3EGOA

Crystal structure of probable 2-dehydropantoate 2-reductase pane from bacillus subtilis
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
292
structure length
292
Chain Sequence
SLKIGIIGGGSVGLLCAYYLSLYHDVTVVTRRQEQAAAIQSEGIRLYKGGEEFRADCSADTSINSDFDLLVVTVKQHQLQSVFSSLERIGKTNILFLQNGMGHIHDLKDWHVGHSIYVGIVEHGAVRKSDTAVDHTGLGAIKWSAFDDAEPDRLNILFQHNHSDFPIYYETDWYRLLTGKLIVNACINPLTALLQVKNGELLTTPAYLAFMKLVFQEACRILKLENEEKAWERVQAVCGQTKENRSSMLVDVIGGRQTEADAIIGYLLKEASLQGLDAVHLEFLYGSIKALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Probable 2-dehydropantoate 2-reductase panE from Bacillus Subtilis
rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords Probable 2-dehydropantoate 2-reductase
total genus 102
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 1.1.1.169: 2-dehydropantoate 2-reductase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02558 ApbA Ketopantoate reductase PanE/ApbA
A PF08546 ApbA_C Ketopantoate reductase PanE/ApbA C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3egoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3egoA01
3JQAD 4FFMA 4PIVA 4AJOA 4BKQA 4GGPA 4YB8A 4CV2A 1DIHA 1PQWA 1LJ8A 3BMOB 1D1TA 4YACA 4PLVA 3DONA 4LRTB 4UVDA 4DPLA 4YA6A 4R3WA 1U2DA 2DKNA 4KZPA 4J3FA 3GF4A 5F21A 2YHIB 1HETA 2AEMA 4AJ1A 2QRJA 2X22A 3SJ7A 4IGEA 4AJNA 4CMHA 3KSDO 1HDYA 1NNUA 4ZQBA 3HUDA 2V6GA 1VL8A 3P19A 1B0AA 2ZB7A 3Q9UA 4K1LA 1XLTA 3LVFO 3QWBA 1NVTA 2OMEA 2DPHA 5G0VA 3NX4A 1LDGA 1XIVA 2FMUA 4GL4A 1Y5RA 1L7EA 3HE3A 1NX6A 5A03A 2DUUA 1HDGO 2VZ9A 3FWZA 5LDHA 2X0IA 3MJVA 3LF1A 4CR6A 3R0IA 1RM5A 3ST7A 1C0LA 2NNLD 3DBRA 2EGGA 4MP8A 3C85A 5GMOA 3TL3A 2PKRA 4JGBA 2JAPA 1PJ3A 3TNLA 3D64A 4R68A 2CMDA 2IE0A 1AXEA 1H5QA 4L75A 3HWRA 2I65A 4BO7A 1Y5MA 4UUMA 7ADHA 4B79A 1DJNA 3Q6IA 2CDBA 2VUUA 3TFOA 3KETA 2P9EA 4DC0A 4XJTA 1YVEI 4KQXA 1EEHA 4FDAA 4WKGA 1J49A 4HX5A 2Q2VA 1NQ5A 1MA0A 1YH3A 3GGGA 2WD8A 2OBYA 2HMTA 3RBVA 3C3XA 1BRMA 1R4NA 4Q3EA 1YOVA 3RVDA 4QFDA 4WUVA 1NR1A 3MTGA 1UAGA 1P1HA 3LDHA 3VPHA 4MIEA 4R01A 2ZKLA 4U5QA 1CYDA 3HDJA 3UAGA 1CETA 2DT5A 2Z95A 1ZK2A 5EINA 3IC5A 3L07A 1H9AA 4CLOA 2W2KA 4HFJA 3IKTA 4IJKA 1E1NA 4Z0PA 4Q3AA 4P4LA 1P0FA 3WIEA 1FF9A 4CQLA 2PA3A 5I8WA 3H3JA 3WFJA 1KVSA 2NV6A 1A4IA 4MVJH 3WYEA 4DBZA 2Y1FA 4OSPA 2W98A 1VKOA 1RKXA 3GDGA 6LDHA 3GRPA 1ULUA 2NU6A 5JO0A 3ETDA 3VTFA 1LRJA 3GEMA 5IAAA 4GMFA 1VL0A 4RV9A 3TZKA 3IUPA 3R1IA 4R51A 4ID9A 1Y8RB 4NG5A 1ENZA 1EQUA 1I3NA 3NT4A 5EPOA 3VPSA 4W7HA 1JAXA 3AU8A 3EC7A 4XYLA 2HCTA 4J2HA 2WDZA 1CDOA 1DIBA 4MP6A 1FK8A 4NK4A 3WSWA 1AXGA 2NQTA 4CLRA 4Z9YA 1WDMA 1ZH8A 1MLDA 3S2FA 2J3IA 1ID1A 4CM1A 3PWKA 2Y0CA 4YAJA 3JD2A 4U6SA 3VH2A 4LRSB 3CKYA 4KTVE 3GVXA 1E1MA 1T1RA 2TMDA 1N92A 4EUEA 2WD7A 3AY6A 5B4TA 1B8UA 1CRWG 1VSVA 1NHGA 4OKIA 2RHCA 5CAEA 1JN0A 1EE2A 1M2WA 2FPGA 1DBVO 1ZNQO 5ENVA 4FCCA 4PLTA 4CLHA 1CERA 5IN4A 2X5OA 3ZN2A 3F9IA 1MXFA 3PDUA 4A03A 3ANNA 5HS4A 3R3JA 2HJSA 4CR8A 3WMXA 1K6XA 2LDBA 4BO2A 3H8VA 4K9DA 2JD2A 1VJ0A 4IJUA 2DBRA 3D4NA 5HWSA 3VKUA 3U49A 2IEDA 3LT4A 5L7WA 3NYWA 1R4NB 4IM7A 3ZHXA 1DC5A 2IZ1A 1GPDG 2Y93A 2AE2A 1M75A 4MJLA 4QXMA 3ROMA 1C14A 4BNGA 3DTYA 3C7AA 1I3KA 3WYBA 2J5RA 4FD3A 5AVOA 3U62A 3GNQA 4CM6A 3IAHA 2RH8A 4RVFA 1ZUD1 4ZVVA 1M67A 1H94A 3QVTA 3PEFA 2JFGA 3HG7A 4BO1A 3E18A 2AW5A 1B2LA 3ZV3A 4QQRA 4ZICA 1BWSA 2A4KA 3RD5A 4IDBA 3F1KA 2VHXA 1BXGB 4YJHB 3GEGA 3MCVA 3TPCA 1KBZA 1HLDA 3W4IA 2EERA 2EJVA 5JDIC 1A4UA 4AJPA 4NBRA 3DBLA 1Q7CA 1MG5A 3OA2A 3AOEC 1X7DA 3HDYA 2PGJA 1AE1A 3HNPA 3M1LA 1JW9B 4BB5A 2YUTA 5JDCC 1T1SA 3VDRA 1EVIA 3GDOA 3RC1A 5THKA 2BF7A 3MJSA 3V2GA 3LLSA 3VPGA 5JBIA 2NQ8A 5TF4A 4NR0A 3A28A 5K0ZA 1DFGA 4J1NA 1WMAA 1VC2A 2VHZA 5A9SA 2HQ1A 2ZQZA 1DEHA 1NWCA 4YXFA 2NVBA 4HFMA 3GHHA 5DN9A 4LK3A 1ISGA 1UP4A 4GAEA 5KNLA 1I33A 2OGUA 2AE1A 1JKIA 1EVZA 3LLVA 2BI7A 1LLUA 4RLSA 4CLRB 1Y1PA 3GVIA 3LQFA 5A05A 4E13A 3I6IA 1E0DA 4RQTA 5TT0A 1R37A 5C7LO 4ONEA 4Z6KA 5THQA 1DOHA 4BV9A 2OP1A 1VJ1A 3JQGB 2R2GA 4JROA 1YKFA 5KJCA 2Y99A 4MO2A 1U3TA 1Q0QA 4A73A 1YO6A 3VKVA 5L4LA 2FPPA 2JL1A 3ZV6A 3GN1A 4BNVA 1LSOA 2C2XA 4GKVA 5F1PA 1UXJA 3RQSA 1E6EA 4IGFA 4J9VA 4DL9A 2EEZA 3UUWA 4ALIA 3GLQA 4CV0A 3VH3A 2CVZA 4PLPA 3MZ0A 1E7MA 2GPTA 2RHRA 4J2OA 4DRYA 2AG5A 2PR2A 1B26A 5TT1A 3PJEA 4BKUA 1P44A 3WTBA 2C0CA 4FFLA 4HFRA 5JYEA 1S6YA 2WE8A 3ZZNA 2EKQA 2Q4BA 5JAQA 2W2KB 4BVAA 4Y67A 4CV3A 1GQ2A 1WZEA 3PFFA 4J6FA 2JD1A 2XF8A 2R00C 4XJSA 3D5TA 3U4HA 1XKQA 3OFSA 1XWFA 4FJ0A 4RF5A 4EYEA 1V35A 4N54A 2DTDA 1SPXA 4MPDA 3EK2A 4UVGA 3TSCA 2J3JA 4NBUA 4FSHA 4NJOA 4QO8A 4UVHA 1SMKA 2BKAA 2W4QA 2AA3A 3FBGA 4DPMA 2DM6A 1UP7A 3B20A 1NHWA 4XQ9A 5BNIA 3SJUA 3AI1A 3GGPA 5G0UA 4E6PA 4ZQFA 4FOSA 4W6ZA 3LF2A 4X54A 1P0CA 1ZK1A 5DF1A 1H6CA 3T4EA 3VZQA 5T57A 2WYWA 1NTOA 2BD0A 5U4QA 4YRBA 4PLCA 5AQ1A 4EGFA 5ICSA 1PGPA 3QHAA 4IQGA 1K5HA 4M8SA 1ISFA 4RPJA 3ICPA 1Q0HA 2Q45A 5KWEA 1LRLA 4GSLA 2PFGA 1EUZA 3I6QA 2B4RO 3NAQA 1VKNA 1NPTO 2VHWA 5L9AA 3FF4A 3UGKA 2X8LA 1RM3A 1YXMA 1AHHA 1H93A 1SCUA 4WJZA 1TB4A 1HDOA 3DZKA 1EE9A 1ULSA 2GN6A 4B4VA 2XPCA 3I52A 1JDJA 1ISIA 2ET6A 3GNSA 4OGWA 4WASA 2Y66A 3JQFC 3ZWNA 1NAIA 1L1FA 3ONDA 3ITDA 4IDDA 3L0DA 