3EGOA

Crystal structure of probable 2-dehydropantoate 2-reductase pane from bacillus subtilis
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
292
structure length
292
Chain Sequence
SLKIGIIGGGSVGLLCAYYLSLYHDVTVVTRRQEQAAAIQSEGIRLYKGGEEFRADCSADTSINSDFDLLVVTVKQHQLQSVFSSLERIGKTNILFLQNGMGHIHDLKDWHVGHSIYVGIVEHGAVRKSDTAVDHTGLGAIKWSAFDDAEPDRLNILFQHNHSDFPIYYETDWYRLLTGKLIVNACINPLTALLQVKNGELLTTPAYLAFMKLVFQEACRILKLENEEKAWERVQAVCGQTKENRSSMLVDVIGGRQTEADAIIGYLLKEASLQGLDAVHLEFLYGSIKALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Probable 2-dehydropantoate 2-reductase panE from Bacillus Subtilis
rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords Probable 2-dehydropantoate 2-reductase
total genus 102
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 1.1.1.169: 2-dehydropantoate 2-reductase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02558 ApbA Ketopantoate reductase PanE/ApbA
A PF08546 ApbA_C Ketopantoate reductase PanE/ApbA C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3egoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3egoA01
3NTQA 4NU6A 4AJPA 4XIJA 3WDSA 1T1RA 3VH1A 3B1FA 5DULA 4GAEA 5BT9A 1AUPA 2BI8A 1V3TA 5DNAA 4BKPA 3FR7A 3I9KA 3INTA 3KLPX 1EUZA 1V3UA 2NTVA 1TI7A 1B8VA 3AUUA 1UUFA 3S1LA 3M2PA 1SB8A 2WYWA 3GFGA 3FWZA 3GGGA 4JK3A 4JCOA 1YGYA 3RFVA 3JQAD 1NVMB 2ZIZA 3JQ9A 3AOGA 4KTTE 5G4KA 2O3RA 5JNLA 3WMWA 3JQ8B 2DLDA 2GN4A 1ARZA 1GPDG 1TEHA 1GUFA 3H9EO 4WLUA 3ROPA 1U4SA 2HJSA 1BWSA 2JL1A 3QWBA 3F3SA 3AOEA 4S1VA 2Y1DA 4J2HA 3ETGA 1N2SA 3AI2A 2ZYGA 2R00A 1HL3A 1LJ8A 1Y8RB 4IDDA 1NYTA 3T7EA 4BO9A 4BO0A 3WSWA 2V6FA 2HKIA 3WGOA 1DO8A 4J4HA 1I2CA 1PWZA 1JAXA 4ZQBA 4QECA 4CMIA 4L75A 3UAGA 3RC2A 2B4TO 4IDBA 2HMUA 4B4OA 4DL9A 1DFGA 3BHMA 4NBTA 1N1GA 1HLDA 2PTGA 1P74A 5FEUA 1OZAA 4BV8A 1XG5A 1ZXLA 5DOZA 1XQ6A 5TT1A 1M6WA 4FSHA 1YQXA 3CMCO 4IIUA 3WBFA 3O9ZA 3ZN2A 5A5EA 2Q2WA 1ISGA 2W2LD 3N7UA 1SO8A 2EKLA 2OP1A 1R4NA 3FPCA 3ONDA 4E32A 4P8RA 4L4SA 4WCFC 1Q7GA 3QE3A 4CM5A 2WD8A 4AFNA 4IMPA 4YJHA 2PY6A 1XEAA 2ZKLA 3HZZA 2VT2A 2GR9A 5IJZA 1HWYA 4IZIA 5GZ1A 1YL5A 2NACA 3S55A 2GN8A 2LDXA 3R6DA 3DB2A 1MG5A 3E5MA 2HLPA 2BFAA 4MOWA 1PS8A 3JQAB 1IYZA 4BNNA 4Q9NA 1TT5B 3UXYA 1W4ZA 5BQFA 3LC2O 3P7MA 1G0OA 3CSDA 4FS3A 2FR0A 1GU7A 3IS3A 3Q9UA 2GDZA 4MIEA 1H6CA 3D5TA 4BNKA 4IM7A 1DLJA 1AHHA 1BTOA 5EN4A 3PJDA 5U4QA 1YDWA 2I76A 2UYYA 4BO5A 1JN0A 3JQBC 4E30A 3DMYA 1H9AA 4BB5A 4GGOA 5JXWA 2PR2A 3ZHZA 2EXXA 2O48X 2NWQA 1PR3A 1R0SA 4K6CA 2HRBA 1PL8A 1JWBB 2CDBA 2QYTA 2GUGA 4R51A 2X0NA 4EUFA 3AI1A 3WNQA 3D4NA 2C54A 2VNAA 1HZJA 1XU7A 3DHNA 1E92A 3GVHA 3MOIA 3AWDA 4ZJUA 3H9JA 4E3ZA 2NU9A 3U4CA 2QHXA 1P0CA 1BXGA 1FJHA 2CFCA 2YV1A 5I8WA 4BVAA 2BKAA 1QLHA 4IQGA 4U6QA 1TB4A 2QYSA 1KOLA 2BFMA 2Q1WA 1KC3A 4XR4A 3ZH2A 4JGBA 3IJPA 1JWAB 3P2OA 2QZ9A 3JYOA 5JSFA 3BTUA 4PVCA 4OYRA 2GF2A 1T2EA 3OQ6A 2H63A 3WFIA 1I8TA 5DCUA 1W8DA 5IDWA 4J0EA 4HFJA 4IY1A 4JX8A 3OBBA 3MCVA 3H3FA 2IZ1A 2EJWA 4P38A 4QXMA 5THKA 4GMGA 3HDYA 4ND1A 2JAHA 4BNFA 2D0IA 2G82A 3DFZA 5BNTA 4R5HA 5A9RA 3U09A 3NTRA 3M1LA 3QWHA 4W7IA 1HEUA 1VRWA 3FSRA 3MJTA 2YQ5A 4FOOA 3MJ4A 4YJGA 4BGVA 3V5NA 1M75A 3VPGA 3RQSA 3TSCA 2OFPA 1N7HA 2GN9A 3KOUA 5LDGA 3O4RA 4Q3AA 8LDHA 1NQOA 4DTIA 1T4DA 3UCFA 1Q0QA 1BMDA 2C5EA 3RIHA 4XQEA 4NBUA 3OIFA 1B15A 1VL0A 4KDFA 1BXKA 3TZCA 1P1IA 3W6UA 4J4TA 2C7GA 5F5NA 4E5NA 4JROA 4EYEA 3IP3A 3KLMX 2GRAA 4R54A 2YHIA 4E21A 4O63O 5A3VA 2EJVA 5FF9A 1KVRA 4FC6A 5TX7A 4J1QA 2OO5A 4YB8A 5GZ6A 3TZ6A 3HFGA 2FPIA 4GX2A 3JV7A 4G2NA 1E5QA 4OXKA 2Q46A 1Q2XA 2PD3A 3D3WA 4B4WA 4IPTA 1PTJA 1EVJA 3VZSA 4OO3A 4DA9A 1YDEA 3WQRA 5IZ4A 1LNQA 4GWGA 3WGTA 1J0XO 3QJ5A 2O2YA 4FW8A 1Q0LA 4CR6A 4BNZA 4W99A 5H83A 3T7CA 4WPGA 4WGGA 5T6BA 2EW8A 1JLLA 2J5KA 4BNJA 5TT0A 1PGPA 2E48A 3MTGA 4U7WA 2C59A 5ILOA 4DUPA 5U9CA 3EMKA 1MXHA 1YBAA 4N18A 1O89A 3V1UA 1ZNQO 2ZB4A 4MP8A 1QV6A 2HQ1A 2ZYAA 4CQMA 6LDHA 1UXIA 1GFSA 4CMEC 1GV1A 1J49A 3EC7A 4PG6A 2J3KA 3ETDA 3DAFA 2V6GA 2JKVA 1YONA 2WSBA 3BMNA 2E4AA 3S2EA 4Z3KA 1KVQA 2NTJA 2X5JO 2NU8A 1PJSA 3PXXA 2PK3A 1ONOA 2XPCA 1P9LA 2NQTA 4G65A 1SBYA 3TWOA 4EJ0A 1H5QA 2G0TA 3H9UA 2WEKA 1PJLA 3EVNA 3H65A 3EGOA 4XYBA 4B7UA 1XGKA 2VWPA 3AY3A 4YT4A 4YTEA 1E3SA 4OHUA 4Z9FA 1WWKA 3SC4A 4Z9YA 2Z1NA 5IDYA 3DWFA 4WEOA 4FGSA 1BSVA 3FPLA 5ES3A 4EBFA 4FB5A 4FFMA 3GK3A 1B14A 4RVGA 2D5AA 4DLBA 1PQWA 1SEVA 2AA3A 4N5NA 2AG8A 4DBVO 5ER9A 3ZNPA 3PK0A 2Y68A 4U8GA 5EINA 4BNGA 3M6IA 2VCYA 2Y66A 1V9LA 2WE8A 5COQA 3QWAA 1SOWA 3H6KA 3PHGA 4GLOA 4PG8A 1O5IA 1P1HA 3K31A 2VWQA 4TZKA 4OM8A 3GVCA 5I8ZA 5BNIA 1U5AA 1QRRA 2FSSA 2Q49A 2FPGA 1FDTA 5I9NA 3C3XA 4XD2A 1PGNA 4C7KA 4XJSA 3L4BA 2TMDA 3GGOA 4RLHA 4J90A 4XCVA 4PG5A 1DIRA 2VHXA 4NDNE 4B8WA 2PKQP 3MJEA 3ULKA 4TROA 1KEWA 1VLLA 4KP7A 1C0PA 4B4VA 3QHAA 1T24A 2P9EA 5DBGA 1RKXA 2C29D 3WB9A 1AGNA 1O8CA 4BO1A 2DT5A 4JJFA 4OXYA 4MPDA 3JQFA 3QP9A 5KJ6A 4GPD1 4UAGA 4RPGA 1E7QA 4DC1A 4WE3A 2DBVO 2ILTA 5B4UA 3OECA 5ER6A 4Y8VA 3GAFA 2NNLD 1TT5A 2R6JA 3RBZA 3AFNA 2E6UX 3AK4A 3F1LA 3MWDB 3OJ0A 3NDIA 4YT5A 4BO3A 3WICA 1GTMA 1U8FO 3K92A 2BI7A 1JAYA 5JDCA 3O8QA 3PP8A 4JP3A 3LU1A 3STHA 2DPGA 2EP5A 4EW6A 4IDAA 