 4BNGA 2JJYA 4IBOA 3FWNA 1IHYA 2O4UX 4KWHA 4LK3A 3X2FA 1CYDA 1E3LA 3PZBA 4MO2A 5TRTA 3ITKA 3VDRA 1S6YA 3G3EA 1P45A 1Y1PA 1KVUA 2VUUA 4YT5A 1CWUA 3L9XA 4CODB 4B7XA 1ZK0A 3HN7A 3PYMA 4KTTE 4KP7A 4CM3A 1HF3A 4K1LA 5THKA 3GVCA 3ZV5A 4CQMB 5B1YA 1JA9A 4R69A 3H9QA 1Q7BA 1ISHA 2HJSA 1HDGO 1XKQA 2XOXA 2YQ5A 5U9CA 1C0PA 2WTBA 4D0RA 2FR8A 1OOEA 4P38A 2C0CA 2JHFA 2O3TA 1DC3A 2FRDA 1T2DA 2R6JA 5CG1A 2AHRA 4TVOA 1H6BA 4Y6RA 4FJ1A 4MOWA 3I9NA 4OGWA 1KIFA 4UREA 2WE7A 3BIOA 3WOHA 4G5HA 4RPHA 3QSGA 1I3MA 4J7CA 1BTOA 4IQGA 3VVBA 4WLEA 1H0KA 4A2CA 4PVDA 3OSUA 1ZW1A 2E82A 4KMSA 2ZTVA 1YJ8A 4CV2A 2XF8A 4PLCA 3LC7O 1A9ZA 4QO8A 1RPNA 5JDIA 3AU9A 3L6OO 2ZIZA 3WX0A 3WWYA 4N5LA 4Q3CA 1UUFA 5L7TA 1DB3A 2JCYA 4BNMA 3EZYA 1BMDA 4XA8A 4G65A 2DBRA 4Z0TA 3ZWBA 4YR9A 1HDZA 3SC4A 2Q50A 4FB5A 1Q0LA 3HB5X 3H7AA 1GDHA 1X15A 5C37A 1EVIA 3I6IA 2GZ1A 3RC9A 4I5DA 4M55A 1VJ0A 2CVQA 4X54A 4II2A 5IZ4A 3OQBA 3U49A 2VYND 1BDMA 2FZEA 1R15A 2PNFA 3U09A 2DVMA 2QQ5A 4UEOA 3IKTA 3PQEA 2A4KA 2YZ7A 1E5QA 2O3SA 5F1OA 1ISJA 1E1LA 3WNQA 2I67A 4TRJA 4DVJA 4YEDA 4IPTA 4IDAA 1HDXA 1UAGA 4JP2A 2OZPA 4AL4A 4PG7A 3GF4A 3PP8A 3AU8A 4DREA 3TSCA 4QSMA 5JC1A 5THQA 1K5HA 2PZMA 3ZU5A 1YJQA 2HRZA 1K6IA 3E8XA 5HS4A 4JXKA 4BS9A 1WWKA 2YY7A 1YO6A 4PCVA 5EQDA 4JCOA 4A7PA 5FWNA 2B36A 2VOEA 1NQAO 3EK2A 1LBEA 3GDOA 1BGVA 5G0WA 2PGJA 2JFFA 3H3FA 3K9QO 3PQFA 2AE1A 5GZ3A 1DRWA 3JD4A 3NGLA 4S1VA 4E5KA 5A05A 4XYGA 1NYTA 1E7WA 2H9IA 2HCTA 4FFOA 4XIJA 2ZJ1A 3UFXA 1TI7A 3ZWMA 3U4HA 2JD2A 2P5YA 2NTNA 4XWYA 3H9GA 5A9RA 4B8ZA 2Y1FA 1B8UA 2QZZA 2DBVO 5IG2A 3L07A 2SCUA 1K6XA 3WQSB 2WD8A 3PWSA 1MC4A 2CDAA 4BNYA 4NBUA 3GUYA 3PQDA 5AXCA 4ZQFA 5CDUA 5HRUA 3UKOA 2EG9A 4R3WA 3JYLA 3V2UA 4EUEA 4XIYA 2CVZA 1PZHA 1ZEJA 4CM1A 1LQUA 3QVOA 1J5PA 2YV2A 4HBGA 1JLLA 3JQ8A 3BAZA 3EC7A 3I23A 1DC4A 4NNJA 1F0YA 3KEQA 1X1TA 3GGPA 5A5EA 2OFPA 2QIOA 1A7KA 1P44A 4XX0A 4YVFA 3ST7A 3S1LA 4RJTA 2X5JO 2Y68A 1N9GB 3NEPX 1XELA 5U4QA 3RJ5A 1UXJA 3DZIA 4XYEA 5L95A 5TF4A 1H9AA 1QKIA 1WZIA 4MVJI 5G0SA 1YB5A 3GRKA 5JDIC 2NV6A 2CUKA 4BO9A 4YJFA 3RUEA 2JKVA 1HDRA 4I9NA 4CM6A 4E5YA 1ZK1A 1HE5A 4RVSA 4EGFA 3AM5A 3IKVA 3U0BA 1PJLA 3DOJA 3H5NA 5EERA 3KRTA 5BSHA 5CP8A 1R0KA 3K5PA 3K2EA 3MJTA 5HBRA 2NU7A 4WNCA 2P5UA 3ROPA 2DBQA 4HNGA 3AWDA 3VZRA 4CMCA 4TRRA 4XZ3A 2ZCVA 3W4KA 3ANMA 4FFMA 4OHUA 3EGOA 1HYEA 1C0KA 3WGYA 1NHWA 3C7DB 1PGOA 1ZMOA 2JFHA 4J91A 4MVJH 4EJ0A 1YB4A 3I9KA 1Y6JA 3RUIA 3A28A 1X7DA 4MVJG 2WEKA 3HNPA 4J1QA 1UXIA 2X22A 2Y66A 4RF3A 3BTSA 2HRBA 1M6WA 5ES3A 3H9UA 1VJTA 1LDBA 3UOGA 1MFZA 5JO0A 2B83A 5COBA 4GMFA 1D1TA 3WNVA 2DU8A 1YRLA 5B12A 1Z6ZA 3K96A 2O3UA 1XCBA 4BGUA 1CJCA 1OI7A 3QVWA 3BYZA 1GYPA 1VC2A 3UW3A 3GEMA 2B37A 4I9UA 3MJSA 3D1LA 3JQBA 4D3DA 1UP6A 1MXHA 3Q6IA 1C14A 3OIFA 3KETA 4RQTA 3N74A 3AFNA 1KS9A 3ICCA 1E7YA 1DJNA 1NR1A 3D3EA 2E4AA 2EP7A 2VRCD 4CM7A 4NPCA 2YJZA 3CH6A 3ZW8A 3F46A 4BO4A 2VQ3A 5I9MA 2BGKA 2CD9A 3TZ6A 4F3YA 3JQ6A 1SB8A 2X7HA 3GGGA 1BVRA 3ON5A 4FSHA 4BHTA 3GEGA 1V35A 2I3GA 1GQYA 4GL4A 4OXKA 4IUYA 4BNXA 3H9JA 1OAAA 1YQXA 4CR6A 4CQLB 1A72A 4R41A 3FD8A 4ALLA 2D1YA 4BO6A 5MGBA 1NQ5A 2WD7B 1PJ4A 2ZB8A 2JHGA 3FCOA 4R5HA 1T4DA 3WGHA 1HE3A 1I5RA 3OIDA 4BB6A 4ZICA 1BXGB 4ZQEA 5GZ6A 4DBVO 2CY0A 4BUCA 1PJ2A 2PKQO 1BW9B 3EVTA 4TKLA 5A9TA 4RZIA 3H2SA 5I9NA 4CM9D 3DOCA 2GUGA 3DFUA 4LSMA 3ZWVA 4GVXA 3OHSX 1PTJA 1DPGA 3W6ZA 1H5QA 3WXBA 1U5CA 3K92A 2C29D 4OQZA 5I8WA 2Y1GA 2BFPA 5A4DA 4IGFA 3INRA 1N92A 5ILOA 3ULKA 2DPHA 3ABIA 3GQVA 4CM5A 2IODA 5BSGA 1R0SA 3GDGA 1AE1A 2O7QA 3G1TA 4A73A 2P68A 5G4LA 5HA5A 4WCDA 4E2ZA 5C7LO 1VLLA 3HADA 4DPMA 5JS6A 1PWZA 3OEYA 1TVEA 3E82A 5TJ9A 1E1MA 3IOYA 4ND3A 3WJAA 3JCZA 4N5MA 2EHDA 5IN5A 1NPDA 2OOSA 1OZAA 4YJGB 4YXFA 4NR0A 5JNLA 4UVHA 3PFFA 3GAFA 4OMUA 4PLFA 4UVIA 1QYVA 4TMFA 3GNQA 1UP4A 1YL5A 4TROA 4U0JA 3QWIA 1FF9A 1Y9EA 1EUCA 3JQCA 1D3AA 4DLLA 2X23A 4U6SA 5TT1A 4NG5A 4J9VA 1VE9A 4QT0A 4CMGA 2Q4EA 1EMDA 2VYVA 4BO2A 2FPGA 5A03A 1EQUA 1DIGA 1E3SA 3RCBA 4MVJP 5COQA 2HU2A 5TQVA 2BH9A 3W1VA 3VTFA 1X13A 1PZFA 1JVBA 1ZXLA 2GD1O 3HDYA 4B4OA 1QG6A 1ZK4A 5IF3A 1YKFA 3H65A 5TLSA 4BO0A 4CMEA 3DEYX 3P2OA 2DUWA 2DTXA 2I5PO 3HSKA 4O1MA 1WLYA 1DC5A 3JQDA 4IZHA 3TFQA 4U0KA 1C0IA 4DPLA 4BV8A 2ZB3A 4O5OA 1XA0A 3BHMA 3KHUA 1NNUA 4J1TA 1YXMA 3ZNQA 1ADBA 1I32A 1MV8A 4EJ6A 1VRWA 3JQBC 3ETEA 3QV1A 1HE2A 1I24A 1PR3A 4ZHSA 1YE3A 4Q3EA 1FK8A 3I6QA 5DZSA 4D41A 3G79A 3L4BA 4JLWA 1EVYA 4R1NA 3U5TA 2D0IA 3K8ZA 3ZDFA 2UV8A 5LCXA 4EI2A 2GRAA 5BNIA 3PHJA 3R6DA 3ZWOA 2BLLA 2PGLA 4M89A 4PG5A 3PLRA 1NVMB 3GAZA 2Q2VA 5AVOA 3DHNA 3CINA 5AXDA 3EZLA 1Q2XA 5G0VA 3GN2A 3SLKA 4UUOA 1CF2O 5FYDA 3RFTA 3QWAA 1U7HA 4URFA 3TZQA 1E3WB 4KOAA 1MG5A 2PV7A 1SNYA 1RM4A 1E6UA 3KOUA 4WLFA 2YUTA 2O2SA 2W98A 4OJNA 3ZGYA 2YDYA 4TVBA 3FNGA 1Y5MA 5I8ZA 2ZQYA 5KJCA 4XYMA 4BGEA 1MA0A 4ND1A 1P9LA 5KWEA 3JD0A 1E3IA 5A3VA 