1KIFA 4FB5A 5KJFA 5BNTA 1DSSG 1NFFA 3DOJA 4L0QA 2YHIA 4DYDA 3EW7A 1NQAO 2YJZA 3OF2A 3W6ZA 4FR5A 1KETA 2W2LD 1LLCA 1DB3A 4LSMA 1D3AA 3QQPA 2R00A 5JCJD 3CMCO 3ZNNA 2DTEA 1P45A 4OSOA 1UXKA 2VTDA 4E0BA 4J49A 1H9BA 2GNAA 4RVUA 1YGYA 3DZFA 5CP8A 2P68A 3TRIA 1PJTA 4M89A 4Z9FA 5KVSA 3RBXA 3HADA 3W4KA 5JS6A 1P3DA 3GY0A 3C7CB 5A9SB 1MFZA 1WPQA 3CTMA 1EBUA 4DA9A 4HFNA 3KSUA 2IXBA 4YR9A 4AVYA 3FI9A 2C2YA 3P2OA 4MVJF 3RUFA 4YAEA 2Q1WA 1QV6A 3W8FA 1UZNA 1I2BA 4GX5A 1R0LA 2HLPA 3WGTA 5JFOA 3G0OA 3F3SA 1E3SA 3FNGA 5COBA 1ENYA 4UVIA 4YAGA 1U7HA 5U1PA 4GVXA 2GZ3A 1BW9A 1ONOA 4CUZA 1XG5A 4B4OA 2X0NA 3UCEA 3WNVA 4CMEA 4FJ2A 3NDIA 4KOAA 3E8XA 2NVUB 4BHTA 3H7AA 4MIYA 4MKZA 1WNTA 2Z1NA 2AHRA 2O3TA 3CH6A 1QV7A 5BNFA 4CM8B 5DZSA 3CE6A 5G4KB 2VWQA 1NPYA 1N1GA 1ORRA 4WNCA 2Q4EA 1XU7A 2YDYA 3EZLA 4KMSA 4W9NC 1LDYA 3DHYA 4WCFA 4TVBA 4I9HA 1U7TA 2Q49A 1IE3A 5EMHA 2DUWA 4JNKA 2PGLA 1E7WA 3AY3A 2JKVA 2BMAA 1JVSA 3AUSA 3JYPA 3B1FA 4IINA 4CQMA 1ZSNA 1QORA 2C07A 2NU7A 1JU9A 5BSEA 2PV7A 1PJSA 3UOGA 2AG8A 3KM0A 5TIIA 4LVUA 2O3RA 3UXYA 5C7OO 4CMGA 1HZZA 1Y6JA 1E92A 3FSRA 4ND4A 5GZ1A 1NFRA 2Y1OA 3SX2A 4D7AA 4RZIA 5A5EA 1XSEA 4TZTA 5DP2A 1U3WA 4GGOA 4TRRA 3VZPA 3JQ7A 1KVQA 3OQ1A 2XXBA 4BKOA 1G1AA 2X0JA 4BNXA 2I76A 1KEPA 1ADBA 4NJMA 5DNAA 3Q3CA 1ISJA 2BHLA 2ZK7A 4UEJA 2FR0A 2ZCUA 4QSMA 3TOXA 3RFXA 3W4JA 1SBYA 3EMKA 3VC7A 2GSDA 1L7DA 1D8AA 3WLEA 1QKIA 1T26A 3WR5A 5I9NA 5HM8A 2YYYA 1C1DB 3KV3O 1I32A 3D5QA 1YB4A 3PRJA 1RWBA 4I9UA 1U8FO 5K9ZA 2F1KA 3ONFA 2CSUA 1DIAA 4C4OA 1GUFA 9LDTA 3ZGYA 1PJQA 1OZAA 4GKBA 1X0VA 3JQ8A 5F1OA 4AJKA 1Q7BA 1DC4A 1ZZEA 2ZB4A 4R1NA 1M6WA 3KOUA 3ZW8A 1GV0A 2EKPA 3H9QA 1I2CA 3BZUA 3IJRA 1P77A 1D1SA 4TKMA 4CUKA 5A1TA 4MINA 2G0TA 3GT0A 4GVLA 2P4HX 3DFUA 3EUWA 5TJ9A 1SEVA 2NTJA 1YL6A 4PGFA 2D0IA 1RM4A 1KEVA 4ND2A 5T5QA 4J1TA 5IDWA 3ASUA 3GH3A 2GCGA 1YOVB 3H9JA 2ZYDA 3VZSA 3ULKA 2OUIA 3WXBA 1LQUA 4E30A 2ZYGA 1LC0A 3QE3A 5IG2A 1ML3A 4E21A 1AUPA 2JCVA 1R16A 2X1HA 5A06A 4LMPA 4QO7A 1LNQA 4OIMA 3PJGA 1NVGA 5KVQA 3PWSA 1BXZA 2PGDA 5TQVA 4PN3A 3ZCXA 2FSVA 1U9JA 2HJRA 2VRCD 3LC1O 1GZ3A 2X23A 4P4NA 4D3FA 2I3GA 3D3WA 4YT8A 1J5PA 1PJCA 2OHXA 1LRKA 3RUEA 3JD1A 2BLLA 3FBTA 4CL8A 2EW2A 2G76A 2NM0A 4RF4A 3MWDB 1IHYA 1UAYA 3MJTA 1K6IA 4C7JA 2CUKA 1W73A 1F8GA 5B4UA 4MVJG 3ZHYA 2Z1MA 5CFZA 2Q3EA 1GL3A 4BNUA 2E4AA 2HSDA 1H2BA 4BB6A 1V0JA 2JHGA 4R16A 4NNJA 1PL8A 5EESA 4OQZA 3ZNPA 3ETEA 2CVQA 5IXSA 4PG4A 1M76A 3IOYA 5I7FA 3BYZA 3E5MA 2NADA 5CDYA 2D5CA 3BMCA 2VN8A 4XGIA 3RU7A 4J4BA 1YB1A 1Z6ZA 5L40A 4KUGA 1K89A 4UVEA 2V6MA 1B16A 1EUCA 4Y6SA 4NBTA 1YONA 4G5HA 4RDIA 1U8XX 2O2SA 3OP4A 2BI8A 4RL6A 4EEXA 2B4TO 1HDRA 2X0RA 2HMUA 1ADGA 3WB9A 3BMCB 1EUDA 3RFVA 4JCOA 1W0CA 4NPCA 1JLLA 3L9XA 4PLZA 3GPIA 4JIGA 4HBGA 2Y67A 2CF5A 3O26A 3UKOA 3EAGA 5CDTA 1E1LA 2Q1TA 5EL0A 4FFOA 4I9NA 4N18A 3K31A 1HYHA 4YAIA 3DBHA 1I30A 1NXQA 2Y0EA 4XYGA 3NJ8A 1E77A 1NPDA 4MDHA 4YEDA 5HBRA 4YJFB 3WJAA 3ROPA 2PKQO 1BGVA 4B3IA 4YJGB 4Z3KA 2D2IA 3NTQA 4XYEA 1ZXLA 4ESOA 3D3WB 3OQ6A 3X2FA 4DC1A 4YCAA 3ETGA 4ALLA 4HY3A 4UREA 4PLGA 7MDHA 1GPJA 1JQBA 4A5OA 2BGKA 4G2NA 1ADFA 3RWBA 4E2ZA 1EZ4A 5GZ6A 2PZJA 2V6BA 3COSA 1ZMTA 1SZJG 3CPSA 1ONPA 5KKAA 1O9BA 4J0FA 4KDEA 4CMAA 3F4LA 3JV7A 3VVBA 3TZQA 1NP3A 4W4TA 4EDFA 3CTVA 5B1YA 4FFPA 4MP3A 2GUGA 1SAYA 2E49A 5IFLA 4D0SA 4BNNA 1P1JA 1J0XO 3SBOA 3GAFA 3GG9A 2IYPA 4J9UE 4FIZA 4FW8A 4IS2A 3AOEA 5DCUA 5CEFA 1FDWA 4UUNA 1Q1NA 2X86A 3DQPA 4BMSA 2E6UX 2LDXA 1X7HA 3PQEA 4DIOA 2W2LA 4E31A 3KEOA 1C0PA 1YQXA 4CUJA 3VOSA 3DZJA 2ZTMA 1LDBA 1R4MB 2E37A 4GLOA 3RBZA 3I9OA 3ZHZA 3WGHA 1GFSA 2C29D 4GMGA 2HAEA 3NEPX 3D1LA 1ARZA 1H0KA 2UUPA 1E3LA 2WM3A 1SO8A 1X0XA 3I9LA 3B1KA 3D4OA 5DP1A 3WJ7A 1Q7GA 2O3SA 3TN7A 4EUFA 3L6EA 4P8RA 5COAA 4DWVA 1T2EA 4IUYA 5H83A 3G1TA 3ZWOA 1UZLA 4DREA 1T24A 4Q39A 1PX0A 3KYBA 4UAGA 1ENPA 1I24A 5A5FA 4IDGA 3NGXA 1XQ6A 1V3UA 4DQXA 4QUKA 4WNIA 4FC6A 2JFFA 1TT5B 2WSBA 4KTTE 1JA9A 2O3QA 4URFA 3TJRA 4XRRA 1G6KA 1QLJA 1TA4A 2VWPA 3KLMX 1HDZA 4XDZA 3T4XA 1PEDA 3K2EA 1HRDA 1TEHA 5JAZA 1X1TA 2I3AA 2Q50A 3GFGA 4QECA 1QR6A 1Z7EA 2P9CA 3R6DA 2VWHA 5L45A 1HE3A 4HUJA 5ER9A 2RBEA 4DYVA 5A4DA 4WCFC 3QW2A 4I5EA 4BGUA 3WBFA 9LDBA 1F17A 1N9GA 4GI2A 1P31A 4F46A 1E3IA 1PQPA 2OXIA 2OBNA 5C37A 4CQMB 1PJ4A 2J3HA 2CNBA 4ALJA 2VCYA 1BXGA 5DOVA 4RQUA 3HB4X 1NQOA 3RCBA 4GH5A 1J4AA 1DFIA 1HSOA 1DHRA 3LU1A 3V1UA 3QIVA 3OJOA 3IMFA 4WCFB 1NM5A 4I5DA 3MEQA 4IDEA 2W90A 2EW8A 1H6DA 3JQ9A 4PLYA 4CM9A 3FRJA 2F00A 3QLJA 4WEQA 4J7UA 2J3KA 4UEKA 4IXWA 4M49A 4YWJA 2O3UA 4XIYA 1B8VA 1UXGA 1GQYA 2X9GA 3PLRA 4CV1A 1PTJA 3GZNB 5I7SA 3KUXA 4E5MA 3H2ZA 1QG6A 1IPEA 5TNXA 4JK3A 4R69A 1P1IA 2FPIA 3D4PA 3JYNA 4O5OA 4BIIA 4O63O 3VTZA 1VLLA 2P9GA 3GG2A 3INRA 4MVJP 5JDCA 4DLAA 1YB5A 3PTZA 3HJAA 4AG3A 3LSYA 4M87A 2Y1DA 3OJLA 3QVWA 8LDHA 5KKCA 1MX3A 4WLNA 1LX6A 2FR8A 3LYLA 4R1SA 4MVJD 2UUOA 1O6ZA 3LC7O 2YFQA 4AICA 3PYMA 4CJXA 1GZ6A 4PVCA 1BMDA 4W99A 1IYZA 1HLPA 3ZV4A 3NUGA 3VVCA 2DPGA 4K6CA 2VYNA 1KC1A 4PRKA 1BDBA 1HWYA 3KSZO 4WEOA 3I1JA 1E3WB 1A7AA 4U0JA 4H3VA 4K28A 4MOWA 2Y1EA 4R5HA 2BFPA 3WLFA 1HYGA 3PP8A 3H65A 3K5PA 4N7RA 1A72A 1Y8QA 1WVGA 4BGEA 3PJDA 5HS6A 2VYVA 2X9NA 1WXDA 