3SJUA 3GFBA 4BNIA 2FRDA 5CDUA 3D7LA 4K6FA 1UP7A 3EW7A 1K6XA 4FN4A 3ICPA 2DUUA 3WWZA 1YB4A 1R4MA 5IN5A 1E6WA 5CP8A 2JD2A 4NI5A 3WLFA 3GT0A 4RVFA 3RUEA 1LTHR 1R4NB 4CJXA 2FSVA 2EEZA 3KB6A 2FY8A 4ZA2A 3ZZNA 1UZNA 4KMSA 4FGWA 3FCOA 4KWIA 1V35A 2YDYA 4UREA 3K2BA 4R1TA 1XIVA 3PDUA 4Q3CA 3HDJA 2ZB8A 3OETA 1D3AA 1I01A 3DTYA 5A9TA 2BRUA 1ZSNA 2I67A 4IUYA 4S3MA 4YVFA 4DGSA 3E8XA 3IMFA 1ZMOA 4NFSA 1DAPA 4LVUA 5A05A 4A03A 2GCGA 4TRMA 1X15A 5KKAA 4DMLA 2CNBA 3VOSA 4IQ0A 5L7TA 2HSDA 4BMVA 1PJ4A 1KIFA 3H3JA 4OKNA 3DMTC 4AJLA 1P45A 1UXKA 3RD5A 2WYVA 5BSFA 4J1NA 1ZEJA 5A06A 1IOLA 3F1KA 1ULSA 4II3A 4CMJA 4GSLA 4FJ1A 4RQUA 1Y1PA 1OI7A 1SB9A 3VTZA 5ITVA 3L6EA 5B4TA 3V8BA 1PQUA 4OOEA 1KBZA 1N92A 1Q7CA 2PLAA 1IPEA 1SZJG 3OICA 2PNFA 2AQ8A 2JFHA 1JA9A 1XYGA 2HK9A 5BSHA 4J9VA 1CF2O 5K6AA 3VPXA 1GYRA 1ZO8A 1I10A 3G79A 4RO0A 1E1MA 1UXGA 4TVOA 1X0VA 3QIVA 5KJ1A 4M89A 3JQGB 3LT0A 4YDRA 5ICSA 1E0DA 1DOHA 1HETA 1O6ZA 2YFQA 2VWHA 1F14A 5F21A 5I7VA 3GZ4A 4N5MA 3VKUA 1GPJA 4XYEA 3NUGA 3TZHA 1I3MA 3FBGA 3BZUA 5TJHA 4JBIA 1ZSVA 4BO8A 3PYLA 1LRKA 2PFGA 4II2A 4M8SA 1ADCA 3ENNA 4P4NA 4XB1A 3GUYA 2DFVA 1P1KA 1HZZA 4QTZA 1E7WA 4YWJA 2WM3A 4YCAA 3IOYA 3C7AA 2I3GA 3NRCA 2DVMA 2Y1GA 3ZWMA 3UCEA 4XWYA 1XWFA 3PVZA 3CKYA 4XR9A 1O0SA 1DC6A 2GZ2A 3LSYA 3W4IA 2YFHA 3UGKA 3ENKA 2DBZA 3VH2A 2IE0A 1E3WA 2OZPA 3CXRA 3RUIA 4X54A 2ZATA 2NVWA 4ZVVA 1A4UA 3GVPA 5A5FA 5JCJD 3O38A 4E13A 1OC4A 2NU6A 3LT4A 3PLNA 4FJ2A 2W2LA 1YVEI 3ZHBA 5KJCA 2X9GA 4Y6RA 2X6TA 3L07A 2AMFA 5KOIA 3C85A 3HB4X 1S6YA 3PRJA 4RPKA 4I5DA 4Y6PA 1WP4A 4DIFA 5TQVA 2W2KB 3R0IA 4K1LA 4QUKA 5EQDA 5H81A 3HDHA 1C0KA 1P1JA 1I2BA 4IXWA 4WLVA 4CMGA 1M67A 4W4TA 1UDBA 1SNYA 3IKVA 4DQXA 2P4HX 4BNTA 4YT2A 1I3LA 1K5HA 3F5SA 3WJ7A 2O3UA 4URFA 4QFDA 3X2FA 3I9JA 4XEHA 3LT2A 5F1PA 3QSGA 2HMWA 4D3DA 2YUTA 4N7RA 3HN2A 4GX0A 4EEZA 3U5TA 1MFPA 3DZHA 5EQFA 2J3HA 1HXHA 4WNIA 4DC0A 1G1AA 4MVJE 4PN3A 1VJ1A 2X9VA 3PQFA 1I33A 3WBBA 4YR9A 1N7GA 4GX5A 5C7OO 3QVWA 1WAMA 2I66A 2B37A 4LGVA 3RUFA 5JYDA 5KKCA 3QV1A 3NDJA 2TMGA 4HFMA 2V65A 2Q99A 3OJFA 1GQQA 3OMLA 4AVYA 1VM6A 2VRCD 4J0FA 3U3XA 4DBZA 1NX6A 3FWNA 1NVTA 1R12A 2W4QA 1QYWA 4WOJA 3L9WA 1ZKMA 5C5IA 3DBHA 4GSKA 5T67A 1PZHA 3B70A 3WJAA 5IN4A 4UUMA 4KZPA 2X8LA 4D42A 3DOOA 4NFHA 2JCXA 3ZCXA 3ZWNA 4A7PA 2W2KA 3P2YA 2XXJA 3NEPX 5A9SB 4YRBA 2Y1CA 4R41A 4GH5A 1LA2A 1YOVB 4YXFA 3AUAA 5IG2A 4HKTA 4CLXA 1T4BA 2X23A 1E7SA 1DRUA 1R66A 2O7QA 2VTEA 2Y1FA 4UVIA 4BKQA 4YYZA 1ZEMA 3BTSA 1ISHA 4INAA 4LK3A 4Z9XA 1PZEA 5ENVA 5AVOA 4CUJA 3RBXA 2O3TA 3K5PA 3V1YA 1KEVA 5AXAA 3WGQA 1NBOA 5JY6A 3GDGA 5L4NA 1GV0A 4XYLA 4E5PA 2ZTVA 3W6ZA 5AQ1A 3FNFA 3RCBA 3DAPA 3TOXA 1PJQA 1RM0A 1HE4A 2Q3EA 5T8KC 4L4RA 1ONNA 1KC1A 5A4DA 2EG9A 2HRZA 5L9AA 4UEJA 1M76A 1QLJA 4RVDA 3LC7O 1HSZA 3KYCA 4IINA 1E1NA 4ALJA 3OH8A 2VHWA 1EDZA 1B3BA 3COSA 2B36A 3E18A 3JYPA 3KYBA 1E3WB 2DAPA 1ENPA 3HNPA 4ILKA 3ANMA 4IS2A 3B1JA 5L4SA 4O6VA 3NJ4A 3UVEA 3WWYA 1HE5A 5JAIA 2GSDA 3DEYX 2LDBA 2AEMA 1K6IA 2IXBA 1BVRA 2BD0A 1OFGA 2GLXA 4BNLA 1DJQA 4ZQGA 2C20A 3HUDA 4CQLB 4JJGA 3GHHA 3WMXA 4DWVA 4D44A 1LLCA 3LLVA 5B37A 4MVJH 1AE1A 2CMDA 3DDNA 1YO6A 4IJKA 3OP4A 4J49A 3D4PA 1PJ3A 1ISFA 1A9ZA 2CUKA 4LN1A 2JCYA 2FP4A 4R69A 3VH3A 1MXFA 5KWEA 1LDGA 3WGGA 4I08A 2EWMA 1ZSYA 4Z0TA 4O1MA 4M55A 4A73A 4WLFA 2GGSA 3GR6A 3GZNA 2Y05A 1Q7BA 4PLWA 2VYVA 4OKIA 4ZICA 3A06A 2A92A 2JFFA 4RLSA 2YYYA 3JQGA 3GA0A 4MVJD 5G0WA 4AJJA 4D46A 3KEOA 4MINA 4B8ZA 3WFJA 3BHIA 5EESA 4PG7A 5LC1A 4KTVE 4DIBA 4HXYA 3VZRA 1PEDA 4L4XA 2P5UA 3D3WB 3D4OA 5AYVA 4XYGA 2AQHA 2PZJA 5JE8A 3PPIA 4YRAA 1AHIA 1DIAA 4GQAA 3ROMA 5DT9A 4GKVA 5CDGA 2J5RA 2HK8A 4OH1A 5L53A 1E77A 3AJRA 4E5MA 2NV6A 2CVZA 1JQBA 3OF2A 4QSMA 5KVCA 5ENDA 4ALIA 3AM5A 2HMTA 1X0XA 5H82A 4GGPA 1LSJA 3ADPA 4AJIA 3C8MA 5JW6A 3KM0A 4GVXA 1I5RA 1I2ZA 3PFWO 5K0ZA 3IKTA 1HRDA 5A9SA 2ZB7A 3KVOA 4CR7A 1NPYA 3CZRA 1EZ4A 1U2DA 2Z95A 1K6JA 3ZNNA 3KYCB 4HV4A 4I1IA 2PD4A 5L40A 2HMSA 2J8ZA 3LF1A 1JTVA 1X7DA 2QG4A 4O59O 3R3JA 4BL5A 3NT5A 5A1TA 3MOGA 4M1QA 3KZVA 3WGIA 3PZBA 1WW8A 2CDAA 4Z6KA 5FYDA 2P5YA 2O4UX 2FHSA 3DTTA 3ZNOA 3KYDA 3WTBA 1XCBA 4P4GA 1RPNA 5J23A 1NFFA 4A10A 5CPFA 4AJ2A 2PA3A 3GZNB 4WNCA 1R4MB 5KVVA 1XDWA 3ZWCA 2PH3A 4TMFA 4R5MA 3CUKA 3DAGA 3WS7A 2O3SA 1ADBA 1GR0A 5TJ9A 1Q1NA 1WVGA 1YRLA 2JHGA 1H2BA 5F3RA 4BOYA 2X86A 4D0RA 1DB3A 3ZWYA 4NIMA 2A4KA 1GCOA 1T2AA 3V2UA 1GEEA 1NPDA 3ZHYA 1HF3A 2DU8A 4DREA 1FDUA 3D1LA 1E3EA 3OA0A 3HG7A 3PWSA 4XRRA 1ISIA 1FDSA 1I0ZA 4JBGA 1E7MA 1E6UA 3ITKA 1NQTA 2HU2A 4K26A 3ZW9A 1I3KA 2NUAA 3ZDFA 4AJNA 4OL9A 3CEAA 3L4BC 4CM1A 3B20A 3A9WA 4CL3A 5COBA 1H0KA 4JP2A 2H9IA 3KTDA 4DQVA 1T2DA 4D41A 2D8AA 4Q3DA 7MDHA 1BHSA 1DC5A 3PIIA 4RVSA 4LRTB 5JMWA 2ZQYA 4K9DA 1CERA 4D45A 2IEDA 4W6ZA 3FBTA 2D2IA 2BFOA 1D1SA 1VKNA 1EUCA 2CDCA 3OIDA 2Y0CA 4WASA 3NGXA 3OM9A 3DMTA 1KETA 2CSUA 3ZU3A 1K3TA 4CLHA 3CPSA 3FN4A 2PGJA 2BHLA 3I9MA 3K6JA 5HS4A 2W98A 3IJRA 4EITA 1LSSA 3IDSA 5DCWA 4PIVA 1L1FA 3U49A 3LK7A 1EQUA 3U9LA 4RF3A 5IF3A 3ANNA 2EHDA 3KXDA 4M54A 1UR5A 4Z0PA 4DPMA 5I7EA 3QQPA 4PZEA 3WGHA 1YOVA 5HRUA 1KEUA 4YPOA 4CM6A 3DBLA 1Z73A 1I32A 3H7AA 4EJ6A 4FFPA 5CDYA 1R6DA 3LZ6A 4ZRNA 3QLJA 2Q1TA 4XGNA 