3EGOA

Crystal structure of probable 2-dehydropantoate 2-reductase pane from bacillus subtilis
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
292
structure length
292
Chain Sequence
SLKIGIIGGGSVGLLCAYYLSLYHDVTVVTRRQEQAAAIQSEGIRLYKGGEEFRADCSADTSINSDFDLLVVTVKQHQLQSVFSSLERIGKTNILFLQNGMGHIHDLKDWHVGHSIYVGIVEHGAVRKSDTAVDHTGLGAIKWSAFDDAEPDRLNILFQHNHSDFPIYYETDWYRLLTGKLIVNACINPLTALLQVKNGELLTTPAYLAFMKLVFQEACRILKLENEEKAWERVQAVCGQTKENRSSMLVDVIGGRQTEADAIIGYLLKEASLQGLDAVHLEFLYGSIKALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 2-dehydropantoate 2-reductase
publication title Crystal structure of Probable 2-dehydropantoate 2-reductase panE from Bacillus Subtilis
rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 102
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 1.1.1.169: 2-dehydropantoate 2-reductase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02558 ApbA Ketopantoate reductase PanE/ApbA
A PF08546 ApbA_C Ketopantoate reductase PanE/ApbA C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3egoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3egoA01
3W4IA 1X7DA 2F00A 3GMDA 2WEKA 1U9JA 4GH5A 1FMCA 4LK3A 3DBHB 1T24A 1JW9B 1W4ZA 2GRAA 3FTNA 3IOYA 3BIOA 1JVBA 3Q9NA 4NFSA 1J49A 1WNTA 2Q1WA 5TLSA 4BMVA 3KV3O 3FNEA 4CUZA 1NR7A 3PLNA 4CM5A 2XAAA 3D4NA 1ZIDA 3I9NA 1WPQA 3IMFA 3M2TA 4QFCA 5I9MA 3QQPA 2UV8A 1XR3A 1LU9A 2Q4BA 3MCVA 4DLAA 3QA9A 4NK5A 4TKMA 5T64A 1YQXA 1RYEA 3W8FA 1SAYA 4BGEA 3QHAA 2YHIB 3G3EA 5G4LA 4ZD6A 3WFIA 3Q11A 2FR0A 3PXXA 4NNJA 3GVIA 2VTDA 3S2FA 3ANNA 5L95A 1F0YA 4R3NA 4JK3A 4JGBA 1UZMA 4RPKA 1PL7A 5GZ3A 2W90A 1F8FA 4AJ2A 4W82A 2DBVO 4Y6RA 2Y67A 1ZK4A 1SBYA 2ZQYA 4D3FA 1KEVA 3S2IA 3U9LA 4L9RA 3HN2A 3IKVA 2OBNA 2X5KO 3W1VA 2PNFA 4BO1A 2WTBA 1KS9A 2PH5A 1PZGA 5CPFA 1U8FO 3OECA 4B7UA 2EJWA 2EW2A 2P2SA 4YAKA 4H15A 4BKRA 3LQFA 4HFJA 5TRTA 4YYZA 3DMYA 5TT0A 1Q7GA 3AI2A 5T67A 4BGIA 4CMCA 1OC4A 1GTMA 5COQA 5BNFA 2NVUA 2VRBA 2F1KA 1NQAO 1O9BA 2P68A 2VOEA 3IP1A 3TOXA 4DXHA 2UDPA 3I83A 5JMWA 6ADHA 1YXMA 1IPEA 3C1TA 3TNLA 4RF2A 1XQ1A 4CPDA 4DIOA 1WLYA 4CLOA 3PRJA 1J4AA 4N5LA 1FDSA 1GL3A 1Z75A 1QG6A 5EESA 1WVGA 1PJSA 3ICPA 1PIWA 4XQCA 3T7CA 3O4RA 2HJSA 1NFQA 4IIUA 2VRCA 4E5YA 2RIRA 3EVTA 4CLRA 4D45A 4Y98A 1FDTA 1E1MA 1QYVA 4U0KA 2VNAA 3WR5A 3GFGA 2J8ZA 5EQDA 1DEHA 4PLPA 3F9IA 5EIOA 1ZXLA 5TNXA 4DC1A 5CEJA 1DHRA 4IINA 5BT9A 5BSEA 3DHEA 3WWZA 4GX5A 5FWNA 2AQIA 5DOVA 2X0NA 4DQXA 1K5HA 1NAIA 4JQCA 2W4QA 4BO6A 3GMSA 2JL1A 3C7CB 4J7UA 1TVEA 1E3EA 3GDOA 2J5QA 4NU6A 4RQTA 5JY1A 4NBWA 4XA8A 4XGIA 4WCDA 4NPCA 3ZNQA 4DBVO 1O95A 4FFNA 4HUJA 4W7IA 1V9LA 4BO3A 5I7VA 3DAPA 3WFJA 1GPJA 1C0LA 4NDNE 5KCZA 1ZKMA 4AJOA 2Y1GA 1MFZA 1BMDA 2CVOA 4B4OA 1X14A 5T8KA 3AW9A 2EERA 4WUVA 4CR6A 4E2WA 2C2XA 4D3SA 1HDYA 3PFWO 3LT2A 1WZIA 1GPDG 1ZXBA 3RUCA 1NP3A 3D1LA 3RWBA 4HWKA 4AJLA 4BO2A 4IDDA 3Q9UA 3RUHA 1LDYA 1SCUA 2CVZA 3ZWXA 3RBXA 3A06A 3GVPA 5T57A 1NQ5A 3TL3A 2QIOA 2NACA 1GD1O 3PHIA 4YWJA 4BKUA 2FPPA 3LSYA 3NT4A 4BQPA 1F12A 1N1EA 4BO5A 4DC0A 1GEGA 5CDTA 5C7OO 4MP6A 5GZ1A 3OF2A 4QEDA 1KEPA 4CM4A 1YL7A 4O59O 4GI2A 1PJQA 3AFNA 3SC4A 4XJTA 4IGEA 1MC5A 2ZYGA 5JS6A 1H9BA 3ZWYA 4IDCA 4MIOA 3WGTA 1ONOA 5B4TA 2DUUA 2Q1UA 4CLRB 2VOJA 4NR0A 2QX7A 1E1KA 1FDVA 2JD0A 2WDZA 1Q0HA 2VT2A 3VPFA 1ML3A 1KEUA 4H3VA 4KTTE 3HWRA 2CFCA 1PJ4A 2Z1NA 1C1XA 1ZNQO 2VHYA 1R37A 4BGUA 1AN9A 4I5EA 4UEKA 1GU7A 2GN6A 3ETEA 2IEBA 1EVIA 4CM1A 2A35A 2ZTMA 1EFKA 5IN5A 5JC8A 4PLZA 2E4AA 4KDFA 4WNIA 5DP2A 1NWCA 3GGGA 2EGHA 2FR1A 2VHXA 3WQQA 4B79A 1BWSA 5KKAA 3QWHA 1IL0A 1VRWA 3OA2A 4OKIA 1ZH8A 3W6ZA 3TQHA 3DMTC 3ENKA 4OMUA 5JYEA 1L7DA 4J9VA 2UUPA 4LCEA 4AJIA 3OJLA 3NT5A 2GASA 4CODB 2PGJA 1UP4A 3BHJA 2GZ1A 2Y0DA 5DBGA 1U3WA 3E1KA 3QSGA 3MJCA 1SC6A 4A0SA 3DTTA 1UJMA 3RKUA 3U4DA 4CV0A 3FBGA 5ER6A 3QWBA 3WQRA 1G0OA 1KVQA 3DBLA 2HMTA 3HSKA 3FWZA 1PWZA 4PG8A 3L6DA 1N9GA 2EIHA 3GEDA 1ID1A 5JPIA 1KY4A 4LRTB 5ITWA 1ADFA 4NBUA 1NX6A 1VI2A 1GYQA 3WS7A 1X7HA 2YZ7A 5I9LA 1UZNA 1TA4A 4XYGA 4IGFA 1R4MA 4PIVA 2BFPA 1UXGA 4QQRA 4Q3NA 4MJLA 4XQ9A 1VPDA 4IJUA 4Q3EA 4MIEA 3GT0A 3L6OO 3E8XA 5DDIP 3WGOA 4E3ZA 3L6EA 1UP7A 2PTGA 2CUKA 4TRMA 5G0UA 3CEAA 4QO8A 1HZJA 4L4SA 4PLFA 5FYDA 3JYOA 4Y67A 3OHSX 1HYGA 3FTPA 3V2GA 3B1JA 3LYLA 4X54A 4I5GA 3U09A 1NVMB 4A73A 5HBRA 4DGSA 3CINA 3WXBA 3SJUA 4M8SA 5U4QA 3GNSA 2FHSA 2YV1A 4YAJA 2EP7A 1FF9A 3IAHA 1BVRA 2PKQP 4A26A 4RV9A 4R1UA 4IDAA 1P3DA 1EBFA 1HTBA 4Z0PA 1VL8A 2B36A 2VT3A 4UVIA 4YPOA 4XD2A 3D4OA 1C1DA 2ZCVA 4DPKA 3O03A 4DL9A 1GCOA 3GN1A 3NKLA 4KUGA 2WYVA 1C0KA 1ENYA 5G0VA 1HDZA 2CDBA 2X58A 2GR9A 4YRAA 5A5FA 2PZKA 3PPIA 1VE9A 2YW9A 1U2GA 4D0SA 4UUNA 3K96A 4K26A 5HS4A 3ROPA 4PFJA 4IXWA 1QYWA 3BMCA 2YHUA 3KHUA 1JWBB 1Z73A 2VZ9A 4RF5A 3DC2A 5T8KC 4YAIA 1N9GB 3DEYX 8ADHA 3WGHA 1Q7BA 3WOHA 1U4SA 4UVEA 1YB4A 3H9QA 3VTFA 1DOHA 3U49A 4MVJD 5CEEA 4D0RA 4W6ZA 5CDSA 2JCXA 1LLCA 1R16A 4B4WA 2NNLD 2AE2A 4PG7A 4JJIA 4A10A 4XIYA 1ISFA 4IDGA 2AG5A 1E3WB 2X23A 2Y1FA 5THKA 1XA0A 2HRBA 4C4OA 5C7LO 1PJTA 3KO8A 4L75A 1K6JA 3I4CA 1C14A 4HX5A 3EC7A 4WLUA 3H2ZA 3TZCA 1UP6A 1N8KA 4IY1A 1EE2A 4RZHA 3KBOA 1PS9A 1LXCA 3RKRA 3BMOA 3DOJA 4CLHA 