3EGXC

Crystal structure of the mammalian copii-coat protein sec23a/24a complexed with the snare protein sec22b and bound to the transport signal sequence of the snare protein bet1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
157
structure length
135
Chain Sequence
MVLLTMIARVADGLPLAASMQEDDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRIMVANIEEVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of cargo membrane protein discrimination by the human COPII coat machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Protein transport protein Sec23A
total genus 33
structure length 135
sequence length 157
ec nomenclature
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3egxC00
2DMWA 4AFIA 3BW6A 1H8MA 2VX8A 3EGDC 3EGXC 1IFQA 3KYQA 2NUPC 4B93A 2NUTC 1IOUA
chains in the Genus database with same CATH superfamily
1E3UA 2HDSA 3PBRA 2V0UA 4X25A 4OVDA 4X68A 2A24A 2ZM0A 5M1AA 2ZQ7A 1BLPA 4KZAA 4I5SA 3TSGA 1PIOA 4NKPA 5CHMA 4NG2A 4L0LA 2K7SA 4R1GA 3Q81A 4Y7PA 5L07A 5EOEA 1SDEA 3P01A 4PM9A 3C4PA 1PW1A 3PAGA 3Q7ZA 1TDGA 2HF6A 1GSVA 4R4RA 2VV8A 5HPIA 2W3DA 3W4OA 2Y59A 4GW9A 3IT9A 3VMAA 2PBYA 3NI9A 3HL9A 5JYPA 4GJ4A 4HOIA 5L2FA 2WGVA 3LEZA 4IHQA 2GZAA 2QJ5A 4NXFA 3LGOA 3LICA 1LT0A 1ES4A 1GHMA 4OOLA 4GN2A 1KOUA 2PT7A 4ARZA 1U60A 2ZQDA 2EXBA 4B93A 2D02A 3B42A 1QMEA 5FQMA 1YMSA 1OT6A 2ZQCA 2W3GA 3CG5A 4P85A 3ZNTA 1PZOA 1OJ5A 5A91A 1V9ZA 1TS6A 1UGUA 1YSPA 4DE0A 1FR1A 5E43A 1T1BA 4D2OA 4NXBA 2R9XA 2FFFB 4MN5A 3SOIA 2C5WB 3FZCA 4LLOB 1KE0A 4FH4A 3KO6A 3S7QA 3T1RA 3SZTA 3A0SA 1JWPA 3IBRA 3BLSA 5M19A 4BENA 4KZ5A 1NLZA 2MJ6A 4NEED 2FZ0A 4KQDA 3FKVA 1WYBA 1QMFA 3UE1A 4GLQA 2Y2HA 3VE3A 2Y2LA 1ZG4A 3G31A 4E3MA 3PHYA 5EOOA 1D7EA 3KSHA 2EX9A 3BEBA 1VM1A 2Y79A 2PD7A 4A5RA 2J9OA 1ESIA 3BQ8A 1ERQA 3S1YA 1S1YA 1RCJA 2WKQA 3UPOA 2JHEA 2X02A 3E98A 2ZJ9A 4OOYA 4LV3A 3NDEA 3MBZA 4EUVA 3LI8A 3OC2A 1HVBA 1IEMA 3VFFA 3TW8A 5FQ9A 5FSRA 3OBFA 2OLUA 4PMAA 1D1JA 2R78A 1P0ZA 5AVEA 2BTFP 2JCHA 3Q07A 3VV4A 4WEKA 2IWDA 3V39A 4K91A 5J4EA 4KUKA 4Q0IA 2Q0OA 3VP3A 1IKGA 4LPZA 1J3WA 5DJUA 2KX6A 1BYWA 4H6JA 1NYMA 3TOIA 3FPWA 1T18A 1KGGA 2XFTA 1LSWA 4GOGA 1XJ4A 4HNBA 2W0NA 1PWGA 1NYYA 1CK3A 5F1GA 3KYEA 4KZ4A 3F1PA 3IF5A 4PKYG 1GSXA 5KZHA 2P9VA 1H5XA 2V20A 4HESA 2ZLYA 3PR6A 4LGWA 5FDSA 1TDLA 1K25A 1W5DA 4IJGA 3PYPA 4WMCA 5EVID 4X56A 3FKWA 3GMWA 5DTTA 1KVLA 3T1QB 4BQMA 3FG8A 3ICYA 5TGFA 4UA6A 5F6AA 5FASA 4BL3A 1I2WA 3H7WB 4GD8A 5AVFA 4OKPA 3CUEA 3NULA 5DVAA 3BY8A 1KVMA 3E4OA 3C8CA 2L1MA 2QKPA 2PU4A 3S7NA 1SKOA 4Z9QA 4HQAA 1YLTA 5FI6A 5EVEA 1IYSA 4I3IA 2H10A 4JF6A 4KZ8A 1A0KA 3PBNA 2CMNA 3UDXA 5HD3A 4DKIA 4HJ3A 3MQQA 1YLWA 1FSYA 3ULFA 4F3LA 2AVXA 5FQIA 3E2KA 3IH8A 4GD6A 5HWTA 1VHMA 4BL2A 3NC8A 2PDRA 5FATA 1TS0A 4JF5A 5G18A 1PI4A 2EX2A 1MWSA 4O01A 2XROA 4PM6A 3ZG5A 2R9WA 2V1AA 2Y55A 4QU3A 3ZVWA 4ARZB 1XA1A 1ES2A 1NXYA 3HLDA 2ZD8A 1XJ2A 1VEUA 2VGJA 1K38A 1S1ZA 5FL3A 3O86A 1RGYA 4E3NA 2ZC5B 2P7JA 3AGFA 3G35A 4E3KA 5HPFA 2J80A 1C3BA 2IWCA 3BJNA 1FCNA 5K5BA 4GHIB 4KUOA 2KLIA 5EM1A 1NWZA 3WRTA 1FCOA 5AJGA 1Z6FA 1MWTA 2XF3A 1F2KA 2Q9MA 4HJ4A 3MQ0A 5CGSA 5EECA 3LO7A 3WS4A 3DWZA 2A2LA 2CC1A 1G6OA 2G2UA 5AQBA 2WADA 3T4KA 3CMZA 1W7FA 4II7A 1MPLA 1TD5A 1BZAA 1HLUP 3C2WA 3PTEA 2XEPA 4IUHA 5CRFA 4Y0UA 3G32A 4X55A 2I9VA 4Q8IA 2BLSA 2WKHA 4HBUA 2HDUA 1BLHA 4R38A 5M18A 3IF6B 2P74A 1XFQA 4HEFA 1LSXA 5IHVA 1L3LA 5G4YA 3CZDA 2LB5A 4ETXA 3UB8A 1PW8A 1XPBA 3CAXA 5HWWA 2O9CA 4PHTA 4KENB 4ME4A 1L2SA 4DXBA 4C6YA 4ZJ3A 3ZGAB 4S2MA 3HUNA 4WM9A 1F5MA 3IHBA 1OT9A 3MSHA 4E3LA 1L0DA 1Z09A 3VP2A 5EUAA 4BBUA 3BFFA 2E8JA 1S66L 4X1LA 3OCNA 3GR2A 4N92A 1SHVA 3V5MA 3JPUA 4S2KA 1ALQA 3ISGA 1I5QA 2D01A 4HP4A 3HVFA 4JGOA 3OPLA 4JGQA 5DJTA 2P04A 4WZ5A 4LCMA 1BULA 4ZJ1A 1AXBA 1OJGA 1UWPX 1SDNA 4WF0A 3OPRA 5C5KA 4XUXA 1EROA 3T4LA 2WGWA 3EQVA 4Y5FA 3V3RA 3VSLA 3HLGA 4DRTA 4BMWA 3FC7A 3Q7VB 5E2FA 5CERA 4QPRA 2GJ3A 3ZYTA 2ZQAA 2WGWB 1BLCA 4BD0A 4JLFA 1XGJA 2J3WA 1L0GA 1TEMA 3EEHA 1NZUA 3G34A 4QY6A 3Q7VA 1OTEA 1S67L 2Y8HA 1SCWA 4QHCA 5FA7A 3K3DA 3OPPA 5DF9A 1FQGA 3GSGA 3LI9A 4FCFA 3DWKA 3IXBA 4FD8A 4CLCE 4ESPA 3LIEA 3D72A 4DXCA 1HZOA 2BASA 3A3DA 1E3UD 1PWDA 1VB6A 3MZDA 2H0TA 4E3IA 1LL8A 3MR0A 4DDSA 4BJPA 5FEFA 2Z2MB 1BT5A 1N9NA 3T4JA 3DTMA 4Q0JA 4U0TA 4ZDXA 4OQGA 4ZJ2A 4G3WA 2ZQ8A 3QP1A 4WUJA 4FUWA 1H8ZA 5F5YA 3LR5A 1BTLA 1ZTUA 3D9YA 2UWXA 5AQAA 1VEUB 4MNRA 3LEQA 3BWLA 3LUQA 1PWCA 2WZXA 3K2NA 4N9KA 3CI6A 4G3VA 1K57A 3GECA 4E3JA 1PNEA 1S0WA 5E2HA 