4R1NA 4MVJP 2JFGA 4CLEA 4B3IA 3RC7A 3WQQA 2IODA 4GLLA 3RKRA 1ZK4A 2DBRA 3VPFA 1EQ2A 4BO4A 2I5PO 5CFZA 5F5LA 4BKUA 3VC7A 1LEHA 4Y98A 5IXSA 2DFDA 2QQ5A 3QVXA 3Q11A 4HNGA 3BMNB 2VOJA 2QX7A 1YL6A 2IYOA 4Y67A 1ZH8A 4E2YA 3S2GA 1WPQA 4FJ0A 4IS3A 2ZJ0A 3BYZA 2PKRA 4UVGA 1IUKA 3JD4A 4ZGWA 2O3QA 3WGZA 4CM3A 4J43A 1X7HA 1B2LA 4DYDA 1ML3A 1NM5A 1X14A 3HE3A 3IC5A 2EIHA 4XQ9A 5DBIA 5DP2A 3WYBA 1BG6A 2IYPA 1QXSA 1P1RA 3BMOB 1ZVMA 4FFRA 3TJRA 3F46A 4HBGA 4NK4A 1T26A 3OHSX 3DQPA 1CYDA 1U1IA 2DQ4A 1WDMA 3L6OO 2YJZA 2BELA 3C1OA 1QG6A 3K2EA 1Y8RA 4ESOA 1OBFO 1HT0A 2A9FA 3KV3O 2HJRA 4HX5A 3G49A 4CMCA 2PV7A 2AHRA 3W8FA 1DIGA 2FPPA 4YJDA 4BIIA 1RYDA 2IZZA 3A14A 3K96A 1B8PA 3DHYA 1PL7A 2I3AA 2AQIA 5JAMA 3GEDA 3FTNA 1SAYA 4DPKA 1U3TA 3C7CB 4EI2A 2X7HA 3JQFC 1OC2A 4YACA 4Q3EA 1UH5A 1C1DA 1IULA 1L7EA 2VHZA 2Z1MA 3KETA 4PZDA 1NAHA 1WZIA 4BNVA 1LUAA 4BQRA 4WLEA 1IPFA 4EDFA 1B0AA 4MVJA 5U1PA 1LDBA 3JQ7B 4MVJF 1OAAA 5FWNA 4D7AA 1K2WA 4L0QA 2G1UA 4Z3DA 7ADHA 1GQ2A 2EF1A 2OMEA 2IXAA 4NBRA 3JYQA 1KY4A 4XZ3A 5CAEA 4KWHA 3I4FA 1ADGA 4E2WA 1N9GA 1UZMA 3VZQA 3W4JA 3K9QO 4YJGB 3WG9A 1HE3A 3NV9A 3GHYA 4YQYA 1E3IA 3KHUA 1EK5A 2VTDA 4BMSA 4B3JA 1H93A 3ZU4A 1UJMA 1Z7BA 1DDOA 3GDFA 4IIVA 4PLZA 3DZKA 3QWFA 4C7JA 2RAFA 3KSUA 5JCJA 4XJTA 1PJCA 1VSUA 3JQDA 1VC2A 3BIOA 1BW9A 2EV9A 1Z7EA 3PHHA 5IDQA 3HJAA 4J1SA 2O50A 3JD3A 5AXCA 1NP3A 1XA0A 4W7HA 5CPBA 4CMEA 2E82A 4ND3A 4DVJA 4YRDA 2QIOA 4XGKA 1QMGA 1PR9A 4ONEA 5AXBA 3EAGA 4F6CA 2ZYDA 4QFCA 2ZQZA 1XKQA 2VYND 4TRJA 4U0KA 2OHXA 3G17A 4OQYA 1ADFA 3KSZO 3TFOA 3U0BA 3V1TC 5G4KB 2UV8A 1FDWA 5G0VA 5DCYA 1NTOA 5GZ3A 5JAZA 2X0JA 1G6KA 2V6MA 3JQ7A 2DC1A 4R1SA 4NMHA 2CVQA 1MG0A 3GN1A 4FPXA 1PJTA 1LI4A 1YE3A 1EUDA 1X1TA 4CMKA 2C7VA 3RUHA 1ZFNA 3PJGA 2OGUA 3UOGA 3Q2IA 4ZRMA 1H9BA 4UEKA 4Q3NA 1QR6A 3HDQA 5EJ2A 1GUYA 3R1IA 3JQAA 3TQHA 4NNJA 1HDOA 2XF8A 4PLTA 1GADO 2P9CA 2J6IA 3ZHXA 3SJ7A 2FZWA 5DF1A 4EJMA 4J4BA 5T57A 1HDZA 1AXGA 2D4AA 3IP1A 1MB4A 4WLOA 1PX0A 1T2CA 3C1AA 2G5CA 2VQ3A 3ROQA 2FOIA 1N1EA 3TZQA 4OAQA 4B4UA 1BW9B 4D43A 2HAEA 4YJHB 3E48A 1Z82A 4CV3A 4QT0A 1QP8A 4ALNA 3TL3A 4MO2A 2Y1OA 5BNFA 4E5YA 1YJ8A 4PRLA 4XX0A 1CIVA 3E9QA 4H7PA 3QVSA 1IB6A 2Y0DA 1KERA 4YEDA 3UHAA 4ND4A 2FR8A 3WXBA 3JQCA 3P19A 4XRGA 4RQTA 2QRLA 1Y5RA 1MGOA 4Z0HO 1UXHA 2JCVA 3UUWA 4A5OA 3MJSA 1B8UA 1JVBA 4NQZA 1YB1A 4IMRA 4BUCA 5MDHA 1SC6A 5CDSA 3TF5A 1PJBA 2GD1O 3DBRB 4UUPA 3TPCA 9LDTA 1HDXA 1Q0HA 4BGUA 1ZJZA 1MA0A 4W9NC 4J7XA 4CM8B 1VE9A 2BFPA 4OIMA 3W1VA 4BB6A 1KS9A 3GGPA 3LYLA 4BKRA 3DZIA 3CTMA 2X9NA 4F45A 1CETA 3VZPA 3WX0A 3M1AA 1X7GA 1GY8A 4MKRA 1PJ2A 2B0JA 3FF4A 4CUKA 2Q45A 1UP6A 4DIOA 2X5KO 4MKXA 2YHUA 3N58A 4D79A 2XXBA 6ADHA 1M66A 4R68A 4L73A 3AM3A 3JQEA 2ZTLA 1U28A 4CL8A 2ZCUA 2RCYA 4BO7A 1GZ6A 3BMQA 1NR1A 4I9NA 4J1TA 1OMOA 2GYYA 4NJMB 4WUVA 3ZV6A 4NH4A 1EDOA 4KOAA 4DMMA 1R0KA 3EDMA 5G0UA 1XQ1A 3WSVA 1NNUA 1Y9AA 4FDAA 3P5SA 3HWRA 5DZSA 3JD0A 2OBYA 5JS6A 3I3OA 4YAIA 4NJMA 4TRRA 3DO5A 5FI5A 4TKMA 2Q1UA 4FR5A 1NAIA 2UVDA 5I7SA 1V0JA 3ONFA 3JQ8A 1Y6JA 3ZV4A 3ZWBA 4H15A 4YT8A 1A72A 3DBLB 3NX4A 1DXYA 5LCXA 4RCVA 4ALLA 3F47A 3JQBA 4ZQFA 4EUEA 4NU5A 3LLSA 3OFSA 4YJFA 1IHXA 1WNTA 4E2ZA 4ROSA 2PKQO 4YAEA 2VT3A 2P4QA 4E6PA 3F6YA 4CV0A 3ZU5A 2WE7A 5IFLA 2VZ9A 1QYCA 3OA2A 1K0UA 2IRWA 4R16A 1FF9A 4E31A 4O5OA 2AE2A 3HADA 1M2WA 3PDJA 3LDHA 3ZW8A 1FK8A 3GG9A 2B35A 3LQFA 4JNKA 4AJHA 1EVZA 1YXMA 4I9HA 5C37A 4I8XA 4Q39A 4GMFA 1UZLA 3I9NA 5JBIA 5KVQA 1N8KA 1RM3A 3FR8A 3RU7A 1HDGO 5KCZA 5AXDA 3BXXA 4ZQHA 2A35A 2YZ7A 3BAZA 1TLTA 4TRNA 2VHYA 3WYCA 3OQBA 3I5MA 5TSDA 1LBEA 4ZQEA 4AG3A 4CUZA 1LSUA 3ZWXA 4PLFA 3VAZA 5HTOA 3ZWWA 2DTDA 4H3VA 1HDRA 3GVXA 3RC1A 3VHRA 3PQEA 2B4RO 1NVGA 4UVHA 2NADA 5A04A 1TA4A 4WCFA 5JO0A 3QVOA 4CM9A 3RWBA 4FFNA 3BMCB 1BDMA 4W9NA 4J9UE 1VSVA 2GZ1A 2C07A 4RJTA 2WTBA 5BR7A 4ZD6A 2X4GA 1WZEA 5A02A 3H5AA 4ZU3A 5L4LA 3G1TA 3W4KA 2W90A 4P22A 1EFKA 2EP7A 3D5QA 4BNUA 5COAA 3H2ZA 3VVBA 4J2OA 3QVTA 1E3LA 1Y81A 2VYVD 3W8EA 1NQAO 3R3SA 4I5FA 1U7TA 1DHRA 1PWXA 4MVJG 4NFYA 4OOFA 1PQPA 4WK6A 3G1UA 4U0JA 3D64A 3I6IA 4AJKA 2I9PA 3GVIA 2Q1SA 3OEWA 1OOEA 1YQDA 5L51A 2VHVA 3DBVO 2YDXA 2VZ0A 2EGGA 4CLOB 1RJWA 2VYNA 4DPLA 3IIEA 1GAEO 2NVUB 2CY0A 3I9LA 4TKLA 3LF2A 2VWGA 1A27A 5L7YA 1VKOA 4MVJI 3JQ6A 4KUEA 3VDQA 4FC7A 1LRLA 1F8FA 5CHEA 4GI2A 3SC6A 3Q3CA 1ZW1A 5BSEA 3JYLA 3LVFO 1RM5A 2CF5A 4DYVA 1ULUA 2J3IA 4E2XA 4U6SA 2RH8A 3RU9A 1B16A 3C7DB 3ZWAA 3AUTA 3TL2A 1DRVA 2FN7A 4IDFA 2QRJA 1A9YA 3ZWOA 4NZ9A 3F5QA 3NT4A 1LU9A 5JLAA 3GPIA 3QY9A 5IZCA 1LC0A 5I9LA 2E49A 2SCUA 2QZZA 1B26A 1LC3A 3GRKA 1I24A 2IZ0A 4B3HA 4HADA 5HM8A 2Q4BA 4YQZA 3Q9NA 3FNHA 3PQDA 4IDCA 1P33A 3WTCA 2BLLA 2BMAA 3AUSA 1QYVA 1DLIA 3PIDA 2VUTA 3RROA 2W8ZA 1CRWG 1ZK2A 4PLPA 3EVTA 4WECA 3Q1LA 3RSHA 1UAYA 3AI3A 3WIEA 4XB2A 4BNMA 4YAKA 3H9QA 2AQKA 1GL3A 1PZGA 2BF7A 3I1JA 4JLWA 2YV2A 3WNVA 5KIAA 2P91A 1W6UA 3ASUA 4WEQA 1HSOA 3RFTA 4BKOA 2UUOA 1UDCA 1P31A 3BMQB 4MJLA 4UEOA 3WIDA 3GNSA 3NAQA 3CZMA 5CEEA 2DTEA 1C3VA 1F8GA 4LSWA 3KRTA 3AM4A 4NG5A 3RC9A 1ZCJA 1WMBA 3PTZA 1E7YA 3RAJA 1Z75A 1HKUA 5JMPA 4J16A 2VOEA 4CM7A 4LISA 3O03A 1PIWA 4GBJA 4QEDA 1V3VA 4MIOA 1TXGA 2GNAA 4GL4A 1U5CA 