3IMFA 1YH3A 1HSZA 1DFGA 3ZV4A 1H6CA 4QEDA 3I5MA 1DSSG 4CLDA 2VTDA 4WECA 2X8LA 1PJSA 3TZCA 4QQRA 1LDNA 2B5VA 2ZJ0A 3PHLA 4IDCA 4QO7A 4WASA 3CZRA 4FOOA 1D8AA 3M6IA 2D5CA 1E3EA 1NP3A 1XLTA 1DAPA 1A27A 3FN4A 3JYOA 2ZKLA 4NBVA 1H93A 1PQUA 3RUFA 3AK4A 4D79A 2VHXA 1UZNA 1KC1A 4Y6SA 3QQPA 3RUAA 3IUSA 3CIFA 1EDOA 1HL3A 4PFJA 3NDJA 1NR7A 3S2FA 3WS7A 4BOYA 4GX0A 1H2HA 4BV9A 3OICA 2B0JA 4GGPA 4NQZA 2BGLA 1Z7EA 4R9SA 4DWVA 3PJFA 4MP8A 3WYEA 4KDEA 3SJUA 5EIOA 4MIOA 5ER6A 3VKVA 4PN3A 3K31A 4J49A 5JE8A 1B8VA 4I8XA 1ZH8A 4NU6A 4GQAA 5J23A 4WPGA 3WDSA 2HO5A 3Q9UA 4CM4A 1JWAB 3DHYA 4J4HA 2PA3A 1GADO 5KJ6A 1LU9A 2BMAA 5CAEA 3JQ9C 2VZ9A 4ZN6A 1A4UA 3W8FA 5JPIA 1XU9A 1UXKA 5DF1A 3JV7A 4CMEC 3Q2KA 1BXKA 1UDCA 1H6AA 4ND5A 1M66A 3LLSA 3KLMX 4OOEA 4CQLA 3OEWA 1GAEO 2G82A 2WD7A 4DBZA 3Q3CA 5L4LA 4DXHA 1EK5A 1Y8QB 3DZGA 1BXGA 1O0SA 2C20A 1E0DA 1HT0A 2BELA 1P1FA 4ONEA 1LLDA 4N7RA 4D44A 4GSKA 3I9LA 3E9NA 3O8QA 1J4AA 3TFOA 3PI7A 4IDDA 1XIVA 2FWMX 2I3AA 2D8AA 4BO8A 3WYBA 1Z73A 1UXHA 3L4BC 1QSGA 5TNXA 1HE4A 3C1TA 2IZZA 2PD3A 3V2GA 1YWGO 3NRCA 4B4WA 4EEXA 2EW8A 2CMDA 2YYYA 3LT2A 1DHRA 1J0XO 3OBBA 4J16A 3D3WB 2HK8A 1O94A 2HUNA 4LMRA 2B4TO 3QP9A 2WE8A 1E3JA 5JFOA 1B2LA 2GN8A 2HMTA 4CLRB 2DUUA 3W6UA 2DQ4A 5C7OO 5A06A 4YQZA 3GZ4A 3Q0EA 3FSRA 4ZA2A 1ISMA 1X7HA 2Q1WA 1R16A 4GMGA 4RLSA 2I66A 2Q1SA 3P7MA 1LA2A 2GO1A 4JK3A 3FPLA 3E18A 3DFZA 1U1IA 4YJGA 3AM3A 3E48A 3F1LA 1X14A 3R0IA 2Z95A 5AYVA 4Y8VA 3S2IA 2Q2WA 5I7VA 3IJRA 5FEUA 2Y93A 1JQBA 3GNTA 2FPPA 4BQPA 1T1RA 3GFGA 5BR7A 4RF5A 3DBRB 3PEFA 4UAGA 1CQJA 1QYXA 2R00A 4P4NA 1DC6A 1Q7CA 4IDFA 4UVEA 2EKLA 4KUHA 1LEHA 1OC2A 2CDBA 2AXQA 4ITUA 2HK9A 1IL0A 4IM7A 2Y0EA 1E5LA 4J43A 4J4BA 4KZPA 4RVHA 4YRBA 2VHWA 3NTOA 2J3HA 1MLDA 1U7TA 1JKFA 1E1NA 5DNAA 3RUHA 1HZJA 2I76A 3EMKA 3HG7A 5TJHA 2OGUA 5CHEA 4G81A 4K28A 1VSVA 3KXDA 1I2ZA 4R1UA 2O50A 3B70A 3TRIA 1LDMA 5FF9A 1CRWG 4UEJA 1W73A 4NH4A 3RKRA 3SBOA 2O2YA 2HKIA 4CJXA 2H63A 1I01A 4DYDA 3S55A 3B1FA 4YWJA 4IMPA 1PJBA 4DPKA 3PVZA 2VNAA 5ITVA 1W0CA 1EK6A 3K30A 1EUZA 5I9LA 2OORA 3IAHA 2HJRA 3QRWA 4NDNE 4AJNA 2V6FA 2AG8A 3PYLA 1LLQA 1GFSA 2WYWA 4HXYA 3RFXA 3ZU2A 1WXDA 2JFGA 1NPYA 3I9OA 4AVYA 4DC1A 1N1GA 3DXFA 1TEHA 3QVTA 4U5QA 3RBZA 5BSFA 3H5AA 3I52A 1RWBA 1E7RA 4XB2A 2HAEA 2Y1EA 2Z1NA 4RPLA 1T2AA 4L76A 1NVTA 1DBVO 5AOVA 2F00A 4E4YA 4A0SA 4JBIA 2X4GA 1RYEA 2DBZA 1GEEA 1NM5A 5T8KA 4QFCA 5DP1A 2ZTMA 3F9IA 1I10A 2CF5A 2VTEA 1NAHA 5A9SA 2X6TA 5HM8A 2D4AA 3ZI0A 2X0NA 1KY4A 2BRUA 3ENNA 2D5AA 1ULSA 3LLVA 5EPOA 1G0NA 2NLOA 3DZJA 4PGFA 2EEZA 1DRVA 1E3WA 4GWGA 1EUDA 2EV9A 3B6ZA 1YDEA 2HQ1A 3R1IA 3TN7A 1WNTA 3PJDA 3QVXA 1WDLA 2PD4A 3LDHA 4MVJF 1R66A 3EW7A 4PLPA 1E6WA 5L9AA 4PZDA 1J49A 1PS0A 3ONFA 3PFWO 1AGNA 2VZ8A 4HFRA 1B7GO 4FR5A 3V1YA 3OM9A 1TXGA 1L1FA 3FNEA 4Z9FA 4FGSA 4MP3A 1E7MA 3LF1A 3AUTA 3R3JA 1AN9A 2YDXA 1I33A 3D0OA 3FF4A 5EL0A 4KUGA 1NFFA 1X7GA 5COAA 1Y7TA 4TRNA 4RZHA 3RFVA 1O8CA 4YT4A 5ADHA 2YHIA 3GH3A 1ARZA 4YCAA 3ORFA 3DO5A 3PHHA 5CFZA 2E6UX 3F4LA 4PLGA 3RU9A 5JMWA 1GQ2A 4FC7A 3TWOA 1YBMA 1E92A 1CERA 4YJHB 2OO5A 4BKPA 3E1KA 5IN4A 1BG6A 5F5LA 1A7AA 4BNVA 2X5KO 3D64A 4CLOA 1IE3A 2EP5A 1XWFA 4JBGA 3KYBA 1CDOA 1O89A 4LW8A 2VHYA 4AJ4A 4J1SA 5JW6A 3DBLB 4YQYA 3WLEA 1D1SA 3WGGA 2CNBA 3L77A 4AJ2A 2R00C 2NSDA 4FCCA 3GOHA 4LSWA 4A26A 1LUAA 3GK3A 1VM6A 3VH4A 5IAAA 2IZ1A 3R3SA 5MDHA 3WGIA 2IZ0A 4Y98A 4Z3KA 2X0IA 4BNJA 5K9ZA 2I99A 2VWQA 1E77A 1T2EA 4XGNA 3ZCXA 3G49A 4ID9A 1O95A 2RIRA 1B14A 3HE3A 4YRDA 4Y67A 1KVQA 4UUNA 2BFOA 1NWCA 2EXXA 3ROKA 3ITDA 3T7CA 3HN2A 4BNTA 1X0VA 1C1DB 4L73A 1UZLA 3BMQB 3KTDA 1SCUA 1K0UA 2I6TA 5DCWA 4BGVA 3RQSA 4E30A 3PHGA 1DLJA 1CEQA 3ZHZA 3DL2A 3HFGA 3WSWA 1BSVA 1IB6A 4R01A 1Y8QA 5GY7A 3TF5A 3I3OA 2OMEA 4CMIB 2HLPA 3G0OA 4KQWA 1LNQA 3DMTA 3BZUA 1RJWA 3UGKA 4FFNA 4L4RA 4MP6A 5IDYA 3OJFA 3PDJA 1GCOA 3KV3O 1V3TA 1GPDG 1A9YA 2FN7A 1U9JA 2P4HX 3LVFO 4FN4A 5IDXA 5DCUA 3UCEA 2B69A 3D4OA 4DL9A 4PG8A 3QY9A 3SJ7A 4OO3A 1DXYA 3QWBA 4D7AA 3D3WA 3DOOA 4FDAA 1P0FA 1XSEA 2JCVA 1UZMA 4PLYA 1JAYA 4CLRA 3MJVA 1LTHR 1MX3A 1P77A 1DJQA 2VYVD 2D3TA 2FSSA 4NFYA 3VZSA 4J2HA 3U4IA 5K0ZA 3BMCA 2POQX 1U2GA 1PGQA 4XDYA 1I3NA 4AICA 5ICSA 5JYDA 2TMDA 8ADHA 2VWPA 3D7LA 3JD3A 1PEDA 3QLJA 4IIUA 3W4JA 5I7EA 4RPGA 1PGJA 2NNLD 1ZJYA 2PZJA 1ZSNA 4IIVA 1JKJA 1UH5A 3HHPA 4EJMA 1YOVA 2J3JA 2QG4A 2VUTA 4YPOA 2V6MA 2XPCA 3KB6A 4XCVA 4IGEA 1W8DA 1ZSVA 5DULA 4I1IA 5JAQA 1I30A 5T64A 4ALNA 3RAJA 2BF7A 4RF4A 1KYQA 1QORA 4R16A 2BD0A 3IC5A 3W4IA 2EERA 5DT9A 1V3UA 1Z7BA 2W90A 2J3IA 3U9LA 3FI9A 3GRPA 4WK6A 2GGSA 1O5IA 1TA4A 2WJPA 1Y8RB 3A4VA 3QW2A 4M86A 3MCVA 5KVSA 4XKJA 4B3HA 1L7EA 1QV6A 1U4SA 2E49A 3NUGA 9LDBA 3EYWA 2VHVA 2NVUB 4YACA 3U4DA 1ZJZA 2H6EA 4W4TA 1R4MB 2OBNA 4BNWA 1WW8A 4IDGA 4E2YA 5L3ZA 1DEHA 5EMHA 3V1TC 4EITA 3D5QA 4UUMA 2X9GA 1C3VA 3RUDA 5ER9A 2V6BA 