3HLCA 4R70A 4GKUA 3EOIA 1XP4A 1TS7A 4I3JA 4HBTA 3BFDA 1DJAA 4LCLA 2Y2MA 3E0YA 3LFVA 3NJAA 1YLZA 3HLEA 5J8XA 3NBLA 3DBAA 3G2YA 4LRXC 3LIFA 5EV0A 3TG9A 1UWNX 1DY6A 3ZVTA 5DTSA 3SS4A 1E4DA 2P9VB 1VETA 3LR4A 3DTEA 4JXWA 2HJ9C 3P7NA 3UPPA 2XQZA 2QZ6A 2HP5A 2B95A 2ZC6B 5HAQA 2GX5A 1DP6A 4DMZA 5HDDA 1DP8A 3D3OA 1MWRA 2XSSA 4M4XA 1JTGA 4OQHA 1NRFA 3NOPC 3DTIA 3MXSA 2HP9A 3HJKA 5DKKA 4G3KA 4IBXA 1ONGA 2ACGA 5FEGA 3MKEA 4RQ9A 4S2IA 4FH2A 1XXMA 3N8LA 1STZA 1X0OA 4CLCD 5TR7A 2Y2KA 2WUQA 5KIZA 3KYQA 3T1XA 3BY9A 2V1BA 2P08A 3DW0A 1P9WA 4EETB 3FYZA 4JGPA 4KG2A 4Q0HA 4F3LB 1YQSA 2J3TD 3O88A 4P87A 4ZBEA 3EQUA 3GVBA 4MBHA 3IF6C 5HAIA 1W79A 4YINA 1K4EA 1K6SA 4B9OA 5F1FA 5I94A 3H82A 1PYYA 4FSFA 1P9RA 3S22A 1O7EA 3E4QA 3M6HA 5EM0A 4UA7A 4RVAA 2WAEA 4YNRA 4RA7A 2ZC4B 4K08A 4P6ZM 3S7PA 3F1PB 2BG1A 2PRFA 1ACFA 4OPQA 5A92A 4Y17A 5IS1A 1ONHA 3BYDA 2W1TB 1LL9A 5EVIA 2XFSA 2J3TC 3C5AA 5HARA 1N4OA 3PBOA 3UPNA 4HIAA 1H3QA 2J7VA 4IVKA 3N4IA 2VLGA 2K31A 3BFGA 3NOTC 5AQ9A 3U2AA 1IFQA 4EBLA 5A90A 2PD8A 3CUEC 1LLBA 3SW1A 4I3AA 2WKRA 3IXHA 2IA2A 3IX8A 4DE3A 3TJZC 4MMNA 1WYCA 3KYZA 4NK3A 1K56D 1FOFA 3IWQA 1MXOA 2ZBBA 5GHYA 3ZNYA 3V67A 3MS6A 5IU1A 2VV7A 3PBQA 2O0YA 3NIAA 5GLBA 4MBFA 4OP5A 4OPZA 3S7OA 1KE4A 1K54C 3GDIA 4HY8A 3WS2A 2H0YA 1N9LA 3ITAA 3KX0X 3FWLA 5KSHA 3UMEA 2INWA 1K56A 1CEFA 5F68A 1V9YA 2JKRM 1Y54A 3CPTB 2QHKA 2Y2GA 1OPXA 3NY4A 1IKIA 1G6AA 1OMEA 1DP9A 4EU0A 3T1SA 3C4OA 3B47A 4OOMA 2DNSA 3TRCA 1ZHHB 1CI9A 3KSFA 1ES3A 2PYPA 2O99A 3GTCA 4LENA 1JWZA 1GA0A 5FQQA 4EERA 1BUEA 3CHWP 4XT2A 4NXEA 3GV9A 5GLDA 4K0WA 4NXGA 3W2ZA 4RX2A 3WRZA 4P6BA 5HDCA 3N8RA 2WKPA 3LYXA 1YT4A 3OPHA 1SKOB 1Y28A 3GQZA 4JGRA 5CGWA 3FV7A 3HUMA 5GHZA 3ZG0A 3PAEA 3D4FA 3BLMA 2XH9A 2W27A 4JXVA 3R4KA 4U0XA 4KZBA 2XK1A 1H8MA 4UQIS 3C7VA 1MKMA 3H9WA 3UY6A 2Y2OA 3Q82A 1NJ4A 3UN7A 2XGNA 4EQIA 4YFMA 3PXPA 4OPRA 2JE5A 2O9AA 2PU2A 2VV6A 4KG6A 4R3AA 4IEDA 5FAQA 5FDHA 1JWVA 3OOVA 4ZRRA 1OTIA 3DAVA 4LV0A 5A93A 3T4OA 4EBPA 2WKEA 1K55A 4O8GA 5GHXA 3SH7A 5CTNA 4RX3A 3O3VA 4KQOA 5TFQA 5E2EA 2ZC7A 3EEAA 4NETA 3LCEA 2H5SA 3MXRA 5DFXA 2VK3A 3VSKA 1XKZA 2V2FF 4R0QA 5HD5A 4DE2A 3NHQA 5FQKA 4N9LA 4BBVA 4S2NA 3MF0A 1MBLA 2ZMVA 3O5YA 4EEPA 5CHJA 1Y4OA 3R7WB 2DRWA 4L9FA 3CLOA 1N9BA 2OWJA 5FAOA 2GNXA 5EE8A 1LL5A 2QMIA 2A3UA 4Y0TA 1NY0A 4S2PA 4CLCC 4H6JB 2ZM2A 4WZ4A 2QPNA 2EWWA 4KQQA 3G30A 1FILA 1YLPA 2ZL1B 4Y0OA 4CJNA 3Q1FA 2ZMAA 5DTKA 5KMWA 1LSVA 2LB9A 3E4PA 1DJCA 4KZ7A 1EW0A 4YOFA 3T4QA 3IF6A 4DE1A 5AQ7A 1CF0A 3QHYA 4WN5A 3MFXA 1XX2A 1YAXA 1VETB 5J7EA 4EQ1A 1TVFA 3NDGA 4WEJA 1FCMA 3IS2B 4IVIA 2Y91A 2W1RA 1M6KA 2WZZA 1MZUA 3BECA 2VEAA 4E6XA 3A3IA 1PRQA 4MCWA 1MY8A 3C30A 1HD8A 3IWIA 3I7JA 2Z6DA 1XFNA 3LR3A 2OAP1 1K6RA 5CX7A 2HDRA 4FOFA 2VA0A 4M3KA 4R3BA 2O9BA 3RFBA 1F98A 2KDKA 4QJGA 4JXGA 1SKFA 2Y2JA 4E6WA 4BD1A 1JTDA 2V8CA 1ODVA 4CPKA 3EWKA 4PM8A 1W8YA 4JXSA 4GDNA 5A8BA 4X53A 4KG5A 2VGLM 4XXRA 4QY5A 3W4QA 2XR0A 4AFIA 3N6IA 5EPHA 2JKGA 3P09A 1DJBA 1IELA 2FFYA 2H28A 4MLLA 2VGKA 5F83A 1JNUA 3NCKA 3MXQA 3MJQA 2XD5A 3B3XA 5DKLA 5CXWA 2FH5A 5F82A 1CQAA 1ES5A 2VX8A 4WZ5C 1P97A 2KOIA 3HBRA 4E04A 5JYOA 4BWIA 1W8QA 2WYXA 4EEUA 5GLAA 1JVJA 3HCYA 3BQAA 4GB7A 3A0RA 4P6ZS 5CEDA 4EUZA 4S2LA 2ZM8A 4R4SA 5FAPA 3SH9A 2ZL1A 1Q2PA 1W63M 4Y13A 4RYEA 1VQQA 4C75A 4JKTA 5EVIB 4Z1WA 4WLAA 2X71A 4DF6A 3ZG8B 2EWVA 4QD4A 1OTAA 4UHUA 3WS0A 4HH3A 1GSWA 3MZFA 3V50A 4C3QA 2EFUA 2Y2QA 4WBGA 2XLNA 3BFCA 1J9MA 1GCEA 2M7VA 3GRJA 2IWBA 3LIBA 4IUKA 2JN7A 2W3HA 2QJ7A 3UB9A 4OQIA 4WL9A 2Y2IA 3ITBA 4PPRA 1IYQA 1T1CA 4EBNA 4Y3IA 4LRZE 1T19A 4L9EA 3HUOA 4OH0A 1WE4A 2DMWA 3BFEA 2GDNA 1CI8A 4S2OA 3RXWA 1M40A 4EWFA 3T50A 5HL1A 2WKIA 5HDSA 4OQ0A 4ZAMA 5FI2A 4ID4A 4DDYA 4WELA 3IBJA 1YKDA 4L9GA 2B5RA 3JVUA 1NRJA 2HV1A 1G68A 3WS1A 3RJUA 1Q2QA 3H82B 1EI5A 4QWOA 2J8YA 3OZHA 2Z2LB 4I38A 5J3WA 2JKTM 3O87A 4H8RA 2HZ5A 3K3CA 4B4XA 3PBSA 2PBDP 4GS9A 1YMXA 2HP6A 3PBTA 1XGIA 3F1NB 1K4FA 1MC0A 1YM1A 5HX9A 2V1ZA 5DF8A 4X1MA 1K57C 1IYOA 2B18A 2YKHA 2VKSA 3QP2A 2WAFA 3QP4A 1GA9A 5FI7A 5HW3A 1OTDA 2Q9NA 3S4XA 4KZ6A 5CGXA 2G2WA 4N1XA 3F1OB 3BW6A 1G5UA 3LIAA 5BOHA 3IS2A 2HGVA 3C38A 3LY3A 2OV5A 2WGIA 2G7UA 5G4ZA 2E8IA 3HLFA 5EFWA 2J9PA 3L7HA 1AWIA 4JBFA 4O7DA 3F1OA 4EV4A 1CJFA 3L9KA 1XJ6A 2NUPC 3IXGA 5EVLA 2W3FA 4OLGA 3N8SA 1PI5A 1KGEA 3UDFA 2VGLS 1DRMA 1FSWA 5DFYA 5GL9A 4F94A 3QNCA 2V9AA 1MWUA 1BLSA 2HPBA 4N1HA 3RTYA 3SH8A 1YLYA 1PZPA 5F69A 2OLVA 3OLOA 3V3SA 1ZG6A 1LHYA 1WA9A 4P0MA 2Y4AA 4QB8A 1LI0A 