4J3FA 2FMUA 2YW9A 3DONA 4IXTA 4YBZA 3DOJA 4HWKA 3UH1A 3AY6A 3ZWPA 3GOHA 2H1SA 4GX1A 2R2GA 1DIHA 1A7KA 1IZ9A 1CDOA 1XLTA 1ZIDA 3PHJA 3DZGA 1BXZA 3RUCA 4B79A 3AW9A 3PJFA 5JO9A 1NWCA 5TC4A 1A4IA 4PCVA 3F4LA 4CLDA 5TS3A 3RJ9A 1R15A 2PGDA 1XHLA 3GMSA 4RZIA 3ZWVA 1HLPA 2RHRA 1I36A 4NPCA 2B83A 3H9GA 3MTJA 4CQMD 5F1OA 1B7GO 1NASA 2X1HA 1UAGA 5L95A 4Q3BA 1GZ3A 4UUNA 2VUSA 4E33A 4RPLA 2D1YA 1UXJA 5A03A 5DBFA 2VRCA 2BH9A 5IAAA 1EE2A 1H6DA 1PU2A 2GO1A 4J7CA 3SLKA 4BNYA 4PLHA 1K89A 4YAGA 3KSDO 4NJOA 4NHEA 4D0SA 3CIFA 3Q6IA 4UUOA 2PZMA 1KEPA 1N5DA 1Y8QA 3BHJA 1WMAA 1YQGA 3U4HA 3VTFA 2ZB3A 5DOVA 4PZCA 1Y7TA 4PFJA 4WLNA 3WGYA 4M86A 4N54A 5CEJA 5JC1A 4Y6SA 2BGKA 2C5AA 1H94A 1YS4A 2AXQA 4XYMA 2BGLA 1DSSG 4BQPA 2WD7B 3SXPA 1LXCA 1O9BA 4BS9A 4DLAA 1ISJA 3ZNQA 5F1KA 1ID1A 2H6EA 2VUUA 5DP1A 3QRWA 4TVBA 3D0OA 4ND2A 1S7CA 1U3UA 1TT7A 5HS6A 2FR1A 4XGIA 2YHIB 2Y99A 1LLDA 3HFSA 4OJNA 1JVSA 2Y1EA 2ZK7A 5CG1A 2DUWA 5JYEA 2BGMA 3OJEA 3CTVA 3I83A 1T2FA 5KJFA 5JDCC 2X58A 1PS9A 4ZN6A 1VJTA 1LDMA 3KO8A 4TQGA 2ZJ1A 3PI7A 4H16A 1QSGA 2EKQA 2P9GA 4WCFB 5JDIA 3PJEA 1JKFA 5C3MA 4HFNA 5G0SA 1EK6A 3TNLA 4BO6A 2YY7A 3DC2A 4OSOA 3EHEA 4A0SA 5B12A 5BSGA 2PZKA 3TZKA 2Q2VA 1EBUA 3FI9A 2ZTUA 1I3NA 4R9RA 1XELA 1BVUA 2H5LA 1GDHA 4XDZA 2DPHA 3VPHA 2R00C 4FFOA 5T5QA 3S2IA 1D8AA 4GKBA 4L9RA 3U4IA 1EFLA 1VI2A 3RFXA 5T8KA 4DRYA 4QO8A 3PYXA 3RKUA 4IDEA 4XIYA 4D3FA 5TGDA 4HFRA 3TDKA 3AU8A 4K28A 3ANLA 3V2HA 1ZJYA 3VPSA 1HYGA 4XA8A 3DZJA 3TRIA 1KY5A 1KVUA 2E37A 2EW2A 2AW5A 3GRPA 4R01A 3GEGA 4M87A 4B7CA 3IQDB 3G0OA 1I30A 1MLDA 2I65A 1ONPA 2O4CA 3LC1O 1HE2A 2Q50A 1NHWA 3T4XA 2G17A 3QA9A 4JJIA 1LLQA 4YAJA 2G76A 2HMVA 1H2HA 1E1LA 4IJUA 3RUAA 3FNEA 1LSOA 1U8XX 3NTOA 3ROKA 1EVYA 1ZK0A 4DLLA 1YWGO 3HQ4O 2AG5A 3DXFA 4RVUA 1NWHA 4BGIA 1HDCA 4BGEA 3GPDG 5G2OA 1V8BA 3S2FA 2RBEA 3I52A 4BNWA 4F46A 3FNGA 5C7LO 2O23A 3SLGA 2AEJA 2XOXA 3AY7A 5L45A 5JY1A 4U5QA 4R4JA 4E4YA 1WXDA 3L77A 4PRKA 3OEYA 5JC8A 1HYHA 3GC6A 2UDPA 3DL2A 5B4VA 1KVTA 4MP6A 2V7PA 4JQCA 2EKPA 1CQJA 5FI3A 2CZCA 5IXYA 5LDHA 4PVDA 1DRWA 4DXHA 3GY0A 4PLVA 4E12A 1CEQA 1E3JA 3PFFA 3PWKA 3RBVA 1U4OA 4MVJM 3X2EA 4F6LA 8ADHA 4JN6B 4UVDA 3PHLA 5TLSA 3TN7A 5JPIA 1ENOA 4EUHA 2V6BA 3FD8A 3GF4A 3K30A 3L9XA 4FD3A 1JW9B 4KDEA 1KVSA 5HBRA 4XQCA 2AEFA 3HB5X 3JSAA 1GYQA 1C1XB 4QQRA 5HA5A 4LCJA 3AFMA 4I5GA 3K73O 1TVEA 4GVLA 4CV2A 4FIZA 4J6FA 2I6TA 1Y9EA 2VZ8A 5GY7A 3ZV5A 4Y9DA 3INRA 5JCXA 3E9MA 1LX6A 3ZGYA 3LT1A 2OP0A 4AJ1A 1Y8QB 3FHLA 1MX3A 1GD1O 4LMPA 1W0CA 5T64A 4AJ4A 2RIRA 5TIIA 4FQ8A 1F12A 1ZBQA 1KYQA 2JD1A 4MKZA 9LDBA 4NBWA 4PGFA 3E03A 4RF4A 4RVHA 5I7FA 1EVIA 1P77A 3ZI0A 1DBVO 1O95A 4HP8A 4UVEA 1M6HA 3F4BA 3INGA 3SX2A 3SBOA 1UDAA 1EMDA 3IUPA 3A28A 3GNQA 2P68A 4ND5A 3L4SO 1IHYA 4ID9A 2I99A 3HN7A 1F06A 3DZBA 3IL2A 1IY8A 1A71A 3WQSB 1J6UA 3C24A 1MFZA 3HSKA 2NLOA 4XDYA 2UUPA 3M2TA 2DTXA 2OBNA 3L6DA 4IDGA 1ZMTA 3F9IA 5IDXA 3GNTA 4TWRA 1UP4A 2P2SA 4HNHA 5L7WA 4PG4A 3PHIA 3V2GA 1MC5A 1QYDA 1VPDA 5EL0A 4DQUA 1ENYA 4OMUA 3E6AA 5DN9A 3A4VA 1C0LA 4ALKA 2JHFA 4RDIA 4CPDA 3BTOA 4RL6A 4EZBA 3BMOA 5C7IO 1GZ4A 4CM4A 1CJCA 3WR5A 2PD6A 1ENZA 5JFOA 2GN6A 3JD2A 1DFHA 1XR3A 4AICA 1E1KA 2POQX 3DBHB 3I6QA 4QX6A 3DOCA 3EZLA 2VN8A 1D4FA 2C2XA 3KEQA 1B3RA 1VL6A 1O94A 2HCTA 1U2GA 2D5CA 3H2SA 3MJVA 3WLEA 2Y0EA 4C4OA 1BGVA 4L76A 3UFXA 1DJNA 4LSMA 4IBOA 4CM9D 2OXIA 1NFRA 3N74A 1DFIA 3MZ0A 1WDLA 1YBVA 4L8VA 3VKVA 2HDHA 2NVUA 4KUHA 3C1TA 1CWUA 1E5LA 3DFUA 1P1FA 4IGEA 4BNHA 1FXSA 2NM0A 1QORA 3BA1A 3B1KA 5K6AC 4PLYA 4CMAA 3EUWA 4L74A 2GPTA 4GWKA 4R1UA 1GUZA 3IUSA 1JKJA 4RV9A 1QYXA 2YV3A 5KNLA 3SEFA 1NFQA 1PGQA 1ISMA 1CQIA 3BMCA 1EEHA 3EYWA 3GN2A 3PWZA 5L3ZA 4BHTA 2DKNA 2Z5LA 3QWIA 3HHPA 1Z45A 4D3SA 3AOEC 1SPXA 3MEQA 1DC4A 3AU9A 2HO5A 4EEXA 1H6BA 1BRMA 1DPGA 2Y67A 1FDVA 1Z6ZA 1PGJA 5KJEA 4N5LA 4E5KA 4F3YA 4J7UA 3H5RA 2IDZA 3Q2KA 3I23A 4LCEA 2PWZA 4IJVA 4MDHA 4YJFB 1HDYA 1U7HA 5IZCC 3E1KA 3RASA 3B6ZA 1YBMA 3NDRA 1J4AA 4R3NA 3TOZA 1RYEA 3FRJA 3E5RA 3EY4A 1MV8A 2X0RA 1C0IA 4CLRB 4IZHA 1GYPA 2XAAA 3UW3A 4P4LA 5MGBA 3GLQA 4RDHA 3GDOA 1E7RA 3O8QB 2X22A 2WMDA 4FFLA 2GZ3A 4CV1A 2GASA 3PGJA 1PL6A 4ZHSA 5GMOA 3JD1A 1R16A 1QKIA 2OORA 3CH6A 4IJWA 4BO2A 2X5OA 3CINA 3OJLA 3ADOA 2JAPA 2J3JA 1SEPA 1NHGA 3WOHA 2NTNA 3NYWA 3OJOA 2F1KA 4AJOA 1MP0A 1EBFA 2O2SA 1FMCA 1C1XA 2VRBA 1SMKA 2Q2QA 1LDEA 2WD7A 3H8VA 3CE6A 1SOVA 3ON5A 4AL4A 2EERA 1GCUA 1D7OA 1XSEA 3EZYA 1P44A 1N9GB 4IQ8A 1LQTA 4FOSA 1C14A 4RF2A 3ABIA 2WDZA 1MUUA 3A1NA 3OSUA 5KVSA 2B5WA 1L7DA 3BTVA 2DBQA 4OXNA 1SCUA 4MIYA 3UN1A 5ITWA 3RUDA 1GEGA 4ALMA 3I9OA 3H4VA 2JJYA 4R3WA 2AE1A 5JDIC 4RZHA 3E82A 5JAQA 3GMDA 2O7SA 5A3JA 2WWRA 1LRJA 3KYDB 5G0TA 1A5ZA 4CR8A 1P3DA 4CLRA 4O0LA 4JIGA 4UULA 1YL7A 4LRSB 1IL0A 4FBGA 1D1TA 3GUCA 1W73A 1C1DB 2NU7A 2CF6A 5ICMA 3ONEA 2PH5A 3VDRA 1J5PA 2UAGA 3S8MA 3PZRA 1NXQA 3VVCA 4RPJA 3UF0A 3UICA 1YH3A 4CM4B 1T1SA 4JBHA 3ITDA 4KUGA 3RI3A 3KUXA 4RPHA 3GQVA 3U62A 1NQ5A 2OL4A 1Y5MA 3OQ1A 3OIGA 2B69A 5DDIP 2NQ8A 4BMNA 4WOKA 4KQWA 1MC4A 2CVOA 1LLUA 4CM8A 2ZTMA 3MWEB 4EGFA 1Z74A 4OSPA 4NR0A 2A94A 2EGHA 1NR7A 2QRKA 3ETEA 3GH3A 3E9NA 4RF5A 3L0DA 3SVTA 3JTMA 1YJQA 4NBVA 3H5NA 4M49A 3D3EA 