3VVBA 5H82A 4RPHA 1O5IA 1K2WA 3C8MA 1E6UA 3GAZA 4R69A 1XGKA 2J5KA 3D0OA 2EJVA 4CR8A 4DYVA 1E6EA 3A28A 4J0FA 5AYVA 4MKZA 3SVTA 3AM5A 5AOVA 5A04A 3INGA 3UCXA 1DC4A 3PVZA 3U3XA 4L76A 1BG6A 1P31A 3L77A 4GSLA 4YT2A 3D5TA 2O4CA 3DONA 2I3AA 4PLHA 4MKRA 3QWIA 2PH3A 4QFDA 5L40A 5H83A 4M86A 5DULA 2VWHA 1ISGA 1V3TA 3G79A 3BMCB 4OSOA 3N74A 5AXAA 1FXSA 3RCBA 3GNTA 2FWMX 5HRUA 4OXNA 4DPLA 5JMPA 1VC2A 5TJ9A 3V2HA 4RVSA 3BMNA 2PKQO 3EVNA 4YEDA 3F3SA 3PJDA 2X22A 4ZQEA 4A5OA 1NR1A 1OFGA 2P5UA 4HNHA 1E7MA 1DFIA 1YBAA 2B4TO 3VC7A 4XZ3A 5I7SA 4QUKA 3VPXA 1VKNA 3GQVA 4J7CA 3SBOA 3H9EO 2G82A 4FCCA 4W9NA 4EUEA 2DAPA 2RAFA 1I3LA 4GMFA 3OSUA 4FS3A 5JY6A 3DL2A 4ITUA 4NK4A 1PR9A 2Q50A 3QY9A 4DUPA 3DZHA 1M75A 1Y81A 1I32A 4NMHA 3ONEA 3ZCXA 1RM0A 3DBRA 1TT5A 4I9UA 4JLWA 4K9DA 5LDGA 5CEFA 5KVVA 5DNAA 1GR0A 3AI1A 3PWZA 1SNYA 3KETA 5JDIA 1LRJA 4LISA 3JQ8A 3Q2KA 4L73A 4PLWA 4DIFA 1U8XX 5EINA 5L4SA 2EKQA 4CM9D 1LJ8A 1B26A 4XGKA 2D8AA 5JO9A 3EUWA 4YBZA 4JBGA 3JD3A 1A71A 1YVEI 2Q2QA 1UXHA 3GH3A 1GQ2A 1M2WA 4DREA 3D7LA 2BD0A 4E4YA 3BHIA 4Q3CA 3IUPA 1BSVA 3HN7A 3OIDA 2QZ9A 1SPXA 3M6IA 2OL4A 1O0SA 3NDIA 3MOGA 4TSKA 1GCUA 1QYDA 4CM8B 3U4HA 1MP0A 4EEZA 4YAGA 3UUWA 4P8RA 4E32A 1X1TA 4PLGA 2OO5A 3IUSA 3BMNB 2BI8A 3GRKA 1VM6A 4RORA 4BKQA 1XU9A 1I24A 4B3IA 2HRZA 1XU7A 3AFMA 3H9JA 4J1SA 1WXDA 3INRA 4W7HA 1R12A 3MJSA 2VYVD 2ZIZA 2CVQA 5EJ2A 3WBBA 3T4EA 4JN6B 3GZNA 3PK0A 2B4QA 1BXZA 1C3VA 1M6HA 1HE3A 4XX0A 1Y8QB 4P4LA 3LLVA 3RROA 2B5WA 2WM3A 3DFUA 2Q3EA 1T4DA 3KYBA 4LVUA 1KY5A 1X15A 3E6AA 3ZZNA 3OP4A 1P0FA 4ZA2A 2ILTA 1NHWA 1PS0A 2DPHA 4UVHA 3HJAA 2ZTVA 4BB5A 5KOIA 1IOLA 3JQDA 3IJRA 2CF6A 5MGBA 1DO8A 4DBZA 1I2ZA 1ADCA 2DBQA 3WYBA 2NTVA 3OJEA 4XR9A 2Y1CA 3JQ8B 3QWFA 1NASA 5G4KA 5DF1A 3ZHZA 2W2LA 2YDYA 4ZQFA 5ILOA 5K9ZA 5FF9A 3DZIA 2BRUA 4ZRNA 2GERA 1K0UA 3F4BA 5KJFA 1HDCA 5DBIA 4RQUA 4JP3A 4EW6A 5I7FA 2J5RA 5B1YA 1V0JA 4FC7A 5F1OA 4B4UA 3F4LA 2FN7A 1B8VA 4FSHA 4CL3A 1GUZA 1VKOA 2ZCUA 3GHHA 4TVBA 4J9UE 1JAXA 3KLPX 4JXKA 3RFVA 1MUUA 3DZBA 3TL2A 4C7KA 1GYRA 3LDHA 1U2DA 4W4TA 1DIRA 3H7AA 1DIHA 3AY6A 3OJFA 2X7HA 3I9JA 2D1YA 3BMQB 2G76A 4K1LA 1A5ZA 4FJ2A 1P1RA 3Q0EA 4GKVA 4YJHA 1G6KA 4NJMA 3VZRA 5EL0A 3EW7A 1DC3A 2EKPA 2A4KA 1M67A 3QE3A 1JQBA 5G0WA 1U3VA 1V3UA 1LA2A 3BXXA 2D2IA 4Z6KA 3I23A 4IBOA 3ZHBA 3AM4A 3ADPA 5AVOA 3W8EA 4GX0A 3X2EA 4E0BA 1GYPA 4PG6A 1LQUA 1LRLA 1T1RA 3WMXA 3BAZA 5TSDA 2IXBA 4MVJG 1LDEA 3ANLA 3PHHA 1HT0A 1UDCA 4BNYA 3CZRA 1GEEA 3ZWVA 4CLXA 1BTOA 1EE9A 3PZRA 3PJGA 1FDUA 2PR2A 3BA1A 3UVEA 1S6YA 3O8QA 3QP9A 3P2YA 3LK7A 5JC1A 2RH8A 4KWHA 4YA6A 3P7MA 4ND5A 2AQHA 4BNNA 4CQLA 5G4KB 5JDIC 3D3WB 1EDZA 4ALMA 3DOCA 2P4HX 1HSOA 2CDCA 1CDOA 2G1UA 4BNJA 1XCBA 1DRWA 3UGKA 2WJPA 3WDSA 4UEJA 2YFHA 4G5HA 4CMJA 4EJMA 4OH1A 2Q1TA 3RD5A 5TS3A 3ULKA 2PA3A 3G1UA 3GVCA 2FSSA 5IXSA 1MC4A 3RUDA 2NU8A 3S55A 3UHAA 1YWGO 2NTNA 1X13A 1DBVO 4Z3DA 5CG1A 1K3TA 4BO9A 3K30A 2RBEA 1AHIA 1KC3A 5F1PA 3UN1A 1YONA 2NUAA 1M6WA 3QVWA 2AG8A 1IE3A 1DLIA 4PG5A 3DBVO 3PGXA 1DRVA 4MKXA 2WD8A 1DHTA 1N7HA 5L3ZA 4DPMA 4EI2A 3MEQA 3QVOA 3QVSA 4XB1A 3ZU4A 1DJQA 1I01A 1EEHA 4D46A 4BNMA 4ILKA 2YUTA 3EAGA 4E5NA 3ANMA 3CPSA 1IY8A 4JJFA 2HKIA 1YJ8A 2GPTA 2QZZA 2AXQA 3PLRA 3GUYA 2VZ0A 3GDFA 1GUFA 1YL5A 2EW8A 1N2SA 3DAFA 3L07A 4OM8A 4CQMA 2DFDA 1QV7A 3GGOA 4PLVA 4ZVVA 3ZV6A 2FOIA 5G0SA 3ZWCA 5DBFA 4RGBA 5B12A 4RVGA 4WOJA 4EJ0A 1R4NA 2W2KA 1VL6A 1NVTA 1W73A 1JLLA 3PDJA 4FR5A 2O2SA 1UDBA 2EV9A 4D42A 4YR9A 5AQ1A 4CQLB 1R0SA 3JYLA 4CMEC 4D43A 3FPLA 2AMFA 4MP8A 1YGYA 1GQQA 1Y8RB 4YVFA 4A2CA 1Y5MA 2Q46A 1O8CA 1EFLA 1HXHA 4R9RA 4S1VA 4AJNA 4ZHSA 5IDYA 9LDTA 3GEGA 4XEHA 2JFFA 2DT5A 2IZZA 4Z9XA 3ZH2A 3WICA 1TLTA 3WSWA 4ZGWA 2GZ2A 3K8ZA 4PGFA 4DQVA 5BSHA 3ROMA 3FNGA 5AXDA 4BNLA 3PI7A 3FD8A 2PK3A 3HADA 4WLVA 2EF1A 2BFAA 3PYLA 2Y0CA 1KERA 4XR4A 1PSDA 1MGOA 2A9FA 3D4PA 4XCVA 4U7WA 2O3UA 4FDAA 4CM3A 4BNHA 3CUKA 4F6LA 4YJGA 3AK4A 2VUTA 3JQEA 3OETA 4BV9A 3C7AA 2H63A 1OZAA 2VYNA 3ONDA 4ZU3A 1GV0A 3C85A 3OIFA 3JQAD 4CQMB 3HZZA 1J6UA 1N1GA 2VHVA 3CXRA 3FF4A 4IS3A 4J4BA 4II3A 4ZQHA 2CY0A 2WWRA 3RU7A 3IQDB 1KVSA 2X0JA 4PRKA 4D41A 5CP8A 2PLAA 2WMDA 2IYOA 1NPTO 2B37A 2Z1MA 1AXGA 4IZIA 5BSFA 2X9GA 3K31A 3NDJA 1OAAA 4D44A 1GZ4A 2NU6A 4PRLA 2C2YA 1V8BA 1GFSA 1HLPA 4PG4A 4GLOA 4IDFA 3CTVA 3DAGA 1Y5RA 2EEZA 1QLJA 4UEOA 3W4JA 3WGGA 4HFMA 3TDKA 1HYHA 4J0EA 1A72A 5KVCA 3KYCA 5DP1A 4GBJA 4ZQGA 2JFHA 3DQPA 4PN3A 2RHCA 2NQTA 1PGPA 3DO5A 4M54A 4DYDA 2PWZA 3LC2O 3IDSA 4RLSA 3DOOA 4FB5A 1U3UA 4BUCA 4AJHA 2NU9A 4XKJA 3ZNNA 2YY7A 3PYXA 2XPCA 2VQ3A 4YTEA 1G1AA 4OXKA 2NVUB 1YQDA 1ORRA 3I9KA 1P0CA 2HU2A 4MVJI 3S1LA 3HE3A 3PTZA 4CLOB 1AUPA 3OQ1A 3JV7A 4QO7A 4PLTA 1IZ9A 3TZ6A 3UCEA 2YDXA 3LVFO 2ZKLA 4E12A 4PLYA 3NTRA 2GF2A 1E1LA 1ARZA 2GZ3A 2GN9A 4IDBA 1F8GA 4NHEA 1EQUA 5DN9A 4YRBA 2YJZA 3PGJA 4BNTA 2J3KA 2C7VA 4WOKA 1PGNA 5TIIA 3RBVA 2C20A 3FCOA 5KWEA 4MDHA 4IS2A 5A5EA 3E9QA 2J3HA 4RDIA 1NTOA 3L4SO 2PZJA 3A4VA 1RPNA 4YT5A 1HDOA 3RC9A 2ZATA 1H5QA 3PIDA 1I36A 3F1KA 1NNUA 1UXIA 1HZZA 3OEWA 4J1QA 1EUZA 2BELA 5CDUA 5THQA 1H9AA 4JBIA 4L4RA 5EN4A 5ER9A 4E2ZA 4XDZA 3VZQA 1JAYA 1RKXA 2GLXA 3H4VA 3ZI0A 5HWSA 1ISMA 4A27A 3FSRA 3EHEA 1Z74A 