3A3JA 2OSUA 3LIDA 1MKIA 1YPRA 4UEYA 4EESA 3G4PA 1XJ3A 1ESUA 4MBKA 4LV1A 1RP5A 5U47A 5DF7A 3P98A 3UE0A 3ZFZA 4MN7A 1SZVA 4PKYA 5HL6A 3VP4A 3WWXA 3AGDA 3UNWA 3C7UA 3CJMA 3JVVA 4R23A 3EGDC 1S4RA 4CLCB 1O07A 4EW7A 4OPYA 1H8YA 3RXXA 3QP5A 3UB6A 5CHUA 2C6WB 3SS5A 1T1AA 3VE4A 3UMDA 3QP8A 5CEBA 2VJWA 1LI9A 2RL3A 5LBRA 5MC7A 4PM7A 4GHIA 3NECA 2QYBA 3BRMA 2RCXA 5FQJA 4DN0A 4WMCD 4JPMA 4CQHA 3UB5P 2JKFA 4OONA 1G28A 2EA9A 1PFLA 1I2SA 3MZEA 3VOYA 5TBMA 4LV2A 4Y15A 4HP9A 2OWHA 2ZOHA 4O0PA 2XDMA 3CITA 3IHAA 3BM6A 2PR6A 2YKFA 2L0WA 4LRYC 4OLDA 2JC7A 2XRNA 3IX3A 2UV0E 1H0MA 1KDSA 2A24B 2QWSA 2EXAA 2X01A 4KQRA 2Y2NA 3B33A 2JBFA 1D06A 3T12B 4DJ2A 4E3OA 1F9IA 1K54A 1S4SA 3UE6A 1E25A 2W3EA 3CPTA 3HJIA 4DJ3A 1NLYA 1NZOA 2EFXA 2L4RA 3DTKA 1TS8A 1RGZA 2PR5A 4IBRA 2PYRA 3F1NA 4U3TA 2NUTC 3R7WA 4GS9B 2M1CA 3VP0A 4EXOA 2JKTI 2EX8A 4UA9A 4JF4A 4K0XA 4GZBA 4BBTA 2B02A 2M7UA 4X6TA 3IQAA 4B88A 4GCZA 5I5LA 3M2KA 3KSGA 5CECA 4UQIM 4CLCA 1FR6A 3MFDA 4KZ9A 4XUZA 3A0VA 3G6OA 4X69A 3OCLA 2ZQ9A 3HREA 3HLWA 3E2LA 3LR0A 3EGXC 1ERMA 3VFHA 1YSQA 2HDQA 3H7WA 4HHDA 3ZG9B 3LY4A 3W4PA 1L0EA 3RH8B 1XA7A 3KSIA 1EWZA 5HAPA 2PAVP 1TF1A 4UAAA 2A49A 3UO9A 1KE3A 1K0KA 1OTBA 4HI4A 5EVIC 4D60A 4FTXA 2XA7S 5L09A 2I72A 4S2JA 4GDBA 4R3JA 2XD1A 3VOZA 1ZC2A 3HLBA 4PM5A 1KDWA 5HWVA 2PHYA 3MKFA 4ETZA 2JKRI 1N9OA 2V0WA 3A3FA 3A3EA 3WS5A 4HH2A 5GLCA 1HTZA 3M6BA 3ZQ5A 3QP6A 3AGEA 3VP1A 4LFUA 4GNUA 4MEZA 3VOLA 5L10A 1IOUA 5IT5A 3ZDJA 1GHPA 2XA7M 3IH9A 3ZCZA 4BLMA 2WK0A 2Z6CA 3N7WA 3MQOA 3IX4A 5CTMA 2VZWA 4R6LA 3TE8A 5E2GA 3NOUC 3T4SA 5KSCA 4MDZA 2Y2PA 4OP8A 2ZC3B 3U4LP 1CEGA 1IYPA 3UE3A 4ZTKA 3ZHHA 2W1TA 4WYYA 4S2NC 3QNBA 4I39A 2OOLA 1YLJA 3W8KA 1L0FA 2ZMFA 2V8FA 4KZ3A 5D3OA 5TJJA 3MMHA 5HFOA 3CWFA 3G2ZA 3SS3A 4HJ6A 3T4TA 2HJEA 2OAQ1 5HZHA 3UB7A 1BSGA 5TBMB 1S6RA 4PAUA 2EX6A 2DCFA 3UDIA 1K55C 1FIKA 4XT2B 4MN6A 5HSQA 4YWZA 3IWOA 3ZG7B 4Y2FA 4B4ZA 1ZKJA 2ZOIA 3FPVA 1GHIA 3IXDA 3JYIA 1W63Q 3M2JA 5L8MA 2K2NA 1KGFA
chains in the Genus database with same CATH topology
3F1OB 3BW6A 2V0UA 3PBRA 3LIAA 2A24A 3IS2A 2HGVA 3C38A 3B47A 4OOMA 4BBUA 3TRCA 2G7UA 1ZHHB 4I5SA 4NKPA 1S66L 5G4ZA 4L0LA 3OCNA 3KSFA 2PYPA 2K7SA 5EFWA 3F1OA 2O99A 1XJ6A 4EERA 2NUPC 2D01A 2W3FA 4HP4A 3P01A 4JGOA 4XT2A 4NXEA 2VGLS 4JGQA 1DRMA 4NXGA 5DFYA 2HF6A 1GSVA 5DJTA 3W2ZA 2P04A 2VV8A 2V9AA 5HPIA 2W3DA 4GW9A 5HDCA 1OJGA 1UWPX 4WF0A 3RTYA 2WKPA 5C5KA 3LYXA 4GJ4A 4HOIA 1Y28A 4JGRA 3T4LA 5F69A 4IHQA 3OLOA 2GZAA 2QJ5A 3EQVA 4Y5FA 4NXFA 1WA9A 2W27A 3LICA 1LT0A 4OOLA 4BMWA 3R4KA 3FC7A 3LIDA 1KOUA 2PT7A 4QPRA 1H8MA 4UEYA 4UQIS 4ARZA 4EESA 1MKMA 1XJ3A 2GJ3A 3H9WA 4B93A 3ZYTA 2D02A 3B42A 1OT6A 3PXPA 2W3GA 2J3WA 4MN7A 4PKYA 2O9AA 5HL6A 1OJ5A 3EEHA 2VV6A 4R3AA 1V9ZA 1OTEA 1S67L 1TS6A 3OOVA 2Y8HA 1UGUA 1YSPA 4ZRRA 3JVVA 1OTIA 3T4OA 1T1BA 3EGDC 1S4RA 3K3DA 4NXBA 5DF9A 4O8GA 4CLCB 3LI9A 4MN5A 4EW7A 4LLOB 3KO6A 4CLCE 3UB6A 3S7QA 3LIEA 4KQOA 3D72A 3A0SA 2BASA 3EEAA 3IBRA 1T1AA 1NLZA 1VB6A 5DFXA 2MJ6A 3VE4A 4NEED 2FZ0A 3UMDA 4KQDA 1LL8A 3MR0A 5HD5A 4BJPA 3NHQA 2VJWA 4GLQA 4BBVA 3VE3A 5LBRA 3MF0A 1N9NA 2ZMVA 3PHYA 3O5YA 4EEPA 5MC7A 3T4JA 1D7EA 4Q0JA 4GHIA 3KSHA 3R7WB 2Y79A 2PD7A 4L9FA 2QYBA 3BQ8A 3CLOA 2OWJA 4G3WA 1S1YA 2WKQA 2GNXA 4WUJA 2JHEA 3E98A 5F5YA 4DN0A 3LR5A 4CQHA 4CLCC 4H6JB 1ZTUA 4EUVA 1G28A 3LI8A 2EA9A 3OC2A 2EWWA 3TW8A 5TBMA 3OBFA 3BWLA 3LUQA 3K2NA 4HP9A 2OWHA 2ZOHA 3CI6A 4G3VA 4O0PA 3CITA 3GECA 2R78A 1P0ZA 5AVEA 2PR6A 2YKFA 4R70A 2L0WA 4LRYC 3VV4A 4WEKA 1LSVA 2LB9A 2XRNA 3EOIA 3E4PA 5J4EA 1EW0A 4KUKA 4YOFA 3T4QA 1TS7A 4I3JA 4Q0IA 2A24B 2QWSA 4WN5A 3MFXA 3E0YA 3LFVA 1YAXA 3NJAA 3B33A 5J7EA 4EQ1A 4LPZA 5DJUA 1D06A 2KX6A 3DBAA 4DJ2A 1BYWA 1F9IA 4H6JA 4WEJA 4LRXC 1S4SA 3IS2B 3LIFA 3UE6A 3FPWA 2W1RA 3HJIA 1MZUA 1UWNX 1T18A 2W3EA 2VEAA 4DJ3A 1NLYA 3LR4A 4MCWA 2L4RA 1TS8A 1LSWA 2HJ9C 3C30A 1XJ4A 2Z6DA 2PR5A 4HNBA 1XFNA 2W0NA 3P7NA 2PYRA 3LR3A 3F1NA 2OAP1 2NUTC 5CX7A 3R7WA 4FOFA 3F1PA 2GX5A 2VA0A 4GS9B 4PKYG 1GSXA 2M1CA 2O9BA 3RFBA 1F98A 2KDKA 4EXOA 1DP6A 4DMZA 2JKTI 5HDDA 3PR6A 4BBTA 1DP8A 3D3OA 1ODVA 4IJGA 2B02A 2M7UA 3PYPA 2XSSA 4M4XA 4GCZA 3EWKA 3NOPC 5I5LA 3FG8A 3KSGA 3ICYA 3HJKA 5A8BA 2VGLM 5DKKA 4G3KA 4UQIM 4CLCA 4AFIA 5F6AA 4RQ9A 3H7WB 5AVFA 1STZA 3A0VA 3G6OA 1X0OA 3CUEA 3OCLA 4CLCD 3BY8A 2H28A 5KIZA 3KYQA 3E4OA 3C8CA 3BY9A 2V1BA 2P08A 2L1MA 2QKPA 3LR0A 3S7NA 1P9WA 1JNUA 3EGXC 4EETB 3MXQA 3MJQA 5DKLA 2FH5A 1YSQA 4JGPA 3H7WA 2VX8A 4HHDA 4HQAA 4Q0HA 4F3LB 1P97A 2J3TD 4I3IA 