5F3RA 1IB6A 3W1VA 4NI5A 3HHPA 3GVCA 1TXGA 2VNAA 4BNYA 1EBFA 1ZEJA 5JE8A 1NASA 3GPDG 3DMTC 1Y81A 4NJMB 4W7IA 4ZRMA 4YRAA 4RJTA 4E12A 3Q2KA 1I3LA 2GRAA 2WTBA 4PLHA 2X58A 3JQ7B 1UZMA 2PKQP 1HYEA 2AEFA 3CMMA 4WLUA 5KIAA 3LZ6A 5JDIA 4Y9DA 4XZ3A 4OQYA 3UFXA 3VHRA 1GR0A 4JJIA 3RI3A 4IZIA 4AFNA 4OHUA 3VZRA 4AJLA 5G0TA 2JJYA 2O4UX 2Q1UA 3TL2A 1DC3A 1SB8A 1XU9A 5I8ZA 3HQ4O 3Q1LA 4GQAA 4UULA 2DBVO 1QYWA 1KEUA 2AQHA 3CINA 2Y0DA 3H5AA 1I5RA 4CM3A 4J1SA 1LU9A 3NTOA 3UHAA 3GQVA 3KYCB 3AWDA 2DQ4A 3F5SA 3HDQA 5IXYA 4Y6RA 3A06A 3JYLA 1YQDA 3OHSX 3OH8A 4IJWA 4NFSA 5JMWA 4DQUA 2PH5A 5JC1A 3KYDA 3S2EA 4UUOA 3LT2A 1I2ZA 2H9IA 3U3XA 2GF2A 3I83A 2FR1A 5TJHA 4CM8A 4BGIA 4ZN6A 3GA0A 1LI4A 3OECA 5GZ3A 3GK3A 2NUAA 4P38A 4U7WA 3D0OA 3DHNA 3KB6A 4II2A 4N5MA 4TWRA 1H6BA 1EMDA 2O4CA 5EIOA 4YTEA 2IYOA 4FJ1A 4ZQEA 3CXRA 2X7HA 3V1YA 1U4SA 1MP0A 5K6AC 4CMEC 2VYND 1A9YA 4YJGA 3O4RA 3BTSA 4P22A 5JPIA 3B1JA 4E5NA 4YJFA 1F0YA 2O2YA 1H6AA 5DCYA 2A92A 3DBHB 4U6QA 4A0SA 1DAPA 3RKRA 4ALNA 5CPBA 2EF1A 4TRMA 1Z74A 3K6JA 4QTZA 2E82A 4DMLA 3ADOA 1GYRA 2VRCA 4A7PA 2Q1SA 3K30A 4C7KA 3DHEA 3OIFA 4J1QA 4JN6B 2D8AA 2D5AA 2O50A 4FC7A 1OI7A 4K26A 4M1QA 3CIFA 4E5PA 4Z3DA 4RPLA 1P1KA 4CM4B 3JQDA 3O9ZA 3PZRA 3QP9A 4OXNA 5TRTA 3IKVA 2EG9A 3UH1A 3L9WA 5A3VA 3QSGA 1EDZA 3QVOA 5KCZA 1FDUA 3DOCA 1PZEA 3DZIA 5AXDA 4OXYA 3BTVA 4TZKA 4LCEA 3WWYA 2NVWA 2P2SA 1EDOA 1E7RA 1ZKMA 1N8KA 4XIJA 1IZ9A 1PL7A 1UDAA 2C5EA 2DFDA 1LSJA 1ZIDA 1ZJZA 1DAOA 3FCOA 1PS0A 4Q3NA 1VM6A 3JQBC 1E3JA 4Z0HO 2YV2A 4CM5A 4E33A 3AUUA 1PJBA 4E5KA 5JW6A 1EFKA 1HDXA 5DDIP 2OFPA 1LTHR 1U5CA 3FPLA 2DVMA 3DTTA 3C7DB 1QYCA 1U4OA 5L51A 3WYCA 3LT0A 4ZA2A 1ZBQA 1Y9EA 3ZH2A 3DBLB 4WLOA 3SC6A 1FDSA 3I9NA 2B5VA 4I08A 2BFAA 4YRDA 3U0BA 2HDHA 1TT7A 2HMVA 3TZCA 4D3SA 4LSWA 3TZ6A 3AM5A 1MG0A 3NKLA 3NTRA 2FN7A 3AW9A 2G82A 3PYXA 5JAIA 2YW9A 3GFBA 4DVJA 1BDMA 4J4TA 1YDEA 4AJJA 4BKRA 3BTOA 4OO3A 3GAZA 4GX2A 1RJWA 2EWMA 5IDYA 2O3JA 5L95A 1KC3A 2EP5A 5G2OA 3ZWMA 4D79A 3FD8A 1DDOA 2C7GA 1U2GA 1ZJYA 3ZU2A 2CF6A 3E48A 1LDEA 1B8PA 4ITUA 3AM4A 3S2IA 3QA9A 2B36A 3OIDA 3LK7A 4A27A 2BRUA 5DOZA 2B4QA 5HA5A 3C1TA 2YQ5A 4NFHA 4CR7A 2PWZA 4A10A 1SOVA 2PH3A 5IZ4A 1A27A 3O8QA 2FHSA 5L7TA 3TZHA 2HKIA 1EK5A 2GZ1A 1LLQA 1GCUA 1K6JA 4B3JA 3DBVO 2DC1A 3WMWA 3DC2A 4L73A 4NMHA 4IIVA 4M54A 5KVCA 1E1KA 4BO4A 1E7QA 1YE3A 1U1IA 3JSAA 3EVTA 4DBVO 1I3MA 3U4IA 1CIVA 1PJLA 4G65A 5IF3A 1SC6A 4J4HA 2OOSA 4I1IA 4QFCA 4B7CA 5TLSA 1YS4A 2Q99A 1JWBB 4BUCA 3FN4A 2FRDA 1DPGA 2A94A 4WLFA 3GC6A 4CMBA 3IQDB 2WWRA 4PFJA 5EQDA 2HMWA 1R0KA 1E7SA 3E82A 1V3TA 1ZK4A 4ALKA 4BMNA 3DZHA 1PJ2A 3PHJA 4J43A 5BSGA 1PWXA 1SB9A 3JQGA 3STHA 5HTOA 3INGA 4ND3A 4NU5A 3WGQA 4XQGA 3FNFA 3CZRA 5A02A 4YT4A 2P91A 4D46A 4R4JA 1T25A 4ND5A 4XYMA 3U9LA 5G0SA 4ZHSA 3V1TC 4O1MA 4BV8A 4PG6A 4BNKA 1KVRA 1QLHA 1V6AA 3PZBA 1YBMA 4M55A 4MVJE 1EFLA 3UICA 1KOLA 3OJ0A 1HTBA 4DIFA 3QY9A 5DULA 4YQYA 4II3A 4DTIA 2X5KO 3PHIA 1Z73A 1HKUA 4CMIA 3AU9A 1ZEMA 3AUTA 3L4BC 3UCXA 3W6UA 4WK6A 1GAEO 3ON5A 1JVBA 5ILOA 1PGNA 4CQLB 3MOGA 3SLGA 3TOZA 4JBGA 1GYQA 1P33A 1O94A 1RYDA 2AQ8A 4IDFA 3V8BA 4ZGWA 4MKRA 5L7YA 2BFMA 1R66A 4FGWA 4Y98A 4TRJA 1EVYA 1LA2A 1YWGO 2I9PA 1GADO 1LEHA 3L4BA 4QEDA 4XDYA 5F5NA 3M6IA 5F1KA 4YJHA 1LSSA 4CQMD 2QX7A 3KVOA 4DMMA 4AJ4A 3KTDA 4NK5A 2H1SA 2PTGA 2YQ4A 3WQQA 1AGNA 1UJMA 1BVRA 5CDGA 4WLVA 2ZYAA 2CD9A 3NJ4A 4XEHA 1LXCA 5T67A 1M6HA 3V5NA 2QHXA 2GD1O 5TSDA 3FTNA 3JYQA 1WP4A 3RUDA 3X2EA 2J5KA 3ZW9A 5JXWA 4O0LA 4YDRA 1DHTA 4RPHA 2DBQA 4NZ9A 1CF2O 4BO6A 1UXHA 1XR3A 2POQX 3EHEA 4E2YA 5LDGA 4OL9A 2GGSA 1E6UA 2FSSA 4GSKA 3BHMA 2JD0A 3PHGA 3PJFA 1EVJA 2NLOA 3OM9A 1VSUA 1N2SA 1MXHA 2J8ZA 3JCZA 1BVUA 1WW8A 3RJ9A 3M2TA 4BKPA 1IPFA 2GO1A 4A2CA 1VJTA 3V2UA 4CMJA 3BA1A 5MGBA 3UCFA 2HRBA 1B14A 1T2AA 4RLHA 2AQKA 4P4GA 5FFFA 3IL2A 2B35A 4Z0TA 3WFIA 5BSFA 2E48A 4XB2A 2ZB3A 2RCYA 3RUCA 2FOIA 3VPFA 5CHEA 4MVJI 2Q46A 3ORFA 3LC2O 1MB4A 5FYDA 4PLWA 2B37A 3S2GA 5ITWA 3DR3A 3NDRA 4OH1A 4JBHA 5LCXA 3H9EO 4FBGA 3ZWPA 4MVJA 1I8TA 5JLAA 2DBZA 1KERA 2C20A 4IBOA 3JYOA 2VT3A 2IRWA 4WPGA 3BIOA 1DRUA 5JMPA 1GV1A 5L53A 4W82A 2DAPA 4RVDA 2BGMA 3H9UA 4XRGA 2WYVA 2HK8A 1A7KA 3EVNA 1C1XA 2GASA 3MWEB 2PK3A 4Z9XA 5KVVA 3D7LA 3H4VA 4E2XA 3OJFA 1ONNA 1K3TA 4EUHA 1XGKA 4RPKA 1C0KA 1DLJA 1FJHA 1T2FA 5IZCA 4ND1A 3PQFA 3E9MA 1A5ZA 3AK4A 5CDUA 1PR3A 3JQFA 1WMBA 4EEZA 1GEGA 3O03A 3O8QB 1F12A 4EBFA 1FXSA 3ADPA 2C59A 2GZ2A 1JTVA 3JQ9C 3N74A 3WGOA 3FWNA 5B4VA 5AXCA 2NACA 3W8DA 1UH5A 2ILTA 5ADHA 3M1AA 4G81A 2YZ7A 4I8XA 1DFHA 2G1UA 4I5FA 3K96A 3KLPX 5CPFA 3QVSA 4GWKA 2IODA 1KVTA 4IY1A 4BL5A 5C7IO 3ENKA 4QT0A 3I4CA 1P1RA 4XWYA 1V3VA 1QXSA 3ZWAA 4DGSA 4PZDA 3ABIA 4ALMA 5ICMA 1YBVA 2GR9A 3VDQA 2VUSA 2HMSA 1GD1O 5ENDA 2P5UA 3FR8A 3Q0EA 3I4FA 4XR9A 3K92A 3IJPA 2I99A 3CSDA 2XAAA 3RC7A 3OIGA 1KVUA 3KBOA 3EY4A 1OC2A 5JSFA 2VOJA 3QWHA 3A4VA 4WGGA 1GUZA 4NBWA 1A9ZA 3K73O 4BS9A 1WLYA 4PVDA 4DQVA 5TS3A 3L4SO 1T2DA 2CDAA 2AMFA 4GLLA 2DTXA 1GTMA 3JQ6A 4DLLA 4BNLA 2G17A 1OC4A 1WWKA 5CDSA 3M2PA 1QYVA 1PGQA 2Y68A 5AXAA 5DBGA 4UEOA 3OICA 1IZ0A 2V7PA 3DAPA 1WAMA 1ZFNA 1IOLA 4HKTA 4PG7A 2B0JA 1V8BA 3H5RA 3JQAB 3AY7A 1Z7BA 2VOEA 2Y05A 3BMNB 