3G3EA 2JD0A 1JDJA 1ZK3A 4IGFA 1U9JA 3ICCA 1R0LA 4A2CA 3ORFA 2OUIA 2B5VA 3NT2A 2D59A 2FWMX 3K8ZA 3DZFA 4XKJA 1IZ0A 1E6EA 2ZCVA 4XQGA 4LW8A 1DC3A 1V6AA 1NPTO 2HK7A 5HWSA 2IEBA 5EMHA 3UCXA 5KTKA 1VL8A 5ILGA 4CODB 1DHTA 3DBRA 2NSDA 1DEHA 1P0FA 1PGOA 3NJ8A 4LMRA 4RGBA 1XU9A 4TSKA 5TRTA 1JU9A 4FCCA 4MP3A 3QW2A 3O26A 2B4QA 4NK5A 4JXKA 4A27A 3PEFA 2RH4A 1F0YA 5I9MA 4CLOA 3CMMA 2C0CA 3W8DA 3PYMA 1X1EA 3GEMA 2Q4EA 1R37A 2C2YA 4CMHA 1G0NA 1PSDA 4TZTA 1IE3A 4CQLA 3ST7A 1VJ0A 1RWBA 3KBOA 1YB5A 2RHCA 2Y93A 3GG2A 1RM4A 2OOSA 4WCDA 2QW8A 2ET6A 1HYEA 2FZEA 4R9SA 4AJEA 5EIOA 2CD9A 2NVBA 3WYEA 2YQ4A 4RORA 5AOVA 1A7AA 1U3VA 4I9UA 2HUNA 2PGLA 4WJZA 3ZU2A 4LVCA 1DAOA 3PLRA 4BNXA 3TFQA 2C82A 1JKIA 5CDTA 1LDNA 5TF4A 5ADHA 1DIBA 3DHEA 4QO7A 1YKFA 3MJCA 4HUJA 4G5HA 3ZV3A 3EK2A 3U4DA 3I4CA 4KQXA 3FTPA 1BDBA 4OGWA 4I5EA 1H6AA 5EPOA 5CEFA 3NGLA 3JYNA 4HY3A 4PLGA 4OQZA 1LQUA 2PZLA 3ASVA 4CQMB 2J5QA 2WYUA 4E0BA 3DR3A 3IAHA 1AN9A 1EE9A 4PLCA 1GQYA 2DM6A 2X0IA 5TNXA 2D3TA 4J91A 1HTBA 5EERA 3RVDA 1WLYA 1AXEA 1BXGB 4W82A 1X13A 1PZFA 3RJ5A 4B7XA 2GERA 2F00A 1U3WA 1LDYA 1T25A 2O3JA 5K9ZA 4ITUA 2WJPA 5CG2A 1ZZEA 4YA6A 3Q0EA 5FFFA 3JCZA 1ZK1A 3VH4A 4CMBA 3T4EA 5G4LA 3NKLA 5B1YA 1ORRA 4CMIB 3UKOA 4WKGA 1WDKA 3GAZA 3JQ9C 1ZUD1 1F17A 1QV7A 3PGXA 4G81A 4A26A 4BV9A 1PS0A 5THQA 1ZXBA 2VNSA
chains in the Genus database with same CATH superfamily
3NTQA 2JEYA 4HB3A 4KGXA 4EABA 4B87A 5K3OA 3VH1A 3AB3A 1Z68A 4F2WA 4GAEA 4KYVA 3FVQA 5K3DA 5BQPA 2BI8A 1V3TA 4X00A 4J3NA 5DNAA 4C03A 1XLVA 4AULA 4YXWD 3ACDA 1PR0A 4M0DA 1U9CA 3KLPX 3I1IA 4QICA 3C7KA 5FOUA 1V3UA 3PCTA 4M88A 1FNBA 1UUFA 1GJRA 1SB8A 3GGGA 2HL6A 4G0NA 1I4WA 2GWHA 2P1ZA 2W2XA 1KZ6A 2QLJA 4UAJA 2Y76A 1XMJA 4MULA 1NVMB 1TA9A 2IF0A 2HHAA 2ZIZA 4QBHA 2KYRA 1P4GA 5JNLA 4IUCS 3AJEA 4PONA 3JQ8B 3OU2A 1Z3IX 5EPUA 3AM1A 4OKSA 3W3AH 1JILA 1OUMA 2J59A 4FILA 1XP5A 2CLDX 1KP2A 3U6BA 1NUHA 1BWSA 2HJSA 2ZWVA 2HADA 1XQVA 3ETGA 1H85A 4G1UC 4WXMA 3L7KA 3MJHA 3PUVA 2QYOA 2R00A 4ZCTA 3U81A 1Y8RB 3T7EA 4YDQA 4Q6WA 3IBFA 1KYTA 1MB2A 4AO8A 5FNVA 3UC9A 3WGOA 4QBTA 3DH0A 3E61A 3HY4A 2R7AA 2XB8A 4J4HA 2QVCA 2XWQA 1EWQA 3X3HA 1WR8A 1HPLA 1SKAA 1UBLS 1JAXA 4H6WA 1ECJA 4O2AA 1I6KA 4M36A 5D7NA 4ZQBA 2XDWA 3HRIA 3UAGA 5KOHB 1Q11A 4HRAA 1IY9A 1DAHA 1HK7A 3WO1A 2HMUA 4MKIA 4DSTA 4NBTA 1HLDA 1RZ3A 4X5OA 3FB4A 5FEUA 2WFAA 1C9NA 2KLBA 4LJ7A 4EA9A 1XQ6A 1NXXA 2O05A 1M6WA 4FSHA 1S2OA 3IKMB 4IIUA 3R3UA 4Y2VA 2W2VA 5ALLA 2C4NA 4X6UA 5A5EA 5FX2A 4ZZIA 1ZIXA 1JL3A 1WHTA 1DTWA 1L2TA 1J0EA 3GRCA 3MOSA 5LQNA 2OP1A 1K8QA 1R4NA 3CB4A 2XEXA 2MR5A 4XX0B 3F7TA 4D0NA 2MSEB 1PEAA 3IPCA 4UOQA 1R0ZA 1Q7GA 3QE3A 4AFNA 2SKDA 4HYYA 5FAXA 2H48A 4YJHA 2JLZA 3L7DA 4DRZA 2P0YA 4M1TA 4B74A 1HWYA 1EP1B 1S89A 1E1RA 2QVLA 2NACA 2ZLBA 3EDCA 5FORA 3SYTA 1ZCZA 2FZGA 1OBHA 1D09A 1MG5A 3K05A 3E5MA 1T6BY 5ALGA 4AZ0A 3U6KA 3G13A 4KXFB 2BFAA 2WOOA 1VL2A 4QJIA 1RI4A 1EXVA 4JYPA 3PWTA 2K7FA 2R1TB 1GKYA 1IYZA 3C3MA 1EFRA 5EJFA 2N75A 1PNVA 2F4NA 4K0RA 2ZTHA 4QD3A 2QPLA 2XCRB 1PFYA 1L5QA 1ZGGA 4KR0A 4HOYA 5FP0A 4QA9A 5BQFA 3LC2O 2GN0A 1PR5A 1RWMA 2HWYA 2PANA 4TXNA 1GU7A 4X7RA 3IS3A 2VEOA 4B47A 3RC3A 2QPTA 4RK4A 1SXGA 2V7BA 2XMZA 3BA6A 3QXGA 1JHOA 3BKXA 2I76A 4KQIA 2UYYA 3VYTB 4BQNA 2VJMB 3JQBC 1OQAA 1Z5ZA 1UCFA 3GDHA 3W9SA 3O8DA 4EGAA 2VYCA 2L0XA 2PLNA 4KKXB 1Z29A 4X3OA 5FJIA 2NO6A 2NWQA 3N5KA 2FRXA 2XQFA 3PNSA 4DVGA 4KYUA 5CB4B 1PL8A 1ZINA 1DJPA 2JBAA 4TX1A 1M5UA 4EUFA 3K71B 2AKYA 2ZBUA 5LMUB 1MIOB 3U4AA 4QNNA 2F43A 1EM6A 1HZJA 1SUWA 3KV1A 4US2R 1C3XA 2RHHA 8MHTA 5TQ0A 4ACAA 4PTYA 4DDVA 2GPWA 2C98A 3AWDA 3L46A 5L3RA 4ZRDA 4JR0A 1ATZA 4ZJUA 2YXDA 2QHXA 2YV1A 1FJHA 2OC9A 4PHGA 1UKYA 5LPNA 3IAS1 4BVAA 3HJHA 3NHBA 1RR6A 4IQGA 3L0PA 4U6QA 4XVCA 4FGZA 3TW8B 1XVTA 3CF4A 4GR9A 4X1OA 2BFMA 2BUAA 2QRHA 3UWPA 5AW1A 5ARCA 5HJEA 2QGNA 4Z53A 2DJ5A 4CF6A 4UAUA 3D6TB 1YKSA 1JWAB 2CHVA 5B55A 2YUIA 4JSYA 4GOKA 2H17A 3BTUA 3SKYA 4BY9E 2J7KA 2C8VA 3QUTA 1PK9A 2AKAB 5AH0A 1JHDA 1UADA 5BUCA 2NP7A 1BQ4A 3GLFA 4MV0A 4WZBB 2GF2A 2UZ1A 4P4UA 4HTFB 3AKEA 5ESXA 1TMYA 2H63A 4FP9A 1I8TA 4IIGA 4ZI5A 2X2FA 3KLBA 1SIUA 4NBLA 1N4DA 2ZS9A 1T1GA 1WBJB 3BQMB 3R5FA 2PUTA 1ZH2A 3MCVA 3IUJA 4BMOB 3ZBPA 2ECKA 3ZKWA 2IZ1A 4Q1BA 2XTZA 4DV2B 1SBHA 2IU4A 1ESEA 4HH4A 1CK4A 2I6SA 4Z4FA 3ETLA 3FJ1A 4WGFA 721PA 1C7RA 1Y4SA 2AYYA 1XXHE 5EY5B 2R87A 2J31A 3L7AA 4KO2S 4P7FA 4BMDA 3NPMA 2G5TA 4FI3F 1YDMA 3NVKI 1BFUA 2P67A 1OILA 2XB9A 3NEAA 1S3IA 1KMNA 1V16A 3OTHA 8ATCA 2PZFA 3ECAA 3F5MA 5K0LA 2LWIA 4FHDA 2QGZA 3QWHA 4QU0A 4TMXA 4POOA 1TQ2A 2AN4A 3FSRA 1BRTA 1EKXA 1QO0D 2IP2A 2IF2A 3TXYA 4DLSA 3OPXA 1WXWA 4NYMQ 4POAA 2Q4TA 2PLWA 5AK4A 1UMCB 1YFZA 1N2IA 3LRPA 4JI1B 1WW2A 3K1AA 5SICE 2UXCB 2GM4A 2GOYA 2NO5A 8LDHA 4B3MB 4FSDA 1NQOA 3A25A 4L5AA 1ZOIA 2WMYA 1V4BA 4PX5A 1VBNA 3HA2A 3N6RA 1J00A 4DSUA 4EJSB 1BMDA 2QRNA 4FBMA 4XQEA 3ZDXB 5F9MA 5FL3A 4KDFA 2R2AA 1UPXA 1P1IA 3W6UA 3HO1A 3UWDA 3TCKA 2NUAB 2WSLA 4KXYA 2FZ5A 4MITA 1W44A 3JWIA 2VSYA 4Q9AA 4WCVA 3LLUA 2JEZA 2YHIA 4A2PA 3IFSA 5A3VA 3REQB 3GJQA 1N34B 1KVRA 2EQ5A 5FEMA 3VR1A 2YS6A 4FC6A 1VMIA 3O2JA 3I0ZA 4J1QA 4GPTA 2AYZA 2OBFA 2WU8A 3AR9A 4KQ2A 3NWBA 4HC4A 4MI3A 