3EGXC

Crystal structure of the mammalian copii-coat protein sec23a/24a complexed with the snare protein sec22b and bound to the transport signal sequence of the snare protein bet1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
157
structure length
135
Chain Sequence
MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRIMVANIEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein transport protein Sec23A
publication title Structural basis of cargo membrane protein discrimination by the human COPII coat machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 33
structure length 135
sequence length 157
ec nomenclature
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3egxC00
3EGXC 1H8MA 2DMWA 3BW6A 1IFQA 3KYQA 2NUPC 2VX8A 4AFIA 4B93A 1IOUA 3EGDC 2NUTC
chains in the Genus database with same CATH superfamily
1XXMA 3LIDA 2JKTM 5F69A 1D06A 1X0OA 4X53A 1L0FA 5U47A 2A49A 1S4SA 3GECA 5CEDA 4NXBA 3MZEA 1RGYA 4GB7A 1T19A 1NYYA 4MBKA 4ARZB 1KVLA 3C38A 4BLMA 4WLAA 3EQVA 1E25A 1G6OA 5CECA 3I7JA 1FR6A 4U0XA 2OAQ1 1K6SA 3MXQA 2V8FA 3SS4A 3ZG9B 3W8KA 3MKEA 4I5SA 3HLEA 1UGUA 1DJBA 2V0UA 1YPRA 2X71A 4KQQA 3G31A 1Y54A 3BRMA 4KUOA 2EX9A 2JCHA 4UAAA 4FTXA 3TE8A 4E04A 3T1RA 4PM8A 1PWGA 5HDDA 5TR7A 2PAVP 3DBAA 1YLWA 3HBRA 1BT5A 3N7WA 2V1ZA 1XX2A 2Y2MA 3T12B 2XEPA 4IHQA 1W5DA 3QP2A 2VK3A 4R4RA 3ZG7B 4OH0A 5FQMA 2B5RA 4P6ZS 4CLCA 5CEBA 2HJEA 3CJMA 1WYCA 2DNSA 3ZVTA 1ZHHB 2BASA 3KYZA 3VE4A 3IWOA 5HL6A 3DTKA 2H5SA 5GLDA 5KSHA 3BEBA 5FQJA 1NZUA 4H6JA 3E4OA 3G34A 3HL9A 1IYOA 1SKOA 3AGFA 4KG5A 5AVFA 4N1HA 2ZLYA 1NRFA 4CLCE 2VKSA 4PHTA 4LV3A 3G32A 4JBFA 4K91A 4OOMA 1ZC2A 3OC2A 3W4OA 4DMZA 3OZHA 5DFXA 1CEFA 1W63M 4DN0A 4IUKA 1LL8A 1A0KA 3LGOA 2Z2MB 1PFLA 2PBYA 2GNXA 2VLGA 3RJUA 4WBGA 3CMZA 2O0YA 3NDGA 2G2UA 3IXDA 1MWSA 2VV6A 2XD5A 1VQQA 4KZBA 2XSSA 4OONA 2NUTC 3QP4A 4EETB 1C3BA 1ESIA 5EV0A 3Q7VB 2KLIA 2PRFA 1MPLA 3MZFA 4OQIA 3IWIA 1ESUA 4R3AA 1K38A 3SH9A 3HLWA 3GSGA 4MMNA 3KSFA 3G2ZA 1SZVA 3P01A 3KSGA 4DE3A 4PM7A 3G35A 3ZHHA 2B18A 5IS1A 1W63Q 2ZQ8A 2Y2GA 4GN2A 3TRCA 1FIKA 4MCWA 1KE4A 4KZ4A 3R4KA 1QMFA 4BL2A 3CI6A 2XROA 3VP0A 4KZ9A 1L0EA 1IKIA 3DWKA 3LY3A 1K56A 4RYEA 3WWXA 4EQIA 1LLBA 4U3TA 3SOIA 3A0SA 3B33A 5BOHA 3E2LA 1I2WA 2Y2LA 3L9KA 4WMCA 4NK3A 3LFVA 2HP9A 1TS6A 4X69A 2DRWA 3FV7A 2ZOIA 2RL3A 1HD8A 4Y15A 2Y2NA 2WGWA 3V3SA 2XRNA 3LIEA 3ZFZA 4DF6A 1F5MA 2PYPA 4CLCB 2H10A 4X1MA 2V2FF 1MWTA 1S0WA 5GHZA 4X56A 1KGEA 2Y59A 2W1RA 4KG6A 5CGSA 3LIFA 3VOZA 3G30A 2ZL1A 2R9WA 5E2FA 4WEJA 5I94A 4UEYA 2VV7A 2XF3A 3GV9A 1YMSA 2Y79A 4HJ4A 2XD1A 1BUEA 1ES2A 4ID4A 3LI9A 4GZBA 3CZDA 1SKOB 3ZCZA 4IUHA 1JTGA 4ZJ3A 3DTMA 5L07A 4BBTA 4PKYG 4WUJA 3UB8A 5A91A 3RXXA 2WKIA 5J3WA 4S2OA 1VHMA 2M7VA 2FH5A 4MDZA 5G4ZA 4Y0TA 4DDSA 3BY9A 3KO6A 3WS2A 4Y13A 5A8BA 4WZ5C 3UPPA 1BYWA 3S7QA 2J8YA 1YLTA 4NXGA 2ZQ7A 3IXBA 2VX8A 1YSQA 4G3VA 1Y28A 4OQGA 2MJ6A 1W79A 2O9AA 1RGZA 3K3DA 3GDIA 3VFHA 1EW0A 1TVFA 2Y2KA 5M1AA 4LV2A 4MNRA 3RTYA 4L9FA 3W4PA 1CF0A 3F1PA 4Y17A 3VOYA 1LSVA 5AJGA 3BJNA 1UWNX 3VSLA 4C3QA 4ETXA 2XGNA 1K56D 2WKHA 4R70A 1N9NA 1TS8A 2XDMA 4JPMA 5A92A 4QHCA 4BBUA 3LY4A 2QJ7A 3NULA 1KE0A 3NOPC 3HVFA 3S7OA 1KOUA 3A3JA 2PBDP 1BLCA 5FA7A 4B88A 4WMCD 1K54A 2WZXA 1Q2QA 1VETB 2J3WA 3UB6A 3BW6A 3IXGA 3M6BA 3O87A 1LSXA 1STZA 4WZ5A 5MC7A 1ONHA 3FPWA 2W0NA 2HP6A 4WZ4A 3C30A 4R0QA 1OTEA 4R38A 1S66L 4K08A 5F1GA 4HY8A 2VGLM 4QB8A 4BJPA 4KUKA 2ZQDA 2HGVA 4FCFA 4BWIA 3CAXA 1P97A 5FQKA 3UMDA 4D2OA 3DW0A 1S1ZA 2O9CA 2UWXA 5DF8A 1FCNA 4E6XA 2NUPC 2PD7A 2R78A 1L3LA 2ZMVA 1MC0A 2C5WB 4OLGA 2A2LA 3E4PA 3H82A 3NDEA 1K57A 3N6IA 4KZ6A 5HDCA 2ZC6B 3MZDA 1G28A 4Q0JA 1CJFA 4LRXC 5FL3A 3VE3A 1G6AA 3K2NA 3ISGA 4ZBEA 1GSWA 2ZL1B 3QNBA 5HPIA 3N8SA 1MKIA 1S1YA 5M18A 2XH9A 3OOVA 4WF0A 2WGIA 4NEED 4RX3A 2JKTI 3QNCA 2HPBA 1PW8A 4EQ1A 3W4QA 2QHKA 1MZUA 2IWCA 2VV8A 4EEPA 1D1JA 1XGIA 5GL9A 1PWDA 1XA1A 3VSKA 3F1NA 4KQOA 5FASA 1DJAA 1EI5A 2V0WA 1OTAA 3QP6A 3A3DA 1T1AA 1NY0A 4GJ4A 1T1CA 5TGFA 2A24B 3BM6A 1K4FA 4BL3A 3WRZA 3ZG0A 4IEDA 4OQHA 3Q07A 4P87A 3PBTA 5J8XA 3CG5A 1Y4OA 5E43A 1S67L 5A90A 3NOTC 5GHYA 4B9OA 4JF5A 3R7WA 4NXFA 5FAOA 1H8ZA 3HLFA 2Y2JA 1BSGA 1XJ3A 5C5KA 5TBMA 1CEGA 2J9OA 3OCNA 3AGEA 3ZG8B 3F1PB 2WK0A 2ZMAA 5GLBA 1G68A 4LPZA 2FFFB 4IBRA 4PMAA 2XFSA 1K6RA 5EVIC 1MKMA 3ZYTA 2Y55A 5FAPA 4DJ2A 4OPYA 1HVBA 2XA7M 3UB9A 4PM9A 3C8CA 3LCEA 4GDBA 4KZ5A 1OTBA 4XUZA 4GCZA 4KENB 2QPNA 2P9VA 5F82A 2C6WB 2L1MA 1DJCA 2GDNA 3ZNTA 1OJ5A 1KGFA 