3RH8B 3KSIA 2KOIA 3EQUA 4E04A 1TF1A 3PBNA 2CMNA 1OTBA 4BWIA 4HI4A 4EEUA 5HD3A 4B9OA 4HJ3A 3MQQA 3HCYA 3H82A 4FSFA 2XA7S 1P9RA 3ULFA 4F3LA 3BQAA 3A0RA 3E4QA 4P6ZS 1W63M 4YNRA 5HWTA 1VHMA 4K08A 4P6ZM 2PDRA 3S7PA 3F1PB 5HWVA 2PHYA 4Z1WA 1TS0A 4WLAA 4ETZA 2JKRI 1N9OA 2V0WA 4O01A 2EWVA 4HH2A 1OTAA 2XROA 2V1AA 5IS1A 4HH3A 3ZQ5A 4ARZB 1GSWA 2W1TB 1XJ2A 2J3TC 1S1ZA 3VOLA 5FL3A 2M7VA 1IOUA 5IT5A 3PBOA 2P7JA 2XA7M 3LIBA 4HIAA 5HPFA 1H3QA 2J80A 2Z6CA 4IUKA 3BJNA 2JN7A 2W3HA 5K5BA 4GHIB 2QJ7A 3MQOA 3UB9A 4WL9A 1T1CA 2VLGA 2K31A 4KUOA 2KLIA 3NOTC 1NWZA 2VZWA 4Y3IA 4R6LA 4LRZE 3TE8A 1T19A 4L9EA 5AJGA 3U2AA 1IFQA 4HJ4A 3MQ0A 3NOUC 2DMWA 3T4SA 2PD8A 3CUEC 4MDZA 3SW1A 2A2LA 4I3AA 3T50A 2WKRA 1G6OA 5HDSA 4WELA 3IBJA 3UE3A 1YKDA 2IA2A 4L9GA 3TJZC 3JVUA 3T4KA 1NRJA 2W1TA 4MMNA 2HV1A 4I39A 2OOLA 3H82B 2ZMFA 3KYZA 4II7A 1TD5A 2ZBBA 3C2WA 3V67A 5TJJA 3MMHA 4IUHA 5IU1A 2VV7A 2I9VA 4I38A 5J3WA 3PBQA 2O0YA 2JKTM 3CWFA 3K3CA 3PBSA 4HJ6A 3T4TA 3S7OA 2HJEA 2OAQ1 5HZHA 3GDIA 4HY8A 4R38A 3UB7A 5TBMB 4GS9A 3PBTA 4PAUA 1N9LA 3KX0X 1XFQA 3F1NB 5KSHA 1LSXA 3UMEA 2INWA 1MC0A 5F68A 5G4YA 2LB5A 4ETXA 1V9YA 2JKRM 3UB8A 4XT2B 4MN6A 2B18A 5HSQA 2YKHA 3CAXA 4YWZA 4Y2FA 5HWWA 2O9CA 2ZOIA 3FPVA 2VKSA 2QHKA 4PHTA 1OPXA 4ME4A 1W63Q 1OTDA 1DP9A 1F5MA 1OT9A 5L8MA 2K2NA 4EU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMW A;  4AFI A;  3BW6 A;  1H8M A;  2VX8 A;  3EGD C;  3EGX C;  1IFQ A;  3KYQ A;  2NUP C;  4B93 A;  2NUT C;  1IOU A; 
#chains in the Genus database with same CATH topology
 1E3U A;  2HDS A;  3PBR A;  2V0U A;  4X25 A;  4OVD A;  4X68 A;  2A24 A;  2ZM0 A;  5M1A A;  2ZQ7 A;  1BLP A;  4KZA A;  4I5S A;  3TSG A;  1PIO A;  4NKP A;  5CHM A;  4NG2 A;  4L0L A;  2K7S A;  4R1G A;  3Q81 A;  4Y7P A;  5L07 A;  5EOE A;  1SDE A;  3P01 A;  4PM9 A;  3C4P A;  1PW1 A;  3PAG A;  3Q7Z A;  1TDG A;  2HF6 A;  1GSV A;  4R4R A;  2VV8 A;  5HPI A;  2W3D A;  3W4O A;  2Y59 A;  4GW9 A;  3IT9 A;  3VMA A;  2PBY A;  3NI9 A;  3HL9 A;  5JYP A;  4GJ4 A;  4HOI A;  5L2F A;  2WGV A;  3LEZ A;  4IHQ A;  2GZA A;  2QJ5 A;  4NXF A;  3LGO A;  3LIC A;  1LT0 A;  1ES4 A;  1GHM A;  4OOL A;  4GN2 A;  1KOU A;  2PT7 A;  4ARZ A;  1U60 A;  2ZQD A;  2EXB A;  4B93 A;  2D02 A;  3B42 A;  1QME A;  5FQM A;  1YMS A;  1OT6 A;  2ZQC A;  2W3G A;  3CG5 A;  4P85 A;  3ZNT A;  1PZO A;  1OJ5 A;  5A91 A;  1V9Z A;  1TS6 A;  1UGU A;  1YSP A;  4DE0 A;  1FR1 A;  5E43 A;  1T1B A;  4D2O A;  4NXB A;  2R9X A;  2FFF B;  4MN5 A;  3SOI A;  2C5W B;  3FZC A;  4LLO B;  1KE0 A;  4FH4 A;  3KO6 A;  3S7Q A;  3T1R A;  3SZT A;  3A0S A;  1JWP A;  3IBR A;  3BLS A;  5M19 A;  4BEN A;  4KZ5 A;  1NLZ A;  2MJ6 A;  4NEE D;  2FZ0 A;  4KQD A;  3FKV A;  1WYB A;  1QMF A;  3UE1 A;  4GLQ A;  2Y2H A;  3VE3 A;  2Y2L A;  1ZG4 A;  3G31 A;  4E3M A;  3PHY A;  5EOO A;  1D7E A;  3KSH A;  2EX9 A;  3BEB A;  1VM1 A;  2Y79 A;  2PD7 A;  4A5R A;  2J9O A;  1ESI A;  3BQ8 A;  1ERQ A;  3S1Y A;  1S1Y A;  1RCJ A;  2WKQ A;  3UPO A;  2JHE A;  2X02 A;  3E98 A;  2ZJ9 A;  4OOY A;  4LV3 A;  3NDE A;  3MBZ A;  4EUV A;  3LI8 A;  3OC2 A;  1HVB A;  1IEM A;  3VFF A;  3TW8 A;  5FQ9 A;  5FSR A;  3OBF A;  2OLU A;  4PMA A;  1D1J A;  2R78 A;  1P0Z A;  5AVE A;  2BTF P;  2JCH A;  3Q07 A;  3VV4 A;  4WEK A;  2IWD A;  3V39 A;  4K91 A;  5J4E A;  4KUK A;  4Q0I A;  2Q0O A;  3VP3 A;  1IKG A;  4LPZ A;  1J3W A;  5DJU A;  2KX6 A;  1BYW A;  4H6J A;  1NYM A;  3TOI A;  3FPW A;  1T18 A;  1KGG A;  2XFT A;  1LSW A;  4GOG A;  1XJ4 A;  4HNB A;  2W0N A;  1PWG A;  1NYY A;  1CK3 A;  5F1G A;  3KYE A;  4KZ4 A;  3F1P A;  3IF5 A;  4PKY G;  1GSX A;  5KZH A;  2P9V A;  1H5X A;  2V20 A;  4HES A;  2ZLY A;  3PR6 A;  4LGW A;  5FDS A;  1TDL A;  1K25 A;  1W5D A;  4IJG A;  3PYP A;  4WMC A;  5EVI D;  4X56 A;  3FKW A;  3GMW A;  5DTT A;  1KVL A;  3T1Q B;  4BQM A;  3FG8 A;  3ICY A;  5TGF A;  4UA6 A;  5F6A A;  5FAS A;  4BL3 A;  1I2W A;  3H7W B;  4GD8 A;  5AVF A;  4OKP A;  3CUE A;  3NUL A;  5DVA A;  3BY8 A;  1KVM A;  3E4O A;  3C8C A;  2L1M A;  2QKP A;  2PU4 A;  3S7N A;  1SKO A;  4Z9Q A;  4HQA A;  1YLT A;  5FI6 A;  5EVE A;  1IYS A;  4I3I A;  2H10 A;  4JF6 A;  4KZ8 A;  1A0K A;  3PBN A;  2CMN A;  3UDX A;  5HD3 A;  4DKI A;  4HJ3 A;  3MQQ A;  1YLW A;  1FSY A;  3ULF A;  4F3L A;  2AVX A;  5FQI A;  3E2K A;  3IH8 A;  4GD6 A;  5HWT A;  1VHM A;  4BL2 A;  3NC8 A;  2PDR A;  5FAT A;  1TS0 A;  4JF5 A;  5G18 A;  1PI4 A;  2EX2 A;  1MWS A;  4O01 A;  2XRO A;  4PM6 A;  3ZG5 A;  2R9W A;  