3EH5B

Structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Combined microspectrophotometric and crystallographic examination of chemically reduced and X-ray radiation-reduced forms of cytochrome ba3 oxidase from Thermus thermophilus: structure of the reduced form of the enzyme.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3eh5B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3eh5B02
4QIDA 4QLWA 4X1HA 4JKNA 2EILB 5KKHA 4ENZA 2X72A 2X87A 2IH9A 7PAZA 1ZIAA 3KJ6A 1PZCA 3OM3B 1E0PA 4QI1A 5AZDA 1E30A 3KW8A 3PLYA 1AQ8A 1IW9A 1NIEA 1C8SA 1A3ZA 1OE1A 4GPOA 1QM8A 3HAQA 4N4YB 3QJUB 2ZIYA 4FPDA 2EINB 2DYSB 1GYCA 3PXLA 3ZEVA 1AS8A 1HAUA 1NPNA 3UABA 4A2EA 1L9HA 1AZUA 4KO7A 1OE3A 5AX1A 2HZHA 1OCRB 4KNUA 2Y03A 3FU7A 3UAEA 3QAPA 1AG0A 2GC4C 2JXMA 5ITCA 2PPEA 1SFHA 3V2YA 2WSDA 2BWDA 5I6KA 2OCCB 4JKVA 3TBCA 1NPJA 3UG9A 3X2QB 2J57A 2Q5BA 3NSYA 3PPSA 4EA3A 2GBAA 1AAJA 4P5SA 2XYBA 4K9JA 5TK2A 3WKQA 3T6XA 5B7FA 3IEAA 1KG8A 4PXKA 3OE6A 1X0K1 1RKRA 2FQEA 3VVKA 2HX8A 2IWFA 7PCYA 2BW5A 4F2EA 1QKOA 3HARA 5H2MA 2Y00A 5H2HA 3UTVA 2OJ1A 2AZAA 4YSEA 1RZPA 1JXFA 4BDVA 2F95A 2OV0A 3OMIB 3KW7A 4AMIA 2YDVA 4HCIA 2HXAA 3X1NA 2TSAA 1CURA 4FAAB 1GS6X 3JT2A 4UANA 2I85A 2FT8A 4HHWA 3AY2A 4YSOA 1ZDQA 2IDFA 3QQXA 6PCYA 1S53A 3FS9A 1PXSA 1P8UA 4E9VA 5F8UA 1X0I1 1PLAA 5C1MA 1JZEA 5AHYA 4KOCA 3NJLA 3OQRA 1IBZA 1FBKA 2WO2B 1AT9A 1Q5IA 1JZGA 1J9RA 2QDVA 1I53A 1SF3A 2FTAA 3VI0A 1ET8A 1S52A 1GW0A 4XT3A 3OMAB 5FC9A 5I28A 5H2JA 3AYMA 3FSWA 2CBPA 1KMEA 2KS9A 3ZBMA 1TEFA 5E9NA 1OF0A 3N2JA 3AW5A 5DYSA 1PNDA 1HAWA 4L0PB 1NIDA 1WA2X 4W1TA 2ZONA 1ID2A 1P8IA 1NZRA 1SDDA 1PZAA 4YVUA 1CUOA 1TU2A 2BP8B 5BR2A 1VLXA 2HX7A 5TGZA 1AANA 1M9WA 2IAAC 3EHBB 1W6LA 1A4BA 2I21A 4DAJA 4DJHA 3ABKB 2FT6A 2JKWA 3BQVA 2AVFA 5I6PA 1XIOA 3HAOA 3QDCA 3QAKA 3GDCA 3T6VA 2QPEB 2BP0A 2LNLA 1BM1A 1AP9A 2MRYA 5B1AB 1RCYA 3NJIA 3ZDWA 4N8UA 2IDUA 4NAJA 3FSVA 1URIA 3HANA 3IBOA 