4FD3A 2NU6A 3WIDA 5DBFA 7MDHA 4BNFA 3ZN2A 1YDWA 4CV0A 1M75A 2W2LA 1Z74A 5KKCA 3GMSA 2X0RA 2IE0A 3ZH2A 3L6EA 1S7CA 3T4XA 4BKOA 4CQMA 4FS3A 3OMLA 4RPJA 4AJOA 5IDQA 2OP0A 3NKLA 1K89A 3ZWWA 3EVNA 4XDZA 2ZYDA 3WYCA 3TOZA 4BNHA 4WUVA 4XJSA 4CMBA 5AXAA 4ILKA 4XQEA 3GNSA 4O59O 3MJCA 2VHZA 5F5NA 4ALIA 4H15A 3WGZA 5CDGA 3ROMA 3DMTC 5DOZA 2O3JA 1EFKA 1KEPA 4LRSB 2W2KB 3E6AA 5KJFA 2DFVA 2TMGA 2NU9A 2NVBA 3ONEA 4BO3A 1B15A 2P9GA 3GG9A 5GZ1A 1NTOA 3AOEA 4INAA 3VVCA 3JD1A 1QYDA 3MZ0A 5CDYA 3DB2A 3JQFA 3VAZA 3DZFA 3CKYA 4NZ9A 1QLJA 1B0AA 4RVGA 1EBFA 4AFNA 2G17A 2YFHA 2C07A 3Q1LA 3VH1A 3LT0A 2DM6A 2UVDA 4FBGA 4JIGA 1IOLA 1UR5A 1GTMA 2WMDA 3S2EA 4L75A 2G1UA 3PIIA 1IUKA 1LSOA 3DBHB 4Q3DA 1WMAA 1AUPA 2J5QA 1NHGA 4E2XA 4EDFA 4YJHA 2Q4BA 2FR0A 4WOJA 3AOGA 2X5OA 1XEAA 3ZWPA 2FPIA 1EVJA 3C8MA 4DLBA 3FBTA 4WJZA 3I9MA 4GPD1 4L8VA 3DBLA 4FC6A 4CV1A 1A4IA 4A10A 1P33A 3VPHA 2CF6A 3GN1A 4R51A 2DAPA 1GCUA 1D7OA 3AJRA 4HFJA 4YBZA 1F8FA 1H2BA 3M1AA 4MINA 4CLHA 1DDOA 4BO1A 4RDHA 3C1AA 3V1UA 2OHXA 3WFIA 4AJPA 1BDBA 5LDHA 3H8VA 3W8DA 8LDHA 5K6AA 3WG9A 1F17A 4PZCA 1HYGA 1EE9A 3GPIA 3JYNA 1JKIA 1MP0A 1M6HA 3CTMA 4BNLA 2AG5A 4PZEA 3RVDA 1ISGA 4WKGA 1F06A 2EIHA 1B26A 4ZVVA 1C1DA 4MKRA 1R4NB 3BMQA 4UVGA 4I5EA 3EDMA 2F1KA 4DQXA 4KWIA 1WP4A 2BFAA 3G17A 5ITWA 4YJDA 1PWXA 5C5IA 5JAZA 1O9BA 1ZMTA 2ZATA 1SEPA 1Z45A 1HZZA 3CE6A 5JO9A 3VDQA 2H5LA 5JCXA 1HSOA 3NDRA 4O6VA 4NJMB 2O3QA 1OMOA 1LI4A 1ONOA 2A92A 4CMIA 4WNIA 4FIZA 4EW6A 3ZNOA 2Z1MA 5H82A 4A27A 3BTOA 3ZHYA 3FBGA 4M1QA 3Q9NA 3A1NA 3RASA 4BNKA 2PWZA 1GZ6A 2JAPA 3BMOB 1RYDA 4OKIA 1U8XX 1U3WA 4MVJM 2NTJA 5G4KB 5TIIA 3QJ5A 3UVEA 4B7CA 4ZRNA 1VL0A 3RC2A 4B3JA 4Q9NA 5EINA 1DIRA 3AUAA 4QECA 5IJZA 4F46A 2QRLA 1QV7A 3HQ4O 2EW2A 4QFDA 4OL9A 4PLVA 4EBFA 3CMMA 1KC3A 1ENPA 2J5KA 3ANNA 4D3FA 4RLHA 4RV9A 5TX7A 2UAGA 3GMDA 2GERA 1GYRA 3TOXA 5JDCA 2DC1A 4EUHA 1U28A 3WGQA 1WZEA 3D5TA 5A1TA 4J1NA 2PZKA 5B4UA 3AOEC 3ROQA 1ZZEA 2DT5A 5CG2A 1N9GA 1H94A 1R6DA 5FFFA 3C7CB 3ADOA 3JQFC 1AHIA 3DQPA 4R3NA 1V0JA 4J7UA 4GKVA 1HDYA 4YAIA 1BXZA 4GBJA 1XYGA 1ISIA 1YVEI 1HLDA 1U5AA 2CDCA 1RM0A 2NWQA 2OBYA 3VH2A 4CMAA 1P1KA 2LDBA 3GC6A 4DRYA 1QXSA 4B4VA 1U4OA 1Q7GA 2PR2A 3OIGA 3E03A 3H6KA 1N7HA 1V3VA 3ZWAA 4NFHA 4OKNA 1I2CA 5G0TA 3L6DA 1EZ4A 2C5AA 2XAAA 4DMMA 2Z5LA 1OC4A 2ZCUA 3IIEA 3X2EA 4D0SA 5JY1A 2GDZA 7ADHA 3ONDA 4W7IA 1GPJA 1IYZA 1QR6A 1ZCJA 2NVUA 3KYCB 2P4QA 4JGBA 3AI1A 4ND4A 1R4MA 2G5CA 4M8SA 4RVUA 3D4NA 2ZTLA 3N58A 3IUPA 4B79A 3WTBA 3M2PA 5A5FA 2HDHA 1ZO8A 2BHLA 3KEOA 3QVSA 5HWSA 4HKTA 4ROSA 3O4RA 1PL6A 3KVOA 2FSVA 1ZKMA 3INGA 4Z0HO 4PLTA 4P4LA 1ZIDA 5IDWA 3NX4A 5F21A 4CLEA 5B4VA 1LLCA 1LX6A 1EBUA 1ULUA 5CEFA 3AI3A 4MKXA 3AUSA 4YAEA 3ZNNA 2JL1A 2VN8A 1ENOA 5JCJA 3NJ8A 1LLUA 4RDIA 2AQ8A 4D46A 5LC1A 4NU5A 3I1JA 4DIFA 2G76A 4XQ9A 2W2KA 4EUFA 4EYEA 2GZ3A 4GWKA 3DC2A 4CMHA 2C2XA 3QWFA 2NQ8A 1BVUA 1GZ3A 2UUPA 5JBIA 1FJHA 1KBZA 3VTZA 4D43A 2C2YA 2Q1UA 3IDSA 2ZB7A 1ZBQA 1BW9A 4MIYA 3T4EA 2GZ2A 4W99A 3PRJA 3VHRA 2X86A 4GX5A 3JD2A 1T25A 4QXMA 3HDHA 3C24A 5ILGA 1E7QA 3PGJA 4GI2A 3F4BA 4J90A 4PRKA 5I7FA 1SEVA 2AQIA 1GU7A 4I5FA 4FFRA 3VC7A 2BKAA 2GN6A 2FOIA 2QW8A 5JDCC 1B8PA 4EEZA 3GHYA 2ZYGA 2HMSA 3DDNA 2VZ0A 1IZ9A 3FRJA 4J0FA 1ENYA 2JD0A 3TJRA 4Z3DA 3SVTA 1TT5B 2BI7A 3JQGB 2VCYA 3ZWCA 4AJEA 3QA9A 3QE3A 4GVLA 1M67A 1KEWA 3JQAB 4CR8A 4OM8A 5KVCA 3KYDB 1GL3A 4Y9DA 3OH8A 3CUKA 3RROA 1DIHA 2G0TA 2UDPA 3I4CA 4TQGA 4Z9XA 3RD5A 4CL8A 3GPDG 2IYPA 1BWSA 3ZWNA 2AEJA 4P4GA 2P9EA 4E33A 1ZK3A 1QRRA 3GY0A 1VJ1A 4KQXA 4UEKA 1IPEA 3EHEA 3V8BA 1SMKA 2UUOA 5KVVA 1SO8A 2AW5A 4ZQHA 3TZKA 1G1AA 1XU7A 1GV0A 1PJQA 4MKZA 2EJWA 1KEVA 3JQ8B 5TGDA 2BGMA 2PK3A 3FTPA 2AA3A 1ZFNA 5KCZA 4A5OA 1ML3A 1MC5A 1MG0A 3PJGA 4NIMA 1SOWA 4BVAA 3DHEA 4HUJA 5TT0A 1YONA 1XG5A 3WBBA 2I65A 1WPQA 1X0XA 4L0QA 2PLAA 4B7UA 5H83A 5DBIA 4WLVA 5L53A 2RH8A 4FOSA 2X9VA 3ENKA 1A71A 1SPXA 1T2FA 4YJFB 1SB9A 3AFMA 4N5NA 4MPDA 2XXBA 4W82A 4BNZA 1G0OA 1Y81A 5HS6A 3BMOA 4H7PA 3SEFA 2GLXA 5G4KA 1QYWA 4NK4A 5DN9A 3CEAA 4RO0A 2VUSA 2PD6A 4B8WA 3Q2IA 4IXTA 1GUFA 1OBFO 1LSJA 1DFHA 1YL6A 1PJ3A 4CUJA 3DTTA 5JLAA 3AM4A 4E12A 2O23A 4KUEA 4R1SA 4XR4A 4IQ0A 4NI5A 3B20A 2J6IA 4Y6PA 3DR3A 3GUCA 1GYQA 3F1KA 4ZJUA 4H3VA 2CSUA 3V2HA 1VKNA 1Y9AA 4U6QA 2RBEA 2V6GA 3VOSA 4P8RA 3UN1A 4AJKA 2DKNA 1E1KA 2Y05A 4LCEA 4O63O 3RWBA 1NX6A 4KTVE 1YL7A 2B4RO 2D2IA 2VT3A 3GVXA 3PZRA 2BFMA 5KKAA 3ZW9A 3KO8A 1LSSA 1RKXA 1TB4A 1U3UA 3AUUA 4JROA 4WLNA 1B3BA 3ADPA 1YQGA 3RBXA 4GAEA 2VT2A 1N2SA 1FDSA 4WEQA 1WAMA 2IEDA 3F5QA 4HFMA 3GLQA 4XYBA 4AJJA 3ASVA 2OL4A 4CMJA 5F1KA 2R2GA 1P3DA 1VPDA 2GN9A 3MTJA 5F1PA 1GD1O 4DLAA 1GY8A 4YDRA 1KOLA 5CDTA 2BI8A 1X1EA 3ZHXA 4RVFA 4MVJA 3ICPA 2QRJA 1BRMA 3NT5A 2ZTUA 3JSAA 1YQDA 5CDSA 1PIWA 2W2LD 3O38A 3KZVA 3VKUA 1HYHA 1JU9A 4D42A 1H6DA 1Q0HA 1P31A 4QX6A 1I36A 4J7XA 3WWZA 