5L4NA 3F1LA 2AQIA 2R6JA 3BAZA 4RF3A 2C54A 4OJNA 4HWKA 4IQ8A 2GDZA 3CEAA 3GHYA 3HDHA 2VZ8A 3PGXA 3A14A 5U9CA 1BXKA 3OEYA 2WYUA 3BMOA 1OMOA 4XQCA 3GUCA 4R1UA 4KUHA 1LSUA 3Q2IA 3PGJA 1FDVA 1U28A 2VT2A 4DUPA 3TF5A 2WMDA 3HZZA 1QYDA 4CM7A 4IXTA 2ZJ1A 4LMRA 2GN4A 4LGVA 5A3JA 1IHXA 3A9WA 4JX8A 1I01A 5BQFA 4EW6A 5JYDA 3QWFA 1S7CA 5L3ZA 2YFHA 2QYTA 1X7GA 1HL3A 2Z5LA 3ZHBA 2EGHA 4JP2A 4AL4A 3LT1A 3KHUA 4B8WA 4GWGA 1CJCA 4D0RA 3FNEA 2PD4A 3WSVA 3GGOA 4O59O 1MC5A 4YQZA 3WBBA 3WX0A 4BNFA 4PRLA 3K8ZA 3RU9A 3OA0A 4R5MA 4BO3A 4FPXA 2GERA 3HN7A 4GPD1 5BR7A 4BOYA 4EITA 4H15A 3F5QA 3PXXA 1ZXBA 3DMTA 3UN1A 1NAHA 1SOWA 3AFMA 1LC3A 3ZWBA 5JY6A 1NQTA 2FZWA 5KJEA 3GZNA 5AXBA 1NVMB 2OORA 3H9GA 3ZNOA 5KOIA 4FQ8A 2UAGA 4XGKA 3JD0A 4ROSA 3ANLA 2CY0A 2JHFA 3GDFA 3KYDB 1HE2A 1XQ1A 4E3ZA 3N7UA 2FWMX 3VH1A 1JWAB 2O48X 4TSKA 5IJZA 2C82A 4FFRA 2HRZA 5FWNA 3ZU5A 1DRVA 1B7GO 3F47A 1PL6A 4OOEA 2QRLA 1NR7A 2DFVA 4JQCA 2PNFA 4IPTA 2OP0A 5L4SA 3UF0A 1BTOA 3O38A 3I9JA 5EN4A 2PZKA 3WGGA 2X9VA 2OO5A 3GOHA 6ADHA 1ENOA 1GY8A 3JQEA 4OXKA 1P1FA 2I67A 3H3FA 3P2YA 4BQPA 3MJCA 3OBBA 1GUYA 3AOGA 1PWZA 1G0NA 2EHDA 3GZ4A 3VPXA 3K2BA 3DXFA 3E6AA 5T6BA 3RUAA 4XYBA 2XXJA 2WD7B 4AJEA 5JC8A 3RSHA 3S8MA 3JQ8B 2D3TA 1A71A 1CQJA 4J91A 4OOFA 4N5LA 4IDAA 3HFSA 3B6ZA 3ANMA 3E1KA 4KWIA 5DBIA 3D3EA 1PQUA 3A1NA 1IY8A 1ADCA 3G49A 1I0ZA 4B4WA 3QVXA 5JY1A 4HNGA 3E5RA 4J7XA 1PGOA 1XA0A 1V9LA 2UV8A 2B69A 3FHLA 1Y8QB 3G79A 3WQSB 2JCYA 1C0IA 2PD3A 3DAGA 3DZBA 4F3YA 1Y8RA 1SEPA 4L74A 1ZMOA 1YL7A 4GX1A 1GYPA 2OL4A 5EJ2A 5IN5A 4R9RA 5T8KC 1E3WA 4CL3A 5T64A 4CPDA 1YJ8A 3N58A 1O0SA 4U0KA 3GN2A 3OJEA 1F14A 3P5SA 3RUIA 4TMFA 3DEYX 2Y1CA 1O8CA 4WOJA 4BO9A 4Y8VA 1YJQA 3DL2A 3RKUA 1R4MA 2JAHA 4ZRNA 1RYEA 4RCVA 4DLBA 1LDNA 1UDBA 3QV1A 4PLFA 1D7OA 1Y9AA 4EJ6A 4CLDA 1Q0LA 2WE7A 3NT2A 4E32A 1RPNA 1PS8A 3I9KA 1HE5A 3IP1A 1T4DA 4IQ0A 4CLOB 4L4XA 5A04A 4RF2A 3EGOA 1YQGA 3WG9A 4HV4A 3PHHA 2I6TA 2PZLA 3WGYA 1UP6A 3ENNA 3RC2A 1UUFA 2HUNA 1C3VA 4NHEA 4XB1A 2FZEA 4Y6PA 4XD2A 5J23A 1DO8A 4S1VA 2W8ZA 1E5LA 1WDLA 1YDWA 3ASVA 2I66A 2IDZA 4BNTA 3F6YA 2D1YA 4DXHA 3U5TA 4OAQA 1OOEA 1HDCA 1OFGA 2XOXA 4O6VA 3KRTA 3NDJA 2AXQA 2QW8A 4ZQGA 1EK6A 2IZ0A 5G0WA 1PSDA 3DZGA 3PPIA 2YV3A 4PCVA 1BHSA 4BNZA 2NWQA 2J6IA 3GEDA 2VTEA 1LDMA 5IZCC 4E4YA 4ZQHA 3BMQA 1GQQA 1KEWA 3OQBA 1BW9B 3E9NA 4BO5A 1SNYA 4L76A 2YHUA 3WIDA 3DBRB 1MGOA 4H16A 3L6DA 2VYVD 4FFNA 4IS3A 3DMYA 3BHJA 4XQEA 3NGLA 3U4CA 3QRWA 1DIGA 3C1AA 2NU8A 4BO8A 4XA8A 4WCDA 4EJ0A 4J90A 1BSVA 1F06A 3JQCA 1QP8A 3AI3A 2IXAA 1Y7TA 4PZEA 5ER6A 4MVJM 5TC4A 3RFTA 5C3MA 3GNTA 5MDHA 4B7UA 1VE9A 4JBIA 5FI3A 4OKNA 1W6UA 3WGZA 4AJ2A 4FGSA 2QZZA 2RH4A 4N5NA 3ONEA 3WWZA 4D3DA 1TT5A 5FF9A 4OMUA 1K2WA 3PFWO 1PZGA 4FS3A 5I9MA 4RVSA 4YBZA 1ZCJA 3AM3A 1ZSYA 2ZTLA 1I10A 2V65A 1O89A 3KO8A 5JO9A 4B3HA 1IULA 2DU8A 2CVOA 3WICA 3ZI0A 4NQZA 3INTA 4LVCA 1OBFO 3C1OA 2SCUA 2NTNA 2VZ0A 2BH9A 4CM4A 1P74A 2VHYA 1PIWA 4S3MA 4L9RA 3UW3A 1X13A 3ZWVA 2V6FA 5AYVA 4KQWA 3FTPA 5GY7A 4U8GA 1LUAA 2EJWA 4MIOA 4Q3BA 5KJ6A 4TRNA 4TVOA 3QJ5A 3ZU3A 4J7CA 4KWHA 4D44A 5ES3A 4AJHA 3IP3A 1ISHA 5CG2A 5I7EA 2IZZA 4RGBA 2VWGA 1PZFA 1XCBA 1ZK0A 2H63A 5JCJA 1T2CA 3RC9A 1E7YA 2DLDA 2EP7A 4Q9NA 1N5DA 4BNHA 2NTVA 3G3EA 4XR4A 3P7MA 5I7VA 3IIEA 3BMQB 1G0OA 2GLXA 4MKXA 4AJIA 2QRKA 4HADA 3CZMA 1YRLA 4QX6A 1MFPA 1DIRA 4IIUA 2CFCA 3WNQA 3H6KA 1F8FA 1HZJA 3GR6A 5JNLA 4KP7A 2VHVA 4A26A 2UDPA 4FOOA 2OZPA 5AOVA 3ICCA 1XHLA 2J5QA 5BT9A 5A9RA 3MJ4A 3ZWWA 3AI2A 2UVDA 3R3SA 3TDKA 3PIIA 1DRWA 1U3UA 3BXXA 2YDXA 4JJFA 4JP3A 1AN9A 1PS9A 2ZTUA 3F4BA 3KYCA 3SC4A 4RDHA 4UUPA 4F6CA 3C24A 1U3VA 4JJGA 4BNJA 3PIDA 3DO5A 1B3RA 2ZIZA 1FMCA 3EDMA 1QYXA 1I36A 2GN9A 3KXDA 2EKLA 1O95A 5TGDA 3WGIA 5F5LA 3QWAA 4FN4A 1XYGA 1GU7A 3PLNA 4HNHA 1AHIA 2HK7A 3HN2A 4L8VA 1ZVMA 2ZTVA 1TI7A 3I9MA 3L77A 3EYWA 4CODB 3G17A 3IUSA 4B8ZA 4BNWA 4TQGA 1E5QA 1JKJA 1Z82A 3ZV5A 1DJQA 1FDTA 1HF3A 2B83A 3VH4A 2O7QA 1C1XB 4KUEA 1O5IA 2TMGA 2ZCVA 1HT0A 1CQIA 4NU6A 3EZYA 1WDKA 1H2HA 1W4ZA 3GRKA 3PYLA 5ILGA 2PD6A 4RPGA 4RVHA 5LC1A 3PHLA 4R3NA 3WTCA 4XGNA 1KY5A 2GN8A 1VRWA 2A9FA 2D4AA 3WS7A 4BGVA 1R15A 4D42A 3RUHA 4YT2A 4XKJA 3RASA 1ZO8A 1PU2A 4EJMA 2BELA 4NFYA 2QYSA 3H5NA 4WOKA 4YT5A 1Z45A 1R12A 3PQDA 3U09A 3CUKA 4RORA 4CLEA 1Z75A 1RM0A 4EZBA 1JAYA 1UXIA 3SXPA 1NBOA 3DOOA 2NSDA 3OSUA 3PK0A 1R0SA 2X5JO 1QMGA 5EQFA 1DC6A 1NFQA 1PR9A 3V2HA 4BO0A 4LW8A 1VPDA 3FPCA 1MUUA 4ZD6A 3RAJA 5JAMA 1GZ4A 3MOIA 3KZVA 4E2WA 3ROQA 4J16A 1TVEA 4YJDA 3U4DA 4CM9D 3FNHA 4INAA 3UVEA 3RJ5A 4IJVA 1UDCA 2ZJ0A 4NBVA 5B12A 3SLKA 4HXYA 4GBJA 3ZWYA 2EXXA 4HP8A 4CLXA 1HSZA 1YBAA 4XX0A 3JTMA 3RIHA 4PZCA 3WDSA 1LBEA 5FI5A 2P4QA 4OYRA 2FP4A 2VNSA 5T8KA 1WZIA 1J6UA 1JKFA 2QG4A 2C7VA 2HK9A 3HB5X 4WLEA 1X15A 2FY8A 1QRRA 3DAFA 2EV9A 2BFOA 3W8EA 4F45A 5G4KA 1MC4A 3NT5A 4IMRA 2CDCA 2Q2QA 3IS3A 1KS9A 2I5PO 3GVHA 1N7GA 2X4GA 5ITVA 3JD4A 3SVTA 3TFQA 1ZK3A 1XDWA 1HXHA 1VI2A 3OEWA 4TKLA 1D4FA 4B4UA 4BMVA 4M86A 1CEQA 1LLDA 2Q2WA 4R1TA 2RIRA 3VAZA 1B3BA 1DLIA 1E3EA 2YV1A 1N9GB 4I5GA 2B5WA 4RVGA 5COQA 2CZCA 1T4BA 2RAFA 4YYZA 5CEJA 5DT9A 2JFHA 3B70A 4B7XA 2G5CA 5JCXA 1NYTA 2ZB8A 5K6AA 1Q2XA 8ADHA 3PVZA 4J0EA 