3QJVB 1S8LA 1ZIBA 3ERXA 1BRRA 3NJMA 1S54A 1NTDA 2AANA 2YXWA 1HZXA 1NICA 1OV8A 4DP6X 3OAXA 3QBGA 5B7MA 4AI7A 5IY5B 3OD3A 2W88A 4FA7B 1A4AA 4X4KA 2XX1A 4LDLA 2B3IA 1PLBA 1V10A 5DHGA 1F50A 4X32A 1KDIA 1ZDSA 5ITEA 4G7SB 4EF3A 1EHKB 2J56A 5AFAA 1ASOA 4HCGA 1E5YA 5PAZA 2BZ7A 4YVNA 1PAZA 1TN0A 4XTNA 3H56A 1L0MA 4A2FA 3T9WA 3FU9A 1KV7A 1SHXA 4DPBX 2I20A 1W6WA 4E9XA 2XV2A 3SBQA 5D4HA 3PAVA 2EI4A 3AG2B 1BQ5A 1M0KA 3AM6A 4W9ZA 2FWLB 1IBYA 1CWQA 5H2LA 5H2KA 1VGOA 1XB6A 2UXTA 2I7OA 3RZEA 3U25A 2YCXA 5AHZA 4L35A 2YAOA 2QDWA 1GZMA 5H2IA 2I35A 4A4MA 4QRYA 2IDTA 2WO3B 2NTUA 3OE9A 5G2CA 2XV3A 4A67A 3GXUB 3UZCA 2ZFEA 1J5DA 2RACA 2VN3A 6PAZA 1BQKA 2R7EA 1V55B 4BUOA 4L6RA 1CYXA 4KO9A 1M0MA 5ANHA 3UTWA 2YAHA 1GU8A 4NC3A 3V9CA 3QJQB 3BVDB 1BRXA 2H3XC 1DZEA 3FPYA 4GP5B 1F56A 4GY4A 4HAKA 4UAHA 3UADA 2FJSA 4GP4B 1DYZA 3MBWB 1ET7A 3QPKA 2PPFA 3NYKA 5F7BA 1L9OA 3PAZA 3SN6R 3V2WA 3REYA 2EIMB 4JQ6A 4DP8X 1UATA 3D12B 2J4YA 1OCCB 5I6OA 1OE2A 5I26A 1SFDA 4G72B 2L6XA 4J4QA 1A4CA 2PP7A 2UXGA 3NJFA 1J9SA 1T5KA 5I6LA 2FNWA 2I1XA 1E67A 4LDOA 2YXVA 5ETZA 2ZZLA 4GRVA 3FSAA 5B6VA 1M56B 3NS0A 3WG7B 2HPYA 4NB7A 2P80A 1N70A 1OOWA 4GP8B 1KGBA 1UAZA 2PPAA 2XXGA 2GI0A 1R84A 3CAPA 1BXVA 4BK5C 5G2AA 4M4RB 1S51A 3VG9A 3SBPA 1EZLA 3FU7B 1XB8A 4G71B 4GYBA 3NSFA 3C9LA 3CODA 3QBLA 3UGEA 1GUEA 3ASNB 1NIAA 2EIKB 5B1BB 2B08A 1NWPA 1TN5A 1PNCA 4MD2A 1OCZB 5B6XA 2KSBA 4KLYA 4KNTA 2M3GA 3OE0A 1WA1X 3WKPA 4DPCX 1GSKA 1JXGA 3HEIB 1KDJA 1MZYA 3SQRA 1GS7A 1ASPA 1JZIA 4A2HA 4FBZA 3PWHA 4BDVB 5D4JA 4DP2X 4EIYA 1PF3A 2BRDA 2YQBA 4BWTA 3AG1B 4HALA 3ZIYA 3WNJA 1E5ZA 2UXVA 2YCZA 2H47C 1F4ZA 5B0WA 1AR1B 2IDQA 3MBVA 4LDEA 4N4WA 1W8EA 2I7SA 3PQRA 1GY2A 2XX0A 3D4SA 2HX9A 2Y69B 4BWUA 1FFTB 4KO5A 3QBKA 2BO0A 4KOBA 3X1EA 1BRDA 4AKQA 2HLEB 5TK4A 4PAZA 4YSAA 1ASQA 3TBBA 5B34A 3HASA 4HYJA 1PY6A 1C3WA 1DZ0A 2YAFA 4A2DA 1XMEB 3S3BB 5AX0A 2DV6A 4WKXA 4YSRA 3T6ZA 1IC0A 4XT1A 4GYCA 3WI9A 4AKPA 