2JCYA 3G49A 4XJSA 1BGVA 1KC1A 1HETA 1XG5A 4E2YA 4ZICA 3WYEA 2CNBA 2ZB4A 3COSA 1EDOA 1NVGA 1OMOA 4U6QA 4ZJUA 3N58A 3R1IA 2FR8A 4EYEA 3RJ9A 1J0XO 3UKOA 1QORA 4TZTA 1RM4A 3ZWAA 3CMMA 3ZNPA 1P44A 5IG2A 1IPFA 2UUOA 1ZSYA 5KVQA 1XLTA 1ULUA 5I8WA 5EPOA 4JCOA 2X9NA 2QW8A 5DCWA 3RVDA 2E6UX 4AJ1A 3UICA 2JAPA 1BW9A 1E77A 4BO8A 5C37A 3AOEA 4ONEA 4BIIA 1F17A 5A06A 5L7YA 4Y8VA 1CF2O 4CL8A 4CM4B 5KVSA 2R00A 1VJ0A 4ESOA 2POQX 1ENZA 4TZKA 5T6BA 2GN8A 4KQXA 1LSJA 1Q0LA 4QX6A 5ADHA 4R54A 4II2A 4GWGA 1S7CA 4A03A 1CETA 2DUWA 1HRDA 3C24A 4CV1A 3OM9A 1A7AA 4AG3A 2DQ4A 1P1FA 3PDUA 2HO5A 1VLLA 4PCVA 4I5FA 4M87A 2B5VA 4JJGA 1C1XB 3H65A 1ZMTA 3MOIA 4MIYA 2I65A 4CMHA 2UYYA 5F1KA 4GKBA 2DU8A 1VSUA 4P22A 4EITA 2YYYA 2VWQA 4KUHA 1LQTA 4KZPA 3GG2A 4D7AA 3HDYA 1I30A 4ND4A 4U5QA 2D59A 2JAHA 5G2OA 4NZ9A 5BNIA 2QYSA 4J2HA 3C1AA 5TC4A 1HDXA 2HMWA 1MLDA 2GO1A 4UVGA 4Z0TA 3WGZA 4CLDA 5DCYA 1V6AA 2BGMA 4M1QA 1VSVA 1EVJA 1W6UA 2NVWA 3R3SA 1E3JA 2GD1O 1WZEA 1T26A 3WJAA 2CSUA 3QLJA 3DBLB 3GVHA 3I4FA 3PYMA 4J7XA 3BTOA 5L7TA 1P1IA 4NG5A 3TFOA 1Z7BA 2BFMA 2CDAA 4LW8A 3TZQA 2AEFA 4KP7A 2EKLA 2O3TA 4B8ZA 2JD1A 3NV9A 1LI4A 2E82A 4PLCA 1GQYA 3WG9A 1R4MB 2YV2A 4IJWA 4CMIA 3WGYA 2O23A 1EK6A 5U1PA 4B4VA 5JAMA 1LBEA 2EHDA 2AHRA 2HAEA 3GN2A 5B4VA 4F6CA 2PZMA 4R1TA 4AJPA 2VWPA 1OBFO 1ZUD1 3K6JA 1HL3A 2IRWA 4OKNA 1SOWA 4EJ6A 2ZQZA 3KEQA 4GWKA 4WLNA 1JN0A 3AI3A 4J1NA 4KMSA 4YQYA 3VZPA 3ZV5A 2LDBA 3F1LA 4J16A 4BNVA 2QHXA 1JA9A 3L4BA 3Q1LA 1DIBA 1LC0A 2BKAA 2QG4A 1C0IA 1LLQA 3HG7A 1T2EA 3PQEA 1HSZA 3QVTA 1N7GA 1K89A 4E33A 1XELA 2OHXA 1XHLA 1T25A 2DM6A 1Q7CA 2O3RA 4R16A 2UVDA 1J5PA 1ONPA 2C0CA 3HFSA 1PL8A 4Q3DA 2P9GA 3KB6A 3SXPA 1PTJA 1QKIA 1C1DB 4BGVA 2VHWA 1MB4A 5G0TA 5F5NA 2E48A 5TX7A 4OAQA 4YQZA 4L0QA 4OQYA 1T1SA 4TVOA 5CDGA 5L4NA 3PHGA 4MINA 4BQRA 4GQAA 4L8VA 4RLHA 2JJYA 3EZYA 5GMOA 3MZ0A 2GCGA 3G0OA 5DZSA 1CQJA 2IZ0A 3FR7A 3RFXA 4Y6PA 3U0BA 4D79A 3Q6IA 1YL6A 4KDEA 4FPXA 2AA3A 1ZEMA 1HDGO 1ZVMA 3NGXA 4DLLA 5A3JA 3ORFA 3A9WA 1O89A 1SMKA 3VPHA 4NIMA 2EG9A 2FZEA 3GLQA 3SEFA 1FJHA 2X8LA 1Y6JA 1EMDA 2C54A 3B1FA 3RI3A 2WE7A 2ZB8A 4KUEA 4LRSB 4FOOA 4EGFA 3BYZA 3MTGA 1D7OA 4WGGA 1PZEA 1U5AA 2X5OA 3TZKA 4DIBA 4RCVA 2ZB3A 5ENVA 1EUCA 4HADA 4B8WA 2R00C 3AU9A 4LSWA 4DMMA 3W4KA 4RF3A 1PS8A 3K9QO 4CM6A 1TXGA 1I0ZA 3ZW8A 1ZMOA 4ND1A 3ZHXA 1E3LA 2HMVA 1DFGA 4RPLA 5AXCA 1LTHR 4GSKA 3BMOB 4GLLA 1DC6A 1JTVA 5EERA 4BNGA 1WP4A 2PZLA 4O1MA 4F45A 3VKVA 1E6WA 2HJRA 2Y99A 4J6FA 1EBUA 1ADGA 4WCFA 4IIVA 1TT7A 1YB5A 2Y66A 3WQSB 1QSGA 1DIAA 4CMAA 5COAA 3Q2IA 2OP1A 1YH3A 3KRTA 1UDAA 4R1SA 4B7XA 2P9EA 2CD9A 1KVUA 3E9MA 1HE5A 3NEPX 5U9CA 1H6BA 1B14A 1KETA 1XEAA 5COBA 1X0VA 3VAZA 5IZ4A 4NH4A 8LDHA 3ZNOA 4R9SA 2DPGA 5AXBA 1SEVA 2QRKA 2SCUA 5TJHA 3S2EA 3EGOA 1Z7EA 2HK9A 2IYPA 3D3EA 2CF5A 3AU8A 5K6AA 5H81A 4I1IA 1M76A 1VJTA 2PFGA 3TN7A 1WDMA 4U0JA 1ZK2A 2VWGA 4MVJA 2J3IA 3KUXA 4RVHA 4XYEA 2DTXA 1E5QA 3JQCA 1IHXA 3GC6A 3VH1A 4YDRA 3H3JA 2BI7A 1KYQA 3AUTA 5TGDA 1X7GA 2OZPA 4LSMA 4E5KA 3FBTA 1NPDA 5I8ZA 2I6TA 1YOVA 1C0PA 4CM7A 4E21A 1IB6A 3K2EA 3GOHA 2TMGA 1DRUA 2FY8A 3DTYA 4HXYA 4O63O 3DZFA 4HKTA 1XKQA 3ST7A 4J1TA 2O48X 4PVCA 3IKTA 1SO8A 4EDFA 3I3OA 4YJFA 1DSSG 1MG5A 4OOEA 3MJEA 3H2SA 4XYLA 3WSVA 2O3JA 1CRWG 3HHPA 3WNQA 1ZK1A 3OA0A 3DBRB 1TT5B 3I52A 4N5MA 1P45A 4E13A 3QVXA 1YBMA 4ALNA 1NHGA 5JFOA 4Z9YA 2FP4A 4OL9A 3H3FA 4H16A 4WCFB 4Y9DA 1XIVA 5DT9A 3UW3A 2NM0A 3ONFA 2VCYA 2HK7A 3GPDG 4BS9A 4P38A 2XXJA 3HDQA 1CIVA 1VJ1A 4URFA 3E5RA 4BOYA 3WX0A 3TZHA 5A1TA 2HK8A 2O3SA 4XWYA 1TI7A 3NDRA 5BR7A 1ZBQA 1QR6A 2BMAA 3GVXA 4YRDA 3OMLA 4NFYA 2XF8A 5JO0A 2GGSA 4GX2A 1HLDA 4E31A 4DLBA 3KXDA 1BXGA 4BKPA 4WECA 2ZYDA 1P1KA 3DFZA 4Y6SA 3V1YA 5IXYA 3GF4A 4G2NA 1DB3A 4MVJM 4FFMA 2IXAA 4YT8A 2TMDA 3RUAA 3FNFA 2LDXA 3E48A 2HMUA 3OBBA 3ZW9A 1LSUA 2OP0A 5A9SA 2O4UX 2PD3A 2Y68A 4GAEA 1PGOA 1H0KA 3ETGA 3ICCA 1UXKA 1UAYA 3M2PA 5B4UA 1PWXA 4XIJA 5F5LA 3GZNB 4E6PA 4RVDA 5IF3A 1U5CA 1U7HA 1W8DA 1JKFA 1I2BA 5HTOA 4HY3A 1A27A 3NJ8A 3ITKA 4AJKA 2H9IA 3ZWOA 3WYCA 4W9NC 5HM8A 1WMBA 2P5YA 1M66A 4AJJA 2VZ8A 3P2OA 1YO6A 5GZ6A 1PJCA 1NFFA 2Y1DA 1ZK0A 5KJCA 3DBHA 1XYGA 4CM9A 2BF7A 4LN1A 4E5PA 4OIMA 3MJVA 2OMEA 1F06A 1NPYA 3DHYA 1E3IA 1H2BA 1PJ2A 1B3RA 4WCFC 1CERA 3QIVA 4QXMA 4WLFA 1B2LA 2VN8A 1JWAB 4TROA 3HUDA 2B83A 3VKUA 2GDZA 3LT0A 4KOAA 2IEDA 3DZJA 4FGWA 4UAGA 3V1UA 4QECA 3ZHYA 3SLGA 4INAA 3PZBA 1DFHA 1OI7A 1B0AA 1GY8A 2VRCD 3FNHA 3PFFA 4R51A 3R0IA 4BL5A 3HB4X 1DAPA 4EUFA 2GNAA 1UXJA 3K92A 4MVJH 5IJZA 4Q9NA 2Q99A 4O5OA 5K6AC 3CSDA 4CJXA 4P4NA 1AGNA 2VYVA 1DPGA 1P1JA 4MOWA 3VPGA 3VH2A 3I9OA 3JYPA 3GEMA 5A9RA 7ADHA 4AJEA 3M1LA 1PZHA 1E5LA 5ITVA 5A9SB 4BNZA 4XQGA 2Y0EA 2NLOA 4EBFA 2B35A 4YJHB 2WYUA 3LC7O 4NJMB 1QYXA 2Q45A 4IPTA 2HLPA 4RPGA 1UR5A 3L0DA 3IS3A 3TPCA 3ZDFA 5KJ1A 4YB8A 1DXYA 1NBOA 2EXXA 4LVCA 2FRDA 5GY7A 3OQBA 1HE2A 2WD7A 5BSGA 1NAHA 1E92A 2DBZA 1I2CA 4IZHA 3WLFA 3CE6A 1WAMA 3WTBA 1UZLA 1T2DA 3S8MA 1LDNA 1R0KA 3AWDA 3GR6A 4IQ0A 3RUEA 1YDWA 2QQ5A 1Q2XA 1KOLA 1KVTA 4N54A 5JXWA 2WE8A 1RYDA 3O8QB 4XB2A 3ZGYA 4TWRA 1JU9A 3VVCA 1A7KA 3OH8A 4A7PA 5F3RA 2P4QA 4XDYA 4EZBA 3LZ6A 1QV6A 3EZLA 4RL6A 4BO0A 1X0XA 4CLEA 