1CWUA 3E03A 1N1EA 4YAKA 2PZMA 2VQ3A 1GDHA 3IDSA 2IEBA 2VRBA 3L6OO 4RZHA 4CMIB 1OAAA 3OMLA 2ZATA 4CMCA 4R41A 2AEJA 3K9QO 1GCOA 3WQRA 4D45A 3ZDFA 3GVPA 4R9SA 5B37A 2WEKA 3ZU4A 3Q11A 2HU2A 3RROA 4LCJA 1W8DA 1X1EA 3MJEA 3PWZA 4Q3CA 5I9LA 2GYYA 3AFNA 1C1DA 5EERA 5CG1A 4ILKA 3WOHA 3ROKA 3NRCA 3MTJA 4F6LA 1XELA 2A35A 2O23A 3S55A 4LISA 5IDXA 4WECA 2ZQYA 1TLTA 4JLWA 1ZSVA 3BMNA 2Y1GA 5DCWA 2D59A 3JQAA 3DB2A 1HEUA 1IL0A 1K0UA 4RO0A 5KJ1A 1YL5A 4BNMA 4ZJUA 3PI7A 2HO5A 2O7SA 4IMPA 3JD3A 4ZU3A 3DFZA 3ZWXA 3BTUA 2H6EA 4PG8A 2QZ9A 4YVFA 2EIHA 3TWOA 1ZW1A 3AJRA 1DXYA 3ZNQA 1UR5A 5BSHA 4L4SA 3HFGA 4XCVA 1X14A 3QWIA 3KEQA 4H7PA 3E9QA 3DWFA 5A9TA 2H5LA 3S1LA 3T7EA 4EI2A 3SEFA 3I23A 4TROA 1U5AA 1HE4A 1IUKA 4YPOA 5FEUA 3OETA 2YY7A 3I3OA 3ITKA 3AUAA 4PG5A 1P9LA 3I5MA 5TX7A 4JXKA 3H2SA 4E5YA 5H82A 3Q9NA 1BG6A 4NIMA 1KYQA 5IDQA 1ISMA 4L4RA 3TQHA 1PGJA 4IDCA 1NWHA 2WJPA 4D41A 1VL6A 1N7HA 2JCXA 4D43A 2QIOA 2NVUA 2X6TA 1PZHA 1GEEA 5H81A 5CEEA 4DIBA 4W9NA 2UYYA 3GMDA 4CMKA 4DPKA 2P5YA 5C5IA 3ZWCA 3JQBA 1E6WA 1XEAA 1LQTA 1QSGA 1B15A 3FR7A 3F46A 5G4LA 2C5AA 2PLAA 1R6DA 4GX0A 4KDFA 4BNIA 5KTKA 4Q3DA 4R54A 4BQRA 4IZHA 4NH4A 4K6FA 3BHIA 3C8MA 3HSKA 1EQ2A 2NU9A 5DBFA 3GMSA 2BGLA 4WE3A 1KY4A 3GUYA 1M66A 4LN1A 2PY6A 4OM8A 2VUTA 4NDNE 2QQ5A 5HRUA 3G1UA 3PDJA 3T7CA 1MV8A 3DDNA 3NV9A
chains in the Genus database with same CATH superfamily
4ZEVA 3MBIA 3JQAD 1QF9A 1U3CA 2F43A 2W7TA 2DH5A 2FSFA 4FFMA 4EB6B 5K0CA 1YJ5A 3FOBA 4CV2A 3JS5A 5FO1A 1WJGA 5I9BA 1N2XA 5DM4A 1D1TA 4CDNA 3OQNA 1ZIOA 1CUXA 4UVDA 4YA6A 3FZNA 3NM5A 1DE0A 4DCVA 1NDQA 2DHDA 4J3FA 3GF4A 1A3CA 2EC5A 1HETA 2XD9A 1TIPA 1PUJA 4FWIB 2JFUA 4PICA 4ZO6A 5F3WB 1K2VN 3O8CA 2FLVA 3LDFA 4RV4A 1P5HA 1XJ5A 3NTVA 3K5IA 3WHLA 1QHGA 1H3NA 3Q85A 4E08A 5C1BA 5E0OA 1G55A 3PRHA 3W2GA 4NZYA 3HCPA 3UV3A 1PLLA 3UMCA 1ZP6A 2OMEA 2DPHA 2XD4A 3ABSB 3MUFA 3NX4A 1ZVKA 2W6ZA 3NQ41 1IM2A 1J23A 1VIMA 3HE3A 2DUUA 4GR4A 4OBEA 4Y2JA 5A03A 1BEEA 2XMBA 3R23A 3WADA 4H7IA 1XL1A 4YNBA 1M6NA 1RCUA 3G9QA 1XLUA 2X0IA 5K3FA 1N7IA 3P8ZA 4WW0A 1O87A 2D0DA 4PAGA 2HPAA 3O1JC 1ODTC 2R79A 1C0LA 3A7EA 1IXSB 3WNZA 1M6VB 3BE8A 4F72A 3F4KA 5GMOA 1XB2A 4YLYA 2QLMA 4GYKA 2V3VA 1L4KA 3FOCA 5KCMA 3TRJA 2GBFA 1JHMA 4KWTA 3WGNA 4BVEA 1PYOA 1UC9A 3TKAA 4FMPA 5D3MA 1U5BB 3K6SA 2PKEA 3D7NA 3FSGD 5INTA 2CT8A 4E6EA 2Z8XA 3G5TA 2C98A 3OZAA 4UBMA 4R2IA 3W79A 3ANXA 1D1QA 2VNJA 4B79A 2CDBA 4IR7A 3TFOA 3KETA 4O02B 2P9EA 1UC4B 4NE9A 4JKYA 3LP5A 5LJLA 1U7PA 3GJXC 3KJEA 1P81A 1JJAA 4MKIA 5FI0B 1YVEI 4LUCA 5J2UF 4HGOA 1TM7E 4FDAA 4KI0A 3I6MA 4TTRA 1J49A 3GGGA 1MA0A 3PT9A 3PITA 3GARA 1X80A 2BY4A 3AL2A 2XTJA 5BWCA 1JKMA 4HATA 4KYTA 4PCLA 1R4NA 1M2VA 1YOVA 2WHXA 4QFDA 5BN5B 4LE2A 4JSRA 2VRNA 1UAGA 1P1HA 1FC0A 3CZCA 4MIEA 5LWHA 1LCIA 4XIFA 4YCBA 3LDUA 4U5QA 2WF8A 4EW3A 4JLJA 2L19A 1CETA 3K1JA 1ZK2A 3L07A 2XLBA 4XE5A 4ZEWA 5JAUA 3H2IA 2CXPA 1A69A 5KKNB 2Q27A 4JAVC 4C3VA 2XDQA 5HF6A 3RC3A 1NF2A 2B6HA 4Z0PA 4H7DA 3HB5X 3SXUA 1P0FA 5I8WA 4CQLA 3H3JA 5KWSA 1VHTA 3WFJA 3HMKA 1KI3A 1A4IA 3WLAA 4DBZA 5K4GA 1FNNA 4PQRA 2NX2A 1V25A 2W98A 3G6WA 1SQ5A 3GDGA 1ULUA 2BEWB 4FNGA 1M54A 5ALGA 4YUZA 4CKWB 3WZ2A 4UNNA 2DQYA 2QV0A 3AILA 3GEMA 3KJFA 3LQKA 2GXUA 5DI9A 3DXYA 3TZKA 3R1IA 4AO6A 2P4UA 2Y1LA 1X6VA 1V6CA 2IEAA 3HUEA 4QU5A 1U80A 5F4BA 1EQUA 1I3NA 3A3PA 4V3CA 5EPOA 4AO8A 2EYQA 1J0AA 5CB4F 5LOVF 4A27A 4W7HA 3ZKWA 4XYLA 1X7XA 2HCTA 2WDZA 5EIBC 1EIWA 3PIRA 1OV6A 2AT1A 3E2MA 4OGFA 1C3EA 4QGAA 2E4UA 3WSWA 4UQLA 3WY9A 3R77A 3EEOA 2MJLA 1N6IA 4WZBA 1CEXA 2WILA 3NIDB 5IJ0B 3M83A 1P73A 5BR1A 5D84A 4CM1A 2XB4A 2Y0CA 4OQQA 4PX9A 1B74A 4YAJA 1MQ9A 1J0BA 3BL6A 5KAPA 4LRSB 1DO0A 2GHTA 2WMNB 1TVMA 1XZLA 2VSQA 5AOCA 2V98A 3QELA 1CFZA 3L1VA 2NU6B 1G8PA 2VUHB 2VXOA 1MVLA 2P78A 1ZUIA 2F6RA 4O4LA 5CAEA 4C06A 1EE2A 4XSVA 4O3FA 4HQ6A 1DBVO 3FM9A 1MAAA 5HIMA 1Q83A 5I5GA 3V7YA 1OLXA 1K3FA 1KY3A 4U2FA 3CRMA 3PDUA 1UM8A 1XC7A 1U8UA 3ANNA 3EASA 3IT1A 2PAFA 4KX3A 1XTTA 5TVGA 3ROZA 4A0FA 2HJSA 4BFTA 4YDQA 1S9DA 1KY2A 1EFUA 2IA5A 4PZLA 1UMDB 2ZJ4A 1D2EA 3CRRA 4JLVA 4UXHA 5B1HA 3TNJA 3K9FC 2JD2A 2C7PA 2MSLA 4IJUA 3IQIX 1PI3A 4DLXA 5BSUA 5HWSA 3DMNA 2CZQA 4EAQA 4EPRA 3BWCA 3LT4A 3UGQA 4GKKB 2XYGA 2WI8A 1JEYA 3T0IA 1BRTA 3D6MA 5DXFA 1CR6A 4FTWA 4EO4A 1GPDG 2Y93A 4UKDA 1HQKA 3C4VA 1OLUB 3C5VA 3FDZA 1M75A 1C3OA 1OD6A 1DBIA 1QO0A 1ZUHA 2H65A 1C14A 2FW8A 3QHPA 4QDUA 4QXMA 4X6XA 4Q4JA 5K03A 2VP5A 3C7AA 1KI8A 4Q1CA 3WYBA 1BMQA 5IW8A 5KDLA 1W5AA 4CM6A 1JIJA 2QP3A 2H1FA 2RH8A 2GMWA 4ZVVA 3PEFA 5K0JA 2B2NA 2RK6A 3ABZA 1XZBA 4MJ7A 4FILA 4N0DA 2EARA 3ZV3A 5BW8A 4QQRA 1KQGA 2A4KA 2VAXA 4PXYA 2Z3WA 4IDBA 4UM7A 2FPRA 2MMGA 1PV2A 2ZYHA 1T8WA 3F1KA 4X5OA 3UK7A 3ZBQA 2FMIA 3MCVA 3IBSA 4FYVA 3TPCA 1XRSB 4WSOA 1KBZA 4GR5A 3O95A 2DQZA 1AKNA 3W4IA 1XEXB 1L4NA 5JBQA 4RHEA 1SUCA 4UU7A 4AKSA 4NBRA 1CRPA 2QW1A 3DBLA 1RAAA 4IFTA 5JLJA 4IJMA 4PYLA 5IRCD 4UNPA 3OWHA 5CYFA 4DIMA 1FL9A 1UBRS 2V96A 3MOSA 1RPAA 2ZSHA 2QXTA 3IGFA 1ZCBA 3RRFA 1T1SA 4K9PA 1EVIA 4RMJA 3RC1A 2YMLA 2QL6A 2BFEB 3LLSA 3QXGA 4NR0A 1EK0A 1W88B 3A28A 5ARCA 2A7QA 1VC2A 2AK2A 2AK3A 2NAFA 3G8CA 3L0OA 4TKUA 5SYNA 3ZHVA 2SKDA 2XBMA 2NVBA 3TTYA 4R9UC 