4PHHA 5GZ6A 4A1FA 1MOZA 1IJEA 3M6UA 3G68A 5JV5A 2NG1A 1FFDA 1TAUA 3I4LA 4DIKA 5F4BA 2EC5A 2GPAA 3TMYA 1XKXA 5LDHA 2WFLA 3VZSA 2HCJB 1EVJA 1APBA 4OO3A 1YDEA 4D4LA 2PX2A 5IC5A 2VSOA 1JJVA 5IZ4A 1LNQA 5AICA 4GWGA 1A2QA 3A9RA 3HR8A 1JA1A 4LJ6A 2DHEA 4DJ5X 6GPBA 2O2YA 5IT5A 1Y63A 1A2KC 4Q1VA 2H8GA 1HQDA 2VI5A 1Q0LA 3O3MB 5EUMA 4BNZA 4W99A 1WTCA 2GCNA 2CVFA 3GO4A 1C3EA 1PDOA 3TRJA 1VPVA 2FSGA 3TXXA 4YUYA 5J5AA 4BNJA 2BFNA 5TT0A 2OYRA 2E48A 3W9UA 4L5JA 3B2NA 4U7WA 2P4UA 4AUKA 4DCVA 4DUPA 2ZAGA 1ZC3A 4BVGA 1HEYA 2NUTA 2QG6A 3EMKA 2R8ZA 1OYYA 1MXHA 4I8IA 4M7RA 4J0GA 5KYXA 4WOPA 3ZWDA 2JLVA 3ZXSA 1TQ8A 4CM9A 4C6TA 2ZYAA 4KLZA 5ALRA 4B32A 1Y1RA 3H1FA 3IBYA 3GV0A 1TZBA 3QLVC 1GFSA 4DM7A 1DTSA 1GV1A 1YR2A 2A14A 3F97A 4W1PA 4AYXA 4PG6A 5B2ZA 1GTSA 2J3KA 1NQXA 1RC8A 1E8NA 3DAFA 2V6GA 3DPUA 3CVVA 2WSBA 2PKCA 1Z47A 2E4AA 4ZAFA 3ZE8A 3W5BA 5E6UB 4Z0NA 4TQ9A 2WJGA 3Q40A 1A1VA 4RKRA 4BLSA 2XADA 4G5YA 3W5CA 1P9LA 4G65A 4QELA 4LE2A 3TWOA 4U2DA 4EUSA 2G0TA 2I2AA 2RH5A 2PL9A 2VHTA 3BGVA 3OLWA 4NC9A 5REQA 5JPDA 1PJLA 3GJZA 3H65A 1RW4A 3PQ3A 3EGOA 4BTEA 3UJBA 4HUQA 2PL1A 4UEQA 4YT4A 3RTAA 4GXTA 5F2OA 1G8GA 2UU9B 3UMYA 3OTIA 3MD0A 1WWKA 4Y1EA 5H9VA 3HXKA 5K05A 3E2MA 2VC2B 3MBIA 2C9YA 4MK4A 2ZYUX 4TTJA 4FGSA 5B1IA 4EBFA 2EFYA 1O94C 5DXAA 2ZE6A 4AJ9A 2DP4E 4FFMA 4HDNA 3KB8A 4RVGA 1YV9A 2Q4DA 3DTNA 5DX1A 3UMBA 4G0XA 1COZA 2AG8A 4IG9A 4DBVO 2XCTB 3DLHA 1X6VA 2HWWA 2ZTSA 1DBWA 3EBLA 3PK0A 4TUYB 4U8GA 5EINA 4BNGA 3RC8A 2P3OA 3A2LA 5IJ9A 1N2GA 3QUQA 5COQA 1XMOB 2REBA 3KB1A 3NGMA 3QWAA 3WKCA 4DXDA 1YU6A 5AKXA 5JROA 2B5OA 2Y3IA 1M2VA 3Q6NA 3IB6A 5HZMA 2VUIB 1QMPA 3B60A 3GVCA 1TYZA 3BCUA 4FM9A 3D2CA 3R74A 3NUQA 1T35A 4KFUA 5IVHA 1W1UA 5TVGA 4DNXA 4RM3A 5ESWA 1ZCFA 2RHLA 4KWTA 4M60A 1MJFA 4ZI7B 3L1HA 1Z2PX 2ZRNA 2TMDA 1VB5A 1SVIA 2ZIWB 1Q6YA 1RKQA 4RLHA 4BQIA 3HCFA 4NX2A 3HCCA 4LHVA 4BB0A 2VHXA 4RTPA 1HI9A 3RTGA 3COWA 1DBQA 221PA 2PKQP 1SZCA 2I2WA 3D6VA 2HJGA 3EXFB 3MJEA 4TROA 3ZD8A 4KP7A 2YJTD 2FLWA 3EVEA 3R7NA 3VFDA 3QHAA 2FWJA 2P9EA 1ZONA 2ADMA 3WRYC 3STUA 3D8BA 3U1VA 2E5FA 4GPD1 4NXMB 3IEXA 3CRVA 4OPMA 3R9XA 2QZPA 3ORQA 1H3NA 1JBEA 1TZ2A 1Z2CA 4WXPA 2R8XA 3AQIA 2VJYA 2XGOA 3TM5A 2HYIC 2JGDB 2ILTA 4FUQA 1ZRMA 3CKKA 3E9EA 5ED4A 1GZ7A 2IDJA 4Y8VA 4D02A 1TT5A 1WZNA 5A0TA 1LVHA 4YT5A 4YS6A 4BO3A 2VQEB 3F8SA 3DPIA 3N53A 4HJRA 4J75A 1GTMA 3FDIA 3C3CA 1E6KA 2GCOB 2PX0A 3K92A 1GKUB 3LU1A 4I55B 1XEXA 1ZU4A 3O4JA 4PCUA 5MGNA 4LRWA 1MIOA 3I8SA 4M99A 2FUG6 2V9PA 1NYRA 3M4YA 1AIPA 2K2QB 1EFVA 1MB3A 4FGJA 4HVAA 1OTHA 2C57A 2Q0XA 4CEJB 3WWZA 1RHMA 4INPA 3U7FB 1G3UA 2UVPB 2GS9A 3HA7A 4JCCA 1W7AA 3N05A 3WLFA 3RUEA 3FOWA 2MYPA 2E2WA 3RJTA 1X7YB 2P3SA 5B2EA 2FY8A 1ST3A 1QHIA 1U8AA 4FXPA 4MR8B 3WRVA 1UZNA 3LY5A 4KMSA 4BE7B 3AIOA 4DM3A 5ALPA 3PQ2A 3U3KA 4HL6A 2AG0A 4CETA 3K0FB 1XIVA 2XMSA 1SIWA 1WZCA 2V3CC 1R10A 3AERA 2JGMA 3DYIA 4Q3CA 3R75A 2ZB8A 2O8CB 2WU1A 1I01A 3DTYA 3FTDA 4RHEA 3K0AA 2BRUA 2BL4A 4YVFA 4BX8A 2R1TA 3LUKA 3IMFA 4H2DA 4NFSA 3X1YA 2H3EA 4J2TA 4LVUA 4R2MA 2R84A 5J2TA 1OLOA 5CXUA 2GCGA 3EQ2A 2ZG6A 1UC5B 4DMLA 1AO3A 2ZW9A 1QF6A 3DKRA 4OK3A 4KEAA 2JIRA 2ZRGA 2IKQA 3EWSA 3HU1A 3HLKA 2YJGA 4OKNA 1UXKA 4IRXA 2QMQA 1TM1E 2D62A 5BSFA 4ZOBA 1ZL2A 2ZUUA 3STVA 3EZ9A 3HRHA 3S4YA 4N7MA 3F1KA 1ULSA 1QZXA 3C3AA 4A8JA 4NJEA 1G20E 1SB9A 1SUPA 2PWBA 5ITVA 1SULA 3SIXA 3QF7A 4H7JA 5KQRA 1NA5A 4NMMA 1N92A 1Q7CA 5C4IA 2PLAA 3DDWA 2JFHA 3A6KA 3F8TA 4HWOA 1CF2O 3ILVA 5K6AA 1W88A 4Q34A 1GPH1 1IJBA 1E1MA 5EZYA 3IEVA 2NXCA 5DJ5A 1RIIA 1Y1KE 5E7MA 5KJ1A 4LF5B 1LV7A 5D7BA 4YDRA 4I2VA 5AM0A 4DM4A 2VWHA 2G09A 1FYEA 1QONA 2P2YA 3DNMA 5F23A 4C7OA 4F71A 4B6JA 3A36A 3JZMA 3RYIB 1GPJA 3ORYA 4UNRA 2DWCA 3Q41A 2V5AA 3TZHA 3ENWA 2XLCA 4CN8A 1PAUA 3BZUA 4C87A 1DAMA 1LRKA 3L41A 2I6GA 2PFGA 1Q3TA 1TZJA 1JEEA 4II2A 5FA8A 5K2OA 2GBLA 1ADCA 3FMFA 1SCJA 3QUSA 3LQ1A 3SDBA 1G6OA 3GUYA 3CV3A 2DFVA 1P1KA 1U0FA 5E8RA 5EAIA 2WTMA 3HV0A 4QTZA 2P3LA 3IRUA 3C4JA 5I45A 3ZCTA 2JJ1A 4F0JA 4W5QA 1Z4MA 5CFPA 5EIWA 4EAAA 1ULHA 2I3GA 3DLPX 5JVDF 4PIPA 5DEOA 3WLAA 2BV3A 4XWYA 4ZDKA 1QBKC 3VNQA 1TMOA 4ZZ2A 4XR9A 4V1CI 2YY6A 5GM2A 2W2TA 2GPSA 1TQDA 3BXFA 4HGOA 3OTOB 1NV9A 2YFHA 5CNKA 4BZQA 3CNBA 2HJHA 3PGMA 4C4YA 3K5WA 4DQ0A 2A33A 4ZPJA 2YHSA 3A6DA 1M34A 2GHRA 1GPAA 1U7OA 3RUIA 5LOVA 1QP4A 4NCBA 2NVWA 1JXQA 3M8KA 4BWYA 3FUTA 4YI3A 5IW8A 5LOVF 3FPSA 1C3LA 1H69A 2YJ4A 5JCJD 3ZY4A 1AK9A 2OZKA 2R44A 3O38A 4CIDA 4E13A 3OFND 3PLNA 4MQLA 2EBHX 3ZHBA 1SUIA 2WNHA 1ZLXA 5KJCA 1IM5A 2X9GA 3F67A 1W88B 4GBMA 1TYEB 3EGDB 4LMBA 5DT2A 2IWRA 1VHLA 1Y9DA 2WKPA 3KPJA 4RBNA 3TECE 4UM5A 1FZQA 4RIIA 1EVEA 2KMLA 3PDIB 4EIWA 3EYAA 5FQOA 3BFPA 4R2LA 2R86A 4K1LA 1JV2B 2FE1A 3IVMA 5EQDA 3P9QA 4RD0A 1YDGA 2DF8A 1MMFB 3C8UA 4KE8A 1SNYA 3IXLA 3VOBA 3IEPA 3IKVA 4C7MA 1FQWA 3NBZC 2CN1A 1DQZA 4IEEA 1QIEA 4BNTA 3UH0A 1D6NA 4C20A 4ESHA 3F5SA 2PFSA 3IT0A 2O3UA 2J41A 4QFDA 1ZNYA 4PAOA 4J0IA 4RS4A 3LYHA 4XUCA 2HMWA 1NN1A 2WM2A 4GXRA 2P6RA 3T35A 2JB9A 3TJZA 3KAJA 1UK7A 3NEYA 3WYNA 4EEZA 1I7LA 1QH9A 3QNMA 3EVFA 1HNNA 2J3HA 4TLLB 3PUXA 4JB2A 2ACKA 4YJ3B 2PIAA 3V42A 4GZ6A 4OLFA 3PQFA 3W6NA 2BR3A 1QH0A 4LPKA 5IF9A 3R09A 5F7XA 3N2YA 