3K3CA 4GS9A 3BQAA 3ZVWA 5J4EA 5CTMA 3IF6C 4N1XA 5GLAA 4CJNA 4JGOA 2OV5A 2M1CA 3HLDA 2K31A 1W8YA 5DKLA 3VP4A 2Z6DA 3S4XA 3LYXA 5AQAA 3OPLA 1TF1A 2R9XA 2EWVA 3LI8A 2WAFA 4M3KA 4Z1WA 2VGJA 4PKYA 5AQBA 5HD3A 4F3LA 3PR6A 2UV0E 4YOFA 3V39A 3B3XA 4N92A 5F1FA 5EVIA 1H3QA 1HTZA 3H7WA 1ZKJA 3IS2A 2OSUA 3S7NA 4JKTA 3SS3A 3EEAA 3A0RA 4DDYA 3IQAA 4I39A 3G6OA 3MQOA 4EWFA 4S2IA 1JVJA 1DP8A 4LGWA 2J3TC 4Y5FA 5HX9A 5CHJA 5LBRA 5TJJA 2V8CA 2EX8A 4GDNA 3LO7A 1GA0A 4MN6A 1XGJA 5KSCA 4HBUA 3UO9A 1ZG6A 4P6ZM 4B93A 1TS7A 3IF6A 5EOOA 5DVAA 4R1GA 2PR6A 3E2KA 4QY6A 1GCEA 4QY5A 2A3UA 2ZJ9A 1OMEA 4OQ0A 3D9YA 4EXOA 4Y0UA 3MMHA 3S22A 3U2AA 3VMAA 2X02A 3W2ZA 4X1LA 1L2SA 3FG8A 4EW7A 5HFOA 1P9WA 3CHWP 5KMWA 4ZDXA 5KZHA 2LB5A 1V9YA 2ZMFA 3OPPA 4HP9A 1Z6FA 1YLYA 3PBNA 3R7WB 1IELA 3EQUA 1ALQA 1DP9A 3PHYA 4RVAA 2KOIA 5HWTA 3T4TA 3BLSA 4MBFA 2HDSA 2WYXA 4YINA 3IHBA 5FI7A 3GTCA 3MXSA 2HDQA 4IBXA 4MN7A 3IBRA 1Z09A 4HH2A 4EESA 4NKPA 2EXBA 3EEHA 3C7UA 4QJGA 2EXAA 3JYIA 1GSVA 1J3WA 3MSHA 4U0TA 1VEUA 2Y4AA 4P6BA 3N8RA 3KSIA 2JN7A 1WE4A 3HLBA 2VJWA 2ZM2A 3ULFA 3C4OA 4Y7PA 4GKUA 3O86A 3CPTA 4FH2A 3GMWA 4I3AA 4HBTA 2P9VB 2KDKA 3SH7A 2ZC5B 3OLOA 5EVEA 3FPVA 2JBFA 3PAGA 3UB7A 5IU1A 1KDWA 2PDRA 2INWA 4Y0OA 1K4EA 3EWKA 3UNWA 5CTNA 3C5AA 3PTEA 1PIOA 2OOLA 1W8QA 1HLUP 1I2SA 5D3OA 1SHVA 5EVID 4G3KA 4X68A 2JKRM 3VFFA 1VB6A 4LRYC 3KYEA 4B4ZA 1OT6A 3VV4A 3A3FA 3SW1A 1RCJA 3MJQA 2VEAA 2WKEA 5F5YA 4LENA 2QJ5A 3ITAA 3LR5A 2HJ9C 1PW1A 1OJGA 1YLZA 1JWVA 1FSWA 1IOUA 3T4OA 2P04A 4OP5A 4AFIA 4E3KA 1SCWA 3P09A 3LUQA 1H5XA 3UE6A 3ZG5A 3NCKA 1F9IA 3G4PA 1T1BA 4H6JB 2ZC3B 2Z2LB 3H7WB 3A3EA 5L2FA 4EV4A 5F83A 4KQDA 3V50A 2PU4A 5FQ9A 1LL9A 5CGXA 5FSRA 2ZD8A 5EM1A 3PBQA 5CRFA 5L8MA 1FSYA 2P7JA 4LLOB 5FDSA 3G2YA 1ONGA 3QP5A 4ZTKA 2H28A 2ZM8A 5HDSA 4RA7A 4ESPA 1HZOA 3HJKA 4JF4A 2D02A 3Q82A 5F68A 2I9VA 3UE0A 2WGVA 1W7FA 3O3VA 4HHDA 2E8IA 3E4QA 1MWUA 4GHIA 2J3TD 1XFNA 3BFCA 3VP3A 1N9OA 1EWZA 1M40A 4OLDA 3C2WA 4M4XA 1DY6A 4E3MA 4X6TA 3SH8A 3C7VA 4C75A 4ARZA 3HUMA 1PZPA 4UA9A 4MN5A 4HESA 2WAEA 1K55C 5EOEA 3PBRA 4E6WA 1FR1A 4HP4A 1CI9A 1E4DA 4OOYA 1PNEA 5M19A 2CC1A 4PPRA 1FQGA 3ZDJA 1XJ6A 3MF0A 4Q0IA 4YFMA 2VZWA 2W27A 2WKRA 1KE3A 4C6YA 3SS5A 4BQMA 1RP5A 4QD4A 4MBHA 5IT5A 4UQIS 5E2HA 1LI0A 4KZ7A 3IHAA 2WUQA 3FWLA 2ZC4B 4GD8A 2QKPA 1YSPA 3OPRA 1S4RA 4RQ9A 3CPTB 2O99A 3T4LA 1ODVA 2Y2QA 1NYMA 4OVDA 4II7A 2EX2A 3IX8A 4ZRRA 2JE5A 2HF6A 2Q0OA 1IYQA 3PBSA 3T4SA 4OPZA 2WGWB 5E2EA 4O0PA 1AXBA 3H9WA 2W3GA 4O7DA 3VP1A 4EBLA 3MFXA 5CERA 3JVVA 2OWJA 4BD0A 3LR3A 3RH8B 1N9BA 4N9KA 3GQZA 2V9AA 3T4QA 4LV1A 2M7UA 3WRTA 1BTLA 5CGWA 2XFTA 5HWWA 1Q2PA 3FKVA 2G7UA 5G4YA 1LI9A 4F94A 2Y2IA 3UDIA 1KDSA 2PT7A 4Q0HA 4HI4A 5L10A 4X55A 3ZQ5A 1XA7A 4I3IA 5FI2A 5FDHA 1JWPA 2IWBA 3IT9A 1K25A 4ZJ2A 2BLSA 3FYZA 2OAP1 1BZAA 4EU0A 1YAXA 2Q9NA 1AWIA 3JVUA 1P0ZA 3Q7VA 2J7VA 4G3WA 4S2PA 3BWLA 5FATA 3ICYA 5DFYA 1ERQA 5DF7A 1UWPX 4HJ3A 2IA2A 5EUAA 1PI4A 1BLSA 3SZTA 4GHIB 1VM1A 3B42A 4CLCC 2HV1A 3M2JA 5HAPA 3Q1FA 1N9LA 2EA9A 1ES5A 4JXWA 1WYBA 3BQ8A 4OPQA 3LEZA 1ACFA 3EOIA 2HZ5A 3LIAA 2X01A 3QHYA 4KQRA 5E2GA 1G5UA 1YQSA 2P74A 3E98A 3BFDA 4CPKA 3TJZC 1YKDA 4GOGA 3MQ0A 2H0TA 3NECA 3CITA 1MBLA 1FOFA 5EM0A 3D3OA 4JGPA 4S2LA 1LHYA 4BMWA 4N9LA 4S2MA 3BY8A 2O9BA 4H8RA 3OBFA 3NOUC 4B4XA 3TSGA 1MWRA 4FD8A 1DP6A 1E3UA 1F98A 3FKWA 2GZAA 3GRJA 4Z9QA 2WKQA 2E8JA 2Y2HA 1GHMA 3KYQA 4A5RA 2XK1A 4IVKA 3NJAA 3KSHA 4LCMA 1CK3A 4JGQA 3UPOA 4FUWA 2AVXA 2RCXA 1ZG4A 2ZQ9A 4I38A 4NETA 3OCLA 2K2NA 4Q8IA 4JXGA 3IH9A 3DWZA 3N4IA 2JC7A 3D4FA 3H82B 3VP2A 4X25A 3LICA 4MEZA 4GLQA 5HARA 5CHUA 4HQAA 3HLGA 1XP4A 1LT0A 4EBPA 1YLJA 5GLCA 1L0DA 3S7PA 4PM5A 3IXHA 2Z6CA 4QWOA 4IJGA 4NG2A 2QWSA 1TD5A 4FSFA 4WN5A 5DJTA 5JYOA 4WL9A 3B47A 3O88A 1N4OA 3UE1A 3LIBA 5IHVA 3HJIA 4IVIA 1KGGA 3M2KA 4E3NA 1QMEA 1BLHA 5HZHA 3F1NB 2Q9MA 1I5QA 2PU2A 4S2JA 4HEFA 3PXPA 1GSXA 4LCLA 1YM1A 2B02A 5K5BA 1LSWA 4OOLA 3ZNYA 3MFDA 5I5LA 5CHMA 4GNUA 3MS6A 4HIAA 5F6AA 3MR0A 1IFQA 3BECA 2J80A 3FZCA 1NJ4A 3L7HA 4UHUA 3EGXC 2LB9A 4KZ8A 3T4KA 1ZTUA 1TDLA 2JHEA 3U4LP 3NC8A 3C4PA 3CLOA 4KZAA 2EFXA 2YKHA 4DE2A 2Y2PA 4JXVA 5TBMB 2VGKA 4HJ6A 1OT9A 1NLYA 1MY8A 1TEMA 4R6LA 5DF9A 2OLVA 3TOIA 3T1SA 1V9ZA 1CQAA 1XPBA 1LL5A 5FEFA 3DTIA 1O7EA 2JKRI 4DJ3A 3BLMA 3NI9A 1SDNA 2W1TA 3V3RA 3HUOA 1VETA 2QMIA 2EFUA 4UA7A 1E3UD 4JF6A 1ERMA 2H0YA 4OP8A 2OWHA 3FC7A 1YLPA 4S2KA 4ZJ1A 3UY6A 4MLLA 4LRZE 3T1QB 4E3OA 5L09A 3UPNA 4D60A 1J9MA 2IWDA 1DRMA 4ETZA 4EERA 2ZM0A 2Y91A 