2O20A 1XJ0A 3GHHA 1C1HA 2OCYC 4KQFA 4LK3A 3EAFA 2LXNA 4GAEA 5TS2A 2VI5A 5KNLA 2B8NA 2ECPA 2JLUA 1LBTA 4BMDA 1GRCA 2CYCA 3T3GA 4D6PA 3HI6A 2EJTA 2HMYB 1JKIA 1KP9A 3ESCA 4WDQA 5JZBA 1JQAA 2HCJB 3LLVA 1LLUA 5FEMA 5KC8A 4HH4A 4LZNA 4NG4A 4ZO7A 4Q9AA 5TT0A 3DZCA 3M34A 2I8LA 4ONEA 3UEOA 1DOHA 1NMZA 2ATIA 3R4CA 5AH0A 3M9WA 1UFQA 2J5XA 4IG9A 3PI6A 4JI4B 1MC1A 2HSZA 3RDPA 1XK7A 4HYEA 2GD0A 5DLPA 3C48A 3X3HA 1YO6A 4A73A 3WL5A 1XTJA 4EGJA 3FPBA 4GZ6A 3V3KA 5K3OA 2HJGA 1R5BA 3TSOA 2FH5B 1ISPA 3EJWA 4IMJB 4L6AA 1CRLA 1Q0UA 3GN1A 5HQ3B 5I6DA 3C3PA 1JYFA 3DAHA 2ZR0A 5ERGB 3VR6D 3QGMA 1ZC3A 1H2AS 3WLSA 2HT1A 4ALIA 5BRAA 4RZUA 5BQOA 2CVZA 1BCRA 2LW7A 3DB1A 3KAKA 4MQUA 2J08A 2NU9B 2PR2A 2XR1A 2C4TA 4MEBA 1XRQA 3A2LA 4BKUA 2F3RA 3DLCA 1P44A 2Q21A 5AJTA 3WTBA 3W5IA 4HFRA 5JYEA 3IPAA 3ZZNA 2EKQA 1D4ZA 2Q4BA 1ECPA 1U6KA 1V7PC 2M32A 2W2KB 3VA7A 5HOQA 1OQAA 4Y67A 4KVZA 5ALUA 1ULTA 4PX3A 3D5TA 5HIJA 3U4HA 2BMFA 3Q72A 3EMBA 4FJ0A 4RF5A 3RB8A 1GFWA 4RXUA 2DTDA 1P8JA 5DKFA 1WZ2A 2QMHA 4FSHA 4YRCA 3O3CA 3WGLA 4QXRA 4R31A 2K4MA 1CUEA 4UVHA 5EE5B 1BKYA 4C4AA 4UTRA 2PT5A 1JIKA 2W4QA 2J6HA 4L85A 4KE9A 4HLCA 5BNIA 4ZAVA 2FG5A 4QOSA 5AUOB 3QBEA 2WSMA 3GOQA 3PQ5A 1IWPB 1ONBA 2F2TA 4FOSA 4JC8A 4E6PA 4FYYA 2PGNA 3LF2A 5KHLB 3VZQA 2WYWA 3JARB 5FBVB 1A2BA 3HJGA 4MQ6A 2IU6A 4FQ7A 1UOOA 2QL7A 4CVNA 2PFSA 1QHXA 4HQKA 4Z1MD 5AQ1A 3TTTA 1PGPA 1Z56C 3PUZA 1DV2A 4BX0A 1N4AA 2PUCA 5ECWA 3ZE2B 3OQJA 3BRQA 2JLWA 3RG8A 3INYA 4RNDB 1HR0B 3MWGA 3I5AA 3QPWA 1LRLA 2OC4A 4G4IA 3DUFA 3U1TA 3RK1A 4ARUA 2MOKA 1C80A 2Z0MA 3I6QA 3NAQA 2BEKA 1RLIA 2W0SA 2YY6A 3FDFA 3FF4A 2MDTA 1I2DA 2FZLA 4MGZR 1FUYB 1W36C 2A5YB 1AHHA 4MW6A 1FVFA 1HDOA 3DZKA 3UFXB 2KHZA 2X42A 3AUJB 2NTYC 3K8QA 4L78A 5IUKC 4KE7A 1ULSA 4MWGA 2QA5A 2O1EA 4B4VA 4Z4GA 3IUYA 4U7GA 2ET6A 3F5DA 2WVAA 4QXAA 1U0SY 2HH9A 4WASA 3S8EA 4YDHB 2G5PA 1E2PA 1G3MA 1A7UA 1QDLB 3ITDA 3LS2A 4B17A 4IDDA 4JU8A 3TW6A 4RHYA 3ZK9A 1G7SA 1ACJA 1FP6A 4P5PA 5KB3A 1NFFA 2GRJA 3DOJA 3L0IB 3SMQA 4DYDA 2GN1A 3KSBC 2FUEA 4A6EA 2C31A 2Q6OA 3OF2A 1CSEE 3R7SA 2W2LD 3SXJA 4CN8A 4EY5A 3CUEF 4LY0A 1EUCB 4HGNA 4AMUA 2GD2A 2Y0BA 4Z3OA 1V5FA 3ZNNA 1VXOA 2BEUB 3LQ4A 5JVDB 3CVXA 5EJ9A 2VTDA 5LBIA 4DJDC 1H9BA 4RVUA 3DZFA 3V00A 2P68A 3T54A 4M89A 4EG6A 5KVSA 5EYPB 3RBXA 4FIDA 3W4KA 4RW0A 4UFPA 5JS6A 4LF4B 2CKMA 2CXSA 3IV6A 3PS9A 4QVIA 4KAAA 3PR3A 3TTVA 3DYVA 1R6VA 2GCEA 5A9SB 4CEJA 1WPQA 4Q0MA 3KSUA 3GXOA 1XRPA 1SXIA 1YIDA 1M83A 3M4ZA 1JHYA 1ICEA 4UARA 2GUWA 1TQHA 2C3UA 4G01B 4YAEA 2G6TA 5H3LA 4HAVA 3W8FA 1G6Q1 1Q7TA 2YBEA 2Y6UA 3D8HA 4KU4A 1XCPA 1UWVA 5JFOA 5AW0A 1X1AA 4PN7A 4U8HA 1CR4A 2VBGA 1Q11A 1QWSA 2CMHA 4BN0A 4HVAA 2CV2A 1V4BA 1U7HA 3TD6A 4GVXA 1SD1A 1WS6A 2GWRA 3H1FA 4MRPA 1BW9A 2CXOA 2PRZA 1NQUA 1YACA 3CXUA 3H2JA 2X0NA 3DCJA 2M6RA 1CUCA 1JEOA 4BX2A 3X1DA 3C3JA 3TUIC 4BHTA 2XGSA 5LQSA 1D8TA 3N8HA 2Z1NA 3MLBA 2AHRA 3Q1KA 2OSVA 1EP2B 1QYIA 3CH6A 3OCWA 2BV3A 1WE2A 2I55A 4QQNA 5EZQA 5BNFA 4CM8B 1GQRA 2V7QA 2VBFA 2YRXA 4CIVA 1KMHA 4IV5A 1WBDA 1DMSA 1G5QA 2R8XA 1S2OA 3K9NA 5EJEA 4EJSB 4X1KA 3I72A 2CHGA 4CFSA 2YDYA 4M37A 2V1XA 1NSFA 2IHVA 4N0MA 4AP6A 1T8RA 3RGWS 1E1RD 4RTLA 4KK4A 1THZA 4B3SB 2YZNA 4ZU1X 1IE3A 5DYNA 2YUIA 4JNKA 3T7JA 5BWMA 2PGLA 4LMBA 2ODQA 3AY3A 3OY7A 2PN1A 2PCJA 1ZM2A 4ROTA 5JRZA 3HP4A 3NBXX 2ZZMA 1JVSA 3CKMA 3JYPA 3KQUA 1T6XA 1Z0IA 3UGJA 3PFNA 1CUHA 2BMJA 3B1FA 3D3NA 5G3ZA 2VQFB 1WTAA 9ABPA 3O4HA 2C07A 2NU7A 1JU9A 5BSEA 2GK7A 4CNQA 2W11A 1H5UA 2AG8A 2I7CA 4I4IA 2AOXA 3KAPA 1PVOA 3FA2A 4D9EA 3A4IA 3BL5A 3UXYA 1U1FA 5IT9A 5GWXA 5C7OO 1HZZA 3IHWA 1RPZA 1EWQA 1E92A 1V41E 2CXXA 2PL5A 4ND4A 4UD2A 5GZ1A 1NFRA 1AUXA 1RHRA 2GHRA 4S04A 1XD2B 2Y1OA 4NNPA 3SX2A 2WF9A 2VJMA 4ZRDA 2JVIA 4DV6B 5AK6A 4KR9A 4TLAA 2JK1A 3GJYA 4RIHA 3QELB 3PUKA 2VIIA 1VPWA 1VE5A 3IA2A 1EM8B 1RWVA 1SVUA 2UZAA 4M3NA 4UUQA 3AEUB 2H1LA 3MGBA 4JYMA 4Q4AA 1Y7HA 4Z2YA 4BNXA 5K3SA 1QB8A 2RGGA 2VVTA 2PDAA 2HU5A 2YCBA 1H3FA 3DKIA 4HH3C 5DNAA 5ICCA 2B1JA 3HXLA 3L7IA 4LV5B 4QBIA 1G3QA 4KXYA 3GUUA 3OKAA 4RKWA 3W4JA 4F3KA 1MRSA 1JKXA 2Q5CA 1NA5A 3ZE0B 5CBPA 1L7DA 5DIZA 5CFRA 2PX5A 1T26A 3KV3O 4M0DA 2VK8A 2ZUUA 2OCBA 1YB4A 3CPEA 5CB8A 2I6SA 1M0WA 2WJGA 3L7JA 1ZD5A 1KDYA 2QRUA 5FULA 1DIAA 4EARA 1CCWA 1US8B 1WM1A 3LHSA 2XX3A 1TD9A 1NTRA 1UANA 1AUQA 3C6XA 5F1OA 1TKRA 4GECA 2CJWB 1VPLA 1XTSA 5IEJA 4AJKA 3PUWA 2Z6VA 1V8OA 2MR5A 3IMKA 4OH7A 2QRMA 1PT9A 2QN3A 2DFLA 1NXVA 3A6LA 4F04A 1P77A 3MMSA 5A1TA 4C4SA 5JS7A 3GT0A 4LNUA 2I3BA 4F8EA 3IMCA 4FMBB 1YL6A 2OLEA 3EF3A 1KWGA 5CR9A 2D0IA 4A6DA 3SIPA 5CD1A 1W7AA 3O47A 1MJGM 2E4YA 3KPJA 4C4XA 3GEIA 4J0IA 3ZCVA 1C9MA 1KEVA 4JB0A 2H1IA 2YXNA 3EEIA 2HA0A 3OCZA 4LXGA 3KZXA 3E22A 1ZOOA 1GNTA 4Y6OA 1Z2AA 2BFWA 3ISJA 1BHJA 1YOVB 1YR9A 4ZTBA 5ALZA 3R8FA 1F8YA 1C2TA 1GAQA 2GJ8A 2H0QA 3ULKA 3SDZA 1CJKC 5E4YA 2ZYGA 1RHQA 3MQFA 3KXPA 1ML3A 2FPWA 4EKNB 3HC7A 5A06A 1BS9A 3AEKA 1PK9A 1R0XA 4QO7A 5BPHA 1UT6A 3PJGA 4OIMA 4MYHA 4TV9B 4W63A 4B75A 1WB6A 2DGDA 3PWSA 1BXZA 3EWAA 3Q5GA 2Q4OA 4OQNA 1U2DC 2R1TB 3VU9A 1VJGA 4S0XA 4X65B 4OD0A 2AI1A 3S5UA 2FTKE 4QWMA 2R8RA 4MV3A 4NX2A 5E9QA 3GJRA 4CF5A 5CFOA 4L28A 4NMWA 1WKBA 4P4NA 3VR2A 2QD2A 3L8HA 