2V1A A;  2Y55 A;  4QU3 A;  3ZVW A;  4ARZ B;  1XA1 A;  1ES2 A;  1NXY A;  3HLD A;  2ZD8 A;  1XJ2 A;  1VEU A;  2VGJ A;  1K38 A;  1S1Z A;  5FL3 A;  3O86 A;  1RGY A;  4E3N A;  2ZC5 B;  2P7J A;  3AGF A;  3G35 A;  4E3K A;  5HPF A;  2J80 A;  1C3B A;  2IWC A;  3BJN A;  1FCN A;  5K5B A;  4GHI B;  4KUO A;  2KLI A;  5EM1 A;  1NWZ A;  3WRT A;  1FCO A;  5AJG A;  1Z6F A;  1MWT A;  2XF3 A;  1F2K A;  2Q9M A;  4HJ4 A;  3MQ0 A;  5CGS A;  5EEC A;  3LO7 A;  3WS4 A;  3DWZ A;  2A2L A;  2CC1 A;  1G6O A;  2G2U A;  5AQB A;  2WAD A;  3T4K A;  3CMZ A;  1W7F A;  4II7 A;  1MPL A;  1TD5 A;  1BZA A;  1HLU P;  3C2W A;  3PTE A;  2XEP A;  4IUH A;  5CRF A;  4Y0U A;  3G32 A;  4X55 A;  2I9V A;  4Q8I A;  2BLS A;  2WKH A;  4HBU A;  2HDU A;  1BLH A;  4R38 A;  5M18 A;  3IF6 B;  2P74 A;  1XFQ A;  4HEF A;  1LSX A;  5IHV A;  1L3L A;  5G4Y A;  3CZD A;  2LB5 A;  4ETX A;  3UB8 A;  1PW8 A;  1XPB A;  3CAX A;  5HWW A;  2O9C A;  4PHT A;  4KEN B;  4ME4 A;  1L2S A;  4DXB A;  4C6Y A;  4ZJ3 A;  3ZGA B;  4S2M A;  3HUN A;  4WM9 A;  1F5M A;  3IHB A;  1OT9 A;  3MSH A;  4E3L A;  1L0D A;  1Z09 A;  3VP2 A;  5EUA A;  4BBU A;  3BFF A;  2E8J A;  1S66 L;  4X1L A;  3OCN A;  3GR2 A;  4N92 A;  1SHV A;  3V5M A;  3JPU A;  4S2K A;  1ALQ A;  3ISG A;  1I5Q A;  2D01 A;  4HP4 A;  3HVF A;  4JGO A;  3OPL A;  4JGQ A;  5DJT A;  2P04 A;  4WZ5 A;  4LCM A;  1BUL A;  4ZJ1 A;  1AXB A;  1OJG A;  1UWP X;  1SDN A;  4WF0 A;  3OPR A;  5C5K A;  4XUX A;  1ERO A;  3T4L A;  2WGW A;  3EQV A;  4Y5F A;  3V3R A;  3VSL A;  3HLG A;  4DRT A;  4BMW A;  3FC7 A;  3Q7V B;  5E2F A;  5CER A;  4QPR A;  2GJ3 A;  3ZYT A;  2ZQA A;  2WGW B;  1BLC A;  4BD0 A;  4JLF A;  1XGJ A;  2J3W A;  1L0G A;  1TEM A;  3EEH A;  1NZU A;  3G34 A;  4QY6 A;  3Q7V A;  1OTE A;  1S67 L;  2Y8H A;  1SCW A;  4QHC A;  5FA7 A;  3K3D A;  3OPP A;  5DF9 A;  1FQG A;  3GSG A;  3LI9 A;  4FCF A;  3DWK A;  3IXB A;  4FD8 A;  4CLC E;  4ESP A;  3LIE A;  3D72 A;  4DXC A;  1HZO A;  2BAS A;  3A3D A;  1E3U D;  1PWD A;  1VB6 A;  3MZD A;  2H0T A;  4E3I A;  1LL8 A;  3MR0 A;  4DDS A;  4BJP A;  5FEF A;  2Z2M B;  1BT5 A;  1N9N A;  3T4J A;  3DTM A;  4Q0J A;  4U0T A;  4ZDX A;  4OQG A;  4ZJ2 A;  4G3W A;  2ZQ8 A;  3QP1 A;  4WUJ A;  4FUW A;  1H8Z A;  5F5Y A;  3LR5 A;  1BTL A;  1ZTU A;  3D9Y A;  2UWX A;  5AQA A;  1VEU B;  4MNR A;  3LEQ A;  3BWL A;  3LUQ A;  1PWC A;  2WZX A;  3K2N A;  4N9K A;  3CI6 A;  4G3V A;  1K57 A;  3GEC A;  4E3J A;  1PNE A;  1S0W A;  5E2H A;  3HLC A;  4R70 A;  4GKU A;  3EOI A;  1XP4 A;  1TS7 A;  4I3J A;  4HBT A;  3BFD A;  1DJA A;  4LCL A;  2Y2M A;  3E0Y A;  3LFV A;  3NJA A;  1YLZ A;  3HLE A;  5J8X A;  3NBL A;  3DBA A;  3G2Y A;  4LRX C;  3LIF A;  5EV0 A;  3TG9 A;  1UWN X;  1DY6 A;  3ZVT A;  5DTS A;  3SS4 A;  1E4D A;  2P9V B;  1VET A;  3LR4 A;  3DTE A;  4JXW A;  2HJ9 C;  3P7N A;  3UPP A;  2XQZ A;  2QZ6 A;  2HP5 A;  2B95 A;  2ZC6 B;  5HAQ A;  2GX5 A;  1DP6 A;  4DMZ A;  5HDD A;  1DP8 A;  3D3O A;  1MWR A;  2XSS A;  4M4X A;  1JTG A;  4OQH A;  1NRF A;  3NOP C;  3DTI A;  3MXS A;  2HP9 A;  3HJK A;  5DKK A;  4G3K A;  4IBX A;  1ONG A;  2ACG A;  5FEG A;  3MKE A;  4RQ9 A;  4S2I A;  4FH2 A;  1XXM A;  3N8L A;  1STZ A;  1X0O A;  4CLC D;  5TR7 A;  2Y2K A;  2WUQ A;  5KIZ A;  3KYQ A;  3T1X A;  3BY9 A;  2V1B A;  2P08 A;  3DW0 A;  1P9W A;  4EET B;  3FYZ A;  4JGP A;  4KG2 A;  4Q0H A;  4F3L B;  1YQS A;  2J3T D;  3O88 A;  4P87 A;  4ZBE A;  3EQU A;  3GVB A;  4MBH A;  3IF6 C;  5HAI A;  1W79 A;  4YIN A;  1K4E A;  1K6S A;  4B9O A;  5F1F A;  5I94 A;  3H82 A;  1PYY A;  4FSF A;  1P9R A;  3S22 A;  1O7E A;  3E4Q A;  3M6H A;  5EM0 A;  4UA7 A;  4RVA A;  2WAE A;  4YNR A;  4RA7 A;  2ZC4 B;  4K08 A;  4P6Z M;  3S7P A;  3F1P B;  2BG1 A;  2PRF A;  1ACF A;  4OPQ A;  5A92 A;  4Y17 A;  5IS1 A;  1ONH A;  3BYD A;  2W1T B;  1LL9 A;  5EVI A;  2XFS A;  2J3T C;  3C5A A;  5HAR A;  1N4O A;  3PBO A;  3UPN A;  4HIA A;  1H3Q A;  2J7V A;  4IVK A;  3N4I A;  2VLG A;  2K31 A;  3BFG A;  3NOT C;  5AQ9 A;  3U2A A;  1IFQ A;  4EBL A;  5A90 A;  2PD8 A;  3CUE C;  1LLB A;  3SW1 A;  4I3A A;  2WKR A;  3IXH A;  2IA2 A;  3IX8 A;  4DE3 A;  3TJZ C;  4MMN A;  1WYC A;  3KYZ A;  4NK3 A;  1K56 D;  1FOF A;  3IWQ A;  1MXO A;  2ZBB A;  5GHY A;  3ZNY A;  3V67 A;  3MS6 A;  5IU1 A;  2VV7 A;  3PBQ A;  2O0Y A;  3NIA A;  5GLB A;  4MBF A;  4OP5 A;  4OPZ A;  3S7O A;  1KE4 A;  1K54 C;  3GDI A;  4HY8 A;  3WS2 A;  2H0Y A;  1N9L A;  3ITA A;  3KX0 X;  3FWL A;  5KSH A;  3UME A;  2INW A;  1K56 A;  