2GSDA 5JAZA 1ULSA 3GNQA 1U4OA 3S2GA 4DA9A 5ICMA 1BRMA 1HEUA 3LF2A 2V6BA 4W99A 2A92A 3BZUA 4JROA 4PVDA 4C7JA 2D3TA 1ZO8A 2XXBA 3N7UA 3JYQA 5HS6A 4Z9FA 2BFOA 2Y1OA 3KZVA 3GG9A 4UUPA 2PKRA 4HV4A 5JNLA 3ZU3A 1EVYA 1YKFA 3H5NA 4BNWA 5BNTA 4HFNA 2IDZA 2X0RA 5A9TA 1Z45A 3DMTA 1MX3A 4BKOA 1YS4A 5A3VA 3K5PA 1L7EA 2PY6A 2IODA 4AICA 1R0LA 1N5DA 3JQ6A 2Z5LA 2D4AA 4EUHA 3TFQA 2Y05A 1QYCA 4YCAA 1B3BA 4RDHA 1I8TA 4E5MA 5KIAA 1GUYA 1L1FA 3JYNA 4P4GA 3ZV4A 1E1NA 1ZSNA 1LDBA 5K0ZA 1LDMA 2NVBA 1GV1A 3C3XA 3KOUA 4R1NA 3ROQA 3TF5A 2O7QA 3ASUA 1XWFA 3P19A 4Z3KA 3GA0A 3B20A 4CMBA 1RM3A 2WD7B 4NBTA 2ZTUA 3GY0A 3UFXA 3H5RA 1EUDA 1RWBA 3UXYA 3G17A 2C07A 1K6XA 4K6FA 4TQGA 3JTMA 3KTDA 4IMPA 4ALKA 2DLDA 2ET6A 3NT2A 5EQFA 4D3DA 2AW5A 3FWNA 4QT0A 1R4NB 1B8UA 3RASA 4AVYA 2W2KB 3GDGA 4RZIA 2V6GA 4HNGA 2H1SA 4TRNA 3I6IA 1TB4A 4I9NA 1ZCJA 2QRLA 2P9CA 1WW8A 3AOGA 2EWMA 2VUUA 4K6CA 1QMGA 1WMAA 1R15A 5ICSA 3UH1A 3U4IA 3AUUA 2JKVA 1HF3A 2E49A 4B7CA 3H6KA 3TWOA 1YRLA 1KVRA 4MVJF 1XQ6A 4ALIA 1DAOA 5L45A 3O26A 3V8BA 4RVUA 1UUFA 2AEJA 2B4RO 3F6YA 3MWDB 2OOSA 1NQTA 2D5CA 3F46A 1GDHA 1OOEA 2I9PA 1NWHA 4GPD1 4RJTA 5LCXA 1CYDA 1E7QA 1SB8A 1QXSA 1T2FA 3LT4A 4FOSA 1E0DA 3JD0A 5JLAA 4DRYA 4G81A 4I5DA 2Z95A 1VL0A 3KSUA 4IXTA 2HCTA 4FFLA 2OORA 2X0IA 3JD1A 3I6QA 1P74A 2D5AA 1CWUA 3JQBA 4LMPA 4YJGB 4FD3A 3OEYA 1JKIA 2GN4A 3CKYA 3NX4A 4KWIA 4Q3BA 5B37A 2HDHA 5BQFA 4CR7A 4R68A 3DWFA 4H7PA 5L4LA 4NQZA 3E82A 1LUAA 3SLKA 3OFSA 3VH4A 4ZN6A 1H6DA 1Q1NA 1T2AA 2X6TA 4GGOA 2FPIA 3SX2A 4AJ4A 2FMUA 3CH6A 2ZB7A 5CAEA 5I9NA 1E7WA 2NV6A 7MDHA 3DHNA 3ROKA 5I7EA 1LC3A 1AHHA 2PV7A 3ZV3A 3MJ4A 2PD4A 1Z6ZA 5C5IA 3AJRA 3V5NA 3RSHA 1IYZA 1PU2A 3AM3A 4J91A 2CMDA 3IL2A 4N7RA 2BHLA 4G65A 3NRCA 1B8PA 2FSVA 1PQUA 1D4FA 2C59A 2DTEA 2VNSA 1V3VA 3I9MA 4GMGA 4MO2A 4YAEA 4NBRA 5JE8A 1PQPA 5JDCA 2J3JA 2Q4EA 3LF1A 1LDGA 1ZEJA 4BNUA 3RC1A 3TOZA 4NU5A 5TF4A 1H93A 2QYTA 3KYCB 4J4TA 1ZSVA 4UUOA 1PJLA 3SC6A 1LEHA 3DZKA 4HBGA 3T4XA 1ISIA 4J2OA 4ND2A 4XQEA 2Q49A 2O3QA 4BMNA 1HWYA 1OC2A 4QTZA 2Q2WA 5ENDA 2DTDA 2DFVA 2NTJA 3A1NA 1QLHA 1WWKA 4PZEA 3ON5A 1HYEA 4J3FA 3B6ZA 3EY4A 1MV8A 2I5PO 5T5QA 4NI5A 5JCJD 5TT1A 1E3SA 1EK5A 1DIGA 3E18A 3GAFA 4TRRA 3E5MA 5JSFA 3D64A 3DB2A 2AQKA 1P33A 1NQOA 1EZ4A 4NFHA 3CTMA 3ZWBA 3RAJA 1IULA 4O6VA 2BLLA 3UOGA 3JQAA 3U5TA 2IZ1A 4JBHA 1N92A 1LRKA 5F21A 2BGKA 4B3HA 3E9NA 1A4IA 2W8ZA 3ENNA 2OBYA 4FFPA 2I67A 5DOZA 1IHYA 1YBVA 2I3GA 3K73O 4I9HA 4OQZA 3H9UA 1PGQA 3FRJA 4FC6A 3ZWPA 1K6IA 1PR3A 3BTSA 4CMKA 2G17A 4U8GA 4N18A 1MXHA 2FZWA 3WLEA 4TMFA 1P9LA 4K28A 5CHEA 1E3WA 3ZWMA 1LSSA 3E03A 3JQFA 3QV1A 3ASVA 4FW8A 3WNVA 4JIGA 4NJOA 2I66A 4XYBA 3F5QA 5CFZA 1BHSA 5ES3A 1PQWA 1R66A 3C7DB 3FR8A 4BNKA 1LX6A 3L9WA 4GL4A 1PGJA 4IQGA 1YJQA 4Z0HO 1JVSA 2D0IA 3RFTA 1Y9AA 2NSDA 3DXFA 3GHYA 2G0TA 3OICA 2V6FA 3HDJA 4IJKA 3DZGA 3PWSA 1WDLA 3NAQA 1KEWA 1IUKA 3INTA 4L74A 1P77A 3IIEA 3KSZO 4UREA 3GFBA 4DWVA 2G5CA 2V65A 2WYWA 1KBZA 2ZK7A 1NFRA 3WMWA 4IQ8A 3WIDA 1BW9B 3PIIA 5L7WA 4ND3A 2CZCA 4XGNA 4MPDA 4I8XA 3RUIA 1MG0A 4ALLA 4HP8A 3JQAB 4JNKA 5IDQA 5KJEA 5DCUA 1G0NA 5FI3A 3JD4A 5MDHA 5A03A 1DLJA 2EP5A 2X9VA 3DDNA 3EDMA 4WLEA 4CV3A 1I33A 2O50A 3JQBC 2HQ1A 4FFOA 1AE1A 1RJWA 3VDQA 4FJ0A 1PZFA 3GUCA 5KTKA 4DMLA 5LC1A 2XOXA 1JKJA 4R01A 5FI5A 1MFPA 1PX0A 2JCVA 3PJFA 2RCYA 2YQ4A 2HMSA 2DC1A 5JYDA 3T7EA 4GGPA 5J23A 3VDRA 3OJ0A 5CDYA 3WTCA 1PJBA 4KQWA 4MVJP 1ISHA 4GVLA 5IZCA 2P91A 4WKGA 1LLDA 2IE0A 3GGPA 3JQ9A 2A94A 5JDCC 2VUSA 4J90A 4FBGA 4RVFA 2AEMA 2NWQA 3TJRA 2PGDA 2AQ8A 2BH9A 3PWKA 3RQSA 1CQIA 5JCJA 3QJ5A 3C1OA 2Y1EA 4TRJA 1KIFA 1U28A 3EYWA 4ZQBA 4AL4A 4CV2A 5FFFA 1DDOA 1E7YA 3QRWA 1XDWA 1NXQA 2C5EA 3UF0A 1T2CA 3AY3A 3I9LA 2JHFA 1X1EA 4WEOA 5JCXA 1Q0QA 1PEDA 2E37A 3W6UA 3DR3A 3NYWA 4BNXA 2V6MA 3JCZA 5A05A 3NTQA 3ZU5A 4CMIB 5L51A 4R5MA 3HDHA 2C82A 1YE3A 3H5AA 4WJZA 3JQ7A 3BTVA 4JX8A 2OUIA 2W2LD 3MWEB 2NU7A 4CMGA 5KJ6A 2BGLA 5IAAA 3AOEC 4CM8A 2DBRA 1D1SA 2QRJA 3WWYA 1ENOA 3AY7A 3KYDA 3O38A 5CG2A 6LDHA 4YT4A 2JHGA 3PHJA 1XSEA 2Q1SA 1MA0A 3RC7A 3CMCO 4ZRMA 1HKUA 1W0CA 4ALJA 2X86A 2B69A 4LCJA 3WBFA 1ADBA 1MXFA 3AUAA 3VH3A 1SOVA 3JD2A 1TEHA 4YXFA 4PZCA 3PEFA 3I1JA 1Y8QA 2YQ5A 5A4DA 4WPGA 1H94A 3JQFC 2JD2A 4BV8A 4WE3A 2B0JA 4QSMA 4R5HA 2Y93A 4OHUA 1YDEA 3LC1O 3ZN2A 1H2HA 4DTIA 1CJCA 2H6EA 3STHA 1EQ2A 5A02A 5IN4A 4IMRA 1H6CA 4O0LA 4S3MA 3PQDA 1GZ3A 3ETDA 4BMSA 1GAEO 4WEQA 2UAGA 1DJNA 4F3YA 3VZSA 2WSBA 4MVJE 3G1TA 2W98A 3X2FA 2I99A 4BHTA 4F46A 1ZK3A 3RC2A 4BNIA 2DKNA 1I5RA 1Z82A 1EVZA 1O6ZA 1UH5A 2PGLA 3IP3A 1D1TA 3ABIA 5C3MA 5ILGA 1I3NA 1ENPA 3JQ7B 4FFRA 3OJOA 4IM7A 1O94A 3SJ7A 1PL6A 3M1AA 3V2UA 2DVMA 4KTVE 5JW6A 1HE4A 1E7SA 4WASA 1D8AA 2Q2VA 1T4BA 4OYRA 3VPSA 4OXYA 2HUNA 3KYDB 2OGUA 4ROSA 2I76A 1F14A 1LSOA 3LT1A 1IZ0A 4NBVA 3L9XA 3WIEA 1BDBA 5L9AA 1D3AA 1SZJG 3A14A 1UAGA 3U4CA 4UULA 4Q3AA 1PJ3A 1JDJA 2X5JO 3R3JA 1P1HA 3BMQA 3L4BC 4L4XA 3B70A 4FGSA 4BB6A 4DVJA 2H5LA 3KM0A 4OGWA 3GPIA 1U3TA 1NYTA 4R4JA 4BO7A 1Y1PA 3JQGA 3LLSA 3U62A 3PP8A 4ID9A 4OSPA 1ZZEA 2YV3A 3FPCA 4FN4A 5IZCC 4M49A 2C29D 4WNCA 3JQ9C 4M55A 1FK8A 2X4GA 4RO0A 4PZDA 3CIFA 4LMRA 1HDRA 4CQMD 1B15A 3O9ZA 4DQUA 3K2BA 2RHRA 1ZW1A 3KSDO 