5AVEA 4WEKA 4YNRA 3RFBA 4CLCD 3BYDA 2EWWA 1ES4A 4GS9B 1FCMA 5EECA 1OPXA 1GHPA 1SKFA 3P98A 2WADA 3GR2A 4ME4A 1K0KA 3RXWA 3VOLA 3QP8A 2JKFA 2HDUA 4HNBA 1P9RA 2XQZA 4XUXA 4KZ3A 4K0XA 4O8GA 5HW3A 1WA9A 3F1OA 2L0WA 3BFEA 4O01A 1CI8A 3IWQA 2PHYA 3P7NA 3LR0A 1D7EA 4F3LB 3UE3A 3WS5A 4ZAMA 4BBVA 4L9GA 1IKGA 2PR5A 4FH4A 3CUEC 3HCYA 4XT2A 2WKPA 1F2KA 5AQ9A 5EVIB 3UB5P 2QZ6A 3IS2B 3WS1A 4EUVA 5EPHA 5GHXA 4E3JA 2PD8A 2HP5A 3MXRA 4DXBA 3IX3A 1ES3A 4I3JA 5FQQA 1T18A 5EFWA 4RX2A 1JWZA 4KG2A 1SDEA 4R3BA 3O5YA 1BLPA 1S6RA 4LFUA 2W3FA 2OLUA 2QYBA 4EBNA 5DTKA 4DRTA 4JGRA 1K54C 2G2WA 5J7EA 4EEUA 5TFQA 4LV0A 1NWZA 3IF6B 2A24A 3CWFA 5EVLA 1YT4A 2V20A 2GX5A 2Y8HA 1PRQA 2KX6A 4HOIA 5DTSA 1FILA 2J9PA 4CQHA 4QPRA 2W3EA 1IEMA 1TDGA 5EE8A 4DXCA 3MQQA 5HD5A 3IX4A 5AQ7A 1EROA 3TW8A 5KIZA 3CUEA 4R23A 5FI6A 3IF5A 3NIAA 3IH8A 2VGLS 5HAQA 2ZBBA 2WZZA 3ITBA 1H8MA 3HLCA 2ZC7A 3HUNA 5HWVA 1YMXA 4S2NC 4OKPA 4QU3A 3UMEA 2D01A 1K57C 3A0VA 1PZOA 1FCOA 4DE1A 3T50A 3M6HA 4K0WA 1OTDA 1L0GA 4R4SA 4YWZA 1H8YA 5DKKA 1NZOA 3UN7A 1JTDA 2ZQAA 1IYPA 4Y2FA 5CX7A 3TG9A 1O07A 2V1AA 3A3IA 1NRJA 1VEUB 2BTFP 4E3IA 2W1TB 4BD1A 2L4RA 3T4JA 2ACGA 3E0YA 4UA6A 1H0MA 4DE0A 2Y2OA 2EX6A 2K7SA 5FQIA 2HDRA 4PAUA 2V1BA 4Y3IA 3NY4A 1GHIA 2I72A 4WELA 3LR4A 3MKFA 2W3HA 3NBLA 4FOFA 4PM6A 4DKIA 3D72A 2ZOHA 5A93A 1PWCA 1XFQA 1XJ2A 2DCFA 4EUZA 5HL1A 4XXRA 4E3LA 3HREA 1K55A 4GW9A 3N8LA 2P08A 3Q7ZA 3QP1A 2PYRA 3UDFA 2CMNA 5HAIA 3F1OB 1NLZA 1OTIA 2YKFA 1U60A 4S2NA 3IBJA 4BENA 4P85A 1NXYA 1MXOA 4WYYA 3PAEA 4P0MA 3GVBA 3PBOA 4UQIM 5HSQA 5JYPA 2GJ3A 4XT2B 3BFGA 3EGDC 2DMWA 3T1XA 2ZQCA 1IYSA 5HPFA 3LEQA 2XR0A 1GA9A 5CXWA 4R3JA 4OPRA 1XJ4A 2BG1A 1JNUA 3ZGAB 3DTEA 1PYYA 2VA0A 4L9EA 3S1YA 1M6KA 4JLFA 4GD6A 3KX0X 4WM9A 5DTTA 2FZ0A 2JKGA 3WS0A 2XA7S 3WS4A 4JXSA 1PI5A 3DAVA 2XLNA 5FAQA 2FFYA 1BULA 3AGDA 3NHQA 5DJUA 5FEGA 4L0LA 3JPUA 5G18A 3BFFA 1XKZA 2W3DA 4HH3A 3Q81A 2B95A 4NXEA 3V67A 1TS0A 3V5MA 3UDXA 3OPHA 1KVMA 3MBZA 3PYPA
chains in the Genus database with same CATH topology
1VB6A 4WL9A 4LRYC 3B47A 1OT6A 3VV4A 3LIDA 2JKTM 5F69A 3SW1A 3LIBA 1D06A 1X0OA 3MJQA 2VEAA 5F5YA 2J3WA 3HJIA 3UB6A 2QJ5A 3LR5A 2HJ9C 1S4SA 3GECA 3BW6A 1OJGA 1LSXA 4NXBA 1STZA 1T19A 5MC7A 5HZHA 3F1NB 3FPWA 4ARZB 2W0NA 1IOUA 3C38A 3PXPA 3T4OA 2P04A 4WLAA 3EQVA 1GSXA 3C30A 4AFIA 2B02A 1G6OA 1OTEA 4R38A 1S66L 4K08A 5K5BA 1LSWA 3LUQA 3UE6A 4OOLA 5I5LA 1F9IA 1T1BA 4H6JB 4HY8A 2OAQ1 2VGLM 3MXQA 4BJPA 4KUKA 2HGVA 3H7WB 4HIAA 5F6AA 3MR0A 1IFQA 4BWIA 3CAXA 1P97A 2J80A 4I5SA 4KQDA 3UMDA 1S1ZA 2O9CA 1UGUA 2V0UA 3EGXC 2LB9A 2NUPC 2PD7A 2R78A 4KUOA 2ZMVA 3T4KA 3PBQA 1ZTUA 5L8MA 1MC0A 2JHEA 3TE8A 3CLOA 4E04A 2A2LA 2P7JA 3E4PA 3H82A 4LLOB 2YKHA 5HDDA 5TBMB 5HDCA 4HJ6A 1G28A 4Q0JA 3DBAA 2H28A 1OT9A 1NLYA 4LRXC 4R6LA 5FL3A 3VE3A 5DF9A 3K2NA 5HDSA 1GSWA 1V9ZA 3HJKA 2D02A 5HPIA 5F68A 1S1YA 4IHQA 3OOVA 2JKRI 4WF0A 4DJ3A 2I9VA 4P6ZS 4NEED 4HHDA 4CLCA 2W1TA 3E4QA 4GHIA 2JKTI 2J3TD 1XFNA 2OWHA 2HJEA 3FC7A 4EQ1A 1N9OA 4LRZE 2QHKA 1MZUA 1ZHHB 2VV8A 4EEPA 2BASA 3C2WA 3KYZA 4M4XA 3VE4A 1DRMA 4ETZA 3F1NA 4KQOA 5HL6A 4ARZA 4EERA 5KSHA 5AVEA 2V0WA 4WEKA 4YNRA 3RFBA 1OTAA 4CLCD 4MN5A 2EWWA 4GS9B 1T1AA 4GJ4A 1T1CA 4H6JA 3E4OA 3PBRA 1OPXA 2A24B 4HP4A 4ME4A 5AVFA 3VOLA 4HNBA 4CLCE 1P9RA 3PBTA 2VKSA 4PHTA 1XJ6A 3MF0A 4Q0IA 4O8GA 2VZWA 4OOMA 2W27A 2WKRA 1S67L 1WA9A 3NOTC 3F1OA 2L0WA 4O01A 4B9OA 3OC2A 2PHYA 3R7WA 3P7NA 5IT5A 4NXFA 4DMZA 3LR0A 1D7EA 4UQIS 5DFXA 5TBMA 1XJ3A 5C5KA 1W63M 4DN0A 4F3LB 3UE3A 4BBVA 3OCNA 4IUKA 1LL8A 4L9GA 2PR5A 3F1PB 2GNXA 3CUEC 2VLGA 3HCYA 4XT2A 2QKPA 2WKPA 1YSPA 2O0YA 1S4RA 4RQ9A 4LPZA 3IS2B 2O99A 3T4LA 4EUVA 2VV6A 1MKMA 1ODVA 3ZYTA 4II7A 2PD8A 2XSSA 4DJ2A 4ZRRA 2XA7M 3UB9A 2HF6A 3C8CA 2NUTC 4EETB 4I3JA 1T18A 5EFWA 3PBSA 2KLIA 3T4SA 1OTBA 4R3AA 4GCZA 4O0PA 3O5YA 3H9WA 2W3GA 2W3FA 2QYBA 2L1MA 4MMNA 1OJ5A 4JGRA 3KSFA 3MFXA 3K3CA 5J7EA 4EEUA 4GS9A 3JVVA 2OWJA 3BQAA 1NWZA 3P01A 5J4EA 3LR3A 3KSGA 3RH8B 2A24A 3CWFA 2V9AA 2GX5A 4JGOA 2M1CA 2Y8HA 2B18A 3T4QA 5IS1A 1W63Q 2KX6A 2M7UA 4HOIA 2K31A 5HWWA 5DKLA 3TRCA 4MCWA 2Z6DA 3R4KA 2G7UA 3LYXA 5G4YA 1TF1A 4CQHA 4QPRA 3CI6A 2XROA 2EWVA 2W3EA 3LI8A 4Z1WA 3MQQA 4PKYA 5HD3A 5HD5A 4F3LA 3TW8A 5KIZA 2PT7A 3CUEA 4Q0HA 3PR6A 3A0SA 4HI4A 4YOFA 3ZQ5A 2VGLS 3B33A 4I3IA 2ZBBA 1H8MA 1H3QA 3H7WA 5HWVA 3IS2A 3LFVA 1TS6A 2OAP1 3UMEA 2D01A 3S7NA 3EEAA 4EU0A 3A0RA 3A0VA 4I39A 3G6OA 3MQOA 1YAXA 3T50A 1DP8A 2ZOIA 3JVUA 1OTDA 4YWZA 2J3TC 4Y5FA 1P0ZA 5LBRA 5TJJA 