1CEF A;  5F68 A;  1V9Y A;  2JKR M;  1Y54 A;  3CPT B;  2QHK A;  2Y2G A;  1OPX A;  3NY4 A;  1IKI A;  1G6A A;  1OME A;  1DP9 A;  4EU0 A;  3T1S A;  3C4O A;  3B47 A;  4OOM A;  2DNS A;  3TRC A;  1ZHH B;  1CI9 A;  3KSF A;  1ES3 A;  2PYP A;  2O99 A;  3GTC A;  4LEN A;  1JWZ A;  1GA0 A;  5FQQ A;  4EER A;  1BUE A;  3CHW P;  4XT2 A;  4NXE A;  3GV9 A;  5GLD A;  4K0W A;  4NXG A;  3W2Z A;  4RX2 A;  3WRZ A;  4P6B A;  5HDC A;  3N8R A;  2WKP A;  3LYX A;  1YT4 A;  3OPH A;  1SKO B;  1Y28 A;  3GQZ A;  4JGR A;  5CGW A;  3FV7 A;  3HUM A;  5GHZ A;  3ZG0 A;  3PAE A;  3D4F A;  3BLM A;  2XH9 A;  2W27 A;  4JXV A;  3R4K A;  4U0X A;  4KZB A;  2XK1 A;  1H8M A;  4UQI S;  3C7V A;  1MKM A;  3H9W A;  3UY6 A;  2Y2O A;  3Q82 A;  1NJ4 A;  3UN7 A;  2XGN A;  4EQI A;  4YFM A;  3PXP A;  4OPR A;  2JE5 A;  2O9A A;  2PU2 A;  2VV6 A;  4KG6 A;  4R3A A;  4IED A;  5FAQ A;  5FDH A;  1JWV A;  3OOV A;  4ZRR A;  1OTI A;  3DAV A;  4LV0 A;  5A93 A;  3T4O A;  4EBP A;  2WKE A;  1K55 A;  4O8G A;  5GHX A;  3SH7 A;  5CTN A;  4RX3 A;  3O3V A;  4KQO A;  5TFQ A;  5E2E A;  2ZC7 A;  3EEA A;  4NET A;  3LCE A;  2H5S A;  3MXR A;  5DFX A;  2VK3 A;  3VSK A;  1XKZ A;  2V2F F;  4R0Q A;  5HD5 A;  4DE2 A;  3NHQ A;  5FQK A;  4N9L A;  4BBV A;  4S2N A;  3MF0 A;  1MBL A;  2ZMV A;  3O5Y A;  4EEP A;  5CHJ A;  1Y4O A;  3R7W B;  2DRW A;  4L9F A;  3CLO A;  1N9B A;  2OWJ A;  5FAO A;  2GNX A;  5EE8 A;  1LL5 A;  2QMI A;  2A3U A;  4Y0T A;  1NY0 A;  4S2P A;  4CLC C;  4H6J B;  2ZM2 A;  4WZ4 A;  2QPN A;  2EWW A;  4KQQ A;  3G30 A;  1FIL A;  1YLP A;  2ZL1 B;  4Y0O A;  4CJN A;  3Q1F A;  2ZMA A;  5DTK A;  5KMW A;  1LSV A;  2LB9 A;  3E4P A;  1DJC A;  4KZ7 A;  1EW0 A;  4YOF A;  3T4Q A;  3IF6 A;  4DE1 A;  5AQ7 A;  1CF0 A;  3QHY A;  4WN5 A;  3MFX A;  1XX2 A;  1YAX A;  1VET B;  5J7E A;  4EQ1 A;  1TVF A;  3NDG A;  4WEJ A;  1FCM A;  3IS2 B;  4IVI A;  2Y91 A;  2W1R A;  1M6K A;  2WZZ A;  1MZU A;  3BEC A;  2VEA A;  4E6X A;  3A3I A;  1PRQ A;  4MCW A;  1MY8 A;  3C30 A;  1HD8 A;  3IWI A;  3I7J A;  2Z6D A;  1XFN A;  3LR3 A;  2OAP 1;  1K6R A;  5CX7 A;  2HDR A;  4FOF A;  2VA0 A;  4M3K A;  4R3B A;  2O9B A;  3RFB A;  1F98 A;  2KDK A;  4QJG A;  4JXG A;  1SKF A;  2Y2J A;  4E6W A;  4BD1 A;  1JTD A;  2V8C A;  1ODV A;  4CPK A;  3EWK A;  4PM8 A;  1W8Y A;  4JXS A;  4GDN A;  5A8B A;  4X53 A;  4KG5 A;  2VGL M;  4XXR A;  4QY5 A;  3W4Q A;  2XR0 A;  4AFI A;  3N6I A;  5EPH A;  2JKG A;  3P09 A;  1DJB A;  1IEL A;  2FFY A;  2H28 A;  4MLL A;  2VGK A;  5F83 A;  1JNU A;  3NCK A;  3MXQ A;  3MJQ A;  2XD5 A;  3B3X A;  5DKL A;  5CXW A;  2FH5 A;  5F82 A;  1CQA A;  1ES5 A;  2VX8 A;  4WZ5 C;  1P97 A;  2KOI A;  3HBR A;  4E04 A;  5JYO A;  4BWI A;  1W8Q A;  2WYX A;  4EEU A;  5GLA A;  1JVJ A;  3HCY A;  3BQA A;  4GB7 A;  3A0R A;  4P6Z S;  5CED A;  4EUZ A;  4S2L A;  2ZM8 A;  4R4S A;  5FAP A;  3SH9 A;  2ZL1 A;  1Q2P A;  1W63 M;  4Y13 A;  4RYE A;  1VQQ A;  4C75 A;  4JKT A;  5EVI B;  4Z1W A;  4WLA A;  2X71 A;  4DF6 A;  3ZG8 B;  2EWV A;  4QD4 A;  1OTA A;  4UHU A;  3WS0 A;  4HH3 A;  1GSW A;  3MZF A;  3V50 A;  4C3Q A;  2EFU A;  2Y2Q A;  4WBG A;  2XLN A;  3BFC A;  1J9M A;  1GCE A;  2M7V A;  3GRJ A;  2IWB A;  3LIB A;  4IUK A;  2JN7 A;  2W3H A;  2QJ7 A;  3UB9 A;  4OQI A;  4WL9 A;  2Y2I A;  3ITB A;  4PPR A;  1IYQ A;  1T1C A;  4EBN A;  4Y3I A;  4LRZ E;  1T19 A;  4L9E A;  3HUO A;  4OH0 A;  1WE4 A;  2DMW A;  3BFE A;  2GDN A;  1CI8 A;  4S2O A;  3RXW A;  1M40 A;  4EWF A;  3T50 A;  5HL1 A;  2WKI A;  5HDS A;  4OQ0 A;  4ZAM A;  5FI2 A;  4ID4 A;  4DDY A;  4WEL A;  3IBJ A;  1YKD A;  4L9G A;  2B5R A;  3JVU A;  1NRJ A;  2HV1 A;  1G68 A;  3WS1 A;  3RJU A;  1Q2Q A;  3H82 B;  1EI5 A;  4QWO A;  2J8Y A;  3OZH A;  2Z2L B;  4I38 A;  5J3W A;  2JKT M;  3O87 A;  4H8R A;  2HZ5 A;  3K3C A;  4B4X A;  3PBS A;  2PBD P;  4GS9 A;  1YMX A;  2HP6 A;  3PBT A;  1XGI A;  3F1N B;  1K4F A;  1MC0 A;  1YM1 A;  5HX9 A;  2V1Z A;  5DF8 A;  4X1M A;  1K57 C;  1IYO A;  2B18 A;  2YKH A;  2VKS A;  3QP2 A;  2WAF A;  3QP4 A;  1GA9 A;  5FI7 A;  5HW3 A;  1OTD A;  2Q9N A;  3S4X A;  4KZ6 A;  5CGX A;  2G2W A;  4N1X A;  3F1O B;  3BW6 A;  1G5U A;  3LIA A;  5BOH A;  3IS2 A;  2HGV A;  3C38 A;  3LY3 A;  2OV5 A;  2WGI A;  2G7U A;  5G4Z A;  2E8I A;  3HLF A;  5EFW A;  2J9P A;  3L7H A;  1AWI A;  4JBF A;  4O7D A;  3F1O A;  4EV4 A;  1CJF A;  3L9K A;  1XJ6 A;  2NUP C;  3IXG A;  5EVL A;  2W3F A;  4OLG A;  3N8S A;  1PI5 A;  1KGE A;  3UDF A;  2VGL S;  1DRM A;  1FSW A;  5DFY