3MTGA 4CQMD 3KYCA 5L7YA 4EZBA 1EDZA 2Y0CA 4IJKA 4YT2A 1RM3A 1SC6A 3N7UA 5B37A 3UICA 4NHEA 4OIMA 1PU2A 3DBVO 3VZPA 1K2WA 4GLOA 4HV4A 3E9QA 3NV9A 3UUWA 5ENVA 5JC8A 1DLIA 4QUKA 1GR0A 4MIEA 1MUUA 1ONPA 1UDAA 1UJMA 4E3ZA 3BTUA 1I3LA 1V8BA 3KSZO 1T1SA 6LDHA 2B35A 2WSBA 1EVZA 3JYPA 4H16A 2AEFA 2HMVA 3PHIA 4L9RA 1QMGA 4GX2A 3LQFA 4OXNA 4XQCA 2J3KA 3RI3A 3U62A 4DYVA 5L7WA 1PL8A 4JQCA 5EN4A 2Y99A 1FXSA 4O0LA 3JTMA 3C3XA 3TQHA 5AXBA 4B4UA 4UVDA 4IJWA 3PWZA 3KBOA 3SLGA 3WSVA 4Q3BA 3H3JA 5BNFA 3KUXA 1XR3A 3F5SA 3IP1A 1OFGA 4GSLA 4ZRMA 5C7IO 1PR9A 3WICA 3OF2A 4F6CA 1ZEMA 3WR5A 4AJHA 4E31A 1HKUA 2Y1DA 5EQFA 1N8KA 3OETA 1ZUD1 6ADHA 1IZ0A 2ZB4A 3NGXA 2AQHA 3ZU3A 2J8ZA 1SAYA 4M87A 1KVRA 4J2OA 5ENDA 4DQVA 1BHSA 3A06A 4YT8A 1PZGA 3OP4A 4AJLA 1LQTA 3JQEA 3L0DA 3MOIA 4PG4A 5HTOA 1XHLA 4NMHA 2B4QA 4IS3A 1XGKA 1K6JA 5IXYA 3B1KA 3NT4A 3BXXA 3NJ4A 3ZWXA 2FP4A 1U2DA 4M49A 4L74A 1DRUA 2EGGA 1PQWA 1XDWA 4YAJA 3E5MA 1NPTO 4YYZA 3OQ1A 2GF2A 5T8KC 2EGHA 2AMFA 4ZD6A 4K26A 1HTBA 4TSKA 2OUIA 4HADA 4MJLA 1EE2A 1ZXBA 1DAOA 3ZNPA 3H9EO 3KLPX 3C1OA 3K2BA 1ONNA 5TS3A 1GEGA 3WMWA 3NAQA 3EY4A 1TT5A 3JQGA 2I9PA 1EQ2A 2VWHA 3JQAA 3BHIA 3KYDA 4XYLA 3KSUA 4XGIA 4BKUA 1TT7A 4WOKA 4XD2A 4DMLA 3ASUA 2V7PA 5JAMA 1T4BA 3JQ7B 5DDIP 1LRKA 2JAHA 4JN6B 3PYXA 3GA0A 3MJ4A 3ZHBA 1PGPA 2DLDA 2C82A 4E0BA 3DBRA 1LRJA 3FWZA 3HZZA 3CMCO 3INTA 4E5NA 4GKBA 2O3RA 4JNKA 5JMPA 4LMPA 2PH3A 1AHHA 3E5RA 2ZK7A 3LT4A 3PTZA 1IHXA 5A02A 1I0ZA 3LT1A 2PTGA 4TKMA 4WE3A 1M76A 2EF1A 2C54A 2Q46A 3ZV3A 1UXGA 3BMNB 2O4CA 2GYYA 2PKRA 3PGXA 1KVTA 4PIVA 1KEUA 3SXPA 3C85A 3WQRA 4JP3A 2Q2QA 2PH5A 3IS3A 3MWEB 3HDQA 4G2NA 1VKOA 1KVSA 4E21A 4NBRA 4GGOA 5CPBA 5CPFA 2B5WA 2WDZA 2Q49A 5IZCA 5A04A 1W6UA 1MGOA 3UAGA 3HWRA 3OECA 3OJOA 3C7AA 1AXGA 1SBYA 1HETA 3MEQA 4UULA 2GPTA 1Z82A 3CPSA 4D3SA 4WCFB 4IZIA 3ANLA 1GV1A 2AQKA 3MWDB 4L4SA 3T7EA 4LVCA 5T57A 5T5QA 2PY6A 4YRAA 1GUYA 1I2BA 3L9WA 4WEOA 1KETA 3RU7A 4OOFA 4JJIA 4C4OA 4HFNA 2PFGA 3UH1A 2GASA 5C3MA 1NVGA 4R5MA 3BHJA 1R12A 3OJLA 1DO8A 3MJEA 3TPCA 4CM8B 4RORA 3I83A 3PLNA 5EESA 2GCGA 5CEEA 5KIAA 4E13A 3HJAA 5IXSA 3GVIA 5L4NA 3O03A 3CZMA 4Z6KA 1PL7A 4LISA 1VL8A 4ALKA 4TRMA 2Q45A 1WMBA 2DPGA 4LRTB 5BSEA 3NT2A 1ISFA 1Q0QA 3MOGA 4ZQBA 3VPSA 2Y0DA 4BKRA 3WMXA 4WGGA 4JJGA 3TL2A 3O26A 1HDOA 2HSDA 4LN1A 3RUCA 4DUPA 3FR7A 2YW9A 3VPGA 1DIAA 3M1LA 4TWRA 1SOVA 5FI5A 4CM4B 3D4PA 2Y1CA 4UUPA 1UAYA 2IXBA 3IJPA 1N7GA 4DC0A 2VYNA 1Y5RA 4C7JA 5BQFA 4HP8A 4OSOA 1PSDA 4ZQGA 1PZEA 3AW9A 4GLLA 3VH3A 1JVSA 5GMOA 1HWYA 2VRBA 3P5SA 1GUZA 1JWBB 1WVGA 1ZSYA 1B16A 4C7KA 2IXAA 4PLHA 3GZNB 4ZGWA 4MDHA 5JCJD 3A9WA 3DZHA 4I5GA 1C1XB 4R1TA 3O8QB 4DGSA 2QYSA 2C7VA 2AEMA 5EJ2A 1H9BA 3GT0A 2X1HA 4E32A 3V5NA 3WIEA 1CETA 3DZKA 2P91A 3OJEA 5CEJA 3ETGA 4FFLA 2QYTA 1ZNQO 4ND2A 4Q3AA 2RHRA 4R4JA 3EAGA 3STHA 3GR6A 4OAQA 4W7HA 4A03A 3AY7A 3GDFA 5KNLA 4S3MA 4BB5A 2RHCA 3ZV6A 1W4ZA 1F14A 4BO7A 4IDEA 1Q1NA 1U8FO 4HY3A 2FY8A 3UCXA 4U7WA 1CQIA 4N54A 1UP7A 2QX7A 1T24A 4LCJA 2A9FA 2ZQZA 1YBVA 2EKPA 3GFBA 4LVUA 4E5MA 3WQQA 3DWFA 2YFQA 1ZVMA 3G1UA 4W9NA 5L40A 4FGWA 1DHTA 3FTNA 5U1PA 5IZCC 3OFSA 1MFPA 2Y1OA 5DCYA 2HMUA 4RL6A 4XB1A 5F3RA 5KJ1A 3NDIA 2PGDA 1N1EA 1ADGA 4PVCA 3TZHA 5BNTA 2VOJA 4J0EA 2WYVA 4B3IA 2NUAA 2GNAA 5FI3A 3NTQA 1DIBA 3RC7A 3H2ZA 4NBTA 1PJCA 4YA6A 4DIBA 1VL6A 3HB4X 2NADA 3SX2A 4BNNA 1PGNA 4NFSA 1P74A 4I08A 5T67A 3I4FA 1VSUA 2CFCA 3A14A 4FW8A 4IINA 4DIOA 3RKUA 3WBFA 1P1IA 3LU1A 3I9JA 1E7SA 3GEDA 3RC1A 1NAIA 4FFPA 3QHAA 2OXIA 5KVQA 3JQ9A 2YV1A 4XRRA 4CMKA 1PS9A 3FPCA 3H4VA 1AXEA 3E9MA 3IP3A 3NYWA 3VPXA 1L7DA 3BTVA 4RVDA 4XEHA 1B3RA 4CR7A 1G6KA 4CPDA 3OJ0A 2AE2A 3DMYA 1HXHA 4PLZA 2IYOA 4Z9YA 3JQ7A 2DTEA 4GX1A 4E2WA 4HX5A 3S2GA 4QTZA 1YBAA 4OQYA 2NACA 5JAIA 4PG6A 1A5ZA 3IQDB 2NVWA 3RIHA 3HUDA 1LDEA 4PRLA 4RPKA 1YGYA 4U8GA 4KDFA 3WFJA 2H1SA 3ZWYA 1PJTA 1DFIA 1FDUA 1TLTA 2D59A 4L4XA 5DP2A 5A9SB 3F6YA 1P1HA 1R37A 4CLXA 3HFSA 3COSA 1LDYA 2C7GA 3LZ6A 3LSYA 1D4FA 1NQTA 3BMNA 3VZQA 2X0JA 2UYYA 1IPFA 4P22A 1ZK2A 2P9CA 2Q3EA 2CVOA 3GHHA 2A35A 3H5RA 4F6LA 3DAGA 1WDKA 4K9DA 4ESOA 1LSUA 1Y8RA 1ID1A 1O6ZA 4TZTA 1MXFA 1F12A 3U4CA 4AJ1A 1HLPA 4IS2A 5JXWA 3WLFA 1PQPA 4NK5A 5AQ1A 1KERA 5L51A 3OA0A 1JAXA 4IMRA 4WCFA 2WM3A 4XR9A 1LDGA 1SZJG 4CL3A 4R54A 3CSDA 4NBWA 2X9NA 3PIDA 2V65A 4JX8A 3CTVA 1FMCA 2VRCA 1NWHA 4I9HA 3KSDO 5JYEA 4J9UE 5K6AC 1NASA 2YHIB 3JYQA 1RM5A 3S8MA 3B1JA 2IRWA 4BQRA 2QHXA 1P1RA 4N18A 5KTKA 3OA2A 2XXJA 3F47A 3QWHA 5TC4A 2PZLA 1LJ8A 4CM8A 4MVJD 1T26A 4GH5A 1ORRA 2EWMA 4BL5A 1FDTA 4W9NC 1V9LA 3ETDA 3RSHA 4CLOB 4NJOA 5JY6A 3PXXA 3FR8A 2GN4A 5B4TA 3PK0A 1NFQA 3W8EA 3UCFA 3LC2O 1UDBA 2ET6A 4IQ8A 3WB9A 4BMVA 5A3JA 5H81A 3FNHA 2LDXA 5DBGA 1QP8A 5BT9A 2FR1A 5G0UA 1DOHA 1N5DA 4CM9A 4FPXA 2WWRA 5KOIA 2A94A 1HRDA 1GZ4A 4D45A 1F8GA 1LC3A 5G2OA 3ZZNA 2YHUA 3UHAA 3LC1O 4F45A 3GGOA