3NGLA 4R41A 4CMEA 4OJNA 4WK6A 3VOSA 3D3WA 3LU1A 4UUMA 3NJ4A 3RIHA 4E2XA 4R3WA 2FPGA 4AFNA 4N5NA 5FEUA 3HQ4O 3WGIA 3PHLA 3HNPA 3F5SA 1BVUA 2O2YA 4UVDA 1YOVB 3UAGA 1E7RA 1DC5A 3VTZA 3I5MA 1NM5A 1I3KA 1U7TA 3FHLA 1GZ6A 4TKLA 5HA5A 4B3JA 5JAIA 1BXKA 2VHZA 4GX1A 4GVXA 1ZJZA 4J4HA 4IDEA 4RPJA 3FI9A 4XRRA 3V1TC 5TQVA 5C7IO 3OQ6A 1LNQA 2RH4A 1LLUA 4FIZA 4CUJA 4YJFB 3IC5A 3RUFA 2YFQA 4WLOA 1AXEA 5IFLA 1A9ZA 2ZYAA 2GYYA 2ZJ1A 2OFPA 3H8VA 4RF4A 3BTUA 2J6IA 4HFRA 2O7SA 3B1KA 2ZJ0A 1GADO 3KEOA 4IJVA 2X1HA 4OO3A 3ZU2A 3QWAA 4E30A 3VHRA 2NADA 2R2GA 3IJPA 3GK3A 2GUGA 1A4UA 1B16A 1A9YA 4YACA 3GRPA 3QW2A 4FQ8A 4CUKA 3JQGB 3NTOA 1QRRA 1Y7TA 3FN4A 1RM5A 3RU9A 4J49A 4XYMA 3KLMX 5CPBA 1QP8A 3TRIA 1SEPA 4BO4A 1I10A 3PQFA 4EEXA 5JBIA 1CEQA 3EMKA 1SB9A 5JAQA 2AE1A 2R6JA 3WJ7A 3GZ4A 1H6AA 1Y9EA 1BDMA 1U1IA 4M89A 3OIGA 4FJ1A 3UCFA 2YHIA 4IUYA 3AUSA 1ZJYA 4U6SA 1YB1A 5IDXA 2VYND 3TSCA 1BXGB 3MTJA 3MJTA 3JSAA 3R6DA 3WGQA 3PJEA 1ISJA 5KKCA 1B7GO 3HFGA 3W8DA 3ADOA 1ONNA 3KVOA 3RJ5A 3ITDA 3NUGA 1WDKA 4XRGA 1R6DA 3P5SA 5LDHA 2JFGA 2VTEA 5IDWA 5L53A 1Y8RA 4JP2A 2NQ8A 4YJDA 2PD6A 4MP3A 2HSDA 4OOFA 4LGVA 2V7PA 3HB5X 1I3MA 2EGGA 3EK2A 2ZTLA 3ZWNA 2C5AA 4I08A 4J43A 5KNLA 3ZWWA 1FDWA 2OXIA 4BNFA 3CZMA 3D5QA 2C7GA 3F47A 3Q3CA 9LDBA 4BVAA 5EMHA 3H9GA 1V35A 3RBZA 1YQGA 1ZFNA 3WB9A 3BHMA 4Q39A
chains in the Genus database with same CATH superfamily
1X7DA 2Y27A 3BBPA 1A5AB 2WEKA 2YUIA 3GMDA 3IV6A 2IYSA 3MOSA 2RONA 2X14A 3IH5A 2H1HA 5D2CA 4ZDKA 4X6XA 2ZROA 2GRAA 1GRRA 2Q2OA 3A0RB 4DJJA 5F51A 3FWPA 2R9VA 1NN3A 4G1MB 4MWDA 4NFSA 1WNTA 4E70A 4BMVA 3KFXA 1QIEA 4RSMA 4URXR 2OFWA 3PQ7A 4HX9A 2FJ0A 2XAAA 4CM5A 5FQNA 3N86A 4CYMA 4M1YA 4P3YA 2YXPX 1WPQA 3IMFA 4QFCA 4C87A 2H2AA 3QKTA 3R5HA 4MCJA 2PXXA 1ZKDA 3H75A 4OUDB 3OKAA 4OB7A 4HLNA 4DLAA 1U3GA 4QD3A 3ZDZB 6YASA 2IXDA 4K03A 3W8FA 3PX2A 5CX1B 3OPNA 1NNEA 1YZKA 1OXKB 2YHIB 1GLGA 5C5DA 4QBIA 1WHSA 3WFIA 2C58A 3KPVA 4NENB 4ZD6A 1OJ7A 3PXXA 1N2JA 1Z3IX 5L8VA 1ZAKA 3NHPA 2OENG 3GJYA 2IYXA 2FWNA 4S1WA 3OY7A 3P0IA 4JGBA 1UZMA 1IEVA 4U9HS 3PUKA 1SXPA 1SU7A 3MINA 2IEZA 2W90A 1F8FA 4Q48A 4QUJA 2AI3A 4LGMA 4W82A 4J8PA 2HLHA 4AJ2A 4D0GA 3I5XA 5F77A 1B1AA 5KU7A 1UWCA 5FO1A 1FRVA 1ZK4A 2ZQYA 5LYJA 1AKYA 3KJXA 4ON9A 1KEVA 4BUZA 3S2IA 2R62A 5DMHA 4NICA 1H2FA 2X5KO 4O3MA 1ZN7A 3QEJA 4NATA 2PNFA 4CG1A 5HKKD 1SVNA 1YI8A 2D5IA 5ALUA 2D2FA 1KQNA 5LQJA 2FZKA 4D9CA 1AA6A 1ZGGA 1EP1B 1X9HA 1GU0A 1RAGA 2CFRA 4CIBA 4H15A 4ZHQA 2VLIA 3NIBA 1XHEA 4HUQA 3T5MA 2QTGA 4YJ2B 3E27A 4INOA 4L0DA 3LL4A 4MI1A 3RG2A 4B33A 5FBHA 1PG0A 2XMPA 2A3RA 4U2GA 2ZBGA 3D7MA 1OC4A 4S24A 3ZJ5A 3WMRA 2IHKA 2F1KA 4ZAVA 1ZD4A 1D2EA 4OJYA 3BN3A 3TOXA 6ADHA 1YXMA 1IPEA 4QBTA 3TNLA 4DIOA 1KAQA 4E5UA 5BQ5A 2B1RA 1Z4NA 4RLFA 5AW2A 1QG6A 2W6CX 5EESA 1N57A 4JFRA 2FA9A 3PGLA 2UYCA 1BDIA 1SG9A 4YREA 3ICPA 1PIWA 4BX8A 3T7CA 3AUFA 1IN4A 3PQCA 4EG6A 1JBEA 1K3FA 4IIUA 2JB9A 4M1SA 4MS4A 4E5YA 1Q6ZA 2B4AA 5EJMA 5CNIA 2YNMD 3FNRA 3C5VA 3GFGA 2J8ZA 4XIGS 1IOWA 3L93A 5CEJA 3OX2A 4DC1A 3AH8A 4BVJA 1D2RA 2QMQA 2GCNA 4IINA 1FP4A 1YVRA 4EKIA 5JAPA 2R8EA 2IT1A 3DHEA 3WA6A 4I9GA 5E6SB 3WWZA 1D2AA 1M33A 3O92A 1JIUA 2JC3A 5DOVA 1TMKA 1T5TA 2I4IA 4DQXA 4ARAA 1K5HA 1G5IA 4DNXA 3B2NA 4AKTA 3CRNA 1K63A 2XYHA 4EJSA 2PUGA 5CLJA 3AJAA 4BO6A 1OTXA 4LWPA 4WDQA 1TVEA 2PMEA 4CG0A 1E3EA 2QVZX 3PNYA 4YMGA 1A9SA 2YJNA 3BCSA 3HYLA 1I2DA 3NPAA 3LWDA 4LDNA 4RQTA 4XA8A 3PWTA 4WCDA 1V8PA 3H5OA 3WAKA 1SH7A 4FFNA 3ZNQA 2CLOB 1ZIPA 4BN5A 1AUQA 1V9LA 3I04A 4BO3A 2PT6A 1U8TA 1A1VA 1X1RA 3DAPA 4ANFA 2Y1GA 3LSTA 5C18A 1BQ3A 1BMDA 2CVOA 3KR1A 1X14A 5LLDA 1DAHA 4G84A 2DRIA 1TUBB 5T8KA 2EERA 1NJGA 3UK7A 4WUVA 1C3JA 3PNLA 2IHZA 1W94A 2C2XA 4OHKA 1TE2A 1S3FA 3I39X 3KSRA 4UMEA 3CX8A 1ZXBA 1GPDG 3LT2A 3D1LA 4PAMA 4HWKA 2RGRA 4KXQA 4AJLA 1BDJA 4IDDA 3Q9UA 5SYAA 2B1GA 1NVXQ 1E66A 4BV2A 2CVZA 5DNEA 4HQNA 3R4CA 2WSSA 2QIOA 4DA0A 2RK6A 3UT6A 1GD1O 4DEXA 5BR8B 3PHIA 2AOUB 5GV7A 3R9WA 4TYYA 1RD4A 2FFRA 5EKXA 3NT4A 1PR5A 4YC7A 1VG1A 2HB6A 3WAJA 1AGXA 3DJFA 1P18A 3H1EA 3Q40A 4KR0A 3THWA 2LD4A 3HL0A 4G6ZA 4M7RA 2NTYC 5HZKA 3QHQA 1YQWA 5HQJA 4MS1B 1FZTA 3OF2A 2ZB2A 4CM4A 4DXAA 5HDQA 5BMOA 4O59O 4GI2A 4P2GA 1U63A 2VH2A 3P20A 2VJPA 3E9RA 4IGEA 2ZYGA 1DKOA 5JAHA 1CUHA 3ZWYA 1YT5A 3QLTA 1MOSA 5KSPA 1EWQA 1ONOA 3GJ4A 3N1UA 4IEIA 4JLAA 4AMYA 3M4YA 3R3ZA 2J9XB 3A1SA 4ZO7A 1FDVA 3FE2A 3R9KA 3QPWA 2CCGA 9MHTA 4NZNA 3ZIAA 1ML3A 4G24A 3TKYA 4H3VA 3QPVA 4BQIA 4W5RA 1N2GA 2C88A 1PJ4A 4PXYA 1DJOA 4RXUA 1ZNQO 2VHYA 2O52A 4BGUA 1AN9A 4DWJA 2O0LA 4PYNA 2J32A 2REQB 4P93A 4DUGD 4ZPXA 4WACA 5EMJA 2QN7A 3RM3A 3SBEA 2AZTA 4B3GA 1DCFA 1POXA 2IEBA 3ETEA 3FMOB 3GBVA 2RFLA 1EVIA 3GV0A 3NIDB 3OTWA 3D1JA 1OY1A 2JI6A 3OSZA 2PZEA 4FLEA 4QDJA 3ZY4A 5JC8A 1ZD9A 4DV7B 3HLYA 5DP2A 3OG9A 3SZRA 1HKHA 4C43A 4UBNA 1L5HB 2QPOA 4ZOQI 3OA2A 4OKIA 1ZH8A 2I62A 3RB8A 3TQHA 3KKEA 4OMUA 4J9VA 2UUPA 5JJLA 4GFDA 3P94A 1UBOS 4V0SA 3NT5A 3R8XA 3H2BA 5AKZA 4CODB 1UP4A 2CMGA 2GZ1A 2Y0DA 1GPYA 2O0MA 3A0UA 5DBGA 5D8DA 1JZTA 3DTTA 3WNZA 4NF2A 4EY5A 3HTXA 3IXLA 5BOSB 3QWBA 2YMQA 1G0OA 1KJWA 1OJLA 3BKXA 3DBLA 3GGSA 3P71T 3Q98A 4BN4A 3VDMA 4J0HA 1QCDA 3EEQA 1A8SA 3LUFA 