A;  5GL9 A;  4F94 A;  3QNC A;  2V9A A;  1MWU A;  1BLS A;  2HPB A;  4N1H A;  3RTY A;  3SH8 A;  1YLY A;  1PZP A;  5F69 A;  2OLV A;  3OLO A;  3V3S A;  1ZG6 A;  1LHY A;  1WA9 A;  4P0M A;  2Y4A A;  4QB8 A;  1LI0 A;  3A3J A;  2OSU A;  3LID A;  1MKI A;  1YPR A;  4UEY A;  4EES A;  3G4P A;  1XJ3 A;  1ESU A;  4MBK A;  4LV1 A;  1RP5 A;  5U47 A;  5DF7 A;  3P98 A;  3UE0 A;  3ZFZ A;  4MN7 A;  1SZV A;  4PKY A;  5HL6 A;  3VP4 A;  3WWX A;  3AGD A;  3UNW A;  3C7U A;  3CJM A;  3JVV A;  4R23 A;  3EGD C;  1S4R A;  4CLC B;  1O07 A;  4EW7 A;  4OPY A;  1H8Y A;  3RXX A;  3QP5 A;  3UB6 A;  5CHU A;  2C6W B;  3SS5 A;  1T1A A;  3VE4 A;  3UMD A;  3QP8 A;  5CEB A;  2VJW A;  1LI9 A;  2RL3 A;  5LBR A;  5MC7 A;  4PM7 A;  4GHI A;  3NEC A;  2QYB A;  3BRM A;  2RCX A;  5FQJ A;  4DN0 A;  4WMC D;  4JPM A;  4CQH A;  3UB5 P;  2JKF A;  4OON A;  1G28 A;  2EA9 A;  1PFL A;  1I2S A;  3MZE A;  3VOY A;  5TBM A;  4LV2 A;  4Y15 A;  4HP9 A;  2OWH A;  2ZOH A;  4O0P A;  2XDM A;  3CIT A;  3IHA A;  3BM6 A;  2PR6 A;  2YKF A;  2L0W A;  4LRY C;  4OLD A;  2JC7 A;  2XRN A;  3IX3 A;  2UV0 E;  1H0M A;  1KDS A;  2A24 B;  2QWS A;  2EXA A;  2X01 A;  4KQR A;  2Y2N A;  3B33 A;  2JBF A;  1D06 A;  3T12 B;  4DJ2 A;  4E3O A;  1F9I A;  1K54 A;  1S4S A;  3UE6 A;  1E25 A;  2W3E A;  3CPT A;  3HJI A;  4DJ3 A;  1NLY A;  1NZO A;  2EFX A;  2L4R A;  3DTK A;  1TS8 A;  1RGZ A;  2PR5 A;  4IBR A;  2PYR A;  3F1N A;  4U3T A;  2NUT C;  3R7W A;  4GS9 B;  2M1C A;  3VP0 A;  4EXO A;  2JKT I;  2EX8 A;  4UA9 A;  4JF4 A;  4K0X A;  4GZB A;  4BBT A;  2B02 A;  2M7U A;  4X6T A;  3IQA A;  4B88 A;  4GCZ A;  5I5L A;  3M2K A;  3KSG A;  5CEC A;  4UQI M;  4CLC A;  1FR6 A;  3MFD A;  4KZ9 A;  4XUZ A;  3A0V A;  3G6O A;  4X69 A;  3OCL A;  2ZQ9 A;  3HRE A;  3HLW A;  3E2L A;  3LR0 A;  3EGX C;  1ERM A;  3VFH A;  1YSQ A;  2HDQ A;  3H7W A;  4HHD A;  3ZG9 B;  3LY4 A;  3W4P A;  1L0E A;  3RH8 B;  1XA7 A;  3KSI A;  1EWZ A;  5HAP A;  2PAV P;  1TF1 A;  4UAA A;  2A49 A;  3UO9 A;  1KE3 A;  1K0K A;  1OTB A;  4HI4 A;  5EVI C;  4D60 A;  4FTX A;  2XA7 S;  5L09 A;  2I72 A;  4S2J A;  4GDB A;  4R3J A;  2XD1 A;  3VOZ A;  1ZC2 A;  3HLB A;  4PM5 A;  1KDW A;  5HWV A;  2PHY A;  3MKF A;  4ETZ A;  2JKR I;  1N9O A;  2V0W A;  3A3F A;  3A3E A;  3WS5 A;  4HH2 A;  5GLC A;  1HTZ A;  3M6B A;  3ZQ5 A;  3QP6 A;  3AGE A;  3VP1 A;  4LFU A;  4GNU A;  4MEZ A;  3VOL A;  5L10 A;  1IOU A;  5IT5 A;  3ZDJ A;  1GHP A;  2XA7 M;  3IH9 A;  3ZCZ A;  4BLM A;  2WK0 A;  2Z6C A;  3N7W A;  3MQO A;  3IX4 A;  5CTM A;  2VZW A;  4R6L A;  3TE8 A;  5E2G A;  3NOU C;  3T4S A;  5KSC A;  4MDZ A;  2Y2P A;  4OP8 A;  2ZC3 B;  3U4L P;  1CEG A;  1IYP A;  3UE3 A;  4ZTK A;  3ZHH A;  2W1T A;  4WYY A;  4S2N C;  3QNB A;  4I39 A;  2OOL A;  1YLJ A;  3W8K A;  1L0F A;  2ZMF A;  2V8F A;  4KZ3 A;  5D3O A;  5TJJ A;  3MMH A;  5HFO A;  3CWF A;  3G2Z A;  3SS3 A;  4HJ6 A;  3T4T A;  2HJE A;  2OAQ 1;  5HZH A;  3UB7 A;  1BSG A;  5TBM B;  1S6R A;  4PAU A;  2EX6 A;  2DCF A;  3UDI A;  1K55 C;  1FIK A;  4XT2 B;  4MN6 A;  5HSQ A;  4YWZ A;  3IWO A;  3ZG7 B;  4Y2F A;  4B4Z A;  1ZKJ A;  2ZOI A;  3FPV A;  1GHI A;  3IXD A;  3JYI A;  1W63 Q;  3M2J A;  5L8M A;  2K2N A;  1KGF A; 
#chains in the Genus database with same CATH homology
 3F1O B;  3BW6 A;  2V0U A;  3PBR A;  3LIA A;  2A24 A;  3IS2 A;  2HGV A;  3C38 A;  3B47 A;  4OOM A;  4BBU A;  3TRC A;  2G7U A;  1ZHH B;  4I5S A;  4NKP A;  1S66 L;  5G4Z A;  4L0L A;  3OCN A;  3KSF A;  2PYP A;  2K7S A;  5EFW A;  3F1O A;  2O99 A;  1XJ6 A;  4EER A;  2NUP C;  2D01 A;  2W3F A;  4HP4 A;  3P01 A;  4JGO A;  4XT2 A;  4NXE A;  2VGL S;  4JGQ A;  1DRM A;  4NXG A;  5DFY A;  2HF6 A;  1GSV A;  5DJT A;  3W2Z A;  2P04 A;  2VV8 A;  2V9A A;  5HPI A;  2W3D A;  4GW9 A;  5HDC A;  1OJG A;  1UWP X;  4WF0 A;  3RTY A;  2WKP A;  5C5K A;  3LYX A;  4GJ4 A;  4HOI A;  1Y28 A;  4JGR A;  3T4L A;  5F69 A;  4IHQ A;  3OLO A;  2GZA A;  2QJ5 A;  3EQV A;  4Y5F A;  4NXF A;  1WA9 A;  2W27 A;  3LIC A;  1LT0 A;  4OOL A;  4BMW A;  3R4K A;  3FC7 A;  3LID A;  1KOU A;  2PT7 A;  4QPR A;  1H8M A;  4UEY A;  4UQI S;  4ARZ A;  4EES A;  1MKM A;  1XJ3 A;  2GJ3 A;  3H9W A;  4B93 A;  3ZYT A;  2D02 A;  3B42 A;  1OT6 A;  3PXP A;  2W3G A;  2J3W A;  4MN7 A;  4PKY A;  2O9A A;  5HL6 A;  1OJ5 A;  3EEH A;  2VV6 A;  4R3A A;  1V9Z A;  1OTE A;  1S67 L;  1TS6 A;  3OOV A;  2Y8H A;  1UGU A;  1YSP A;  4ZRR A;  3JVV A;  1OTI A;  3T4O A;  1T1B A;  3EGD C;  1S4R A;  3K3D A;  4NXB A;  5DF9 A;  