1JXDA 1YLBB 2E86A 1IKOP 4JHUA 3WIAA 3AG3B 1IUZA 3JTBA 2GHZA 4F2FA 2PLTA 1NINA 1SF5A 2HRGA 3NT0A 3PAUA 3CDZA 5B6ZA 1AOZA 3NJNA 3CVBA 4XTLA 2N0MA 2JAGA 1NDTA 1X9UA 1X9RA 1XB3A 2H5UA 2VW7A 3FQ1A 4YSUA 2A3TA 2BZCA 1PCSA 1WS8A 2KSAA 1VJMA 3QJRB 1SDDB 3DDLA 5A7EA 2Y04A 5FJGA 3AZUA 3T6WA 3T45A 3FYIB 3N55A 2JAFA 4HWLA 5G54A 1ILSA 4WW3A 2DWSA 2VM3A 2YAQA 4TXVB 1AS7A 2CUAA 3EH3B 3NY9A 3DKHA 5AZUA 3RYMA 3CVCA 2YDOA 3UTXA 1FWXA 2BP0B 3NP4A 4KNFA 4YSSA 3UTYA 1A8ZA 2R4SA 2VSKB 4BVNA 3EF4A 2PPCA 4P5RA 1L9PA 2KSYA 4DP5X 1JZFA 4Q8BA 1M0LA 5LDUA 2XWZA 5AWZA 5I6NA 3NJGA 2CCWA 4CSZA 1B3IA 4YSDA 4XTOA 2QPDB 5JJEA 1HFUA 2PP8A 2F93A 1QKPA 4AX3A 4BEYA 2AT9A 1KBVA 2PCFA 4DPAX 5I5IA 5I5JA 4X31A 1A65A 5DHHA 3UACA 1JOIA 1L9RA 4IARA 3CZUB 1L9SA 2FQFA 3FQYA 3MX0B 4BXVA 3AG4B 4DP9X 2YCWA 3EMLA 3PBLA 5I6MA 1N68A 1JVLA 1M57B 2WJKA 1JV6A 1JV7A 5JJJA 1H68A 4YL4A 1UCQA 3WQJA 4YSTA 3NJKA 4M3HA 4EJ4A 4AZUA 1J9TA 5B2NA 3G5WA 3L45A 3C75A 3PCYA 4YSQA 1WA0X 3NSBA 1L9TA 2BWIA 1E12A 3EH4B 1PZBA 5B6WA 1X0SA 2R4RA 3HAPA 1BAWA 1SJMA 3ZPRA 2EIJB 4GXFA 4UG2A 3DTUB 3PXOA 3X3BA 5B3SB 3CG8A 1V54B 3ZX1A 4KNSA 2PPDA 3UONA 2CALA 2YARA 3TASA 4IB4A 3FPXA 3X1FA 4RH4A 1MGYA 4HZ1A 2VW4A 4E9SA 3QBIA 5G28A 4BV0A 1ILUA 2JFCA 2Q9OA 1GR7A 1GS8A 2Z55A 4AKOA 1KCBA 2RH1A 3ABWA 1ZPUA 1S8JA 2FT7A 2TSBA 4MQTA 1TKWA 2R7EB 2QT6A 1H2SA 1JZHA 2GIMA 3UAAA 4KO6A 4DP1X 2J55A 5A45A 4XXJA 1BYOA 1SNRA 5H2NA 4YSPA 4ZK8A 2PEDA 2IH8A 4PXFA 3FQ2A 2ZOOA 3DQBA 3UZAA 5J7AA 1NIFA 2FQGA 3EH5B 4GBRA 3OMNB 1CYWA 3QJSB 3NYAA 3X3CA 4MBSA 4DP7X 4A2GA 1JFPA 1O0AA 4BWWA 2CAKA 5LWEA 3NY8A 1PY0A 1XJIA 9PCYA 1TEGA 4IAQA 1KYAA 2DY2A 2AFNA 2VMJA 3NSDA 3SBRA 2G87A 1MZZA 3TA4D 2GC7C 1ADWA 4HYXA 2NTWA 3GYRA 3ODUA 1AIZA 3ASOB 2CJ3A 3NSCA 4CSPA 1L9QA 3COCA 4UHRA 5A44A 4DP0X 2IWEA 4YSCA 8PAZA 1AZNA 3NJHA 3S3CB 5B7EA 3P0GA 2IDSA 5EN0A 3NP3A 4HHGA 5B1JA 2X88A 1BXUA 1BYPA 1JGJA 3ABMB 5B1KA 2MTAA 2HRHA 2WJLA 3FT0A 