chains in the Genus database with same CATH superfamily
2FX5A 3WIVA 1FDVA 1GL9B 5ERXA 5A6VA 2PSSA 4AZ0B 2PZBA 4WERA 2XBMA 2JIDA 4OL0A 3BBLA 4OSPA 1PCXA 5A0FA 3ND8A 2Q1XA 1QO0D 2R8ZA 1TNDA 2IA5A 1CPYA 1W4RA 1W36B 1RYNA 2YV3A 4GRAA 2E48A 4WNYA 3I92A 1X6VA 1R4AA 2QZ4A 3T54A 3W5VA 4B6JA 4OX9Y 1EI9A 1I8TA 2I8LA 2NM0A 4HEA6 4H4CA 1MR3F 2CL6X 4E6EA 5K3FB 4QJ5A 4WJKB 1QQ6A 4CV3A 2ILTA 1XMXA 3AJEA 4YUZA 5A7FA 4WXYB 5JXIA 1YRAA 4AWAA 4KHZA 3MMPA 3HS3A 2PWBA 4YAGA 3C15C 3KWMA 2O48X 1P2VA 4NH0A 2XY4A 1M74A 1FRZA 3GZNA 3I0ZA 5GVRA 3ILHA 2G08A 5C8ZA 2J9FB 5F7OA 1SG9A 2G9RA 3IYLW 4BKQA 4BMDA 4CKYA 5L4SA 3BE8A 1PFVA 4W5TA 5FBVB 3RS4A 4OH1A 1VPTA 2XLCA 3PJEA 3PUKA 4GVPA 2Q3CA 5E4TA 2JD1A 1O7JA 4XLLA 1PAUA 2EFDB 1R0LA 3QLTA 4UZSA 4J3FA 2UXCB 4CEJA 3MS2A 4ZVOA 4EGAA 3VPFA 3PITA 1C1HA 1I6MA 1OXTA 1S3FA 2A0WA 2HV9A 2WLTA 5AW9A 3T0IA 4BGIA 1M33A 5KYWA 2QSYA 3EPJA 5EZYA 3RIXA 2IYVA 3KBBA 1IXZA 5B1SA 4E22A 2FHSA 1D5WA 2IYRA 4RQUA 2NTVA 1XZ8A 1JKMA 2OXCA 5CVDA 3IB6A 4YRZA 3EDRA 5TY0A 1JDJA 1SK9A 3DHVA 1DIOB 4CKEB 1IULA 4K6FA 1V48A 1WDMA 3L01A 1M8KA 4HR7A 3UHOA 3I3SR 4DLWA 5JD3A 4GUAA 3PDUA 2IEAA 1C9JA 1PX0A 1UM9B 2A2ZA 3WWCA 3BRQA 4ZJZA 1A9XB 1D6SA 1YZHA 4GEKA 3K0FB 2RG7A 1E1YA 1P1JA 4GO1A 1EJ6A 2PLRA 2YS7A 3O8RA 1Z75A 4XLTA 1NLYA 5E7IA 5CLFA 1FX0A 1IN4A 4H7EA 1OHHA 1TU0A 2WJJA 1CZNA 4EF4A 4ETWA 5JD6A 4NRDA 3AH8A 1RHJA 1TFUA 4UPDA 5ICMA 2GD6A 1HQYE 1O96A 1AUVA 4V2UA 5AVJA 1NFRA 2IZOA 3CNEA 2QU7A 1C8VB 2WR8A 4N65A 3ZJ5A 3RAEC 1PDVA 3ROFA 4Z0NA 1NSYA 5E9AA 1XPUA 1QCYA 2HIGA 4UASA 4Z8YA 3ZTYA 1KNXA 5KJEA 3DZBA 4A6EA 3H8JA 3LF2A 5CB4B 1M2WA 3SLRA 2PRJA 3L4EA 2CB0A 1T6BY 4E5SA 2XW6A 1ZD3A 1OGYA 3LCRA 3VSDA 2PUEA 2FPUA 4LC1A 4GPAA 4PHGA 1RIIA 2YBDA 3A70A 3FOWA 4LFAB 1ZVJA 1OX5A 1ZN2A 3PQ4A 3VJMA 1GL6A 1BJTA 3U1VA 1QC5A 1ODCA 5IARA 3VDXA 1CIVA 1SXJE 4MYTA 1QQAA 4LZWA 2XWPA 3IL2A 5H8WA 4F7DA 5IX8A 1JECA 4WZBE 1XNQB 4EMSA 1PLJA 1D8TA 2YQ4A 3G9UA 4HWTA 4II3A 4LJRA 3ZD8A 3ZX5A 2EKQA 2D54A 1KKUA 4QU0A 2Q9AA 5E6UA 2RH4A 4YAKA 3PSAA 1U9CA 1WS6A 1JFVA 3JWHA 1E2PA 3AF0A 3QELB 2Z3WA 1R88A 3NNNA 1DMRA 5B7GA 1EFLA 1LC0A 3VV3A 4DJTA 4EG5A 2ZJ7A 4BMSA 2CFRA 1QFZA 5ELXA 1W4LA 3GOQA 3MELA 1NBOA 3NYQA 4LS3A 5KKNB 3QMWA 4QAQA 5K0EA 4H7JA 5FOUA 1NOIA 2H1RA 1MVOA 1C50A 3K9NA 4MWTA 4EUSA 3FWNA 2XBLA 4AS1A 2O4UX 2VDRB 4LK3A 4RENA 1L8AA 1CV2A 3Q88A 4FN5A 1II8B 3ZU6A 4ZKDA 3PZBA 4M60A 2QX6A 4KQMA 3VDRA 4Z7QB 1S6YA 3I1YA 5AKYA 1Y1PA 2RHGB 1KVUA 2ODQA 3KUCA 3LRTA 1CWUA 5FB3A 2WWVD 4CODB 3HN7A 2DFNA 3IV7A 2HX1A 5CK5A 4CM3A 3K8QA 4TSRA 5B1YA 1O6GA 4R69A 2CJFA 4RELA 3S7TA 3VNAA 1Q7BA 1ISHA 5DYTA 1TM3E 5JI2E 2AMVA 1FUKA 5IJ9B 2JLZA 1C0PA 2VQSA 1QUFA 1ZZGA 2G06A 4N41A 2LW7A 2O3TA 4NC9A 2FRDA 2R6JA 3OHMA 5BWCA 4D4MA 2GKOA 3CZQA 5CG1A 5BQ5A 2R1ZA 1R3UA 3FFXA 1KIFA 3AG5A 4LC9A 5ALOA 3HO1A 1IN7A 3IJEB 3LBAA 3FY4A 3UWKA 2PS9A 3H2IA 3WOHA 4TVSA 4O1IA 3QSGA 4J7CA 3MGAA 4IQGA 2O20A 4EUNA 1M34A 2EJBA 2G9VA 3LKBA 1R18A 1H0KA 1U0OC 5DT2A 3SSMA 3T1VA 4LFBB 3U3JA 1MRZA 4KMSA 1YJ8A 1VIVA 4A0FA 4WN3A 4QU5A 5DM70 3LC7O 4QO8A 4TT3D 1RPNA 2DHEA 1OILA 5TARA 3M1IA 4FNAA 3L6OO 2ZIZA 5FA5A 2P3SA 3DKIA 5KTSA 1JT2A 4MMZB 4Y1RB 2I4OA 1M54A 4Q3CA 1WHTA 4N12A 2N1BA 4HN4B 1DTWA 2R7LA 2HXGA 2JCYA 3K1AB 3U48A 1RI3A 2JBAA 3ZWBA 2DBRA 4Z0TA 4M4SA 3TQTA 4A9AA 4EHDA 1NRIA 3WL5A 4BB9A 2IPAB 1XL1A 2H1VA 2Q5JA 2Q50A 3HGTA 2RHWA 1E98A 4OHBA 5JSHA 3NFRA 1FVFA 2QUBA 3A1TA 4Y7CA 1E9SA 5K45A 1P7PA 5AVSA 5FUQA 4I5DA 4J0HA 4UEQA 4QTXA 4X54A 3OAAD 3OQBA 4AW9A 4DMGA 5IZ4A 4TYMA 1LPOA 3RS7A 1NI4A 1BCRB 5DXFA 5ESDA 4NXMB 1FFBA 2J32A 2MYUA 5EJIA 2PUFA 3ZXXA 2DVMA 3ED1A 3UT6A 3WHKA 3IKTA 2PAAA 4G8JA 2YZ7A 2PVCA 2QLTA 3W5HA 1LK7A 2A14A 1VXOA 3O90A 4G37A 4PFKA 5F1OA 1UPAA 5B58C 1QVZA 2RHJA 5A0VA 2FPKA 3WNQA 4IGAA 2ECKA 4JYZA 2FZGA 1F6DA 2BCJQ 2IIBA 1GR1A 3RTEA 1HDXA 4ZT5A 5BYJA 2ZPAA 3C6QA 1FFAA 2OZPA 4QPCA 4Z2YA 3VYSB 1JEYA 2FEKA 3K3PA 2WWFA 1N36B 1K63A 3VU8A 2G4LA 3K0AB 3SQOA 3TSCA 5JC1A 2E4UA 4H6PA 3ZU5A 2HRZA 4CWAA 3I73A 1Z0IA 3E8XA 5HS4A 1O3YA 3K0HA 1WWKA 2YY7A 2W42A 3KQQA 1QAQA 2YWBA 3RG2A 2YC2C 1BN6A 1N6IA 1LBEA 3C98A 1BGVA 4OFXA 1R0XA 1OT3A 1SHKA 2UVPA 1CIJA 3K9QO 3FI0A 3GGCA 1JEDA 3CVVA 5AK0A 2EBHX 3JD4A 3NGLA 4KAFA 4S1VA 1E6MA 5BVGA 1Z2CA 2PZFA 1J9ZA 2H9IA 5J3JA 3LHKA 2HCTA 2P2ZA 2C8LA 2W83A 4FDTA 4YAWA 1P1BA 3M7IA 2BEVB 1B4DA 2MMGA 4TKVA 1B76A 1FMFA 1XVUA 3DUWA 4LJSA 2NTNA 2P5YA 3L7DA 3GI1A 3H9GA 3TM5A 3AHEA 3T0FA 1BMTA 2PMFA 1UDXA 4XOIA 2ZUCA 2LCQA 1QH1A 5IG2A 3L07A 2SCUA 2W0MA 3BFKA 5CX4A 1DV1A 3RPEA 4DWJA 5CK4A 1AF7A 2RARA 1PFKA 3EVFA 3RRBA 5HZHA 1D6JA 4ZARA 1WCXA 1P2GA 3M0EA 5CDUA 5HRUA 4KR7A 1RPAA 3WNCA 3HYTA 1KYWA 3V2UA 5JV5A 2G6BA 2VT7A 2CVZA 1PFYA 1Q0PA 2A5DA 2O2EA 1PZHA 1ZEJA 3PXAA 3ZGVA 1MOSA 2R6FA 4MQ5A 4NEQA 1T4GA 1U8ZA 5LM3A 1ZRNA 3L2OB 2ANCA 3OOEA 4UBMA 5DXAA 