4O8G A;  4CLC B;  3LI9 A;  4MN5 A;  4EW7 A;  4LLO B;  3KO6 A;  4CLC E;  3UB6 A;  3S7Q A;  3LIE A;  4KQO A;  3D72 A;  3A0S A;  2BAS A;  3EEA A;  3IBR A;  1T1A A;  1NLZ A;  1VB6 A;  5DFX A;  2MJ6 A;  3VE4 A;  4NEE D;  2FZ0 A;  3UMD A;  4KQD A;  1LL8 A;  3MR0 A;  5HD5 A;  4BJP A;  3NHQ A;  2VJW A;  4GLQ A;  4BBV A;  3VE3 A;  5LBR A;  3MF0 A;  1N9N A;  2ZMV A;  3PHY A;  3O5Y A;  4EEP A;  5MC7 A;  3T4J A;  1D7E A;  4Q0J A;  4GHI A;  3KSH A;  3R7W B;  2Y79 A;  2PD7 A;  4L9F A;  2QYB A;  3BQ8 A;  3CLO A;  2OWJ A;  4G3W A;  1S1Y A;  2WKQ A;  2GNX A;  4WUJ A;  2JHE A;  3E98 A;  5F5Y A;  4DN0 A;  3LR5 A;  4CQH A;  4CLC C;  4H6J B;  1ZTU A;  4EUV A;  1G28 A;  3LI8 A;  2EA9 A;  3OC2 A;  2EWW A;  3TW8 A;  5TBM A;  3OBF A;  3BWL A;  3LUQ A;  3K2N A;  4HP9 A;  2OWH A;  2ZOH A;  3CI6 A;  4G3V A;  4O0P A;  3CIT A;  3GEC A;  2R78 A;  1P0Z A;  5AVE A;  2PR6 A;  2YKF A;  4R70 A;  2L0W A;  4LRY C;  3VV4 A;  4WEK A;  1LSV A;  2LB9 A;  2XRN A;  3EOI A;  3E4P A;  5J4E A;  1EW0 A;  4KUK A;  4YOF A;  3T4Q A;  1TS7 A;  4I3J A;  4Q0I A;  2A24 B;  2QWS A;  4WN5 A;  3MFX A;  3E0Y A;  3LFV A;  1YAX A;  3NJA A;  3B33 A;  5J7E A;  4EQ1 A;  4LPZ A;  5DJU A;  1D06 A;  2KX6 A;  3DBA A;  4DJ2 A;  1BYW A;  1F9I A;  4H6J A;  4WEJ A;  4LRX C;  1S4S A;  3IS2 B;  3LIF A;  3UE6 A;  3FPW A;  2W1R A;  3HJI A;  1MZU A;  1UWN X;  1T18 A;  2W3E A;  2VEA A;  4DJ3 A;  1NLY A;  3LR4 A;  4MCW A;  2L4R A;  1TS8 A;  1LSW A;  2HJ9 C;  3C30 A;  1XJ4 A;  2Z6D A;  2PR5 A;  4HNB A;  1XFN A;  2W0N A;  3P7N A;  2PYR A;  3LR3 A;  3F1N A;  2OAP 1;  2NUT C;  5CX7 A;  3R7W A;  4FOF A;  3F1P A;  2GX5 A;  2VA0 A;  4GS9 B;  4PKY G;  1GSX A;  2M1C A;  2O9B A;  3RFB A;  1F98 A;  2KDK A;  4EXO A;  1DP6 A;  4DMZ A;  2JKT I;  5HDD A;  3PR6 A;  4BBT A;  1DP8 A;  3D3O A;  1ODV A;  4IJG A;  2B02 A;  2M7U A;  3PYP A;  2XSS A;  4M4X A;  4GCZ A;  3EWK A;  3NOP C;  5I5L A;  3FG8 A;  3KSG A;  3ICY A;  3HJK A;  5A8B A;  2VGL M;  5DKK A;  4G3K A;  4UQI M;  4CLC A;  4AFI A;  5F6A A;  4RQ9 A;  3H7W B;  5AVF A;  1STZ A;  3A0V A;  3G6O A;  1X0O A;  3CUE A;  3OCL A;  4CLC D;  3BY8 A;  2H28 A;  5KIZ A;  3KYQ A;  3E4O A;  3C8C A;  3BY9 A;  2V1B A;  2P08 A;  2L1M A;  2QKP A;  3LR0 A;  3S7N A;  1P9W A;  1JNU A;  3EGX C;  4EET B;  3MXQ A;  3MJQ A;  5DKL A;  2FH5 A;  1YSQ A;  4JGP A;  3H7W A;  2VX8 A;  4HHD A;  4HQA A;  4Q0H A;  4F3L B;  1P97 A;  2J3T D;  4I3I A;  3RH8 B;  3KSI A;  2KOI A;  3EQU A;  4E04 A;  1TF1 A;  3PBN A;  2CMN A;  1OTB A;  4BWI A;  4HI4 A;  4EEU A;  5HD3 A;  4B9O A;  4HJ3 A;  3MQQ A;  3HCY A;  3H82 A;  4FSF A;  2XA7 S;  1P9R A;  3ULF A;  4F3L A;  3BQA A;  3A0R A;  3E4Q A;  4P6Z S;  1W63 M;  4YNR A;  5HWT A;  1VHM A;  4K08 A;  4P6Z M;  2PDR A;  3S7P A;  3F1P B;  5HWV A;  2PHY A;  4Z1W A;  1TS0 A;  4WLA A;  4ETZ A;  2JKR I;  1N9O A;  2V0W A;  4O01 A;  2EWV A;  4HH2 A;  1OTA A;  2XRO A;  2V1A A;  5IS1 A;  4HH3 A;  3ZQ5 A;  4ARZ B;  1GSW A;  2W1T B;  1XJ2 A;  2J3T C;  1S1Z A;  3VOL A;  5FL3 A;  2M7V A;  1IOU A;  5IT5 A;  3PBO A;  2P7J A;  2XA7 M;  3LIB A;  4HIA A;  5HPF A;  1H3Q A;  2J80 A;  2Z6C A;  4IUK A;  3BJN A;  2JN7 A;  2W3H A;  5K5B A;  4GHI B;  2QJ7 A;  3MQO A;  3UB9 A;  4WL9 A;  1T1C A;  2VLG A;  2K31 A;  4KUO A;  2KLI A;  3NOT C;  1NWZ A;  2VZW A;  4Y3I A;  4R6L A;  4LRZ E;  3TE8 A;  1T19 A;  4L9E A;  5AJG A;  3U2A A;  1IFQ A;  4HJ4 A;  3MQ0 A;  3NOU C;  2DMW A;  3T4S A;  2PD8 A;  3CUE C;  4MDZ A;  3SW1 A;  2A2L A;  4I3A A;  3T50 A;  2WKR A;  1G6O A;  5HDS A;  4WEL A;  3IBJ A;  3UE3 A;  1YKD A;  2IA2 A;  4L9G A;  3TJZ C;  3JVU A;  3T4K A;  1NRJ A;  2W1T A;  4MMN A;  2HV1 A;  4I39 A;  2OOL A;  3H82 B;  2ZMF A;  3KYZ A;  4II7 A;  1TD5 A;  2ZBB A;  3C2W A;  3V67 A;  5TJJ A;  3MMH A;  4IUH A;  5IU1 A;  2VV7 A;  2I9V A;  4I38 A;  5J3W A;  3PBQ A;  2O0Y A;  2JKT M;  3CWF A;  3K3C A;  3PBS A;  4HJ6 A;  3T4T A;  3S7O A;  2HJE A;  2OAQ 1;  5HZH A;  3GDI A;  4HY8 A;  4R38 A;  3UB7 A;  5TBM B;  4GS9 A;  3PBT A;  4PAU A;  1N9L A;  3KX0 X;  1XFQ A;  3F1N B;  5KSH A;  1LSX A;  3UME A;  2INW A;  1MC0 A;  5F68 A;  5G4Y A;  2LB5 A;  4ETX A;  1V9Y A;  2JKR M;  3UB8 A;  4XT2 B;  4MN6 A;  2B18 A;  5HSQ A;  2YKH A;  3CAX A;  4YWZ A;  4Y2F A;  5HWW A;  2O9C A;  2ZOI A;  3FPV A;  2VKS A;  2QHK A;  4PHT A;  1OPX A;  4ME4 A;  1W63 Q;  1OTD A;  1DP9 A;  1F5M A;  1OT9 A;  5L8M A;  2K2N A;  4EU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...