3EZ7A 4PG8A 2NO6A 2FWAA 2W2TA 3L6DA 1N9GA 4KKVA 4MQFA 5JPIA 4R6XA 4V0OA 1KY4A 5ALKA 4R7GA 4KO4S 1NX6A 1VI2A 5I9LA 1UZNA 1UJ5A 2YTZA 4QQFA 2J0EA 4MJLA 4M9QA 1P1CA 3L1IA 1GPAA 3QKRA 4Q3EA 4MIEA 4RD2A 1BMTA 4UAVA 4DJEC 3GT0A 3L6OO 4ETIA 3BXFA 1WKVA 4WZBE 1CS0A 1V7CA 3NWPA 4YLGA 5CYOA 1UP7A 3VNSA 2JCSA 2ZSEA 4A0GA 2CUKA 1DV1A 1NURA 4H17A 4WN9A 3ZR4B 3SYKA 1QP0A 3NXSA 3PNVA 5A6SA 4TRMA 3MTDA 1OASA 1SU6A 4QO8A 5G0UA 3VSDA 1ZJWA 2FLKA 3QZUA 1WD7A 4IGKA 5JQWA 2PUHA 3KYIB 3OHSX 1L1RA 1DBIA 1X38A 1NT4A 1KYTA 4TM8A 1Q44A 2JI7A 5CR9A 3V2GA 3LYLA 3H0EA 4X54A 1UF9A 2GOYA 5JATA 1DE0A 2BF4A 2QVYX 1NVMB 4KQFA 2FG7C 2NG1A 4TWBA 1K6EA 3CINA 4KB5A 2PMFA 4K9OA 4M8SA 4BECA 1RHKA 4NU0A 2INGX 4JBWA 5HHTA 5JBNA 3V8NA 1Z83A 2VI5A 3GUVA 2B1IA 2X8JB 5AI0A 3WISA 4ZEMA 4QBFA 5MFZA 4OL0A 3C6XA 1J7JA 2CLEB 1HTBA 1KH2A 1VL8A 3QU9A 1PP4A 2WIBA 1JXAA 1ZX1A 3C8ZA 3NOOA 4UVIA 2WVAA 4RKWA 1YHNA 4XD2A 2GJAA 5FT9A 4Q47A 4DLKA 1C1DA 2ZCVA 4DCOA 4X8HA 3O03A 1NXWA 4KUGA 2WYVA 5G0VA 1AK1A 4Y0AA 3CJQA 1Q83A 1V9CA 5EHGA 3N3AC 2GR9A 3UHOA 3NHRA 1JH9A 1FLVA 2VEDA 3ELUA 2XKKA 3GU3A 3K96A 1RXWA 5HS4A 2E0IA 3D8SA 4R7TA 5NLLA 3FGPA 4IXWA 5JNRA 1HPLA 4EMUA 1I1HA 2YH2A 1I2MA 2Q3FA 3KHUA 2VZ9A 4KO1S 4KVAA 2IU3A 2OORC 5T8KC 2J07A 5A2GA 1FU8A 3IUYA 3H1PA 5KNBA 4EF4A 5IULC 4C29A 1YSCA 1GL7A 1PVDA 3CUSA 1XQVA 3GFPA 1A8QA 3CONA 2AC2A 4UVEA 1I5EA 2PUCA 5JXGA 2FZLA 3RC8A 1A9XB 1IZ8A 3JPWA 2BY4A 1S3IA 2JJ1D 1UXOA 1SY7A 3LCCA 3T3MB 4W6ZA 4ED9A 1NY5A 4DVGA 1RAEA 3D7NA 2AE2A 1RLJA 4PG7A 4ZCIA 2WK1A 4JJIA 4CDRA 3G0GA 1ISFA 4IDGA 5J2UF 4F04A 1WV1A 2AG5A 3HCOA 3KPYA 4QULA 4ZYWA 4QE3A 1V7ZA 1VSTA 2AZDA 2Y1FA 3AKDA 4HDRB 4YO7A 4C4OA 4ZYXA 1KI3A 4IZ6A 4JI0B 3CF2A 1OTYA 4ZVTA 4MS3A 1UKZA 4RMNA 4I55F 4IIHA 3NDBB 2Z3VA 2HJGA 2B61A 3QPAA 3HWX1 1QG0A 3HCFA 3ILYA 3KBOA 4YGYA 1PS9A 3RKRA 3MD0A 4CLHA 5ALDA 1ULZA 1Z88A 4MV1A 1E4VA 2CYAA 4HWOA 1B6GA 1OV6A 4JUCA 1TDJA 3UMMA 2I6QA 1K2WA 3ETCA 3VNUA 3C8MA 1E6UA 4X41A 3V7UA 1VKZA 3FDXA 5FULA 2EJVA 2B1JA 2CB0A 5F3DA 3SVTA 3K0FA 3CRQA 1HLGA 1SCDA 5A04A 1XQWA 3FNBA 4K46A 2XUZA 3PVZA 4HQOA 1NNI1 1Y7LA 2EQAA 4LK2A 4XOIA 1EB8A 3C3CA 2W6MA 4GSLA 3EQ9A 5FPQA 1JQKA 2O4CA 2I3AA 4U39A 2GJ4A 3OOJA 4IIXA 4DG8A 1UFQA 2VPPA 4HZGA 4Y9RA 4G1FA 3IBTA 2C2ZA 5H83A 5L40A 4M0MA 5DULA 3VU3A 4YUAA 5HF8A 2VWHA 3L1UA 2O1EA 3V8MA 5JNWA 2GHTA 4F5WA 4UBLA 3REQA 3T7DA 3S2UA 4REQA 3NM6B 3OTIA 4JOQA 4YRFA 2WAXA 1C30B 5SZHB 1CB7A 3RCBA 1KOFA 1JIVA 2MYTA 4FGZA 5ALIA 3SZOA 4AZ3A 4DSZA 1ZOOA 1I4DD 1YCDA 2YZKA 3HP4A 3HZHA 3F3KA 4I3FA 1YU9A 4JLNA 4LDZA 4MUFA 4RVSA 4U9UA 5TJ9A 1LFAA 3V2HA 1Z0DA 4J0GA 1BZYA 2X22A 1FDRA 2YJ5A 3EGWA 2ZUFA 1YS1X 3PEEA 2FSGA 2FDXA 1J22A 1I6WA 1NR1A 3VHXB 2WP0A 3ET4A 4HNHA 3RYIA 1DFIA 5BMVA 1K92A 2P2NA 3GBSA 2XSZD 4CI0B 1ZC3A 5HCNA 2OHJA 4MMXB 3QBTA 4R1MA 1RLOA 2JFVA 4W9NA 2RAFA 5EKDA 3EE6A 3GRFA 3QU4A 3OSUA 4GMFA 4GOJA 4TTAA 3GDHA 5DGCA 2R97A 3VO8A 1CQXA 1KQOA 1P2UA 4NK4A 3O1LA 3QY9A 3SSOA 5AVRA 5KYYA 1M75A 4H3KB 4ZTUB 1X7ZB 1I6LA 5JG7A 2JK0A 1NDHA 1WDWB 4M60A 4QLAA 1G66A 1MOQA 1T43A 5B1EA 4JC8A 3QX7A 1CQIB 5DNAA 3WWOA 2O8FB 1MPTA 4UHDA 1V7QA 1Q16A 1WZNA 2IS4A 1JUDA 4MK4A 2VK8A 3JQ8A 4RJLA 5FTMA 4PLWA 5JZOA 3MJFA 1URPA 1KXJA 1U8XX 3OPVA 4PYRA 2FFHA 4FINA 4D02A 5KQRA 5L4SA 1B26A 3L7LA 3LUDA 4OXRA 4BDTA 4EI8A 1A71A 3WVNA 1UXHA 3MUNA 1AHNA 1GQ2A 1M2WA 1GILA 2Y77A 3D7LA 3R5SA 1IJBA 4DLUA 4ILEA 4J0KA 3MXTA 5BP7A 2BD0A 5JSZB 1BEEA 1RWVA 3AONB 1RE0A 2P9ZA 1CRQA 1QG4A 3HN7A 4BYGA 2PL3A 3M6IA 3D6AA 3NDIA 2JKZA 2QJTA 3AF5A 1GCUA 3QELA 4YCLA 2H2HA 4CM8B 2WHPB 2YXDA 3T4UA 3ESZA 2AYYA 4EEZA 3UUWA 1WXXA 4P8RA 4WBNF 4OBWA 1X1TA 4JBXA 4ZDIA 4Z0NA 1E2NA 4DGQA 3IUSA 3MPOA 1EWYA 2H2IA 4HN4B 4NCKA 5B6JA 3KQKA 1VM6A 1YS7A 1NOKA 4RORA 1XDZA 1Z0KA 3FFWA 3MJHA 1I24A 4B3IA 3EW9A 4LYGA 1YR6A 3AFMA 4F92B 5CBKA 1M8GA 3VOTA 2F8LA 3T5GA 2HA0A 1IXSB 1W9HA 3JQQA 2QX4A 4IXDA 5EWLA 1PDOA 3T4EA 4JJ7A 4CKXA 2H8GA 3GZNA 5EJEA 3PTAA 2B4QA 1K4YA 1QIKA 1ACJA 2QLMA 1M6HA 1X1CA 4HEHA 4JGIA 4G3XA 4XX0A 5EEHA 1Y8QB 4RA9B 2FFBA 4P4LA 5LNK6 2QB5A 3LLVA 3OF5A 1ESDA 1KFBB 2Y3IA 3KYBA 1JA1A 4G63A 4BYMA 4LVUA 1BC5A 4XCXA 1UJNA 4CTNA 1XFDA 3SIRA 5JD6A 1G8AA 1LW6E 3OP4A 4UZSA 1CZRA 4ZA2A 2Q5JA 2II6A 1Y6RA 4CIDA 1JGTA 1TCBA 4DSTA 3NANA 3SXJA 3BDIA 1ESCA 3I6BA 2VJKA 3IOCA 1MDBA 5KOIA 1IOLA 3LE8A 2CF6A 3K16A 5SICE 5L3VA 5MGBA 2DFKB 4F56A 4EHIA 2V0NA 4ITRC 1UBSB 2I80A 3DDCA 1TW3A 3WYBA 2NTVA 4E6EA 1KQFA 1YB7A 3UJPA 4PN3A 3OZCA 3TMAA 1UPBA 1LK5A 1V39A 1KEEB 4HWGA 3DQZA 1NASA 5DF1A 1HFWA 2W2LA 2YCLA 4ZMSA 1Y6QA 3U31A 3IEVA 5HDBB 4RK1A 2P6UA 3H16A 4K3VA 5EHNA 4O4HA 5K9ZA 5FF9A 3DZIA 2W70A 4HC4A 1S3SA 4B47A 3QE2A 3TOSA 4GOKA 1OLSB 1YC5A 2QNBA 3N2YA 4F9GA 5BN5A 5KJFA 4LRUA 2OZEA 3JRNA 3BPSA 2LPMA 4B81A 3C8DA 3CO0S 1V0JA 3QEMB 4N7BA 4G1UC 1N5RA 4KIGA 4WW0A 1GNSA 1LWOA 2IY8A 1B8VA 2Q8NA 2R8OA 2WMNB 3DBOB 4FSHA 4CL3A 5BORA 2ONCA 1UBCA 4I1VA 1VKOA 4S12A 1JG7A 3RNLA 4DQDA 2I1LA 1XJ0A 1V25A 2MSEB 4OFXA 4R3UC 1FTWA 2PMCA 4V1CA 4CEJA 3FLAA 4TQAA 3RFVA 4QGGA 2AF4C 3EWAA 1E79D 1FPQA 3DV2A 1CFJA 4P7FA 3WKBA 1JYSA 3LDHA 3KQWA 4KAFA 1QWOA 2IVZA 4PYIA 3OZDA 4W4TA 2IWHA 3H7AA 3MCUA 3U6BA 1DIHA 1FW8A 4ZANA 3BMQB 