3RK1A 3G9ZA 4HQ0A 4M7OA 4RL4A 4YH1A 1T10A 2ASEA 3EC7A 4FINA 4ZGGA 4JFAA 1WZCA 1Z4PX 4NNJA 4ZT3A 4JI2B 2FRDC 3PDCA 3ABRB 5BN5A 3H1BA 1T6NA 1XTZA 3KVRA 3W6OA 2LCFA 1PFWA 1VJGA 2XV1A 3DE7X 4R2XA 2IW1A 4YVFA 3BGIA 3S1LA 1JIIA 1IBKB 1JLKA 2Y68A 3DS8A 3K9BA 1IOVA 1P91A 3A0UA 3DMDA 1FXUA 2ZAMA 5FBRB 3U3RA 4HDKB 3RJ5A 3UFBA 3DZIA 1A8QA 4XYEA 5DYGA 1QRUA 1H9AA 4KYIB 1KU0A 1WZIA 4RTQA 1O6FA 4C9BA 1I4TD 4MQUA 4JUBA 4O4IF 2CUKA 3HB0A 4BO9A 4YJFA 2JPDA 1QIFA 2CD7A 1HDRA 2PS1A 4I9NA 4E5YA 5JXGA 1ZK1A 1G2QA 1AO3A 4RVSA 2FDXA 4AMUA 4PPGA 4KHPB 2GKSA 2ZYVX 1CXZA 4HK4A 3U0BA 1PJLA 3AEKA 5EERA 5KSYA 3KRTA 1Z28A 4Q3OA 1R0KA 4QVGA 5BSHA 2VSFA 1UKVY 1YDHA 1TIBA 3MJTA 4HDAA 4BDSA 2D1FA 3HZOA 1DARA 1US8A 2C96A 2VBFA 5HBRA 5I5GA 1ZJ5A 1KY3A 1PEYA 5KNCD 4M99A 3ROPA 1NL3A 1USIA 3VZRA 5LQAA 2G71A 4CMCA 1AHPA 2G80A 1G59A 4JR2A 1Z6GA 3T7IA 3O74A 2OCAA 3MINA 2ZCVA 2B1IA 4FFMA 2RFLA 4OHUA 2J0UA 1U7PA 2XWQA 2ZUWA 1G3IA 2XWSA 1T8SA 3C7DB 1QH8A 4MVJH 2CBZA 3SSOA 5HUHA 3KJZA 4EJ0A 3UT5A 4P5EA 1V7PC 2LP4Y 2DHCA 4JENA 4MVJG 3RUIA 4P31A 4BVJA 3CCFA 3QEMB 4HBZA 5AVXA 3NATA 4QELA 4L3OA 3HKCA 2HRBA 5ES3A 2CL7X 2H08A 3TO5A 4CKXA 1TZCA 2XB2A 1DXQA 3ML1A 3AY0A 4RXMA 3H1EA 3GH1A 5COBA 4GMFA 5JSYA 3U4AA 1M1YA 1DKRA 3FM9A 3VC3A 3PF9A 5B12A 2X7JA 1PWYE 1Q95A 1EESA 2O3UA 1FVHA 1BEUB 5FUVA 2FF5A 1CJCA 3QVWA 4FCWA 4BKRA 1I9CA 4KJZA 2CC2A 5DW3A 3DDUA 1GYPA 4F06A 3UW3A 2QAGA 3E7DA 5TQ2A 1ECJA 1XKXA 1UP6A 3Q6IA 1MXHA 2F48A 3B6KA 4G1MB 1KS9A 5CT9A 2FSHA 2C2BA 1GFIA 1H2XA 1NR1A 2CB9A 2ZI6A 3D8UA 1N2BA 5I7AA 1DUVG 4AZTA 3P2JA 4QYIB 4PGGA 2EP7A 3V3TA 4E94A 1JHVA 3IT2A 3O8OA 4RS4A 3UMGA 1C3OB 2WF8A 3QG5A 3U7GA 1QP0A 3CH6A 4G0XA 3F46A 2OPBA 2ZJBA 1WCIA 3EF3A 2BGKA 1TAGA 4M1SA 1UBKS 1QO9A 4DEXA 1NVUQ 4YA6A 3BDVA 1HBJA 1NBMD 2WKQA 3JQ6A 3L7YA 4UM9D 3ON5A 3FUVA 2FN3A 2Z5GA 3AVTA 1R3DA 3FLAA 1E6LA 3IODA 4IUYA 4Q3LA 3NO4A 1G41A 3OZSA 2JJQA 3NU1A 4CQLB 4CR6A 1Z6YA 3UJBA 1W87A 2JAQA 3EDCA 3BJRA 4ALLA 2D1YA 5MGBA 4EO7A 1RW4A 2WD7B 4IJMA 4RCYA 4WKCA 3V7FA 4MR8B 3DWIA 1TRKA 2GJ4A 3LOUA 4ZQEA 4NE9A 3B7PA 5EKXA 4DCTA 4B3RB 3TZLA 1KI6A 1U0SY 4F3KA 4KYVA 3W5AA 4EB6B 3NEYA 4KPEC 4RZIA 2IYWA 3C74A 1G2IA 4CKWB 5I9NA 3T7RA 1WTAA 3TTTA 1SBTA 1ZH6A 3WKAA 2H52A 3H5TA 1PTJA 2R66A 3L1KA 4UPVA 5FA6A 2BV3A 1NIPA 1TM7E 3VQTA 4NARA 1FNCA 1H5QA 1U5CA 1AT1A 1T9ZA 3D4IA 4C78A 4C7MA 1LBTA 2BFPA 2NTEA 3DR5A 5A4DA 1JE0A 1VMDA 2GD2A 2DT8A 1YE5A 5DEIA 1C4WA 2FHPA 2I4RA 3B8HA 5CW1A 2DPHA 3ABIA 1IJKA 3GQVA 2VLBA 1GGVA 2V1XA 1GA4A 2JB9A 1BA3A 2IODA 3AIMA 4OLHA 5A71A 2G88A 1T3GA 2V55B 1FEZA 2JK0A 5AM2A 5DTQA 3CW9A 3GDGA 3A6KA 4X7PA 2FMTA 2VA9A 1Z22A 2VNHA 3G1TA 3LVRE 2WPDA 1K9VF 3AVWA 2P68A 2PA0A 3HVJA 2W0SA 3AERA 1DRKA 2WOOA 1VLLA 5G4LA 1W5TA 4AURA 4DPMA 4E2ZA 2A57A 3HDTA 4J8PA 4XPIB 3E82A 4IIXA 2NYAA 2JFQA 5TJ9A 3OZVA 1E1MA 4QLAA 1DG1G 2QRHA 4WFKA 3DVQX 2EHDA 4URHA 4YJGB 1IEQA 4QHTA 3GAAA 3HJHA 4TQAA 4ARVA 1XZHA 1W2WB 1J0BA 1UBHS 1AZTA 3LCCA 2ADMA 4IWYA 5ELLA 3MXTA 3T61A 1WW3A 3QVMA 5BOVA 3VTKA 3AF5A 4JXZA 1YL5A 4TROA 3PVCA 2BIFA 2BTEA 3QWIA 1TK9A 1TW3A 2SKDA 1EUCA 1GG8A 3JQCA 1D3AA 1VG9B 2QMUA 1F8XA 4FX5A 4UHHA 5TT1A 1MEEA 4G4JA 2RSLA 1K4MA 1LI7A 2Q4EA 6GPBA 1EMDA 2VYVA 1RRVA 2GN0A 3F8WA 1JDBC 5BNWA 5AW8A 2E4VA 3RS3A 2OXEA 1E3SA 1LPBB 4YAOA 3U7JA 1ZY2A 2Q8NA 4K9SA 3ZQKA 2AN9A 2H9YA 3IR6A 1F60A 3OM8A 1B1CA 1YQWA 1ZXLA 2GD1O 2UZ0A 1JR3D 1BEEA 4HNUA 4I1UA 2Z8ZA 1N33B 1YKFA 4FSDA 4ZIRA 1IXSB 1KHTA 1KJ9A 2VSYA 3AYZB 3RREA 3ZDDA 2IF2A 4GLBA 4AF8A 4CMEA 3DEYX 4RSMA 4K87A 1CS0A 3HSKA 4G8DA 5AW5A 4X41A 1DC5A 2XH8A 3IAAA 3TJZA 1OHHD 4BBAA 5BV1A 3EGDA 2WJHA 3VC2A 1ZCBA 4LDJA 3UOAB 3KZKA 4UE3S 3TLGB 2JZOA 2ASVA 2QRGA 3CN7A 3KHUA 3O92A 4C07A 3E7FA 3U61B 1OJ7A 3ZEIA 2PBFA 1E5DA 2QAGC 5JRZA 1PUXA 1I32A 1S02A 5GP1A 3RIEA 5K3SA 3ETEA 4PR3A 5TMEA 1HE2A 4B09A 4WDQA 2CV2A 2CLFB 2MSCB 3CSUA 4Q3EA 5DZSA 2B2XA 4GECA 1BH2A 2ORVA 3A2NA 4H60A 4IFIA 4NCHA 4S2EA 4UHJA 2PX2A 4EA9A 1KP3A 2BJHA 3NC4A 2W2QA 2ZIWB 4BV3A 2PYZA 4DJAA 1NBME 3HH8A 4TMYA 3KE8A 1IRXA 1VFPA 4LJAA 3A32A 5F7JA 4FE4A 2BLLA 1NDUA 3SM3A 4O25A 3Q8XB 3P8ZA 3PLRA 1CCWA 3I5UA 3ZV7A 2NPFA 4RTRA 3QIAA 1GWNA 5K03A 1TCUA 1KAGA 2C03A 3CINA 2H2IA 3EZLA 3HA5A 1LB1B 3I04A 3JWIA 1Z5GA 2IH5A 1WXHA 5LB2A 5G3ZA 3SLKA 1AMNA 4QQ8A 3AR4A 3I01A 3Q9LA 4JLVA 4RWZA 3QWAA 1ZLXA 5AJYA 3V8PA 4B80A 4IDOA 4G67A 1E3WB 4JIMA 3K0BA 3U4QB 1DJMA 4JFRA 2Q4DA 4RLFA 1YNOA 2FWAA 3H4MA 4C4RA 1KL7A 3TW6A 1IDOA 4WLFA 1P2TA 2YUTA 3JPYA 3QKTA 5IC4A 2W98A 1FBNA 3T1OA 4PN7A 1M6EX 2I2DA 3DT9A 4ILEA 3P9NA 1C7ZA 3BIFA 4JT8A 2FQQA 1PTJC 2FEXA 1P9LA 2QR2A 5CIQA 2EFJA 4Q4LA 5DH9A 5A3VA 3IMFA 1YH3A 5ALXA 3P9KA 4KITB 1DFGA 1W4AA 3ZV4A 2G8NA 1G18A 3I5MA 1DSSG 3R2JA 4OAPA 5LZ7A 2ENWA 1M9NA 2YIVX 1PJSA 2W58A 3C4JA 3TZCA 3TRFA 4QQRA 4WSOA 3PHLA 3H2KA 4QO7A 5FX2A 1AV7A 3ET5A 3OUUA 3IEXA 4FWBA 