1X87A 2Z9BA 3R3HA 3Q7SA 2E3JA 4RHXA 2XCOA 5JCZA 3LPNA 1I1QB 1IH8A 3OMXA 4KXMA 1LRKA 2W2XA 4Y9RA 3A1EA 4B45A 2BLLA 3VOBA 2EW2A 1HH4A 4RF4A 4AURA 4M60A 1E20A 4D3XA 3THWB 4ZI7F 1K6IA 2JFQA 4C7JA 1M10A 4YHHB 2B8TA 3UAZA 2Q5LA 1WZNA 3QU4A 4HUQA 4MVJG 3ZCUA 5CFZA 1U8YA 5AVTA 2WJYA 4J16C 1CYEA 1YMUA 1LPAB 2G07A 4BNUA 4MUBA 5FPKA 4RPIA 3B60A 4ZAFA 3PCXA 2VPYA 1LVUA 1Q5PA 2JHGA 3OHMA 5HRAA 2UZ0A 4XLLA 5JQWA 2IH2A 1ZNXA 3I01M 2ID7A 2PKWA 1O58A 1M76A 3WKDA 1SKYB 3HVIA 3OI7A 4JQSA 5BVHB 1OROA 3ZDQA 3EZXA 2NO6A 3PQ6A 1CUSA 2HN9A 2AMLA 2NW6A 2AJLI 2V7BA 2VN8A 1VL1A 1Q57A 1YVDA 2PZEA 1A8QA 1YB1A 2X13A 3IQWA 2WT8A 4R7TA 3CLRC 4Y2VA 5JFGA 1C9NA 1OILA 1SKBA 4F8JA 5BV2P 4M0CA 4PX5A 4KUGA 3QI7A 4KODA 3B85A 1C7RA 1F6WA 4PC6A 1EK2A 5IBPA 1ABBA 1NBMD 4NBTA 2EIXA 3DF7A 1E9CA 4HAUA 4N6GA 2QZPA 1G8FA 2EEPA 1GPKA 1PO7A 3IP6A 3SHVA 4F7DA 4H3SA 4RL6A 4EEXA 3FHOA 1HDRA 1QP0A 3U17A 2X0RA 5C7YA 2A0UA 4M21A 4LGYA 4BVBA 2AEEA 2O8EB 4H1TA 3EARA 1MTOA 1MRZA 4WZAB 3QPUA 7GPBA 2IX9A 3NWBA 5C34B 1DBWA 4HNVA 1FY2A 1W5BA 3KKOA 2PLRA 5IM5A 4HDMB 4NPCA 4JXJA 2F55A 4WN3A 3L9XA 2OCPA 1T6NA 2BGNA 4HBGA 2Y67A 2P5SA 3JXEA 1YZ3A 3RVJA 1E69A 1VHDA 1BD4A 3BWXA 4RJIA 3PL5A 5EL0A 1HY3A 2IQ5A 3K31A 2PT7A 4P4SA 2V0CA 1I30A 2VXCA 4RVOA 2FYTA 1E77A 4MDHA 5HBRA 1R00A 4HGQA 3SQXA 5E7MA 3MINA 2IBMA 3GLIB 2D2IA 3BXZA 3DW3X 2UXBB 3N3AC 2XEXA 3OQ6A 3S3TA 3X2FA 2IDMA 3TB4A 4YCAA 3WK7A 2FDRA 4HY3A 4UREA 7MDHA 5JSQA 3FVTA 3ZKAA 1GPJA 2EDCA 2H11A 4P3PA 1MJHA 2BGKA 3RWBA 4HXEB 3LUKA 3QIAA 4J0GA 2Q2OA 4X20A 5GZ6A 2PZJA 1LD3A 3RNLA 1ZMTA 2CUNA 3RAFC 3EA5A 1IHDA 3L7OA 3CF4A 3R7LA 1SULA 5JNVA 1I4EB 3LBHA 4J0FA 2BTOA 5EIHA 3A58B 3HCFA 2FZKA 1JQDA 3F4LA 1JEAA 5FUBA 3CW9A 3SHOA 5B1YA 1CJBA 1SVNA 2BONA 4JLPA 1EESA 1C0EA 2E49A 2GUGA 1SBHA 1TECE 1ACMA 2BCEA 2YOGA 2ZROA 3AFGA 3WWEA 2AWNA 3ZHSA 1ZICA 2HPHA 1EP9A 1EM6A 3I8OA 3WBKA 2WVHA 5BNZA 3FGOA 3GG9A 2IYPA 1RHUA 3L7CA 2GKGA 1MBZA 4FIZA 1U7WA 1UBOS 5CEFA 2YYZA 1XK6A 3UTDA 5KVAA 4JLUA 3M89A 2HU7A 4TGLA 2LDXA 4C1NA 1X7HA 3PQEA 4DIOA 4WQMA 2W2LA 4E31A 3H13A 1N5KA 3WAGA 1JFVA 5BN3B 1U94A 3Q3VA 4DMRA 1KNQA 4K9KA 4KH1A 3COYA 1AV7A 2H00A 1WUJS 4TQUS 2Q7OE 4JMLA 3EYAA 2IOFK 1QZXA 3H4TA 4CCAA 2P41A 3ZHZA 1M72A 5E3JA 2HAEA 3L8CA 4H27A 2YH2A 3NEPX 4O08A 4DRZA 4PNEA 3D1LA 4I9GA 1YS7A 1L5MA 1PUIA 1H0KA 2WM3A 3DW1X 2QZJA 3SVLA 3PDCA 1E2MA 1JIXA 1VPVA 3D4OA 3LZDA 1JV2B 4NOKA 3UATA 4P8RA 4DWVA 1P3Y1 1T2EA 3RT9A 3QOXA 1XUOA 1E0JA 3LX4A 3FPAA 3L01A 1TAGA 1Z47A 4U2BA 2WKRA 3ZWOA 3U44A 3BDVA 3OCCA 3RSLA 1RWMA 2ONCA 4M0EA 1N2HA 1PX0A 4UAGA 2ZRJA 3O2SB 1IBCA 1QFSA 1ENPA 1W44A 2XCUA 4GVPA 4IDGA 1CR1A 4R1OA 5NLLA 5H8WA 1T4CA 1EDBA 4XEUA 1FLAA 4QUKA 5D87A 5KTYA 1A8PA 1J2RA 3W90A 2O3QA 4L07A 4URFA 5MGNA 5BVHA 5C80A 1G6KA 1TA4A 1Z0UA 1R3DA 4P7JA 1RJFA 5EE3A 4JEMA 1ZMBA 3ZQ6A 2NV0A 4X8LA 4ZCIA 3BWYA 1BO6A 4KHPB 5AHWA 3QW4B 5E9WA 1N1MA 2O52A 2F62A 1YFZA 3O5AA 2A59A 2P77A 1JQLB 4LDJA 3R6DA 2VWHA 4MYCA 4EEKA 2VRWA 4QDOA 2JGEA 3IDFA 1J1IA 3KYJB 1CY2A 4IILA 4MV7A 1UJBA 1JFFA 9LDBA 4YPVA 4XUDA 1YK0A 1GVNB 2ZRHA 1P31A 4F46A 2C5LA 3UB4A 5CT6A 1X9HA 2INGX 1PJ4A 2J3HA 2E21A 2CNBA 3PKIA 3JWHA 4IIYA 4D6YA 2BM0A 4YS6A 5U4XA 2VCYA 1BXGA 2FQYA 3OE7A 3VDNB 2I4TA 4PHGA 4B3RB 1D0SA 3HB4X 3RCBA 5IULC 4HYYA 5JASA 3IQEA 1DHRA 1YNOA 3UAVA 3V1UA 3O3NB 3OJOA 3IMFA 4WCFB 2ZYRA 2QP9X 2XWQA 4BJ6A 2ZSFA 2DUNA 2VDPB 3PNSA 3DLHA 3JQ9A 1HEYA 4PLYA 5KNDH 1SUSA 3HKCA 3RVQA 4WEQA 4GPTA 4IXWA 8ATCA 2E4WA 2O3UA 3FG9A 1EG7A 1UXGA 1V2HE 1BYUA 2X9GA 4CV1A 4YVFA 4BLPA 5I7HA 4QGHA 5EUBA 4EUKA 1WOYA 1NMEA 1EE1A 1UKAA 4EOGA 2PBLA 4ETNA 2WZQA 4XX0B 5JI3E 5HJEA 2XA1A 1P1IA 3E8MA 4AS1A 2W6IA 1XXHA 2EF0A 4DQ0A 1J42A 3LGAA 1TRKA 5E3IA 1T5LA 4DLAA 4JQOA 1XP5A 3HJAA 3LSYA 3EC2A 2AKEA 3ISVA 1QS0B 4D4JA 2ZSEA 2AOVA 3D4LA 1REQB 4DW8A 3FRIA 2RHGB 2XYHA 4L8FA 1QFXA 4LVOA 4WLNA 1U7DA 4ZEOA 4ZANA 3DQQA 3RIMA 1DBSA 1TF7A 3ZIUA 1NMYA 2O7RA 3LC7O 5GP1A 4AYXA 2YFQA 4BN5A 1KJJA 3LTNC 5F7ZA 4BFCA 1FFBA 3B53X 4GW3A 4PVCA 1HLPA 1SQGA 2A3NA 4RADA 3NUGA 5AM5A 2DPGA 1RYZA 3FIJA 3UMFA 4WEOA 1K7XB 1W75A 3QSYA 2NYAA 2QMEA 1E3WB 1JHXA 4XD7D 1SPBS 4BRWA 4E70A 2G9VA 4AY2A 3CGWA 1RLOA 3W6NA 1SR8A 3V1MA 5GJBA 4FHCA 1JI3A 1KK3A 3K5PA 1O57A 5EP3A 5AVYA 4F9GA 4BRZA 1Y8QA 1Z0FA 1WVGA 2IKSA 1R9GA 3UC5A 5FOSA 3ZDDA 4B74A 3H8SA 5EZYB 3PJDA 1Z25A 4E1VA 4F5EA 4ARIA 2X9NA 3WKAA 3Q6NA 2Z3ZA 5EIXA 2YICA 3K2QA 1IB6A 2B8EA 3A3OA 5L3RA 5KSYA 4ABTA 3GVCA 3KJNA 2AF3C 4YJ3F 1EBFA 1UJ6A 2GXSA 4D82A 3AERB 1NVUQ 1GZHB 1NASA 2JJ1D 2C0PA 2VP0A 4YRAA 3RTCA 4Q4AB 1NSTA 3IJEB 3CSUA 3P1JA 1ZW6A 2CB9A 2WTBA 1ZD2P 2ZETA 1GXSB 5JPCA 4PLHA 3PRKE 3UGTA 4CDMA 5BUCA 5I4BA 2XZOA 1IBLB 4LHYA 2JZCA 3GLIE 5ESDA 4JYZA 1N25A 3CMMA 3ZQUA 4DNXA 5JDIA 2H4YA 4Q7JB 4Y6GB 3KDSE 3O4GA 4OQYA 2O57A 2CSXA 2ZAGA 3RVRA 4XW2A 1W1WA 4NZNA 5H16A 1OKKD 2IF2A 2R6FA 4AFNA 4H1WA 1MNAA 1T0HB 4O4JF 2UXDB 4HSGA 5KNBH 2X2FA 2VBIA 4Q7LA 1KAHA 2J0VA 1JRLA 2O4UX 5KTSA 1CQZA 2ZZKA 3BZBA 3I2KA 1KK0A 3DV0B 2OG2A 3PX3A 1BFUA 1HMYA 2QR5A 3QOWA 5I8ZA 3HQ4O 5EHXA 1N6NA 2ZJ7A 4GQAA 1ZI9A 3RJMA 2DBVO 2AQHA 1KEUA 4QNNA 1T10A 3CINA 3V4FA 3H5AA 4EKEA 4IQ4A 1NN3A 2EWWA 3PC8A 4J1SA 4OI0A 3DULA 5DTQA 