3FYEB 1MDAA 2ZWNA 1FBBA 1PMYA 2IWKA 2W8CA 3IN2A 4OV0A 1OCOB 1NIBA 2BP8A 1FA4A 2VW6A 1P8HA 2AZUA 2Z73A 4PCYA 1PXRA 5B1JC 5PCYA 4E9RA 1R1CA 3HB3B 3V9EA 1AZBA 2XU9A 3IN0A 2YAEA 2GB2A 1R2NA 2GSMB 2YCYA 4MQSA 4WTQA 5D4IA 5BR5A 3X1BA 3H4HA 3H4FA 1WAEA 2FQDA 2Y02A 3ABLB 3WNIA 5A8EA 1KGYE 4E9TA 1MG2C 3OE8A 1CC3A 2XUWA 2NRDA 1Q5JA 1QNIA 3TU6A 3VHZA 1AACA 5JJNA 5B6YA 5I5MA 4AMJA 3CVDA 2PP9A 4TL3A 2PCYA 3VGAA 1J5CA 4A66A 4WAVA 1WS7A 3NJJA 1IW6A 3FU8A 2BW4A 1BEXA 1QLEB 2P80D 4QKTA 3ZPQA 2DYRB 4G7RB 3FSZA 2LLNA 3T71A 1IXFA 3C9MA 5G53A 1BQRA 1JZJA 3DIVA 2J5WA 4HIPA 2DWTA 4JR8A 4E9WA 4NERA 4BXSV 2VSMB 1J9QA 1E65A 1SHWA 1JERA 1JVOA 4HCFA 2UXFA 2UX7A 4Q89A 1ET5A 1PLCA 3QJTB 2XXFA 1F88A 2BHFA 3VW7A 4DKLA 3AYNA 4N6HA 1NWOA 2ZXWB 3CDZB 1AZRA 2VT4A 1ETJA 5H2OA 2YAPA 1LN6A 5G2DA 4BWBA 5H2PA 1QHJA 3PDSA 1AG6A 5F7AA 3S8GB 4DP4X 2XV0A 2XLLA 3S3DB 1MG3C 2VM4A 4JHVA 5EHFA 4F7KA 1ZV2A 4MFHA 5AKRA 1U19A 4Y9HA 4G70B 3RFMA 1AZCA 2YAMA 2Y1AA 3ABGA 1QHQA 4G7QB 3S8FB 5G36A 4K5YA 1GY1A 3A7KA 5B35A 2Y01A 1C8RA 3IE9A 2XVBA 3X1GA 4UF7C 1KBWA 2UX6A 4MD1A 1BXAA 4E9YA 4A68A 1KCWA 1KG9A 1RZQA 4BEZA 1AS6A 4E9QA
chains in the Genus database with same CATH superfamily
4V1DE 4YPGA 3ROOA 4L5FE 5I8CB 4TQEH 4HSCX 3DV4B 3BP7A 5I1CH 2ZG3A 2J8UE 2BNUB 4L1BA 3QEGL 3QPQC 4ZS6C 3VTAA 1E30A 1GZHA 1FCGA 3L3HB 4AJWA 1GGUA 3FO9B 4FFVD 1T21B 4GOSA 1J18A 2EZ0C 4YLCA 3IPFA 2W91A 1BA9A 2WCSA 1DHKA 1HC1A 4ORGA 5DGRA 5IWLA 2EINB 2W0FB 3D69B 9CGTA 5DJ2B 4LSQL 2D31B 1I8MA 3LHPH 2VDRB 1MI5E 2EIZB 2A6IB 4QT5A 2ZZUT 3Q5OA 5ITCA 3AY4C 3SPGA 4YLQT 3GMQA 4EPSA 3ZDYE 4KH9A 1I8LA 4LHUB 4RIRB 3MA9L 3NSYA 1SDAB 2H6UA 2X4TA 3L1FA 4L29A 5GS2D 1D9KC 3DRQA 3BISA 3ISWA 1RJLA 4PJXA 4AY0A 4LDCA 4N3UA 3RIFK 5TE7H 1BQLL 2BW5A 4ADGA 4D0DA 4Z78A 3US0A 1QKOA 4G8FB 3NIDB 3O41B 5I9QB 4DNLA 3MBXL 4YSEA 3N85H 2F15A 1AKJA 4PVBA 3NQKA 3HUJF 4QRSA 4QWWC 2OV0A 3HOGA 3OMIB 1Z9LA 4AMIA 3RQ3A 4EUPB 5D7KE 