2WT4A 1D8AA 2VYQA 1W5AA 2D5CA 3GLFB 1NP3A 3LQYA 5AKHA 5E7MA 4EHKA 4BNDA 1A27A 2HHAA 3LS2A 2Z83A 1VG8A 1H93A 2ZKLA 3QPUA 4NBVA 5EXDA 4D79A 1OWOA 1UZNA 4X9XA 1KC1A 3EIFA 1YMVA 2PX5A 4BVEA 1KGDA 1IHPA 2X2PA 1GKUB 2B8JA 5AKKA 3ZUPA 3CIFA 3NDJA 3PR3A 2DHDA 4CXMA 1U2ZA 4Q7LA 1FNBA 1XZBA 1ZNYA 2OZVA 1J56A 1Z5UA 1L4KA 1XD2B 2VQDA 3A4NA 4KXUA 2XF2A 1B43A 2B0JA 4GGPA 5CJ2A 5F73A 2GHIA 1SVLA 1XTUA 3S99A 3CG0A 4O2AA 4JOSA 3TXYA 1Z7EA 5MN4A 2XZTA 3PJFA 3TAXA 4DDWA 1YSCA 3A04A 2AKYA 3WYEA 1IWBB 1L8XA 3GLUA 3UNXA 3VJKA 4MIOA 4D3YA 1O97C 5ER6A 5KO2A 1FFXB 2YY6A 4UZFA 1TW2A 4JVMA 3VKVA 3R7DA 2X4IA 4F72A 4LTDA 4TLCA 3K31A 5FBZA 4RAQA 5JE8A 1YUMA 4I8XA 4R7GA 3A31A 4GQAA 1S2IA 3ABSB 4JGGA 3ENWA 3KT0A 4NCXA 5DO9A 4D9CA 5A6SB 1IAQA 1NYLA 3S28A 3WDMA 4HAYA 5BPFA 1NLZA 2HA0A 3CT4A 1L4UA 1SHLA 4H3KB 3G6KA 2V0CA 4QDXA 3LUKA 3VM6A 1F2UA 1W2GA 2Z8YM 1OD6A 3SYKA 2X42A 4ZN6A 7YASA 4HDSA 1V1MA 2AR9A 3A6LA 2TECE 3O3OB 3TLJA 2ESRA 4DMHA 1UXKA 5DF1A 4ARSA 4CMEC 4E6PA 2Y9ZA 3MF4A 3OURA 3T9BA 5I45A 5JRJA 4IIHA 4JC4A 4F56A 3KLMX 2WNSA 4YUWA 4OOEA 2GTIA 1YTUA 4BUJA 1AB6A 3K0SA 3TIXB 3BQMB 2L2QA 3ESXA 3BJEA 4JB2A 4LJ8A 3L6RA 5AVZA 1EK5A 1QCCA 5IHPA 1O0SA 4E14A 3CZ4A 1T3HA 2FN9A 4RD2A 4C30A 4B3FX 1G21A 1IC6A 1N2XA 2ZE7A 2ZI4A 3E9NA 3O8QA 4CCYB 3QVGA 5KMGA 3PI7A 4WK4B 2XCUA 1C9NA 1XIVA 5I9BA 4L5AA 4ZHQF 1Z73A 3EIEA 5KAMA 2F3UA 3T9DA 5C35A 2QTRA 3C1TA 3V2GA 1E6KA 5AIBA 3USZA 1R1DA 1GTG1 2AUTA 3J81A 2NYVA 3FHJA 4F85A 2HMAA 1QGYA 2ZSAA 2QUJA 1MF7A 1UDRA 4OATA 4L51A 3D3QA 1J97A 1E0KA 2M1XA 2ZSDA 4P9NA 3VU9B 4F9TA 5AVRA 4RULA 2NZ8A 1O94A 2FJUA 2HUNA 2VP2A 3Q7IA 4NE7A 4DR6B 3HJUA 3JVIA 2YCLA 3QP9A 4ZV7A 1KJYA 3S7ZA 2Y77A 2HMTA 1A5TA 2VTKA 4I55F 4LF5B 5C7OO 1P5FA 2F17A 2FWRA 2H2WA 4BCBA 4YCCA 2WA2A 2ZYSA 1VCHA 4YQZA 1JB1A 1ZGGA 3FSRA 2HA2A 3LBIA 3T06B 1P7WA 2IU3A 2CK3A 4GMGA 3WKBA 3AF6A 1AS3A 2L69A 2I66A 3M3HA 5CNMA 3OTGA 2MYPA 4BMOB 3RS8A 2ZRLA 4JK3A 3E18A 2ACKA 3DFZA 3PE6A 5CVJA 3ZZTA 4S05A 3AM3A 4UQOA 1X14A 4G0QA 5FEUA 1JQBA 1YD7A 2FPPA 1T1RA 3KHSA 3M4ZA 4FGKA 4MA5A 4MKGA 5EHGA 3DBRB 1Q3KA 3EGXB 4P3NA 1BKDR 1JV2B 4FNOA 1JLHA 3TRDA 3E70C 4F2DA 2RHDA 4CL2A 3A3OA 2CYCA 1X7ZB 2QWXA 4B76A 3I62A 1QHHA 3SFTA 2EKLA 4KUHA 1EJBA 1UBJS 2CDBA 3GJ8A 3HYRA 2QR3A 4ITUA 4J43A 4O2BF 2OBLA 4REQA 3PENA 2B0CA 2EFCB 4XIIA 1VSQA 4FSHA 3LGSA 3L0CA 1MLDA 3P4XA 3EVAA 3RUHA 1ZD4A 1BX0A 1KYIA 1HZJA 1ZPDA 3EMKA 3FHCB 3HG7A 5FFNA 5FOWA 4O4IB 4XAQA 1GT91 4MKHA 1VIMA 2O50A 4FW9A 4KU4A 3I6YA 4WN9A 3B70A 1QYRA 3TRIA 4MI3A 3ANTA 5FF9A 4UEJA 1V96A 1W73A 3HJCA 3U26A 2X5XA 4V0RA 3K8OE 3TLMA 4TZ0A 1RXIA 1RWQA 3SBOA 2O5CA 2O2YA 5DHAA 2CCGA 1JEEA 1KAEA 2FLWA 2G28A 1M34E 3GJ4A 2ZUFA 5KINB 2PIDA 5EE3A 4MUJA 3F7NA 4YWJA 1ODKA 2MSKA 1P2FA 5KCMA 2VNAA 5ITVA 4WTOA 1KYVA 1EK6A 4PFQA 5G1OA 4CTJA 4DC9A 4JCCA 1EUZA 1ML4A 3R3YA 2DLNA 4F5WA 3EIQA 1GTRA 2OORA 2GYVA 3IAHA 2HJRA 2P69A 2P9BA 4AJNA 3O2NA 3O82A 1QU3A 3FNIA 2JDIA 2ZUUA 2V6FA 4RYLA 4F5ZA 4PAGA 4ATNA 1GFSA 1QWSA 4B40A 1G5TA 3CGGA 3KVYA 3I9OA 4ERXA 3NKVA 5AK5A 4KPYA 1TEHA 4M0CA 3IJ5A 4DV2B 2AFRA 3VAAA 4LV5B 1D04A 1RWBA 1E7RA 3GFPA 3UENA 4E4RA 1BDHA 4QKQA 1RPJA 1VB3A 1TZBA 4MV3A 2F00A 5AOVA 2JANA 3IPRA 2OCIA 4H6XA 2Q5FA 1NM5A 3PVSA 2FYTA 4HAXA 5AOBA 5EA2A 1Q1ZA 1KPIA 2V7TA 2NZJA 2OV2A 1A1VA 1ATZA 3ZI0A 4YP0A 4Y1FA 1RLMA 3V8VA 1NMEA 2BRUA 3ENNA 1NTRA 2D5AA 2WMOB 3LLVA 5IUJC 4BC1A 2QBYA 3DZJA 3GEBA 3ZXUB 1E2QA 2AFHA 3NLLA 4G5OA 5FOTA 4B6GA 5CIWA 2IHZA 2JHCA 3HYNA 3ZCTA 4HYTA 3CH5A 4GWGA 2GFHA 2HSJA 2II6A 4DCOA 3B6ZA 2V5VA 1XI2A 3F90A 4JVLA 1W9HA 4KV7A 4YRRA 3R1IA 3OSZA 4MO9A 3Q9SA 1WDLA 4NPHA 4UTPA 3ZD6A 3OTHA 4Q48A 2HV8A 2GLTA 2F4VB 3WLMA 1NP6A 2AZMA 2YYZA 4PZDA 3O91A 3GXOA 3PUYA 2O2HA 4DZTA 1ZAYA 2R7AA 2VZ8A 3V1YA 2XKJE 4TN5A 1KF0A 1TM1E 2GA9A 2JHPA 1MO5A 4MP3A 3OPYA 4U2BA 4X64B 2GAJA 1A8IA 4W5QA 4AY6A 3D0OA 3STXA 4BRSA 1G42A 5EL0A 4KUGA 1NFFA 4NCNA 3W5JA 4D9FA 5A4AA 4KXMA 3T95A 3GLHB 4RZHA 3KZOA 1O94C 3Q40A 1SU8A 4PCAA 3TSZA 2OSVA 4Q03A 1PK8A 3G8YA 5DNWA 3G13A 3I9V1 1VPWA 1ARZA 1LNSA 2R6CA 3DO5A 5CCDA 5ITZB 3R5JA 4G24A 4BQSA 3QM1A 3EEBA 3IVGA 2R47A 1YBMA 2JJ1A 3F2IA 2LD4A 2OO5A 2C00A 4BKPA 4PIPA 5IN4A 4PYJA 3EG9B 1U7UA 1H2YA 2X5KO 4CLOA 3I2JA 5BURA 2P9TA 1XWFA 1YCFA 5K8VA 1T13A 4E5UA 4YRJA 3KYBA 1RHRA 1PHPA 5HQTA 1CR1A 2PGXA 1GGMA 3DBLB 4RCZA 4EARA 3KPYA 5JW6A 1JNXX 1U1FA 1L8LA 3WLEA 2VS1A 1EVEA 3UW1A 2PJUA 4RFSA 4HRVA 3RVRA 3MT9A 4A26A 3LIIA 4F11A 4XFJA 4NENB 1WMFA 1J00A 1YS7A 5IAAA 3TBKA 3U39A 3K9FC 5JUWA 3KB2A 4WIAA 2A67A 4WH0A 3F4KA 2IZ0A 3F6RA 2D2FA 1Y1KE 3U31A 4EL5A 4FFWA 2NAPA 4LVNA 4F2PA 4YNBA 3T5BA 3WO1A 1KRHA 3REGA 4A92A 4H1UA 5AP9A 3G49A 2W2NA 1DTEA 1O95A 1Y3HA 2ZR9A 4ID9A 1UDWA 4UE2A 5ALHA 1NV8A 5DGDA 2VF5X 2WJ4A 1KVQA 5IVIA 1SKYE 2OK8A 3N53A 3INYA 4NOKA 4XVRA 1DZIA 2R62A 1IBMB 2EXXA 4G9GA 2PUGA 1A0OA 2JRCA 