5DKKA 4G3WA 4Y2FA 5CX7A 2XRNA 3BWLA 4MN6A 3LIEA 3ICYA 5DFYA 2V1AA 1UWPX 1NRJA 1F5MA 4HJ3A 2IA2A 2PYPA 4CLCB 2W1TB 4GHIB 2L4RA 3T4JA 3B42A 4CLCC 2W1RA 4P6ZM 4B93A 3LIFA 3E0YA 1TS7A 2HV1A 1N9LA 2K7SA 2EA9A 2PR6A 4PAUA 4WEJA 2V1BA 3BQ8A 4Y3IA 4UEYA 2VV7A 4WELA 3LR4A 3EOIA 4FOFA 3LIAA 2W3HA 2Y79A 4HJ4A 4EXOA 3D72A 3MMHA 3E98A 2ZOHA 3TJZC 1YKDA 1XFQA 1XJ2A 3LI9A 3MQ0A 3U2AA 3CITA 4IUHA 3W2ZA 3FG8A 4EW7A 3D3OA 4JGPA 1P9WA 4BBTA 4PKYG 4WUJA 3UB8A 4BMWA 4GW9A 2LB5A 2P08A 5J3WA 1V9YA 2M7VA 1VHMA 2ZMFA 2PYRA 2CMNA 3F1OB 2FH5A 3BY8A 4HP9A 1NLZA 1OTIA 2YKFA 4MDZA 5G4ZA 3IBJA 3PBNA 3R7WB 2O9BA 3BY9A 3KO6A 3EQUA 3OBFA 1DP9A 3NOUC 3PHYA 2KOIA 5HWTA 5A8BA 3T4TA 3PBOA 4UQIM 1DP6A 1BYWA 3S7QA 5HSQA 1F98A 4NXGA 2GZAA 2GJ3A 2WKQA 2VX8A 4XT2B 1YSQA 4G3VA 1Y28A 3EGDC 4MN7A 3IBRA 2MJ6A 3KYQA 2DMWA 4HH2A 2O9AA 4NKPA 4EESA 3K3DA 3NJAA 3KSHA 3GDIA 5HPFA 1EW0A 3EEHA 4JGQA 1GSVA 3RTYA 4L9FA 1XJ4A 3KSIA 1JNUA 2JN7A 4I38A 3F1PA 2VJWA 2VA0A 1LSVA 2K2NA 3OCLA 4L9EA 5AJGA 3ULFA 3BJNA 1UWNX 3KX0X 3H82B 4I3AA 4ETXA 2FZ0A 2XA7S 2KDKA 4R70A 3LICA 4GLQA 1N9NA 4HQAA 1TS8A 3OLOA 3FPVA 3UB7A 5IU1A 1LT0A 2PDRA 2INWA 3NHQA 5DJUA 4BBUA 4L0LA 3EWKA 3S7PA 2QJ7A 2OOLA 2Z6CA 3NOPC 2W3DA 4IJGA 4HH3A 3S7OA 2QWSA 4G3KA 4NXEA 1KOUA 3V67A 1TD5A 1TS0A 2JKRM 4FSFA 4WN5A 5DJTA 3PYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGX C;  1H8M A;  2DMW A;  3BW6 A;  1IFQ A;  3KYQ A;  2NUP C;  2VX8 A;  4AFI A;  4B93 A;  1IOU A;  3EGD C;  2NUT C; 
#chains in the Genus database with same CATH topology
 1XXM A;  3LID A;  2JKT M;  5F69 A;  1D06 A;  1X0O A;  4X53 A;  1L0F A;  5U47 A;  2A49 A;  1S4S A;  3GEC A;  5CED A;  4NXB A;  3MZE A;  1RGY A;  4GB7 A;  1T19 A;  1NYY A;  4MBK A;  4ARZ B;  1KVL A;  3C38 A;  4BLM A;  4WLA A;  3EQV A;  1E25 A;  1G6O A;  5CEC A;  3I7J A;  1FR6 A;  4U0X A;  2OAQ 1;  1K6S A;  3MXQ A;  2V8F A;  3SS4 A;  3ZG9 B;  3W8K A;  3MKE A;  4I5S A;  3HLE A;  1UGU A;  1DJB A;  2V0U A;  1YPR A;  2X71 A;  4KQQ A;  3G31 A;  1Y54 A;  3BRM A;  4KUO A;  2EX9 A;  2JCH A;  4UAA A;  4FTX A;  3TE8 A;  4E04 A;  3T1R A;  4PM8 A;  1PWG A;  5HDD A;  5TR7 A;  2PAV P;  3DBA A;  1YLW A;  3HBR A;  1BT5 A;  3N7W A;  2V1Z A;  1XX2 A;  2Y2M A;  3T12 B;  2XEP A;  4IHQ A;  1W5D A;  3QP2 A;  2VK3 A;  4R4R A;  3ZG7 B;  4OH0 A;  5FQM A;  2B5R A;  4P6Z S;  4CLC A;  5CEB A;  2HJE A;  3CJM A;  1WYC A;  2DNS A;  3ZVT A;  1ZHH B;  2BAS A;  3KYZ A;  3VE4 A;  3IWO A;  5HL6 A;  3DTK A;  2H5S A;  5GLD A;  5KSH A;  3BEB A;  5FQJ A;  1NZU A;  4H6J A;  3E4O A;  3G34 A;  3HL9 A;  1IYO A;  1SKO A;  3AGF A;  4KG5 A;  5AVF A;  4N1H A;  2ZLY A;  1NRF A;  4CLC E;  2VKS A;  4PHT A;  4LV3 A;  3G32 A;  4JBF A;  4K91 A;  4OOM A;  1ZC2 A;  3OC2 A;  3W4O A;  4DMZ A;  3OZH A;  5DFX A;  1CEF A;  1W63 M;  4DN0 A;  4IUK A;  1LL8 A;  1A0K A;  3LGO A;  2Z2M B;  1PFL A;  2PBY A;  2GNX A;  2VLG A;  3RJU A;  4WBG A;  3CMZ A;  2O0Y A;  3NDG A;  2G2U A;  3IXD A;  1MWS A;  2VV6 A;  2XD5 A;  1VQQ A;  4KZB A;  2XSS A;  4OON A;  2NUT C;  3QP4 A;  4EET B;  1C3B A;  1ESI A;  5EV0 A;  3Q7V B;  2KLI A;  2PRF A;  1MPL A;  3MZF A;  4OQI A;  3IWI A;  1ESU A;  4R3A A;  1K38 A;  3SH9 A;  3HLW A;  3GSG A;  4MMN A;  3KSF A;  3G2Z A;  1SZV A;  3P01 A;  3KSG A;  4DE3 A;  4PM7 A;  3G35 A;  3ZHH A;  2B18 A;  5IS1 A;  1W63 Q;  2ZQ8 A;  2Y2G A;  4GN2 A;  3TRC A;  1FIK A;  4MCW A;  1KE4 A;  4KZ4 A;  3R4K A;  1QMF A;  4BL2 A;  3CI6 A;  2XRO A;  3VP0 A;  4KZ9 A;  1L0E A;  1IKI A;  3DWK A;  3LY3 A;  1K56 A;  4RYE A;  3WWX A;  4EQI A;  1LLB A;  4U3T A;  3SOI A;  3A0S A;  3B33 A;  5BOH A;  3E2L A;  1I2W A;  2Y2L A;  3L9K A;  4WMC A;  4NK3 A;  3LFV A;  2HP9 A;  1TS6 A;  4X69 A;  2DRW A;  3FV7 A;  2ZOI A;  2RL3 A;  1HD8 A;  4Y15 A;  2Y2N A;  2WGW A;  3V3S A;  2XRN A;  3LIE A;  3ZFZ A;  4DF6 A;  1F5M A;  2PYP A;  4CLC B;  2H10 A;  4X1M A;  2V2F F;  1MWT A;  1S0W A;  5GHZ A;  4X56 A;  1KGE A;  2Y59 A;  2W1R A;  4KG6 A;  5CGS A;  3LIF A;  3VOZ A;  3G30 A;  2ZL1 A;  2R9W A;  5E2F A;  4WEJ A;  5I94 A;  4UEY A;  2VV7 A;  2XF3 A;  3GV9 A;  1YMS A;  2Y79 A;  4HJ4 A;  2XD1 A;  1BUE A;  1ES2 A;  4ID4 A;  3LI9 A;  4GZB A;  3CZD A;  1SKO B;  3ZCZ A;  4IUH A;  1JTG A;  4ZJ3 A;  3DTM A;  5L07 A;  4BBT A;  4PKY G;  4WUJ A;  3UB8 A;  5A91 A;  3RXX A;  2WKI A;  5J3W A;  4S2O A;  1VHM A;  2M7V A;  2FH5 A;  4MDZ A;  5G4Z A;  4Y0T A;  4DDS A;  3BY9 A;  3KO6 A;  3WS2 A;  4Y13 A;  5A8B A;  4WZ5 C;  3UPP A;  1BYW