1A4JA 4PV1C 2TSAA 4GEIA 3HI5L 3IWUA 3QJOA 4DN4H 1AD9A 4N2HA 3HS0A 4EI5B 4LBEA 4GG8A 4WGKA 3KL3A 2IDFA 1NM4A 2AERT 2IANA 4R3SA 2DF3A 4JM2C 3STLA 3T5WA 1TUPA 1MIEH 2B2XL 3JV6A 1R4XA 3DURA 5F1NA 3T09A 1S9WA 4AQOA 4HKJB 4XP4H 1S52A 1JGVL 3BHBA 3KGTA 2DLGA 4YHOH 4XT3A 5F9OL 5B39B 2AJVL 4HPYH 5IB4A 5IOPB 2JELH 5MI0C 1TNNA 5C08E 3U4BL 1UC6A 2VDQL 4BZ1H 4D0CA 3DI2B 3M07A 5DYSA 4ZTOH 1A1NA 1UADC 5KSBE 1F90L 4KFMA 2KMWA 4FCAA 4S11A 3SE3C 3U2IA 4FG6C 2XWBA 1G7PB 1U95B 1XCQA 4DO5A 5AVVB 3S3PA 4XAWL 3FFOA 5A2JH 5I5RA 2ZYIA 2NYYD 3GI8H 4N2FA 4LAQH 2WMPB 4XN8A 1HZKA 4MMZB 4ZAKA 1CD8A 3VXNB 1WT5C 1JI2A 1KJ2H 4EZJA 2LQRA 5HGHB 3F7YA 4PRPD 3HANA 3BDBA 5I82A 1IAKB 1F4YH 2EEFA 3U1PA 3OAYH 1DZBA 2N0KA 5IY5B 3JBG7 2X1XR 4PJEA 4YO0B 4YXLL 2WLLA 1GC1H 2W88A 3BAIA 5D7SH 3NIFE 1V10A 2JI1A 4LMQI 1EHKB 2XI9A 2WBJC 3AMKA 3WJMA 2XG4B 1WVZA 3FW6A 3MFGB 1UUSA 3BAEH 3IXAA 2VDQH 4E0RB 2Y4SA 3ESUF 3TIDA 3CZNA 1E6JL 5JW3L 1ORSA 3VRLE 5KAQG 2DDQL 2P8MA 3GMLA 2F53D 1AYOA 4UQ2B 3ARBA 3UDWC 5C6TL 1F90H 3FFCB 4LRNH 4KQ0A 5E94B 3LNEA 5LAXA 4QRPD 3WY4A 2A77L 3QUXD 4CADA 3QUGA 2I35A 2CO7A 3R19A 1UUNA 3GXUB 2X6MA 6PAZA 4FNSA 4L37B 2EDMA 3OKOB 2FEEL 5BVPL 5CINL 2HPTA 3KLLA 2CK0L 3SDCD 1UJ3A 1P1ZB 5TF0A 4Y19A 4W9CC 4HLZH 1QQDA 4MJHA 3E9TA 4GY4A 3WFCH 4YDIL 3NSJA 4Y0GA 3IKCB 1RPUA 3O45B 2PPFA 4X6DA 3IU4L 1R5IA 2F19L 3MRIA 3OKLA 1KYFA 2VO5A 1TIUA 2EIMB 3HPLA 2FX8L 3VB9A 2J4YA 4B3VA 4WAFA 4L4TD 1SFDA 2Q3XA 3B9KC 1NOAA 1H3GA 4J3OF 4NAQA 4EO5A 4L8DA 4DKTA 3HC4L 1EH9A 3P4OA 2EUZA 4HJ0D 1G0DA 1VEPA 2LLLA 2D7MA 3B3IA 1M56B 3NCJH 4I77L 1ZGLB 1JL8A 3LKPA 3CFCH 4JRXD 4KMQA 1JZ3A 2RJMA 4HBCH 5L2KD 2QADB 2WTRA 4X6FA 4GIOA 3EJQA 4ZQKA 3HI1A 4ODSL 3K91A 3V5DB 2H26A 1Q1PA 4IIQB 1RUAL 1U8JB 3DGGB 4F15C 1FZMA 5E8DL 2CGZA 4PP2A 3WUWA 3ARFB 4PJ7B 1PDKB 3U30B 2BHZA 4HX1A 1FZOB 3BO8B 3KHOA 3QPQD 4ZS6D 4YDIH 3ZRFC 4KNTA 2OR8A 4PRDB 3WMQA 2EZ0D 2NY3C 1BIIB 4IM8A 1PFCA 1U8NB 1URZA 