2O07A 4O1IA 3UY4A 2NUPB 1A5ZA 4IG4A 1E9RA 5HF6A 1X7XB 5REQA 3RRBA 3SFTA 1XB2A 2RIPA 2B3TA 3P9YA 1L8OA 1TCUA 3L92A 2CD7A 4HAXA 1NN5A 2PYZA 4C6TB 1FFGA 5B64A 3UMYA 1JDSA 1CNFA 1Z5VA 4PPGA 2ZWPA 3H5WA 1M67A 5E1BA 2XVMA 1JQBA 2BHRA 4Y1EA 1SM4A 3PXEA 4BX3A 1RMTA 4Z6KA 1LD3A 4I1YA 3AZPA 4LOLA 1GYPA 4PG6A 1AF4A 1G16A 4EY8A 1P7WA 3ND6A 4RTSA 1LRLA 3VC2A 3WMXA 3QVMA 3BAZA 4JLMA 4DIDA 1X8KA 2IXBA 2XTZA 1LDEA 3ANLA 1HT0A 2AR9A 3L8DA 1NBHA 4G67A 2V9ZA 2HMYB 3TTVA 1EE9A 1SKUA 1K5PA 1TA9A 2X15A 3PGA1 3PZRA 1E89A 2PR2A 1SHZA 4DDMA 4DLVA 3O8QA 4RK0A 5JD5A 1L7OA 4MITA 4MUBA 3P2YA 2QRMA 1FUYB 3DTVA 4DY6A 4IXNA 4N3AA 3A9SA 4MW6A 1RQXA 3CG4A 2H65A 3GW8A 5G4KB 2PUDA 2LIPA 1Q1AA 2H5JA 3JARA 1QIJA 3F73A 3QX9A 1PSZA 3C5HA 3PR2B 2WJPA 4MQEA 4Q01A 4A0FA 2V1XA 4LXTA 2Q1TA 3DWIA 4ME6A 2JHAA 3RTAA 2YRWA 8OHMA 2PA3A 2OECA 4C01A 2IYTA 2FSSA 5IXSA 4M1ZA 2O8DA 3RUDA 3S55A 4FK8A 1NXOA 1Y4ZA 3V33A 1H4SA 3U7QB 5ALEA 1UMCA 2HNKA 4LJAA 4HMOA 2OB2A 4MQMA 3EF0A 1KL7A 1WSDA 1ZH6A 2HPAA 1F1JA 4JYBA 1UZAA 4O5AA 1AHIA 5CNMA 2HYIC 1P2BA 1SBTA 1BA3A 4K9MA 1II8A 4EBBA 3CUTA 5IPFA 4XB6B 5E2BA 1WZCA 4PZUA 3DBVO 3ROZA 3D8BA 4MKXA 2R84A 2D13A 3LHFA 2RBKA 4JSYA 1N7HA 3B2EA 4DPMA 1HTWA 1XTRA 3ZEAA 3QVSA 4BMDA 4F4CA 3FUXA 5FX2A 1RHQA 1UPAA 3X43A 4BFXA 4MKIA 2E9SA 4JASB 3EAGA 1GNLA 2EBFX 3GJXC 4H7DA 4KO2S 3NC1C 4U2DA 5ALPA 1JKMA 5AOAA 1NQUA 2GT1A 1CUXA 1QZZA 1TQ2A 2AXQA 2OYCA 2GILA 4H1VA 3SHWA 5DM70 1NN0A 5DISB 1GLNA 2EX0A 2Q9CA 2QZJA 1LW7A 2VA8A 4PSCA 3L07A 4U02A 5JADA 4OM8A 2PQ6A 2A9JA 3N2GB 3N3BC 4PLVA 2EARA 1JIQA 1FSZA 4S05A 1TKCA 5A5VA 4HDMA 1RJEA 4DNOA 5G0SA 2QTTA 2ID8A 1PYDA 1TO2E 4WOJA 4C78A 2VHEA 4UW9A 4N5HX 1VL6A 1J0BA 1A50B 4P4SA 2FK7A 4U7GA 3UT5B 3T1HB 2IIVA 2DJ5A 3E0QA 3U3MA 1LLFA 2EV9A 4MUXA 4P3KA 1TK2A 3R0XA 2WIJA 3M3DA 1V45E 3TNYA 2CLHB 3ZVKA 2AJ8A 2RH5A 2V7VA 3IKJA 4LWQA 4RKRA 1KDVA 2HHHB 4BXOA 2I33A 3JRWA 4MP8A 2VAVA 4RFVA 4UNQA 2P1DA 3LDAA 3AEQB 2ZANA 2FMIA 1AQUA 1GQQA 3U61B 1PR2A 1G21B 1XTIA 1Y5MA 2V55B 2ZI3A 2ZSJA 2SHKA 1ZAYA 3TXXA 4POAA 1ZCFA 4ZALA 4Y0VA 5CLLA 3IQGX 4C6SA 4XWOA 4DW8A 3GEGA 4XEHA 1T5SA 1E0AA 2WZQA 2X1VA 1GG9A 4FDTA 1MORA 5ESRA 3ZH2A 5KNDD 2JLYA 4CF4A 4I4LA 5KSWB 1HR0B 4EFLA 5FOVA 2ONKA 3SKYA 4L7QA 3HCBA 1OLUB 3PI7A 3FD8A 4W1QA 5IVHA 1YDHA 2Z9DA 3SYRA 2EF1A 1HMYA 1ZN2A 2Y0CA 1D8TA 1KGDA 1MGOA 1XNHA 2YWGA 3P2MA 1QFMA 3BCHA 4CM3A 2QMZA 2J48A 2QPAA 3M5CA 1XYVA 4BFVA 3EXG2 2ETXA 4TQUS 4HPJB 1NUPA 2OBLA 4FEGA 1F0KA 4B48A 1KI6A 1AG9A 1UFOA 3T38A 5J2UB 4BV9A 3MIIA 3C7AA 1KYZA 5K6RA 2Z08A 4V0QA 5IANA 2R66A 2H11A 3R5JA 3KWJA 4YXWA 1T8TA 3DOIA 3W8RA 2VHVA 3CXRA 3PI6A 2PT5A 2R2AA 3WLNA 5EJ5A 1DDIA 2CY0A 2EZ9A 2FOXA 3BRQA 4GD3Q 3OQIA 4PU0A 1XJWA 3IQDB 1AMNA 4I55B 4PRKA 3B5JA 1NW3A 5FA5A 2WMDA 3O3MB 3TLAA 5FORA 1XKLA 4J76A 2R48A 2QROA 1Q50A 1JLLB 2Z1MA 3HY3A 2WJHA 3L7NA 2VJBA 1YFZA 2L18A 4IZIA 4UE2A 3U1VA 4C0LA 2JIOA 5EHXA 1EI9A 3GFOA 2I6UA 2BFDB 2N0SA 2NU6A 2Q1XA 3OE1A 4G86A 4JELA 4MGYR 5ALWA 1Z16A 2JPDA 4PRLA 3ZK9A 1V8BA 1SUWA 3FOAA 1GFSA 2ZEJA 1E58A 2F1HA 3KDSE 1UKVY 2PS3A 1W87A 1Y5RA 1QLJA 1UANA 4H35A 5GINE 3GEHA 4OMDA 5ELMA 1HYHA 2HF7A 3EFOA 5IKXA 1I7LA 1X7WA 5K0BA 4MRSA 1YS6A 3EA4A 3I1FA 4KG7A 4OLHA 2ZIUB 2RHCA 2NQTA 1BQ4A 1X92A 3MCWA 3R40A 4PS1A 4TKUB 5AUQA 3HO1A 1M9NA 4S2EA 1HNZB 1X70A 4DB2A 2M9MA 1WEHA 3MJDA 1E1YA 2EL7A 1WZUA 3DMPA 5CXUA 3DMFA 3L7AA 4RLSA 2PKEA 3NJRA 4JUDX 4KI7A 5FTNA 3SIWA 3AFOA 4BUCA 1E4EA 2C4VA 3OCVA 1IHOA 2VQ3A 2XPCA 2H9YA 3EYAA 4OQNA 4GECA 4OXKA 4AWAA 2G67A 1M2HA 3I9KA 1JSZA 1P0CA 2XJ4A 3PXCX 3L8GA 5EWMB 1RWWA 3HE3A 3W5VA 4DB4A 4CLOB 1XUOA 2OYRA 2VPYA 2HFJA 3ZE8A 4LGYA 4GP7A 1YCHA 5E7IA 2ZKLA 1Z08A 3A1DA 2CHQA 1ZR4A 3H97A 1UK7A 2BT4A 3ZY2A 5BRAA 3BB4A 1SQGA 4FHEA 1E1LA 5AK3A 2J9RA 4C7OB 5LJIA 2GZ3A 3UJ7A 2H52A 5DN9A 4YFVA 3C3EA 3DXZA 1NBIA 3SZGA 2E7ZA 3DV9A 3AEUA 3FCOA 4B5LA 3GPLA 1Q0SA 3IQWA 4RDIA 4YT5A 1QHXA 3A4VA 3BC1A 3IUMA 3L4SO 3RC9A 3G9ZA 4F2DA 1H5QA 3V46A 3VXKA 4PPFA 3RYHB 1IQUA 2WPDD 1U2QA 4QC2A 3HM9A 1V48A 1GQRA 3OEWA 4J1QA 2OAGA 3B13B 4F6RA 2H1VA 3N70A 4NCHA 4QTYA 5LR6A 1JPUA 2XT9A 1T91A 1H9AA 4P4UA 5EN4A 2HQBA 2XIJA 5ER9A 1P4GA 5HKKA 2BFFA 1WW2A 1ABEA 2Q9UA 4IWNA 3ABSB 3LY7A 5AI9A 3VZQA 5JVDB 1J07A 4YUXA 2PT9A 5JBQA 5T6MA 4P5PA 3FSRA 1GWNA 1ZM3A 2OGTA 4TS4A 1FFXA 3TLGB 4JKIA 1N3YA 1G4HA 1Z12A 2NT3A 4MYRA 4ZV9A 2VF5X 3G49A 5ICGA 4NYIQ 1XG5A 4E5DA 4ZICA 1ZI8A 5E2AA 1OBCA 2ZB4A 4PHTA 4KOEC 1PKXA 3COSA 3B38A 3UV7A 3K9FC 4U6QA 4ZJUA 1RVDA 2HQSA 2QQEA 3T5AA 1MO6A 3R1IA 4EYEA 3RJ9A 1A9PA 3TLYA 5AIAA 2HA7A 4PYMA 4TZTA 3W0LB 4EKEA 3CMMA 5HR5A 4G9GA 1P44A 5LUAA 3U48A 3RDPA 4PY2A 2LNDA 1U0FA 3IPYA 4YO8A 1TUGA 4HDQB 4Q16A 2P0AA 1ULUA 2Y6UA 4WBNB 4JCOA 2VJMB 2BMDA 1IXYA 3RVDA 3L7KA 3CB4A 3WLKX 2E6UX 5EFOA 5IASA 2O57A 1BW9A 5LLTA 2P6MA 4PM4A 3LBHA 2BEUB 4ONEA 1W76A 4BIIA 5FUQA 1YQQA 3VDXA 3WGJA 1NI3A 3KKPA 2YNMA 4CL8A 1AV6A 3MWYW 3SF8A 2R00A 1VJ0A 3DXYA 4B75A 2CJPA 4F9FA 4M0PA 1GP2A 3OQHA 1IJKA 4ZAYA 1NVFA 2C1ZA 3LO8A 4TZKA 4KQXA 1AOXA 1SOUA 4R54A 2W2QA 1SXHA 1UOPA 5E1MA 1HRDA 5JJ5A 4GXNA 1EEXB 1P3JA 1P1FA 2PMWB 2APJA 3NP7A 4N9WA 4N8DA 1EGQA 3HXKA 5A4KA 5BV7A 3F5DA 4QU0A 4PCVA 1SIBE 5EKUA 