A;  3S7Q A;  2J8Y A;  1YLT A;  4NXG A;  2ZQ7 A;  3IXB A;  2VX8 A;  1YSQ A;  4G3V A;  1Y28 A;  4OQG A;  2MJ6 A;  1W79 A;  2O9A A;  1RGZ A;  3K3D A;  3GDI A;  3VFH A;  1EW0 A;  1TVF A;  2Y2K A;  5M1A A;  4LV2 A;  4MNR A;  3RTY A;  4L9F A;  3W4P A;  1CF0 A;  3F1P A;  4Y17 A;  3VOY A;  1LSV A;  5AJG A;  3BJN A;  1UWN X;  3VSL A;  4C3Q A;  4ETX A;  2XGN A;  1K56 D;  2WKH A;  4R70 A;  1N9N A;  1TS8 A;  2XDM A;  4JPM A;  5A92 A;  4QHC A;  4BBU A;  3LY4 A;  2QJ7 A;  3NUL A;  1KE0 A;  3NOP C;  3HVF A;  3S7O A;  1KOU A;  3A3J A;  2PBD P;  1BLC A;  5FA7 A;  4B88 A;  4WMC D;  1K54 A;  2WZX A;  1Q2Q A;  1VET B;  2J3W A;  3UB6 A;  3BW6 A;  3IXG A;  3M6B A;  3O87 A;  1LSX A;  1STZ A;  4WZ5 A;  5MC7 A;  1ONH A;  3FPW A;  2W0N A;  2HP6 A;  4WZ4 A;  3C30 A;  4R0Q A;  1OTE A;  4R38 A;  1S66 L;  4K08 A;  5F1G A;  4HY8 A;  2VGL M;  4QB8 A;  4BJP A;  4KUK A;  2ZQD A;  2HGV A;  4FCF A;  4BWI A;  3CAX A;  1P97 A;  5FQK A;  3UMD A;  4D2O A;  3DW0 A;  1S1Z A;  2O9C A;  2UWX A;  5DF8 A;  1FCN A;  4E6X A;  2NUP C;  2PD7 A;  2R78 A;  1L3L A;  2ZMV A;  1MC0 A;  2C5W B;  4OLG A;  2A2L A;  3E4P A;  3H82 A;  3NDE A;  1K57 A;  3N6I A;  4KZ6 A;  5HDC A;  2ZC6 B;  3MZD A;  1G28 A;  4Q0J A;  1CJF A;  4LRX C;  5FL3 A;  3VE3 A;  1G6A A;  3K2N A;  3ISG A;  4ZBE A;  1GSW A;  2ZL1 B;  3QNB A;  5HPI A;  3N8S A;  1MKI A;  1S1Y A;  5M18 A;  2XH9 A;  3OOV A;  4WF0 A;  2WGI A;  4NEE D;  4RX3 A;  2JKT I;  3QNC A;  2HPB A;  1PW8 A;  4EQ1 A;  3W4Q A;  2QHK A;  1MZU A;  2IWC A;  2VV8 A;  4EEP A;  1D1J A;  1XGI A;  5GL9 A;  1PWD A;  1XA1 A;  3VSK A;  3F1N A;  4KQO A;  5FAS A;  1DJA A;  1EI5 A;  2V0W A;  1OTA A;  3QP6 A;  3A3D A;  1T1A A;  1NY0 A;  4GJ4 A;  1T1C A;  5TGF A;  2A24 B;  3BM6 A;  1K4F A;  4BL3 A;  3WRZ A;  3ZG0 A;  4IED A;  4OQH A;  3Q07 A;  4P87 A;  3PBT A;  5J8X A;  3CG5 A;  1Y4O A;  5E43 A;  1S67 L;  5A90 A;  3NOT C;  5GHY A;  4B9O A;  4JF5 A;  3R7W A;  4NXF A;  5FAO A;  1H8Z A;  3HLF A;  2Y2J A;  1BSG A;  1XJ3 A;  5C5K A;  5TBM A;  1CEG A;  2J9O A;  3OCN A;  3AGE A;  3ZG8 B;  3F1P B;  2WK0 A;  2ZMA A;  5GLB A;  1G68 A;  4LPZ A;  2FFF B;  4IBR A;  4PMA A;  2XFS A;  1K6R A;  5EVI C;  1MKM A;  3ZYT A;  2Y55 A;  5FAP A;  4DJ2 A;  4OPY A;  1HVB A;  2XA7 M;  3UB9 A;  4PM9 A;  3C8C A;  3LCE A;  4GDB A;  4KZ5 A;  1OTB A;  4XUZ A;  4GCZ A;  4KEN B;  2QPN A;  2P9V A;  5F82 A;  2C6W B;  2L1M A;  1DJC A;  2GDN A;  3ZNT A;  1OJ5 A;  1KGF A;  3K3C A;  4GS9 A;  3BQA A;  3ZVW A;  5J4E A;  5CTM A;  3IF6 C;  4N1X A;  5GLA A;  4CJN A;  4JGO A;  2OV5 A;  2M1C A;  3HLD A;  2K31 A;  1W8Y A;  5DKL A;  3VP4 A;  2Z6D A;  3S4X A;  3LYX A;  5AQA A;  3OPL A;  1TF1 A;  2R9X A;  2EWV A;  3LI8 A;  2WAF A;  4M3K A;  4Z1W A;  2VGJ A;  4PKY A;  5AQB A;  5HD3 A;  4F3L A;  3PR6 A;  2UV0 E;  4YOF A;  3V39 A;  3B3X A;  4N92 A;  5F1F A;  5EVI A;  1H3Q A;  1HTZ A;  3H7W A;  1ZKJ A;  3IS2 A;  2OSU A;  3S7N A;  4JKT A;  3SS3 A;  3EEA A;  3A0R A;  4DDY A;  3IQA A;  4I39 A;  3G6O A;  3MQO A;  4EWF A;  4S2I A;  1JVJ A;  1DP8 A;  4LGW A;  2J3T C;  4Y5F A;  5HX9 A;  5CHJ A;  5LBR A;  5TJJ A;  2V8C A;  2EX8 A;  4GDN A;  3LO7 A;  1GA0 A;  4MN6 A;  1XGJ A;  5KSC A;  4HBU A;  3UO9 A;  1ZG6 A;  4P6Z M;  4B93 A;  1TS7 A;  3IF6 A;  5EOO A;  5DVA A;  4R1G A;  2PR6 A;  3E2K A;  4QY6 A;  1GCE A;  4QY5 A;  2A3U A;  2ZJ9 A;  1OME A;  4OQ0 A;  3D9Y A;  4EXO A;  4Y0U A;  3MMH A;  3S22 A;  3U2A A;  3VMA A;  2X02 A;  3W2Z A;  4X1L A;  1L2S A;  3FG8 A;  4EW7 A;  5HFO A;  1P9W A;  3CHW P;  5KMW A;  4ZDX A;  5KZH A;  2LB5 A;  1V9Y A;  2ZMF A;  3OPP A;  4HP9 A;  1Z6F A;  1YLY A;  3PBN A;  3R7W B;  1IEL A;  3EQU A;  1ALQ A;  1DP9 A;  3PHY A;  4RVA A;  2KOI A;  5HWT A;  3T4T A;  3BLS A;  4MBF A;  2HDS A;  2WYX A;  4YIN A;  3IHB A;  5FI7 A;  3GTC A;  3MXS A;  2HDQ A;  4IBX A;  4MN7 A;  3IBR A;  1Z09 A;  4HH2 A;  4EES A;  4NKP A;  2EXB A;  3EEH A;  3C7U A;  4QJG A;  2EXA A;  3JYI A;  1GSV A;  1J3W A;  3MSH A;  4U0T A;  1VEU A;  2Y4A A;  4P6B A;  3N8R A;  3KSI A;  2JN7 A;  1WE4 A;  3HLB A;  2VJW A;  2ZM2 A;  3ULF A;  3C4O A;  4Y7P A;  4GKU A;  3O86 A;  3CPT A;  4FH2 A;  3GMW A;  4I3A A;  4HBT A;  2P9V B;  2KDK A;  3SH7 A;  2ZC5 B;  3OLO A;  5EVE A;  3FPV A;  2JBF A;  3PAG A;  3UB7 A;  5IU1 A;  1KDW A;  2PDR A;  2INW A;  4Y0O A;  1K4E A;  3EWK A;  3UNW A;  5CTN A;  3C5A A;  3PTE A;  1PIO A;  2OOL A;  1W8Q A;  1HLU P;  1I2S A;  5D3O A;  1SHV A;  5EVI D;  4G3K A;  