1LEIB 2KUTA 1H19A 4HJIA 2HG5B 2C4FU 1PF3A 5GISL 1KPUA 5C07D 1JZDC 3WEAA 3KZ8A 3M1BB 2ADGB 1CLOL 2UXVA 3GS7A 1QFPA 2YCZA 3MTRA 2VMCA 4OF7A 2R1WA 4QRTB 3PQYA 4JFTA 1N64H 2I7SA 2JKJA 3FQNB 1QA9A 2YSTA 4NQVB 4ATWA 1HHGB 5ESAA 4F7MA 4KO5A 1U91A 3FTWA 5AOZA 1D9KD 5D7JC 4NZUL 1ZXKA 5J8OA 2V37A 3GSWB 1SBSH 2BP5M 5HDBB 3QR0A 3EDDA 3CLFL 4LCWE 1D5XA 1PZ5A 5T1LD 3UYRH 2PLTA 1CS6A 3PAUA 1OPGH 4JKKA 4LE8A 5CBAA 4QWWD 3VXRB 2AQQA 5IJDC 1NFIA 3L3GA 2H5UA 4NPJA 3JUZA 2G30A 4WDIB 5F7DB 5CJXC 2R0WL 3NOIA 4YUEH 1LL1A 1RJYB 1OTTC 5FJGA 2VJ0A 3P02A 1WDAA 4A39A 1EA9C 2JB5H 3KPSD 2Y22A 4JM2D 2DMCA 4UT6H 2NYKA 3RYMA 4HFUH 4JY4B 2AK4B 1KPVB 2BP0B 3FUIA 4ZDHA 4PS4H 2WWKT 2J1WA 1AHWA 2VR9A 3VG0L 1ZT1B 3MPCA 4MDRA 2WWMC 5K1VA 4K3JL 5ELIA 1KTCA 2A9DA 2CK2A 4GSUA 4OLYH 4KTEL 1ORQA 2R56L 4NP4L 3RL2A 1NCJA 4QOKD 5D7KD 3NJGA 1M3IA 5KN5B 3WIIL 4B9GA 2AAAA 4JDZA 2CWRA 2ITEA 4AQ1C 3DROA 1AE6L 4H8WH 3K4DA 4IGBB 1EO7A 5IW6B 3QCUH 3H7BA 4FG6D 2WTPA 4W6WB 1I7RB 3N44B 4PY8I 1BREA 3MRNB 3WU1A 3O8XC 1X7QB 1SHMA 4Q0XL 1DLFL 4Y4HC 5DS8A 1UCQA 3U9UB 1A9BB 1J9TA 3MXWH 3PHQB 2YGOA 4MD5A 2FJGB 4X7EC 5CR8A 4YSQA 1UGNA 1F86A 5HBBA 4APQC 4KK8C 2MH4A 1FGNL 2QVTA 2R2BA 3K6DA 1MWOA 3HS8A 1V54B 3GT6A 2CR6A 1F00I 2EEAA 3FPXA 4LSVL 3X1FA 2H1PH 3DWTA 3P54A 2EC9U 2JFCA 1GYUA 3K5SA 4ZJ9A 4DW2H 1I82A 2RH1A 1UT1A 4NHUB 3HG1B 4K3JH 1CGWA 1SOXA 2WBJD 2X12A 2D3NA 3OL2A 4PW4A 3VO0A 1NAMA 2Y7QA 4RWYL 1LO2H 2BIPA 4I2XB 4PXFA 3FQ2A 3GRGA 4QXTB 4ZUVA 2DLFH 2EKSB 4RISH 4G83A 5G5DA 4MBSA 2KLSA 4L8SC 3WMSA 1JFPA 4EQ3A 4UIKL 4YH6A 3NY8A 1B6UA 2J25A 4PRPA 2FHFA 4YJZL 3TWYA 3DPBB 1H3PL 1QSEE 1D5IH 2ID5A 1R6VA 5EPMB 5CBEA 5FKPA 4U1KA 3VUAA 1ADWA 3VE0B 1YNKH 2NTWA 2IFGA 2R2HB 4XVTL 2LOEA 3ODUA 1OAXL 5I74C 3K5RA 4DGUA 3D3VD 1UYWL 5I30H 1Q9WB 1KIQB 2IWEA 1YO4A 5LBSH 1QVOB 3RU8L 3FQWA 4PWHA 3HNTL 3FHQA 3LIZL 1MWAH 2YFOA 2D03H 5HI3C 4ZZKA 2F53A 2ZE0A 3W37A 2IH1A 4QRPA 4MXVE 3QUXA 4K94H 