2OV4A 2B5VA 1C1XB 5CM2Z 3CF0A 1ZMTA 1JJFA 1HOXA 4EM6A 1PFQA 3PQ4A 1D5WA 4MIYA 2I65A 2QQFA 1SFRA 4I2VA 5EGNA 3E58A 4AF6A 4L4ZA 4UDOA 4WX2B 2E2WA 5E7JA 4RTQA 1VSUA 4JEHA 3CLRD 1SXGA 2RH9B 3FOWA 1F1BA 2QKYA 3V4PB 2VWQA 3NIFB 1N2XA 5T4FA 1N6HA 4NFLA 621PA 4D7AA 4U5QA 4XW2A 1XDSA 3W2HA 5ISMA 5IJ0A 1YVUA 2J6CA 1QB8A 4KYVA 2C5FA 1PBTA 2X0FA 3O4GA 4Z0TA 1J09A 5JH7F 1YU6A 1V6AA 2GHQA 3G5AA 3I2KA 4M1QA 1W6UA 4F9TA 2HRCA 2ZDQA 5DYTA 5FTJA 1R6AA 4RD4A 1Y1TA 2H1IA 2HBRA 5AVWA 3RWMB 3QLJA 4ARCA 3C5CA 4MYCA 1F2DA 2Y76A 1RCUA 2EFEB 3KKKA 2FZ5A 3PSHA 4GOXA 1DAIA 5BR4A 3D0KA 5DHRA 4IIGA 3V9AA 2C3MA 2BFMA 1MH9A 5JPCA 3ZLUA 2Z4SA 4R0MA 4KP7A 4AUMA 5BVGB 3S2YA 4AWXA 2H92A 3FF1A 5GQSA 4GUAA 4L72A 2GFHA 3QU7A 3KBBA 4JAVC 3BXOA 3WG9A 2WZCA 4DF3A 3CLHA 3NP9A 1UM9A 4B4VA 1AV7A 5U1PA 1LBEA 3FCXA 2AHRA 3GUUA 3GAMA 3GI1A 5B4VA 1J9EA 1CRPA 2PZMA 4EUSA 1ZA2A 2OT3B 1OBFO 1RVV1 3AUKA 2IA5A 4AG5A 4C7BA 4I3GA 4CF3A 2FPUA 1TQ4A 3NNDA 2C0PA 3HDVA 4HAWA 5TMDA 1OZ0A 5CVTA 2I0FA 4G41A 4KRXA 4MWSA 1JN0A 4DUGA 3PSAA 4D4LA 1YJXA 4X92A 5EP3A 3W7AA 3F1LA 4EHAA 3IP5A 4FHCA 3W5DA 3PC4A 1UPFA 4L9AA 4EKYA 3GJSA 2QHXA 3VYVA 5DB4A 4OJMX 1DIBA 2B8TA 1T6YA 4QM6A 2QAIA 1HA3A 2ORVA 3E35A 2Y71A 4O4JA 4EKDA 3VVLA 3PL5A 1BWPA 1NVVQ 3MXOA 5EIWA 1N7GA 2QN6A 5KMGB 1W36B 2UU9B 2QY6A 2OHXA 4N0MA 2GN1A 1KI7A 2DM6A 1I7SB 3A11A 1EFAA 1K08A 1K7EB 2UVDA 1VSBA 2FF7A 1E2FA 1XMPA 2ERXA 2TS1A 3E05A 4Q3DA 1T2UA 2IXGA 3HJHA 3NEAA 3H99A 3UAWA 2HQOA 3SXPA 5EUMA 4BGVA 5DNVA 3GRUA 1LY1A 5DLPA 5KNDH 4MR7A 4Q9JA 5F5NA 821PA 1VYHA 3NAZA 1CUJA 2IUYA 4CKWA 2XT0A 3TSWA 4OQYA 1HUQA 4HH3C 4Z5XA 1G5PA 1VBMA 4DT1A 4MINA 1DPFA 3K1AB 1J33A 4KYIB 4PSVA 4OHPA 4C0JA 1FP2A 4RLHA 1DI0A 2W71A 3R24A 5GMOA 2HDNB 1ZHFA 2KM1A 3T7IA 3BSYA 2G4CA 4BLRA 1CQJA 1U8EA 2BW0A 2D7JA 3U0BA 2C4MA 3H1GA 1PX2A 2VRWA 3I2GA 4RMGA 2E5LB 3UAOA 3ZDQA 1GAWA 2DWUA 5DV9A 1K86A 4DLLA 3PUZA 5BN1A 4FNOA 1G98A 2WTAA 3P9PA 3D5EA 4N76A 4KPFC 1PRYA 2EG9A 2FZEA 2EWVA 5C4IA 1CVIA 3ABZA 4BQNA 2C9OA 2WE7A 3QLUC 3WLIA 5B3JA 4BEVA 1S2GA 1E63A 3QH4A 4MR9B 4FOOA 4EGFA 4F9EA 1WF6A 2H8KA 2WUWE 2OGWA 4C0AC 5L3QA 4ENUA 1CG6A 3F74A 3N0VA 1SRRA 2YNMC 4HADA 3CH7A 1PJAA 5K4GA 3K70B 4B8WA 3BD8A 2R00C 1LBIA 2AKYA 3NETA 5DHTA 1SVOA 4LSWA 2DPLA 2NIPA 1PS8A 4RF3A 4ENWA 1DJPA 3YASA 3ZHXA 3U56A 1E3LA 2QL7A 3GCZA 2J59A 2QD2A 1LTHR 1Q6YA 4GSKA 2Y1XA 1MX9A 4JXZA 1JTVA 2W6ZA 2YY5A 4I50F 1Z47A 3EXHC 1XZPA 1U0OC 1WP4A 2Z83A 3HKEA 2YC2C 4O1MA 4BX2A 2AVNA 4KQJA 3VKVA 2ESRA 4G0UA 2PQMA 2HJRA 4X1YB 4J6FA 1EBUA 1ADGA 2JANA 4WCFA 3DPIA 1J8YF 4LQDA 1FSPA 1YR7A 1COZA 1GZVA 1N6NA 4R8VA 1DIAA 1TVKA 1VZ3A 1SA0A 4JB8A 3WQSB 4CMAA 5COAA 1Y8ZA 3Q2IA 5GJBA 1EFHA 1YH3A 2OP1A 4Y2GA 4B35A 3T54A 4PRZA 3M0EA 1E5XA 2ZSFA 4ZWNA 4BLOA 1H6BA 1CTQA 4UFOA 1KETA 5DYIA 3DDHA 1X2BA 3VAZA 5I47A 3F2VA 4NH4A 3A1TA 1S8NA 4DJFC 3RADC 1MQAA 4REOA 8ABPA 1SEVA 2QRKA 2SCUA 2I7VA 2HK9A 2PKCA 1T9HA 2FRVA 3O8OA 2BTEA 3HEAA 3N6VA 1U94A 1U2GC 1VJTA 2DHQA 2K2WA 2C7PA 1WDMA 4GXQA 4U0JA 4DWOA 1FRZA 2JJ1A 2MU1A 4Z4HA 2QAGA 1FQKA 1RWPA 3TQQA 3HBNA 1WB6A 4JSTA 3QITA 3R74A 1IHXA 4K2AA 3VRHA 4NAVA 3GC6A 3VH1A 2GO7A 4HDKB 1ODCA 1J97A 3GFRA 1JZQA 3H3JA 1R0YA 4HRVA 4O0MA 3TX2A 2OLKA 3AESB 4QOIA 1KP2A 1B0PA 1SVIA 3FDIA 3F3MA 3GGDA 3L6RA 4AP9A 1Z8FA 1ZI9A 5I8ZA 2DKOA 4R2WA 4KO8A 2E1PA 1C0PA 4CM7A 4KZKA 1JEQA 1U80A 3LRXA 4MQ5A 3FGZA 4FWTA 4QNMA 3DZFA 5I3ZA 2Z56A 2I34A 3ST7A 1CUAA 1X2EA 3ILVA 4ND6A 1KSHA 1X80A 4CWAA 1O08A 2ONZA 4X6YA 2F1OA 2H3EA 5B1IA 2RHLA 2YASA 4YJFA 3TLEA 1XTJA 1YHZA 3KUDA 4OOEA 4TV9F 3MJEA 4XYLA 3O5AA 4C07A 5EIBD 2YXEA 1E1CA 1CRWG 1E5DA 3IUBA 4K6KA 4LYHA 1MPXA 4R84A 3T4PA 1WCIB 3FETA 4NTZA 1GZHB 3CCBA 3F3YA 3JWPA 4COOA 4F0JA 2BL4A 1YBMA 1G17A 1GCGA 3KZOA 3MFQA 4IO1A 4CEIA 5JFOA 1FYEA 3H3FA 4OL9A 1G64A 4H16A 1Z4IA 1ILWA 4U2BA 5H5JA 3WV4A 4N41A 5U4XA 3ONFA 3U17A 1U81A 1AK2A 4OG2A 3OPQA 4P38A 2XXJA 3HDQA 5MN6A 4NONA 2ZBDA 3I5YA 2BBWA 3E5RA 4BOYA 2HZBA 3WX0A 3TZHA 2F7SA 3VV2A 2O3SA 5BR7A 1FTQA 1QCCA 3NDRA 3L5KA 5TMEA 2KB0A 2PA0A 3OIUA 1WUYA 4CXMA 3GVXA 1DWUA 3DUWA 4TS3A 1W0KD 1CHNA 4DCCA 4F93B 3ZI4A 5G40A 4EDHA 4YI3A 5B2FA 1EG2A 2XODA 2GGSA 3MHTA 3DO8A 4AP6A 2REBA 4DLBA 4E31A 5DTRA 2RHGB 1D7AA 3K7EA 3KZXA 4E1AA 1XPOA 2ZYDA 3NKFA 1U0LA 5TQ0B 2DPMA 1YK0A 4AKIA 2YMMA 3DCYA 3HJRA 5DH9A 3GF4A 3VR6D 3LHSA 5IXYA 4K87A 4K9NA 4KLNA 2IHJA 5JZSA 2A57A 1GKLA 2P62A 4LRYA 5C1IA 2BHNA 3ESCA 4QYSA 5IT4A 1CJBA 1LSUA 5A9SA 1OXXK 1FDOA 2O9JA 1QHYA 1Z3CA 2VP5A 2YN0A 3GMIA 3PFKA 4TQ9A 2FWPA 4GAEA 3RNOA 1USWA 4R8SA 1J0AA 1FNCA 3ICCA 5DGXA 4D8YA 1U7PA 1E2HA 3SZUA 2NP7A 2W2PA 1QDLB 2EWWA 4I4TA 5B3JC 1F5SA 2X7JA 1CZKA 1YR2A 3RK0A 3PEYA 1U7HA 1JKFA 1I2BA 2XMQA 4GYYA 5HTOA 2XIQA 4NV3A 5CURA 3ERCA 3NJ8A 2H9IA 4OHRA 3F67A 3COJA 2JGJA 3L0CA 3W8NA 4ZFNA 4XIFA 1SVWA 3PRKE 2A5DA 1ZN8A 5FA8A 3R6GA 3TI7A 4QUIA 3WDLA 2UZIR 1PJCA 2BJVA 2W6NA 1JFLA 1NFFA 4RZ3A 1DT5A 2HBQA 2Y1DA 4B4KA 4A0QA 2ON6A 3HB0A 2UUAB 4GI7A 1GTVA 4S0ZA 4WTOA 1Z8DA 3SM3A 1LPAB 1V43A 5HILA 3Q4GA 3AV0B 2FP4B 2VBGA 3H1BA 5EXSA 4C4SA 5F9FA 1AK9A 2OMEA 3W2IA 5EVJA 3ZJTA 3TPFA 4RABA 3WWCA 1H2BA 4WCFC 1B3RA 2X8AA 1CERA 1O6BA 1ZGAA 4MI9A 2TMKA 4U6NA 4JDPA 5KSYA