5J5VA 5KTOA 5KX5B 2VPZA 3UHAA 4BPBA 3D2CA 3GQVA 3KELA 3O8DA 3T5CA 2XI4A 3WK8A 2PS1A 2Z98A 2ZUDA 2H54A 3SS8A 4BZQA 2YN4A 3ZE1B 4YV2A 1ZC4A 1J5XA 1TEVA 1TDJA 2ZJ2A 1PN3A 4IJWA 4DDVA 4BFVA 5LQRA 4DQUA 1MW8X 1CTQA 1VSTA 3B52X 2RH9B 5JAPA 2JLXA 2A5GA 1FFEA 3U3XA 2H9IA 1GPWB 4H1HA 3H0CA 3I83A 3OEED 2HC9A 1LPOA 4CM8A 1VIVA 5HRCA 1RJ9A 3RSQA 1W46A 4AZSA 3V7NA 4EIWA 1NUUA 4U7WA 3D0OA 1VB3A 4UXJA 4F3CA 4TMTA 4N5MA 1FS6A 1H6BA 1MAVA 2D2VA 5DSXA 5F77A 3TTSA 4EECA 2FPKA 4IYJA 1Y5NA 3QVJA 3NCHA 4WT7A 1SKYE 1AQNA 1W5FA 4LI3X 5HDBB 4PRZA 1KYVA 1M73E 1A9YA 2IHYA 5H7XA 2RHBA 1NVKA 4P22A 3KU4A 3B1JA 3RV4A 2D7JA 4A2QA 4MRMB 2QD3A 5DCYA 1H6AA 3G9TA 1ZWLA 3M6FA 5B6JA 5A0TA 3P9RA 2UUBB 1H1LB 4A0SA 2AI2A 2IYTA 2RJOA 4FZRA 1ESZA 1ZPDA 4QTZA 2IF0A 2WU4A 2PVCA 4DILA 4HD8A 4Q9JA 5DE3A 1GYRA 2VRCA 4G8CA 4AMGA 4BAZA 1HE1C 1DTEA 1PTJC 3OOWA 1MX1A 1Z36A 3M9XA 1KWKA 2C4NA 2GDJA 4UPDA 3M82A 3KTFA 4X8MA 1FFXB 1UPTA 3B36A 4M1QA 4L0MA 3NBAA 4RPLA 1NE2A 5IVPA 4OXNA 3UG7A 3N59A 1QLWA 4A0RA 1HQDA 4MCHA 1EDZA 2PRYA 3QVOA 5SYAA 4DY6A 3NI2A 3RSZA 1PZEA 1PJZA 2VDWB 3NH6A 5AXDA 2JEOA 2IYEA 3DDUA 1T43A 3GRFA 3H19A 5DLDA 4BVLA 2WB4A 2MSDB 2CCGA 4C3UA 3QEBZ 2JI8A 3LQ1A 4BX3A 5FHRA 1M7GA 5KSOA 5IU6A 1XMVA 3W8RA 2DFDA 4I9FA 2A0XA 5FA5A 1DAOA 3N75A 2QTMA 5KDOA 2J3MA 3CH4B 4Q3NA 1SFRA 3JQBC 2YJ4A 1KSFX 1WD5A 2V7VA 2VEOA 5I7AA 4NENB 2YOFA 3KVVA 2V9PA 1QAQA 3AUUA 4S1NA 3P9ZA 4E5KA 3T3PB 4D2IA 1HDXA 2VHCA 4HO1X 1U5CA 1LTHR 1NKSA 4UASA 3DTTA 1KYYA 4BZXA 2O6LA 1QYCA 4R83A 3UZUA 2ODTX 3NHBA 2AL7A 2CFTA 3DTVD 4DTCA 4H7HA 1P0QA 1I5EA 1ZBQA 2HWXA 2PSJA 4RSRA 2YVLA 3SC6A 2IZOA 4QU9A 4BGDA 2IH5A 2C2MA 3KQLA 2X76A 2HJHA 4OCZA 1T1GA 4MHOA 3HV0A 1NJFA 1Z4KA 3BE4A 3O7WA 3TZCA 1FQKA 4LSWA 4S2EA 3U0BA 1OFUA 2H4ZA 2Y8EA 5JZVA 4EPTA 1IOWA 1MG0A 1Q16A 3NKLA 3MJHA 3IKLA 3ADBA 3PYXA 1E0KA 4O4JA 2PMEA 1EFCA 3GFBA 2CNNA 4GZLA 5HJ5A 3GD5A 4AJJA 4BKRA 1E32A 1XO1A 2YVUA 3AHHA 3GAZA 3NHFA 4GX2A 1L7AA 2A5DA 2GK3A 4HN9A 3E3OA 3FY4A 3KJXA 3CZ9A 3OU7A 4RU1A 5IDYA 3GX1A 3FMVA 1KC3A 3I1YA 3A26A 1BDJA 1JH9A 4F3TA 3FD8A 2O19A 4X63A 5IYZA 1U2GA 1BX1A 4R6WA 3ZU2A 4FNOA 1KSHA 2YJGA 5A3RA 3AM4A 3UKDA 4B40A 2B36A 4N5HX 2BRUA 1FTWA 2H16A 2J31A 2WNHA 1C9JA 3JATB 3L1KA 2PIAA 5GJWC 7ABPA 5IZ4A 2OVBA 1A27A 1L4MA 2A0WA 5AM2A 2GZ1A 4H60A 4N7JA 2IELA 5ALKA 4B3JA 1PRYA 4JYBA 2WFZA 2DC1A 3DBVO 3U7IA 1NV9A 5GVSA 5ALJA 3DC2A 2EZ4A 2GZHA 1GPYA 3MTBA 1VOTA 4LY6A 5B58T 1L5SA 5D1NA 5CJPA 3B3AA 4LWQA 5DHPA 1U1IA 1KHTA 4F4CA 3EVTA 4YC7A 3MYRA 4P53A 4CKEA 3U4IA 3SE7A 4CKCB 3I5XA 4GKAA 1C7JA 4DLYA 1WHSA 1BCRB 4I1IA 4HRAA 5IMSA 1XRNA 2WF5A 5TLSA 1YS4A 4QSHA 4N3CA 1ND5A 1FJ2A 2I0FA 4J8PA 1QH1A 3P9CA 3AM1A 1UBUS 4BUCA 3FN4A 1J7JA 2QRVB 1DPGA 2A94A 2BEVB 1AKQA 1ZLXA 1AURA 3IQDB 2BZSA 4PFJA 3TXXA 4EP1A 3E82A 1E7SA 3PXAA 4EPYA 2WB2A 1CU1A 4IIBA 2XWJI 1G8AA 2VJLA 2W2PA 4NPHA 5HK8A 3RYHA 2GFIA 3WLKX 1F9AA 1GZ5A 1IDOA 1Q7EA 1UDRA 1UQUA 1EIZA 2XQIA 4LOKA 4OJMX 3K9BA 3TD9A 3FLEA 3PHJA 2IPLA 4J43A 4U7FA 5BSGA 3JQGA 2A1IA 3Q8MA 4XVQA 2YFYA 4NU5A 3AEYA 3FUWA 3OE4A 3LNTA 4OJYA 3T3DA 4QGGA 4ARVA 5A02A 1WHTA 5ALFA 1TCBA 1T25A 4ND5A 1TK3A 3U9LA 4ZHSA 3I61A 2OHGA 3OTIA 4DV5B 3LCUA 1HV8A 4PG6A 3C5CA 4RZXA 4OLBA 1KVRA 3HKBA 3V34A 5K20A 3PLAE 5F64A 4L8WB 1YBMA 2WUFA 3TQFA 3Q7QA 1ITZA 3EGDB 3F6CA 3PEUA 4GMXA 3SAJA 3ER6A 2V7GA 3MIZA 4ND6A 3W05A 3I30X 5DN6D 3QKWA 1SHZA 2Q3DA 2DUMA 4II3A 3VM6A 1FUEA 1RJEA 1W88A 2GPWA 1H0HA 2E85A 4K87A 5CH5A 2R11A 2YY5A 3HH8A 3QTBA 1WMDA 5LU8A 4IXMA 1G6HA 4AMZA 3W6UA 5LB2A 2XE6A 3ON5A 3Q9LA 4IRXA 5FH9A 3AUFA 3MOGA 1T0BA 3SLGA 4D8TA 3FWPA 1U1GA 1JL3A 3K5WA 3OKCA 1RYDA 4H7JA 2ZIEA 1P4JA 2X6RA 4URZR 5EIEA 1YVPA 1IHPA 5L7YA 3L4KA 4FGWA 4OTZA 2JIDA 4TRJA 1YWGO 2Z5GA 1FP1D 3PPWA 4KJXA 2YJTD 2QVBA 3ZJUA 1LEHA 4AIIA 2GEJA 3QE4A 1KQPA 2E1PA 2R8YA 4QEDA 2G9ZA 5E6RA 4YRJA 1NNEA 2JVJA 3VO2A 2IHUA 2W2TA 4O29A 1P9NA 4C76A 1WCXA 1NQVA 1YZKA 1P75A 3JATA 3VR4D 2WKWA 3KVOA 4HZIA 3PNQA 3R5HA 4DMMA 1GAJA 4LYYA 2H1SA 2XKJE 4NMMA 3ZLUA 2WV9A 5BVGB 1F4PA 1AO0A 2HF2A 4N03A 4O2AA 1W25A 6PFKA 4I6GA 2AN1A 4Z99A 3TVYA 2CD9A 3LYUA 1M6HA 2I22A 2I4RA 2XA9A 2VJCA 2G25A 4GPAA 5E6SA 2QHXA 4ZDKA 1I7QB 4M53A 2O5EA 4IOLA 1ECLA 4YJ2B 1DKOA 5TSDA 3JYQA 5JXWA 1WP4A 4O4JB 2C83A 4A4DA 5B30A 3A9VA 1DHTA 2DBQA 4FNAA 3J7TA 1K4KA 4D0NA 1N3IA 3AHIA 1L8OA 2FN3A 3JW8A 2R87A 3BE5A 2JK0A 3LXRA 3LVRE 3ORRA 4OL9A 2GGSA 2HQOA 4GSKA 3VU8A 3TG2A 3NBFA 3OIWA 4HXFB 1QIHA 4G23A 3GYGA 2G28A 4B81A 2X40A 1THGA 1W36B 1NT2A 2ARKA 3QBDA 2AIRA 4NCHA 3RRXA 3FWHA 2G0AA 2J8ZA 4FS8A 1T5IA 1E5TA 1DQYA 2ZUWA 1T6BY 1SQ6A 3RJ9A 2JFZA 4B6GA 1AZTA 3M2TA 4H1VA 5KHOC 2B61A 2FPMA 3VR2D 1VJTA 3QEKA 4AZ3A 1NW5A 2X1LA 2JIQA 4Q3OA 5CFPA 4JYAB 3I09A 1UFVA 4RLHA 4M1ZA 4KQ6A 1Z7GA 1KBQA 1VP3A 2OFXA 5HOEA 4MRSA 3IL2A 4LJ7A 4U5XA 5HKAA 1CJUC 5BN4A 3NC4A 1NATA 3VXKA 5CA1F 2HM7A 2J0UB 3RUCA 4V3BA 2FOIA 2YOHA 3KL2A 2QX8A 4ZOCA 4MVJI 1WU8A 3O4JA 4X9XA 3RABA 1WUIS 2R2AA 2WLTA 1CUAA 4PLWA 1RBQA 1V43A 3HVUA 2HLDA 3O9VA 4YIKA 4JBHA 4E22A 1Y7LA 4FBGA 3G2LA 3ZWPA 1H8HD 1I8TA 4AZ0B 1KERA 1PZMA 2BMVA 4IBOA 4ZODA 1V5IA 5H68A 2YMQA 1WVMA 3G2NA 3QFSA 4RVDA 4W82A 3KTAB 3LCMA 2BGMA 3LQRA 2ODAA