3B9KD 4LSSL 4HDIA 3RJOA 1VZIA 1YEKL 1K2DB 1PSKL 1PXRA 5G4NA 1X6NA 2GBVA 2FLBT 4YE4L 2C9RA 3SDAB 3FKUS 3NEOA 1QBML 3GZPA 4ATTA 2YCYA 2CJUL 1MFCH 2NX5B 3QQ3A 3EXLA 2JF1A 2COQA 2FSDA 1E9OA 3ZYZA 2Y02A 3LN4A 43CAB 3SDCA 4KH2A 3MJ7B 1YMHB 4LLAA 2NRDA 2EYRA 4X4YB 3RE0A 1YYCA 3N06B 2K3TA 4W9LC 3VWKC 4BA8A 2EEXA 2H2SC 3O6LH 1Y1UA 1QLEB 2A9AA 3W82A 3ES6B 5E2JA 3OB0H 1E8WA 1SLUA 2GFBB 3BWSA 2CA3A 4WV1A 3P4MA 4OCXH 1DQLH 3CH1B 3OWRA 2HJFA 1UWEL 1G7HB 2H8PA 2NY3D 2VERN 3NA4A 4FQXC 4ZUTB 3U46B 1I8IA 3OKMB 1N4XH 4NDMB 3C6EA 4QTFA 4DEPB 1I8KA 4BSVA 3EGDA 1F45A 3CDZB 4JDTL 1OSPH 4K9EC 4OLVH 2WLIA 3RUGE 4AYBA 4N0UA 5L2KA 5CSZA 1YECL 5KOVC 2AQ1A 2FRGP 3VFSB 2Y24A 2YEZA 1MG3C 4GW4A 4H8UA 1BQSA 7FABL 4E41D 2A9NH 2GJ6E 4N2GA 4NUGL 4PJ5B 2UYLB 3D34A 4BFGA 4DUXA 4H40A 4OCSH 1AZCA 4FC3E 1Y7VA 4JS7A 1QTYT 5D7JD 3LJ3A 3K81A 2GITB 2QTVA 1G7MB 2Y01A 3POCA 1E28B 4LLVB 4PSRA 4YGVB 3MJWA 4IKKA 2C34A 2F8IA 1CFNA 1KBWA 1Y0LA 4UF7C 3GSNH 4XPFH 1BQUA 1U8MA 1E4KC 5GS1C 3NH7L 5AW8B 2B3RA 3VXOB 4KTDL 3NCXA 3G6JF 2ZCZA 3H3KA 1JK8A 4TNFA 1X5MA 5DVKA 2DTSA 4NQEE 2UUDK 1OP3H 5D2LE 4MB1A 4Z77B 4YDKL 5DU7A 1IKFL 3TCXA 3BYYA 4UNTA 3EFOA 4YOKA 5IJKC 5IMKA 2V6HA 3AY4A 2FSEA 4WEUD 4JBSA 3HAEH 4AGPA 1ZJAA 4GAGH 1OTTD 1N10A 4GUPB 1FO0A 4MYWB 1UM6H 2G4GA 4OCWL 2J8UA 3ZEVA 1D9KA 1MNUL 3HUJB 4EQ2A 2K9FB 4CBPA 1AZUA 1PEZA 1CTNA 1JV2B 4L05A 1SN2A 1F3JB 2ROXA 5TPWH 1K4DA 2WWMD 3WS3A 1OZUA 1EMTL 2FWOB 3OKDB 2Q5BA 3TONA 4BRVA 5T1LA 1HEJC 4HUCA 1BFVL 1M7XA 4NZTH 4K9JA 4P5SA 1X9LA 5F2FA 1OAQL 2B14A 2OLDA 3DIFA 1I9JL 1AMXA 3NRQA 5FW7A 3ZHFA 3U7AA 1T0PB 1CE6B 5KYWB 4KZDH 4AL8L 4NKMA 3GF8A 3ILPB 5DZJA 3SDXA 2A4ZA 2CLVB 1AO7E 1OGSA 5CO1A 4AM0A 1BVKA 2XPZA 5TF1H 3KPSA 3O8XD 4JM2A 4BQ6A 4C58B 4Y4HD 3IDIB 2FL5A 4K23L 1A9EA 2A5UA 1F4WL 2DOCA 4FQIH 3N50A 3QI9C 3O11A 1KTJA 2YA1A 2FLRT 4APQD 2FT8A 4PN6A 4X6DF 4KK8D 4BZ2H 2CQVA 5BO1H 3D50A 4PYHA 2NQDA 3AWFA 4HV8A 4QOKA 1DSYA 2ATAA 