4MDEA 1UBJS 3IIMA 1WAMA 2I66A 2B37A 2BJVA 3OZEA 4F6LA 4ML3A 3CJTA 5M29A 1K75A 1NVVQ 1WTAA 1G5RA 2IGBA 3BSYA 3ZI4A 4U02A 1YB6A 3W3ZB 4G24A 1QO9A 2EFDB 2Q99A 1L3CA 3VPBA 4W6QA 2FR8C 4BZWA 2EU8A 1CVIA 3U0VA 1VYTA 4AVYA 4B3CA 1WB5A 4GDMA 3TDNA 1QK4A 4J0FA 1KYWA 1QBGA 4A92A 1EUYA 1HLGA 1S02A 3ETHA 9GPBA 2ZI4A 2WG1A 4RHTA 4HNVA 3TQFA 1TQHA 5AVSA 4RH0A 1U0GA 2GBPA 3KQHA 1R12A 3K9LA 4QGSA 1D2HA 3OX2A 2IYNA 8ABPA 1EUCB 3BILA 4HYQA 5B7QA 2CSXA 1DEKA 2J0UB 1L6RA 1G41A 4ZCQA 4KZPA 4URVR 3MUOA 2J6BA 4NFHA 2IE8A 3BK2A 4H18A 1BX0A 4A7PA 3M0EA 4A8TA 1IBLB 4KIJA 1WY7A 5A9SB 2VAXA 1J70A 3H6GA 1ZI9A 4OHYA 4GH5A 3KXPA 3GCWA 4YXFA 1QRTA 4CLXA 2PYIA 3ZXUB 1Q1BA 4KGVA 4MJ7A 2IUFA 4MEJA 4Z7QB 2O7QA 5AVXA 4AS2A 1BIFA 2FMHA 1KI1A 3NETA 1RP1A 4LBWA 5REQB 2BYTA 4INAA 3GJ6A 4Z9XA 1PZEA 4MV7A 3OQOA 1XPOA 2AOTA 5EZ5A 1Z83A 1KJJA 1T0BA 1US8A 2O3TA 3B1ZA 4HQLA 3V1YA 3VHQA 4C5BA 1YS2X 2C7QA 1IIRA 2AZTA 1PBTA 1VCHA 1AB5A 2VL7A 3FFAA 4KW7A 1CR4A 3PSAA 2E1RA 4QUDA 5JY6A 1JVNA 1WU7A 3M4NA 3PF9A 1FVOA 4H1UA 4YP5A 4KACA 4US1R 4E5PA 3W6ZA 1JYFA 4XYLA 5L4NA 1CUIA 3FNFA 1VSTA 3DAPA 2ESRA 4OHWA 3SZ3A 4EY3A 1NUUA 4PPNA 3K9HA 3CNNA 1SVSA 4UMEA 1M2JA 2Q3EA 3WJ1A 1ONNA 2YBEA 4UMVA 4UHBA 4C6HA 5JQWA 4N03A 5H8WA 2V7VA 4HGQA 3DFMA 3FROA 5HJ2A 1PT9A 1M76A 1ABEA 4PPYA 2A30A 1PI3A 3B53X 5I51A 1OV4A 3RE1A 1E59A 1JEQA 5EZQA 4AQDA 3RTDA 1DINA 2ICAA 3DCYA 3H04A 1XA3A 4JOSA 2ZUFA 3ANMA 1FMJA 2EZ8A 4IOMA 1HE5A 2P90A 4RJLA 5JAIA 5KSPA 2GSDA 2P0EA 3DEYX 2WKRA 2WABA 4OQPA 4B6RA 4D9HA 3WHPA 1KH1A 2TRSB 3MGAA 3KE9A 2JH9A 3UJDA 1F7UA 4JP5A 4JUBA 4EL5A 2IXBA 3QBEA 3PVSA 2P7HA 1J8DA 5D1HA 1H2YA 3L5OA 5JXGA 5TR9A 3JY6A 3MRXA 4HDOB 2FWAA 3KQSA 4WX2B 5KWJA 1G66A 4EB0A 1SKQA 1YZFA 3HCAA 3N2LA 1PNOA 4W1SA 5TY0A 3SICE 3T3NA 1B23P 3G89A 3DDNA 3GLFE 1G20A 4C6SA 3OFVA 1MENA 3FYTA 1UFQA 4CYMA 5JNWA 3D4PA 3BWBA 1LBIA 5C4GB 3IXQA 3PFBA 4LN1A 2JCYA 2PMEA 1GNSA 1MXFA 4D9IA 3SYNA 1KAQA 1ZSYA 4Z0TA 3ZCUA 5HKKA 4TVKA 4O1MA 2OD7A 3GLHE 4JLBA 1E9CA 4FYIA 3UBMA 1F0PA 2ZUCA 3JS5A 4A73A 1ZICA 3F8WA 1OXTA 3C5EA 3M3HA 1BCSB 1GTZA 3BB4A 1OVGA 4OKIA 5DH9A 4RY2A 3FOZA 1H8HA 3KLNA 2YYYA 1U7XA 5ALFA 3DVAA 4HQKA 3NXKA 3KPYA 2QUIA 4B8ZA 5EHZA 2UZIR 3QVGB 2W22A 1VXRA 2Z2XA 5EESA 3V7FA 1FA9A 3IJEB 5JSYA 4KTVE 1NW8A 3SMVA 3W90A 1XZHA 1XJQA 2X5NA 3D3WB 3D4OA 5AYVA 5JE8A 3PPIA 4MHOA 3FSGD 1DIAA 4IRMA 4G07A 4KWEA 3SX0A 5AM3A 1YA8A 1P7PA 1UEIA 3TS1A 3QPBA 5CDGA 2J5RA 1BQEA 1QFYA 5L53A 2G80A 3AJRA 3K09A 5H3HA 2L2QA 2PU7A 2JJ2D 3KR0A 2CVZA 1FTNA 1JQBA 4ZT3A 3D4LA 5B1HA 1C7QA 3SS8A 5KNBD 4K3UA 3ZOKA 6NULA 2IUSA 2A0KA 4IYRA 4N3NA 1FDOA 3ND6A 3N0TA 3CNQS 3IOMA 2RGRA 3OKFA 2WAYA 1T2VA 1ZYUA 2LKDA 4TTPA 4ALIA 4TZ0A 4PRYA 3NMUF 4XLLA 5LA6A 4N0MA 5H82A 1RYMA 2ZJ3A 4AJIA 5BSHA 3KM0A 5LXTA 2D54A 1VGQA 1U1EA 4GVXA 1I5RA 1Z3CA 5A9SA 1BJTA 2JGKA 1IEQA 2WICA 5AIBA 4KC0A 2G06A 1EZ4A 4HBZA 4W9RA 9ATCA 4ZIRA 4L2IA 1THGA 4HV4A 2ZBRA 4HLDA 3RYFA 1E8DA 1XZPA 5AOAA 2HMSA 5IT0A 2GETA 3FZEA 4BL5A 4UBMA 1ILWA 1WKBA 4QJ4A 4LI3X 5A1TA 4CKEB 4NU8X 3SHQA 2J0EA 3GBPA 4Q7MB 2A1TS 3KKEA 4C14A 5DNWA 2MR6A 1D4AA 1XFDA 5KYKA 4KSYA 4YV0A 3DTTA 1F2TB 2W8BB 2HCFA 1JF8A 1QE3A 4NJEB 1G6HA 3X1KA 5DTIA 3KD3A 2B6NA 3WTBA 3AR8A 3PXEA 2WF9A 3GFQA 3DT6A 2XNKA 2FGKA 3MJDA 4A10A 5LP6F 1FS4A 3GZNB 1Z5NA 2P9QA 4YO7A 2XGMA 3HTXA 4FHEA 2PH3A 2QN6A 4KB5A 4F8JA 3CUKA 3R9XB 2O3SA 1ADBA 1GR0A 3N8GA 1UKCA 4KLCA 4MI6A 5TJ9A 5KNBA 4U00A 2C77A 3N75A 1DS6A 1XZDA 1VBFA 5F3RA 4BOYA 2X86A 5J5VA 1ZOPA 5C53B 2W6MA 3HSSA 3ZWYA 3UWSA 4JSRA 1Z4OA 1RI1A 3JWEA 4RMNA 4TT3D 3V2UA 1NUSA 4M83A 4UBIA 3AC0A 4DABA 1N0UA 1XTVA 1P1CA 3D1LA 4BLPA 2PRZA 2Q5HA 2PXHA 3WA6A 3HG7A 2YXBA 4XRRA 4W5JA 5JH7F 4S2EA 1US8B 1JJ7A 1FDSA 5ADVA 3GFTA 1E7MA 1E2UA 2HU2A 3HKBB 5CFLA 2OZEA 3IAS6 1SBCA 2YMPA 1VG1A 4GP7A 4OL9A 1G63A 3CEAA 3L4BC 1RPTA 3ROGA 4V1CB 4LRQA 3ZDQA 3SYLA 3TGWA 4FXOA 4N7JA 2IA5A 2H9IA 3WISA 4DQVA 4JI7B 3PUIA 3V00A 4D41A 3EVAA 4ZMRA 3LPLA 3OCCA 3I6MA 1DC5A 3PIIA 3VSAA 5FHQA 4LRTB 2B2CA 2GPYA 3BX1A 1CERA 2A57A 2I4LA 2P77A 2GEVA 2XCLA 2GTHA 3AP2A 2WG0A 2PZBA 4W6ZA 4EB6B 4CIBA 2JGRA 3OT4A 2RI1A 1NLYA 1FLDA 3IEKA 1EUCA 3KZXA 4FYJA 5BV0A 4Q9HA 2VNHA 4WASA 4ZWNA 4F21A 1WABA 3OM9A 3DMTA 4QJ3A 1KETA 1Z18A 2RI6A 5HIKA 5JLJA 1I7QB 1V5WA 1K3TA 1FUEA 2FFJA 2QMEA 3C8ZA 3LGSA 4CBVA 4CLHA 4MW2A 3MB5A 3K6JA 2NYUA 1TEXA 1ML4A 3DAHA 1NLZA 2BKXA 2I1VB 3IJRA 2WK1A 3KQYA 3CBQA 4PTZA 1LSSA 3K72B 5LB2A 5SZKB 5DCWA 2XITA 3I37X 3VR3A 5JEEA 3HJFA 5JSHA 3RVKA 4BRZA 4DSAA 3CLTD 2QSJA 3MUNA 3QY0A 4YK7A 1I1OA 2JRLA 1I3CA 2X77A 4DNPA 4DDWA 5EJ6A 3HJGA 4Q15A 2C9MA 2NU8B 3U49A 2CL6X 3LK7A 4RF3A 4ZVQA 4AS1A 2O7NA 4KKVA 2EHDA 4RESA 3PNKA 1ZGAA 4F4JA 2A0XA 1A8IA 5I7EA 2V1XA 1QYRA 1JXOA 4PZEA 3LA8A 2E7ZA 3WGHA 1KEUA 1FBNA 2AUTA 3KU4A 4CM6A 5CYPA 4DCNA 5CX4A 1CDZA 3WK4A 5DN6D 3MINB 3TSWA 1I32A 3W9YA 1QV9A 5ALWA 3WYGA 4BLVA 2W2NA 3A9VA 5IJXA 3RVOA 4QQKA 2QVGA 3O7MA 4R1NA 4H4EA 4LTNA 1IK4A 3B7PA 1TK9A 4FMDF 4CLEA 3TW6A 4B3IA 2QP4A 5HRAA 4PGHA 1V8ZA 2H2FA 1ZK4A 3RKRA 2ZYSA 2YMQA 4MARA 5F5LA 2AMYA 1EX6A 2WJZB 1C2YA 1V5GA 1GU1A 3ZZUA 2CJYA 4Y98A 2DFDA 4AIRA 2O0KA 3I09A 3DV0B 1G3MA 3G2OA 1Y1QA 4NYMR 4Q4HB 5LLDA 2XVXA 