2VAXA 3D6JA 3FCAA 4DKXA 3UHJA 4L73A 3KTDA 2IXGA 3COJA 4Q1EA 4N82A 2I6TA 2RHMA 3DOHA 4FYPA 2IP4A 5DCWA 3ZJ4A 4CRWB 1I13A 2OQRA 2YC4C 3PHGA 1CB7A 4BFVA 1DLJA 1N0UA 1VL2A 1Z3IX 3ZHZA 4CHGA 4JXXA 2EZ4A 1VA4A 2QE7A 3RWOA 3UWPA 4C4AA 1IB6A 3OX2A 5GY7A 5HGXA 2OORC 4HB0A 4V0NA 3VOTA 5DNUA 3GFFA 2WPDD 2AN3A 2F67A 2OMEA 2NUAB 1H5UA 2HLPA 4KQWA 3WVNA 3DMTA 2JFNA 1I5OA 1RJWA 5JTTA 3UGKA 2D0DA 4YJ2F 1C7EA 2C9BA 3B6EA 4FBMA 3PDJA 3KU1A 5AKIA 1D2MA 1GCOA 1ST3A 2JIBA 3KV3O 1XJCA 4OJQA 4C2TA 2R8PA 2P4HX 1A9YA 3WJ2A 1CJUC 3LVFO 1PR4A 3QF4B 3ORHA 3MD9A 1NM5C 2OG2A 4PHHA 5FTNA 1XYVA 3RS5A 2JIOA 1W1UA 2VFAA 4ZAYA 4GL2A 3D4BA 4FDAA 4MWZA 2OAP1 4PLYA 4YI5A 4DSUA 3GUVA 4ZJPA 5F7XA 5J2TA 1D2NA 3RT1A 2F90A 2BRUC 1EA7A 1O97D 1HRKA 4QOGA 2XYQA 5A2QA 3BGVA 3ASZA 1Q14A 3HU1A 2VYVD 2CHEA 2FEOA 5SY4A 4BZWA 4R1MA 4QU8A 1E59A 1R6UA 5CA1A 3QUCA 4H7FA 4J2HA 4M7RA 2IYSA 3GUUA 3CSSA 3CUTA 4FGJA 2J45A 3C3WA 4I50F 2OYSA 4AM8A 2KLHA 2WHPB 3ETHA 2IE8A 3Q5DA 1M1YE 4KMRA 4LOLA 1Y8AA 2TMDA 3JD3A 4MQEB 3N59A 4KH0A 3OQJA 5E3HA 3W4JA 1MJGM 3ZLUA 4RPGA 3MUEA 1YIDA 1ZJYA 1RRCA 3CC8A 3H84A 3ISTA 1TTHA 4JL6A 4OXRA 4QBTA 2SBTA 3I42A 4YPOA 2IEYA 4TWZA 4LNHA 2C0QA 4JLDA 5JVDF 3HM2A 3U1BA 2BKEA 4J3JA 1GGHA 3FAKA 1V25A 4I1IA 4DUZB 2VRNA 2I4NA 1UKBA 4GM4A 4Q9DA 2BF7A 3SQDA 4BU0A 1XPRA 4F86A 1KYQA 4ENSA 2R8EA 5LKRA 4L3VA 1UMDB 1RBQA 1JYEA 3NWPA 4PC2A 5KNDH 3FJOA 3W06A 3UTCA 3MJHA 4YDHB 4U9IS 4TLBA 5FDFA 1TZMA 1GZHB 1WCWA 3F6SA 3PNYA 2OO5C 2CLEB 5CXUA 4QYTA 1WE2A 1G5RA 2QUKA 3PA8A 4JLPA 3LFTA 5D3MA 3TKLA 1W52X 4EYQA 2ZJYA 5F23A 2V0NA 3LXXA 4P4TA 1I7LA 4EX6A 4ZO6A 3A4VA 3ND5A 2JCGA 5ETJA 3HP7A 3EJ6A 4M86A 4B3HA 2WA1A 1GT6A 4MA0A 5D3ZA 4EYGA 5B53A 4GOND 1U4SA 2E49A 5LU9A 1PT5A 2GB4A 2VHVA 4E03A 4ZFNA 3I0MA 5JFGA 3GL9A 1OZHA 4YACA 3U4DA 1XZIA 2P35A 3KE9A 5HCNA 4O29A 1NJFA 3DWGA 3JWGA 3TEJA 3DM9B 4BNWA 3EUFA 1D0SA 1P60A 2HPZA 4HQRA 3VC1A 3ZK9A 2JJ8A 4KN6A 4ZPJA 2LRHA 4L4ZA 3V1TC 4EITA 2V7QA 4ON9A 4QPNA 3D7MA 3OU2A 3C3BA 4UUMA 5HJEA 3EB9A 3IALA 1KU6A 2LKCA 2WKSA 4QEZA 3RFFA 1R5NA 3TR0A 3DZDA 3QSYA 3IH5A 2AFIB 1O95C 3RC8A 1JSXA 2P9ZA 4W63A 4E1AA 4QOJA 1YDWA 4X1YA 2W2LA 3E7WA 1WQ3A 2ORYA 4L2IA 3FUWA 3QENA 2ADOA 3CW2A 4JR1A 3WQHA 3K70D 4MRMA 2ZBDA 3IIMA 2F3PA 3DDCA 2FSGA 5IDQA 5IYZF 2E4XA 1Y5NA 3C41J 2DR3A 4JEMA 4XDZA 2ZYDA 5F76A 3WYCA 3IQXA 4MZXA 2R48A 3JALB 3TOZA 4TV8F 1QP4A 3H18A 4Y0NA 4KX3A 1F3LA 4YLYA 4BZPA 1MEOA 4HNRA 3LY7A 4E70A 5ICGA 5ADUS 3MJCA 4BLRA 4QUDA 5LIPA 2H1OA 4ITVA 1EWRA 3NH9A 3WGZA 4BXOB 2A0KA 3DMTC 5DOZA 3FUTA 2JGKA 4OGKA 1EFKA 5KJFA 4LRSB 5KS2A 5ALDA 1RHQA 3ONEA 1U6IA 1F1BA 3AOEA 3OD5A 4IV0A 4KPUB 4NZOA 1V5GA 4KNYA 1SVMA 5EJGA 3MZ0A 3HJFA 4RD1A 2WVAA 3ZDBA 4OVKA 4HQKA 4NZ9A 1ZIPA 1F6WA 2AOXA 4F4JA 2MINB 4H0NA 3O5AA 4RVGA 2D2VA 3O21A 4AFNA 1SU6A 2H1HA 3CF6R 2FMHA 3ZCVA 3DVLA 1Z83A 2VJBA 2QRMA 3LT0A 5DPMA 1X8XA 2OCBA 2R6DA 4L6IA 2AG1A 4ZOCA 1RMYA 3TE7A 4DUYB 4MLDA 1Y6FA 2WMDA 4EKIA 3O8BA 2DRIA 3PDIA 4BAGA 3DBHB 1WMAA 3UMRA 5KQPA 1NHGA 3HXKA 1VG1A 3M5DA 2Q4BA 3KVVA 4G89A 4FT2A 1VLHA 1XRNA 4CTKA 2C92A 5H59A 1HEIA 2FR0A 1WUHS 2JIMA 3OJWA 4WOJA 1OE0A 4IXMA 3ND9A 5SY6A 3U7EB 1K5GA 3TW0A 4AI6A 2FPIA 4I5IA 4Y18A 1P3JA 4Y9SA 4WJZA 5FT9A 4GPD1 5E38A 4CL0A 4HGYA 2FWNA 4LCBA 4QJBA 3V9PA 4CV1A 3IHLA 5TQ0A 5GPBA 1Z8FA 4HQNA 2CF6A 2DAPA 4KNVA 1GCUA 1K08A 2R1UA 1PWEA 2O2XA 4HFJA 1H85A 6PFKA 3M1AA 4I55B 4YBRA 1Y9DA 4OA8A 2CZGA 2PWYA 3MMZA 2D7DA 3KNZA 1BDBA 5LDHA 2O8EB 3H8VA 1R8QA 5D7NA 2RAPA 3E84A 1VHDA 3MRSA 3BN3A 3LFUA 3SI7A 1HYGA 1EE9A 4ZCLA 3JYNA 1V5WA 1CEYA 1MP0A 5LN1A 2IY8A 1MAVA 4KMMA 4BNLA 1T9GS 5HF9A 3VKHA 4F5YA 1ISGA 1F0NA 1U0JA 4B33A 2GK6A 5KTPA 1AJEA 1AIPA 4M8IA 1R4NB 4XASA 3A37A 4I5EA 1Z5ZA 3FZGA 3EDMA 2F1KA 2A1IA 4KWIA 3VYVA 1WP4A 4DHWA 3G17A 3NOOA 2J31A 4DSZA 2EFYA 4MS4A 1A97A 3A9TA 1OI2A 1ZMTA 4M9UA 1Z45A 3VDQA 5JCXA 4C3VA 2H5LA 3QXCA 4ZC8A 1LV8A 1FOEB 2Y27A 2O3QA 3VR6A 1ONOA 3MRXA 5E7JA 1OAKA 3JATA 3QX9A 4WNIA 2YVQA 1G5IA 5DM2A 4EW6A 1ZQ1A 2CK3D 4DSAA 5H82A 1AG9A 2I62A 4TLAA 2HF2A 1KFKB 1CY6A 1N5RA 1FYEA 2WM9B 2PWZA 2VSXA 4UCWA 4BZZA 1XMQB 3IEKA 1KHHA 2QY9A 3CB4A 3OOYA 4X45A 4CDMA 1U3WA 5TIIA 4NYJR 1Z6QA 1H1LB 1N9ZA 2IYTA 4H0CA 4H7KA 2VDUE 4LIPD 5BNZA 1UKZA 5LSAA 2P90A 2HF9A 1YFJA 1JIKA 2DQZA 1XWIA 1C30A 2H85A 1CX9B 1N6NA 4RMIA 2HNBA 4O4HA 4Q6WA 1TTTA 2Z2YA 4TYYA 1OWLA 5CYPA 2XEXA 3HQ4O 3EGIA 3JW8A 4OL9A 1DO0A 1MRSA 1K4YA 2Q62A 3F2VA 2CWDA 3HCDA 4H3HB 4KQ9A 4ZCQA 4ZMRA 1T9GR 3GLVA 1PZMA 2GZSA 3T5MA 2DETA 3BE5A 2H3HA 4FFBB 4HGNA 1Q0UA 3HLKA 3RVJA 1GYRA 1JHDA 2ZAYA 5ED0A 2DC1A 5C1IA 3CX3A 4IH4A 3T0GA 2P4SA 3LOQA 1EUQA 1M1NA 4CN9A 4KV9A 4PGHA 1OZGA 1TLLA 2W9XA 4R1LA 1E58A 2GPBA 1YJCA 5CVTA 1HFEL 3GQBA 2VCEA 3AOEC 1HFKA 5T41A 1Z7GA 2DT5A 4J94A 4MEAA 5DNCA 3W8NA 1N9GA 1R6DA 3C7CB 3ADOA 3AJDA 2FDRA 2FPRA 1Z37A 2XUJA 2BGNA 4H1HA 2ZRJA