4X68 A;  2JKR M;  3VFF A;  1VB6 A;  4LRY C;  3KYE A;  4B4Z A;  1OT6 A;  3VV4 A;  3A3F A;  3SW1 A;  1RCJ A;  3MJQ A;  2VEA A;  2WKE A;  5F5Y A;  4LEN A;  2QJ5 A;  3ITA A;  3LR5 A;  2HJ9 C;  1PW1 A;  1OJG A;  1YLZ A;  1JWV A;  1FSW A;  1IOU A;  3T4O A;  2P04 A;  4OP5 A;  4AFI A;  4E3K A;  1SCW A;  3P09 A;  3LUQ A;  1H5X A;  3UE6 A;  3ZG5 A;  3NCK A;  1F9I A;  3G4P A;  1T1B A;  4H6J B;  2ZC3 B;  2Z2L B;  3H7W B;  3A3E A;  5L2F A;  4EV4 A;  5F83 A;  4KQD A;  3V50 A;  2PU4 A;  5FQ9 A;  1LL9 A;  5CGX A;  5FSR A;  2ZD8 A;  5EM1 A;  3PBQ A;  5CRF A;  5L8M A;  1FSY A;  2P7J A;  4LLO B;  5FDS A;  3G2Y A;  1ONG A;  3QP5 A;  4ZTK A;  2H28 A;  2ZM8 A;  5HDS A;  4RA7 A;  4ESP A;  1HZO A;  3HJK A;  4JF4 A;  2D02 A;  3Q82 A;  5F68 A;  2I9V A;  3UE0 A;  2WGV A;  1W7F A;  3O3V A;  4HHD A;  2E8I A;  3E4Q A;  1MWU A;  4GHI A;  2J3T D;  1XFN A;  3BFC A;  3VP3 A;  1N9O A;  1EWZ A;  1M40 A;  4OLD A;  3C2W A;  4M4X A;  1DY6 A;  4E3M A;  4X6T A;  3SH8 A;  3C7V A;  4C75 A;  4ARZ A;  3HUM A;  1PZP A;  4UA9 A;  4MN5 A;  4HES A;  2WAE A;  1K55 C;  5EOE A;  3PBR A;  4E6W A;  1FR1 A;  4HP4 A;  1CI9 A;  1E4D A;  4OOY A;  1PNE A;  5M19 A;  2CC1 A;  4PPR A;  1FQG A;  3ZDJ A;  1XJ6 A;  3MF0 A;  4Q0I A;  4YFM A;  2VZW A;  2W27 A;  2WKR A;  1KE3 A;  4C6Y A;  3SS5 A;  4BQM A;  1RP5 A;  4QD4 A;  4MBH A;  5IT5 A;  4UQI S;  5E2H A;  1LI0 A;  4KZ7 A;  3IHA A;  2WUQ A;  3FWL A;  2ZC4 B;  4GD8 A;  2QKP A;  1YSP A;  3OPR A;  1S4R A;  4RQ9 A;  3CPT B;  2O99 A;  3T4L A;  1ODV A;  2Y2Q A;  1NYM A;  4OVD A;  4II7 A;  2EX2 A;  3IX8 A;  4ZRR A;  2JE5 A;  2HF6 A;  2Q0O A;  1IYQ A;  3PBS A;  3T4S A;  4OPZ A;  2WGW B;  5E2E A;  4O0P A;  1AXB A;  3H9W A;  2W3G A;  4O7D A;  3VP1 A;  4EBL A;  3MFX A;  5CER A;  3JVV A;  2OWJ A;  4BD0 A;  3LR3 A;  3RH8 B;  1N9B A;  4N9K A;  3GQZ A;  2V9A A;  3T4Q A;  4LV1 A;  2M7U A;  3WRT A;  1BTL A;  5CGW A;  2XFT A;  5HWW A;  1Q2P A;  3FKV A;  2G7U A;  5G4Y A;  1LI9 A;  4F94 A;  2Y2I A;  3UDI A;  1KDS A;  2PT7 A;  4Q0H A;  4HI4 A;  5L10 A;  4X55 A;  3ZQ5 A;  1XA7 A;  4I3I A;  5FI2 A;  5FDH A;  1JWP A;  2IWB A;  3IT9 A;  1K25 A;  4ZJ2 A;  2BLS A;  3FYZ A;  2OAP 1;  1BZA A;  4EU0 A;  1YAX A;  2Q9N A;  1AWI A;  3JVU A;  1P0Z A;  3Q7V A;  2J7V A;  4G3W A;  4S2P A;  3BWL A;  5FAT A;  3ICY A;  5DFY A;  1ERQ A;  5DF7 A;  1UWP X;  4HJ3 A;  2IA2 A;  5EUA A;  1PI4 A;  1BLS A;  3SZT A;  4GHI B;  1VM1 A;  3B42 A;  4CLC C;  2HV1 A;  3M2J A;  5HAP A;  3Q1F A;  1N9L A;  2EA9 A;  1ES5 A;  4JXW A;  1WYB A;  3BQ8 A;  4OPQ A;  3LEZ A;  1ACF A;  3EOI A;  2HZ5 A;  3LIA A;  2X01 A;  3QHY A;  4KQR A;  5E2G A;  1G5U A;  1YQS A;  2P74 A;  3E98 A;  3BFD A;  4CPK A;  3TJZ C;  1YKD A;  4GOG A;  3MQ0 A;  2H0T A;  3NEC A;  3CIT A;  1MBL A;  1FOF A;  5EM0 A;  3D3O A;  4JGP A;  4S2L A;  1LHY A;  4BMW A;  4N9L A;  4S2M A;  3BY8 A;  2O9B A;  4H8R A;  3OBF A;  3NOU C;  4B4X A;  3TSG A;  1MWR A;  4FD8 A;  1DP6 A;  1E3U A;  1F98 A;  3FKW A;  2GZA A;  3GRJ A;  4Z9Q A;  2WKQ A;  2E8J A;  2Y2H A;  1GHM A;  3KYQ A;  4A5R A;  2XK1 A;  4IVK A;  3NJA A;  3KSH A;  4LCM A;  1CK3 A;  4JGQ A;  3UPO A;  4FUW A;  2AVX A;  2RCX A;  1ZG4 A;  2ZQ9 A;  4I38 A;  4NET A;  3OCL A;  2K2N A;  4Q8I A;  4JXG A;  3IH9 A;  3DWZ A;  3N4I A;  2JC7 A;  3D4F A;  3H82 B;  3VP2 A;  4X25 A;  3LIC A;  4MEZ A;  4GLQ A;  5HAR A;  5CHU A;  4HQA A;  3HLG A;  1XP4 A;  1LT0 A;  4EBP A;  1YLJ A;  5GLC A;  1L0D A;  3S7P A;  4PM5 A;  3IXH A;  2Z6C A;  4QWO A;  4IJG A;  4NG2 A;  2QWS A;  1TD5 A;  4FSF A;  4WN5 A;  5DJT A;  5JYO A;  4WL9 A;  3B47 A;  3O88 A;  1N4O A;  3UE1 A;  3LIB A;  5IHV A;  3HJI A;  4IVI A;  1KGG A;  3M2K A;  4E3N A;  1QME A;  1BLH A;  5HZH A;  3F1N B;  2Q9M A;  1I5Q A;  2PU2 A;  4S2J A;  4HEF A;  3PXP A;  1GSX A;  4LCL A;  1YM1 A;  2B02 A;  5K5B A;  1LSW A;  4OOL A;  3ZNY A;  3MFD A;  5I5L A;  5CHM A;  4GNU A;  3MS6 A;  4HIA A;  5F6A A;  3MR0 A;  1IFQ A;  3BEC A;  2J80 A;  3FZC A;  1NJ4 A;  3L7H A;  4UHU A;  3EGX C;  2LB9 A;  4KZ8 A;  3T4K A;  1ZTU A;  1TDL A;  2JHE A;  3U4L P;  3NC8 A;  3C4P A;  3CLO A;  4KZA A;  2EFX A;  2YKH A;  4DE2 A;  2Y2P A;  4JXV A;  5TBM B;  2VGK A;  4HJ6 A;  1OT9 A;  1NLY A;  1MY8 A;  1TEM A;  4R6L A;  5DF9 A;  2OLV A;  3TOI A;  3T1S A;  1V9Z A;  1CQA A;  1XPB A;  1LL5 A;  5FEF A;  3DTI A;  1O7E A;  2JKR I;  4DJ3 A;  3BLM A;  3NI9 A;  1SDN A;  2W1T A;  3V3R A;  3HUO A;  1VET A;  2QMI A;  2EFU A;  4UA7 A;  1E3U