3KFVA 2IYOA 4Y67A 1ZH8A 2AT1A 5JAHA 5JMOA 1AS2A 2PX6A 2VQFB 5CB4F 1Y6GA 3HWWA 5IM5A 4MQ4A 3VMFA 4UVGA 4G9GA 1PR1A 3JD4A 3NXSA 4FE7A 2O3QA 3QKRB 1ORIA 1QAOA 4J43A 2BLNA 4RD1A 4AW9A 3TM4A 2CEAA 4X62B 5CTAA 1PSZA 2GNOA 4XQ9A 5IARA 5DBIA 1VL5A 2EIHA 3QM1A 1QQAA 1KDYA 2H1OA 3PFIA 1SKBA 4MVWA 1MDFA 3DO8A 3TJRA 2YV5A 4L08A 4NECA 3CG0A 1PQ4A 2FFRA 2ZITA 1ZIYA 3QBVA 3QMVA 2A59A 4NAHA 5FUVA 4D3XA 4HB0A 5KYWA 3TIFA 4BFUA 3UMMA 2IBTA 5IRCD 2E18A 5BW5A 1Z2OX 3LL4A 3KVYA 4PC1A 2Y6VA 2YJZA 1RRMA 2BELA 4Q19A 4BMYA 4G4IA 4JBYA 1Y8RA 5GAJA 4EVIA 1OBFO 1HT0A 2YCLA 3ESXA 2A9FA 2F3TA 3ESYA 1U1CA 2HJRA 3KV3O 4ESEA 4FFWA 4ZV4A 2EJTA 1B93A 2DWQA 1IHDA 1A5TA 3KKQA 1GIAA 5CK4A 4Z4IA 4BIIA 4D4GA 1WLSA 4RIGA 1K2VN 1PL7A 1SJ9A 5SYNA 2AQIA 2G72A 3T38A 4B8YA 5JAMA 3FTNA 4YGXB 4MW9A 5FIUA 4EI2A 4G9EA 4MLZA 1GL7A 3SHOA 4BFWA 1HNXB 3H5VA 4S2UA 3ZY5A 1KP3A 3IA7A 1MAUA 1UH5A 3AG5A 3G0DA 5DM2A 3EPPA 4PZDA 3R7DA 5I3ZA 5IJ0A 5E1DA 1H1LA 1LUAA 1NRWA 1QFMA 2NZJA 1IPFA 2PRIA 3T3MB 3WGVA 4IV8A 1WZ2A 3D6NB 1Z56C 5BO5A 3VYRB 1K5GA 1ZU5A 3CRRA 5SY4A 2QEQA 4E15A 1OKKD 1E2BA 1A95A 4EJSA 1LWOA 2G1UA 3RHSA 4Z3DA 1W36B 1KK3A 4PZUA 4XH9B 4DUGA 1GQ2A 2XIJA 3A32A 1USWA 4BDTA 1Z4KA 1AKEA 3V1KA 4I36A 2D5IA 2IV3A 3BGSA 2ZXFA 1G8FA 2AFIE 2K7ZA 2P78A 2XQKA 4HN9A 4TLMB 4EF6A 5KYGA 4N01A 4CKYA 4GRAA 4FK8A 3OZBA 1E5XA 3LQRA 3M4XA 3NIDB 1T13A 3TLJA 3WLHA 1ZR4A 3PUHA 2R5FA 4EG3A 4UBNA 3FMGA 3NV9A 1TUEA 4N0DA 3GLFB 4OXRA 1EK5A 2VTDA 2BHTA 5EJIA 4D4MA 4MDYA 3P0HA 1C7FA 4PYRA 3BH0A 5EI5A 3BJEA 1DDOA 3RVJA 4ARZB 2UYCA 2K6GA 5HGXA 2I2BA 4MLDA 1J8YF 4QFBA 1ZD9A 4PLZA 4W8HA 5K2MA 2O2EA 3KSUA 4C76A 5JBQA 2FFBA 1PJCA 3JQDA 4QDTA 1AUXA 1VC2A 1IMOA 2QMUA 4MYTA 4R1MA 5ALIA 5IDQA 1TK3A 1RYFA 4J1SA 4M0LA 1CQIB 3CURA 4M6WA 4N7BA 1T9DA 4L3VA 1YC2A 5EXPA 1RWXA 4ND3A 3M83A 4YRDA 2QIOA 3PGVA 5ERXA 4CGZA 3BQ9A 1Q7TA 2B92A 2HDWA 2HSJA 3M9XA 5AXBA 5JXIA 1FDIA 1IK6A 1GFZA 1XJWA 2WPNA 4N9QA 2OY0A 1DU4A 3R0ZA 4UUQA 4QHSA 4F1WA 1LQ2A 3PDHA 2OBBA 3LIIA 4ZREA 1F8YA 4KWCA 5DI9A 5HF5A 1LF0A 5MFPA 3MT0A 4C7VA 5G4KB 4LYAA 1FDWA 2ISQA 2AJ8A 1J07A 1XXLA 5DNUA 2IYEA 4KLNA 4UPDA 1J7JA 3NHAA 1XUOA 2PG3A 3PX7A 4O2BB 1SQ5A 2XLBA 3IP9A 4NMHA 2CVQA 1MG0A 2WAMA 2Z98A 3GN1A 3IB3A 5A71A 2EWVA 3UNXA 2FZVA 2OXTA 2AZXA 4GBGA 1YE3A 2DSTA 5LP6C 2DQKA 4OX9Y 1J2YA 4XCXA 4PWZA 2ATXA 1SY7A 2H85A 3FDXA 3DEAA 4ZRMA 3OIUA 1H9BA 4HAYA 5AOBA 3DHVA 3FGZA 4LGCA 4Q3NA 3UAZA 1SN7A 1A8UA 4LPSA 3FW1A 4ZYUA 4JQOA 1BQ3A 3FBWA 4LHEA 4HDKA 3JQAA 3BGIA 2ZPTX 4OMDA 3TSAA 4NNJA 1HDOA 3TVDA 1UJNA 3V7NA 4KQEA 3H2HA 2VQ6A 2XR1A 3NB0A 2VJBA 1GADO 1XZIA 3MINA 5AM5A 3SJ7A 4EJMA 1IC6A 1PF7E 5DFAA 5I9IA 3LHIA 1BFDA 2CXXA 4RSHA 1ABBA 3QZUA 3ZLUA 3I72A 4WLOA 1UOPA 1URPA 3C1AA 1S2LA 4MCAA 4DQLA 3OP1A 1N1EA 2DBYA 2DE0X 3GLSA 5EUBA 5LQSA 4OAQA 4ARUA 1ZM4A 1UDWA 3IVCA 4D43A 2HO4A 4YJHB 4BRUA 1XZMA 3HM9A 2ARKA 3KDSE 3IQGX 4IZOA 3V8RA 4ACBA 2H5IA 4BX2A 1QP8A 2RGBA 4M0EA 4FGUA 4LBZA 4MO2A 1CB0A 1KI7A 1II9A 2Y1OA 1SXJB 4ZCLA 5BNFA 3LBIA 4UNNA 4DNQA 5BP7A 2OCPA 5FOTA 1M2VB 2V7GA 2G67A 1CIVA 4Y6OA 4FIDA 2I4TA 1JBQA 1FFBA 1EGAA 2XSZD 3E9QA 2A8YA 4D9NA 4H7PA 3QVSA 5L3QB 1JQ3A 3C5HA 3AW8A 4ND4A 1CPYA 3RSSA 1J33A 4J7AA 1MGOA 5D00A 1L5KA 4BEVA 4OREX 4TSFA 5EE0A 3RADC 3UUWA 4R6WA 4P33A 5CM9C 3MJSA 4A5OA 4I50F 5K8JB 1SZDA 1YB1A 5MDHA 4Y7DA 5AD1A 2D8MA 5CDSA 1EHYA 4MTLA 3EVCA 3VR3D 1T9ZA 1ULBA 2XJ9A 5FTWA 1OA1A 4BGUA 2ZBDA 2VSQA 3ZTYA 2A0UA 1VBMA 2HQRA 3LX4A 4E2FA 3STXA 1DADA 2W6JA 4XE5A 3IRVA 4RA6B 4G0ZA 3RYIA 3LYLA 3I04A 1IAVA 2X9NA 1LD3A 1HDEA 1JYSA 1O8BA 3S44A 2IHTA 3VKWA 3VZPA 4EKIA 4HAVA 3M1AA 1KPHA 3C8DA 2IEZA 4LZJA 2B0JA 1GSOA 3L1IA 5T4FA 2HNKA 3FF4A 5BN3B 1RCUA 1XRPA 3ED1A 5JWHA 1HGXA 2GD0A 4O02B 1YFLA 2Q45A 4B35A 3HJBA 1VDMA 2OO5C 1L4UA 3G0BA 4PAGA 4ECAA 2X5KO 4XI9A 2VCEA 1NV8A 5KQPA 4JLKA 1RC1A 4YJ2A 3N9IA 2PSHA 4D79A 1XAGA 3AT1A 2BEWB 5J5CA 4QSHA 2X15A 4PRZA 3CW8X 2O06A 3ILXA 4RADA 4CL8A 2FE4A 2YMMA 1WB6A 2RCYA 2XUGA 3AHCA 4Z7JA 4NJMB 2ZJOA 2HGZA 3NHKA 4WUVA 4NH4A 2A1UA 3PUKA 4PIMA 3W6OA 3OQHA 3ZHUA 4DMMA 2UVPA 4TLEA 5EUCA 1NW7A 2FEMA 4FDAA 1G8AA 2FZCA 4LXXA 5AKHA 1Z0ZA 2QUHA 4DYVA 5JS6A 2CL7X 2N42A 4YAIA 5CLFA 4RK5A 3DO5A 4QZVA 2DQSA 2A9OA 4MWDA 4FR5A 2I54A 4X7BA 2UVDA 1W87A 3ONFA 1MO6A 2CHFA 2RHWA 4B43A 4H15A 3LUHA 5EUQB 2YN0A 1IOWA 2QE6A 3HMKA 3KSAC 2O52A 3DBLB 1DXYA 2PUCA 3F47A 1EHIA 2IPAB 3A58B 3EXG2 1W5TA 3T3IA 1M1ZA 4OF4A 1RSZA 4OQDA 2W7TA 1IHXA 1A9QA 1WNTA 3OF5A 5FBRB 4E2ZA 2P6UA 4ROSA 3MIZA 4GD3Q 4XLTA 5IC4A 4KQ1A 2P4QA 5D6OA 2WE7A 1QYCA 1LK5A 1JH9A 1R18A 4E51A 1AD2A 1Y5LA 5EHXA 3HDGA 3BB3A 1KHTA 1NUPA 4Y3UA 3UENA 2P2GA 1M2EA 3WMRA 2Q21A 1KFCB 1QR2A 2WP8J 4UQPA 3LDHA 2IP1A 3C6QA 3ZW8A 4RFSB 2WSSA 3LQFA 1BROA 1TVKA 2YWEA 4JNKA 4LG1A 5C37A 2HR1A 4PZAA 5GPBA 1JPJA 3G2MA 2Q27A 4J1TC 2QT0A 4XVRA 4LUCA 1YE8A 1N8KA 3TX6A 2EBUA 4D3YA 3L2OB 4V0MA 3DWGA 3R7BA 5GQSA 3I30X 3BXXA 2FWIA 2W9XA 4FNAA 1ITZA 4TRNA 2VHYA 3AH8A 3GJ3A 3NBYC 3MJFA 4WBNF 2YKGA 4G0WA 2QU7A 1O87A 5DBOA 1KS2A 3I5MA 4GLBA 5EGSA 2P9ZA 1LBEA 3RIYA 4BP1A 2I4NA 1LSUA 3HXMA 3O9MA 2H31A 2VPTA 3HJNA 2WFZA 1ZM9A 4PLFA 2CV1A 4P80A 2H7XA 4Y6GB 3PQ4A 2JLWA 5F7ZA 5KKNB 1UF9A 1HDRA