D;  4JF6 A;  1ERM A;  2H0Y A;  4OP8 A;  2OWH A;  3FC7 A;  1YLP A;  4S2K A;  4ZJ1 A;  3UY6 A;  4MLL A;  4LRZ E;  3T1Q B;  4E3O A;  5L09 A;  3UPN A;  4D60 A;  1J9M A;  2IWD A;  1DRM A;  4ETZ A;  4EER A;  2ZM0 A;  2Y91 A;  5AVE A;  4WEK A;  4YNR A;  3RFB A;  4CLC D;  3BYD A;  2EWW A;  1ES4 A;  4GS9 B;  1FCM A;  5EEC A;  1OPX A;  1GHP A;  1SKF A;  3P98 A;  2WAD A;  3GR2 A;  4ME4 A;  1K0K A;  3RXW A;  3VOL A;  3QP8 A;  2JKF A;  2HDU A;  4HNB A;  1P9R A;  2XQZ A;  4XUX A;  4KZ3 A;  4K0X A;  4O8G A;  5HW3 A;  1WA9 A;  3F1O A;  2L0W A;  3BFE A;  4O01 A;  1CI8 A;  3IWQ A;  2PHY A;  3P7N A;  3LR0 A;  1D7E A;  4F3L B;  3UE3 A;  3WS5 A;  4ZAM A;  4BBV A;  4L9G A;  1IKG A;  2PR5 A;  4FH4 A;  3CUE C;  3HCY A;  4XT2 A;  2WKP A;  1F2K A;  5AQ9 A;  5EVI B;  3UB5 P;  2QZ6 A;  3IS2 B;  3WS1 A;  4EUV A;  5EPH A;  5GHX A;  4E3J A;  2PD8 A;  2HP5 A;  3MXR A;  4DXB A;  3IX3 A;  1ES3 A;  4I3J A;  5FQQ A;  1T18 A;  5EFW A;  4RX2 A;  1JWZ A;  4KG2 A;  1SDE A;  4R3B A;  3O5Y A;  1BLP A;  1S6R A;  4LFU A;  2W3F A;  2OLU A;  2QYB A;  4EBN A;  5DTK A;  4DRT A;  4JGR A;  1K54 C;  2G2W A;  5J7E A;  4EEU A;  5TFQ A;  4LV0 A;  1NWZ A;  3IF6 B;  2A24 A;  3CWF A;  5EVL A;  1YT4 A;  2V20 A;  2GX5 A;  2Y8H A;  1PRQ A;  2KX6 A;  4HOI A;  5DTS A;  1FIL A;  2J9P A;  4CQH A;  4QPR A;  2W3E A;  1IEM A;  1TDG A;  5EE8 A;  4DXC A;  3MQQ A;  5HD5 A;  3IX4 A;  5AQ7 A;  1ERO A;  3TW8 A;  5KIZ A;  3CUE A;  4R23 A;  5FI6 A;  3IF5 A;  3NIA A;  3IH8 A;  2VGL S;  5HAQ A;  2ZBB A;  2WZZ A;  3ITB A;  1H8M A;  3HLC A;  2ZC7 A;  3HUN A;  5HWV A;  1YMX A;  4S2N C;  4OKP A;  4QU3 A;  3UME A;  2D01 A;  1K57 C;  3A0V A;  1PZO A;  1FCO A;  4DE1 A;  3T50 A;  3M6H A;  4K0W A;  1OTD A;  1L0G A;  4R4S A;  4YWZ A;  1H8Y A;  5DKK A;  1NZO A;  3UN7 A;  1JTD A;  2ZQA A;  1IYP A;  4Y2F A;  5CX7 A;  3TG9 A;  1O07 A;  2V1A A;  3A3I A;  1NRJ A;  1VEU B;  2BTF P;  4E3I A;  2W1T B;  4BD1 A;  2L4R A;  3T4J A;  2ACG A;  3E0Y A;  4UA6 A;  1H0M A;  4DE0 A;  2Y2O A;  2EX6 A;  2K7S A;  5FQI A;  2HDR A;  4PAU A;  2V1B A;  4Y3I A;  3NY4 A;  1GHI A;  2I72 A;  4WEL A;  3LR4 A;  3MKF A;  2W3H A;  3NBL A;  4FOF A;  4PM6 A;  4DKI A;  3D72 A;  2ZOH A;  5A93 A;  1PWC A;  1XFQ A;  1XJ2 A;  2DCF A;  4EUZ A;  5HL1 A;  4XXR A;  4E3L A;  3HRE A;  1K55 A;  4GW9 A;  3N8L A;  2P08 A;  3Q7Z A;  3QP1 A;  2PYR A;  3UDF A;  2CMN A;  5HAI A;  3F1O B;  1NLZ A;  1OTI A;  2YKF A;  1U60 A;  4S2N A;  3IBJ A;  4BEN A;  4P85 A;  1NXY A;  1MXO A;  4WYY A;  3PAE A;  4P0M A;  3GVB A;  3PBO A;  4UQI M;  5HSQ A;  5JYP A;  2GJ3 A;  4XT2 B;  3BFG A;  3EGD C;  2DMW A;  3T1X A;  2ZQC A;  1IYS A;  5HPF A;  3LEQ A;  2XR0 A;  1GA9 A;  5CXW A;  4R3J A;  4OPR A;  1XJ4 A;  2BG1 A;  1JNU A;  3ZGA B;  3DTE A;  1PYY A;  2VA0 A;  4L9E A;  3S1Y A;  1M6K A;  4JLF A;  4GD6 A;  3KX0 X;  4WM9 A;  5DTT A;  2FZ0 A;  2JKG A;  3WS0 A;  2XA7 S;  3WS4 A;  4JXS A;  1PI5 A;  3DAV A;  2XLN A;  5FAQ A;  2FFY A;  1BUL A;  3AGD A;  3NHQ A;  5DJU A;  5FEG A;  4L0L A;  3JPU A;  5G18 A;  3BFF A;  1XKZ A;  2W3D A;  4HH3 A;  3Q81 A;  2B95 A;  4NXE A;  3V67 A;  1TS0 A;  3V5M A;  3UDX A;  3OPH A;  1KVM A;  3MBZ A;  3PYP A; 
#chains in the Genus database with same CATH homology
 1VB6 A;  4WL9 A;  4LRY C;  3B47 A;  1OT6 A;  3VV4 A;  3LID A;  2JKT M;  5F69 A;  3SW1 A;  3LIB A;  1D06 A;  1X0O A;  3MJQ A;  2VEA A;  5F5Y A;  2J3W A;  3HJI A;  3UB6 A;  2QJ5 A;  3LR5 A;  2HJ9 C;  1S4S A;  3GEC A;  3BW6 A;  1OJG A;  1LSX A;  4NXB A;  1STZ A;  1T19 A;  5MC7 A;  5HZH A;  3F1N B;  3FPW A;  4ARZ B;  2W0N A;  1IOU A;  3C38 A;  3PXP A;  3T4O A;  2P04 A;  4WLA A;  3EQV A;  1GSX A;  3C30 A;  4AFI A;  2B02 A;  1G6O A;  1OTE A;  4R38 A;  1S66 L;  4K08 A;  5K5B A;  1LSW A;  3LUQ A;  3UE6 A;  4OOL A;  5I5L A;  1F9I A;  1T1B A;  4H6J B;  4HY8 A;  2OAQ 1;  2VGL M;  3MXQ A;  4BJP A;  4KUK A;  2HGV A;  3H7W B;  4HIA A;  5F6A A;  3MR0 A;  1IFQ A;  4BWI A;  3CAX A;  1P97 A;  2J80 A;  4I5S A;  4KQD A;  3UMD A;  1S1Z A;  2O9C A;  1UGU A;  2V0U A;  3EGX C;  2LB9 A;  2NUP C;  2PD7 A;  2R78 A;  4KUO A;  2ZMV A;  3T4K A;  3PBQ A;  1ZTU A;  5L8M A;  1MC0 A;  2JHE A;  3TE8 A;  3CLO A;  4E04 A;  2A2L A;  2P7J A;  3E4P A;  3H82 A;  4LLO B;  2YKH A;  5HDD A;  5TBM B;  5HDC A;  4HJ6 A;  1G28 A;  4Q0J A;  3DBA A;  2H28 A;  1OT9 A;  1NLY A;  4LRX C;  4R6L A;  5FL3 A;  3VE3 A;  5DF9 A;  3K2N A;  5HDS A;  1GSW A;  1V9Z A;  3HJK A;  2D02 A;  5HPI A;  5F68 A;  1S1Y A;  4IHQ A;  3OOV A;  2JKR I;  4WF0 A;  4DJ3 A;  2I9V A;  4P6Z S;  4NEE D;  4HHD A;  4CLC A;  2W1T A;  3E4Q A;  4GHI A;  2JKT I;  2J3T D;  1XFN A;  2OWH A;  2HJE A;  3FC7 A;  4EQ1 A;  1N9O A;  4LRZ E;  2QHK A;  1MZU A;  1ZHH B;  2VV8 A;  4EEP A;  2BAS A;  3C2W A;  3KYZ A;  4M4X A;  3VE4 A;  1DRM A;  4ETZ A;  3F1N A;  4KQO A;  5HL6 A;  4ARZ A;  4EER A;  5KSH A;  5AVE A;  2V0W A;  4WEK A;  4YNR A;  3RFB A;  1OTA A;  4CLC D;  4MN5 A;  2EWW A;  4GS9 B;  1T1A A;  4GJ4 A;  1T1C A;  4H6J A;  3E4O A;  3PBR A;  1OPX A;  2A24 B;  4HP4 A;  4ME4 A;  5AVF A;  3VOL A;  4HNB A;  4CLC E;  1P9R A;  3PBT A;  2VKS A;  4PHT A;  1XJ6 A;  3MF0 A;  4Q0I A;  4O8G A;  2VZW A;  4OOM A;  2W27 A;  2WKR A;  1S67 L;  1WA9 A;  3NOT C;  3F1O A;  2L0W A;  4O01 A;  4B9O A;  3OC2 A;  2PHY A;  3R7W A;  3P7N A;  5IT5 A;  4NXF A;  4DMZ A;  3LR0 A;  1D7E A;  4UQI S;  5DFX A;  5TBM A;  1XJ3 A;  5C5K A;  1W63 M;  4DN0 A;  4F3L B;  3UE3 A;  4BBV A;  3OCN A;  4IUK A;  1LL8 A;  4L9G A;  2PR5 A;  3F1P B;  2GNX A;  3CUE C;  2VLG A;  3HCY A;  4XT2 A;  2QKP A;  2WKP A;  1YSP A;  2O0Y A;  1S4R A;  4RQ9 A;  4LPZ A;  3IS2 B;  2O99 A;  3T4L A;  4EUV A;  2VV6 A;  1MKM A;  1ODV A;  3ZYT A;  4II7 A;  2PD8 A;  2XSS A;  4DJ2 A;  4ZRR A;  2XA7 M;  3UB9 A;  2HF6 A;  3C8C A;  2NUT C;  4EET B;  4I3J A;  1T18 A;  5EFW A;  3PBS A;  2KLI A;  3T4S A;  1OTB A;  4R3A A;  4GCZ A;  4O0P A;  3O5Y A;  3H9W A;  2W3G A;  2W3F A;  2QYB A;  2L1M A;  4MMN A;  1OJ5 A;  4JGR A;  3KSF A;  3MFX A;  3K3C A;  5J7E A;  4EEU A;  4GS9 A;  3JVV A;  2OWJ A;  3BQA A;  1NWZ A;  3P01 A;  5J4E A;  3LR3 A;  3KSG A;  3RH8 B;  2A24 A;  3CWF A;  2V9A A;  2GX5 A;  4JGO A;  2M1C A;  2Y8H A;  2B18 A;  3T4Q A;  5IS1 A;  1W63 Q;  2KX6 A;  2M7U A;  4HOI A;  2K31 A;  5HWW A;  5DKL A;  3TRC A;  4MCW A;  2Z6D A;  3R4K A;  2G7U A;  3LYX A;  5G4Y A;  1TF1 A;  4CQH A;  4QPR A;  3CI6 A;  2XRO A;  2EWV A;  2W3E A;  3LI8 A;  4Z1W A;  3MQQ A;  4PKY A;  5HD3 A;  5HD5 A;  4F3L A;  3TW8 A;  5KIZ A;  2PT7 A;  3CUE A;  4Q0H A;  3PR6 A;  3A0S A;  4HI4 A;  4YOF A;  3ZQ5 A;  2VGL S;  3B33 A;  4I3I A;  2ZBB A;  1H8M A;  1H3Q A;  3H7W A;  5HWV A;  3IS2 A;  3LFV A;  1TS6 A;  2OAP 1;  3UME A;  2D01 A;  3S7N A;  3EEA A;  4EU0 A;  3A0R A;  3A0V A;  4I39 A;  3G6O A;  3MQO A;  1YAX A;  3T50 A;  1DP8 A;  2ZOI A;  3JVU A;  1OTD A;  4YWZ A;  2J3T C;  4Y5F A;  1P0Z A;  5LBR A;  5TJJ A;  5DKK A;  4G3W A;  4Y2F A;  5CX7 A;  2XRN A;  3BWL A;  4MN6 A;  3LIE A;  3ICY A;  5DFY A;  2V1A A;  1UWP X;  1NRJ A;  1F5M A;  4HJ3 A;  2IA2 A;  2PYP A;  4CLC B;  2W1T B;  4GHI B;  2L4R A;  3T4J A;  3B42 A;  4CLC C;  2W1R A;  4P6Z M;  4B93 A;  3LIF A;  3E0Y A;  1TS7 A;  2HV1 A;  1N9L A;  2K7S A;  2EA9 A;  2PR6 A;  4PAU A;  4WEJ A;  2V1B A;  3BQ8 A;  4Y3I A;  4UEY A;  2VV7 A;  4WEL A;  3LR4 A;  3EOI A;  4FOF A;  3LIA A;  2W3H A;  2Y79 A;  4HJ4 A;  4EXO A;  3D72 A;  3MMH A;  3E98 A;  2ZOH A;  3TJZ C;  1YKD A;  1XFQ A;  1XJ2 A;  3LI9 A;  3MQ0 A;  3U2A A;  3CIT A;  4IUH A;  3W2Z A;  3FG8 A;  4EW7 A;  3D3O A;  4JGP A;  1P9W A;  4BBT A;  4PKY G;  4WUJ A;  3UB8 A;  4BMW A;  4GW9 A;  2LB5 A;  2P08 A;  5J3W A;  1V9Y A;  2M7V A;  1VHM A;  2ZMF A;  2PYR A;  2CMN A;  3F1O B;  2FH5 A;  3BY8 A;  4HP9 A;  1NLZ A;  1OTI A;  2YKF A;  4MDZ A;  5G4Z A;  3IBJ A;  3PBN A;  3R7W B;  2O9B A;  3BY9 A;  3KO6 A;  3EQU A;  3OBF A;  1DP9 A;  3NOU C;  3PHY A;  2KOI A;  5HWT A;  5A8B A;  3T4T A;  3PBO A;  4UQI M;  1DP6 A;  1BYW A;  3S7Q A;  5HSQ A;  1F98 A;  4NXG A;  2GZA A;  2GJ3 A;  2WKQ A;  2VX8 A;  4XT2 B;  1YSQ A;  4G3V A;  1Y28 A;  3EGD C;  4MN7 A;  3IBR A;  2MJ6 A;  3KYQ A;  2DMW A;  4HH2 A;  2O9A A;  4NKP A;  4EES A;  3K3D A;  3NJA A;  3KSH A;  3GDI A;  5HPF A;  1EW0 A;  3EEH A;  4JGQ A;  1GSV A;  3RTY A;  4L9F A;  1XJ4 A;  3KSI A;  1JNU A;  2JN7 A;  4I38 A;  3F1P A;  2VJW A;  2VA0 A;  1LSV A;  2K2N A;  3OCL A;  4L9E A;  5AJG A;  3ULF A;  3BJN A;  1UWN X;  3KX0 X;  3H82 B;  4I3A A;  4ETX A;  2FZ0 A;  2XA7 S;  2KDK A;  4R70 A;  3LIC A;  4GLQ A;  1N9N A;  4HQA A;  1TS8 A;  3OLO A;  3FPV A;  3UB7 A;  5IU1 A;  1LT0 A;  2PDR A;  2INW A;  3NHQ A;  5DJU A;  4BBU A;  4L0L A;  3EWK A;  3S7P A;  2QJ7 A;  2OOL A;  2Z6C A;  3NOP C;  2W3D A;  4IJG A;  4HH3 A;  3S7O A;  2QWS A;  4G3K A;  4NXE A;  1KOU A;  3V67 A;  1TD5 A;  1TS0 A;  2JKR M;  4FSF A;  4WN5 A;  5DJT A;  3PYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...