3MNDA 1VF5C 3UBXB 3VFPB 1YPZE 5EZPA 2CIKB 3GLDA 4KRNA 3CFKB 4K5LA 1BFSA 5F44A 1CI5A 1JZGA 3ROLB 1IM9D 3SE3A 1KGXA 3PV6B 3FH7A 5CLWA 4O02A 4L9DA 3VFTB 1BG9A 2QQLH 2Q20A 4ZPTB 2KS9A 4HJTA 1TLKA 3HBQA 5AW7B 3WSQL 4ANXA 4L0PB 1WT5A 2LAAA 1E9QB 3W9EA 1ID2A 4PJIE 1HSBB 3IE4A 4NT6A 1KB9J 1Q9OA 3DVNB 3WAKA 1LEGA 3V7AG 2Y7MA 4TVPL 4DEWA 1RJZB 2E47A 4GKNA 4K23H 5ICUA 1SQMA 1HWWA 5G4OA 4UTBA 3QAKA 1FL6B 5GSRB 3TX4A 3I6GA 4FMFA 1KLGA 2C26A 3K1KC 2O6CA 4M1GL 4WHCA 5L88L 1JBJA 1D5MB 2WBJA 4PRNB 1IQDB 2ESVB 3IRZA 3GI9H 3GMRB 4LVNC 3SQBA 2ZWYA 1ZANH 2P44B 5HI3D 5KSAC 3MGTB 2QKIB 4PJ8C 4B41A 3UDWA 2V5TA 4LDLA 1PY9A 4U1SA 5DHGA 3ZSSA 2GK2A 4EF3A 1QSED 3FBKA 1Z9PA 4GJTB 4ZO8A 1DQIA 5JO5B 4XMZA 3WHXB 1CFVL 2WBWB 1PKOA 1IEBA 1WEJL 3GMPA 1LMKA 2BNQB 4IRJC 2F74B 3UTSD 3B6SA 3DI3B 4WI9A 3D18B 4X80H 4CW1A 2MCPL 3D3VA 1K4CB 1S7WB 3VMNA 4FA6A 5JMOC 1WD8A 3NFNA 4OJAA 2VIRB 4L35A 4IK6A 3VNYA 1QYGH 5TDPB 2BNRB 5FOJA 3FOMB 4GRWH 4RFOL 1LHZA 3VWKD 5F1OB 2ROYA 1MIMH 5KZCD 2H2SD 1EGJH 1E6OH 4ELMF 4X9BA 3L3JB 1NCCH 4JNXA 1CYXA 3B9KA 3IU3A 4GQQA 5AL8A 5K9JL 2WQUA 5AAPA 5KYYA 2VDNB 3BPOC 1DZEA 3JWNH 3F12B 4NKOB 4NHCH 3FU6A 4FQXD 4MCYA 1YJDC 4S1RL 4YHIA 1BX2B 2XZCH 2YD0A 5F70A 4Z0XA 1HI6A 1HL5A 3QZWA 4R83A 3PP4L 4YHPB 5I6OA 1KEMH 5I26A 3P2DA 1MCLA 2VCOA 4PJDE 4W6XB 1P4LA 1B0WA 5I6LA 3QA3B 2I1XA 1BZ7B 1COBA 1QO3B 4R7DA 4MDJA 3BAKA 4GRVA 5J13C 3CGTA 2NY7L 1BQHB 5LAPA 5D1ZI 2HPYA 2NZIA 4X6BA 5E5RB 5LXVA 4XC1L 3KPQB 2CGYA 4U1IA 5ICZA 1WHOA 3MLVL 2NLJB 4TVPE 1CDHA 5SWSD 3D4CA 1XTLA 1TYJA 4LLYB 1E4XL 3MRCA 1ZLEA 4XC3H 4CMHC 4E9LA 4KTYA 2X28A 4TSCH 4NBYB 3KJ6L 4ODXA 1CXFA 1SN5A 5C09B 5DHDA 3WHE1 3A4AA 5AW3B 1ZA6A 1CIDA 3WKPA 2YD2A 4JR9L 2OSXA 2IOIA 3A3YB 3I74A 3OLIA 3MR9B 3S5LA 3V9FA 1JXGA 4E41A 1A6UH 1C16B 3SQRA 1EXHA 1GS7A 2HRPL 1LEKA 3GRWA 3IGFA 5D7JA 3CFIC 5BUAA 4MBOA 3VXUD 1FNAA 4X7TA 3BUIA 4JN2B 3KLAA 1CMOA 1EVTC 2Z7YA 4WENB 3RHWF 1F4ZA 2EABA 1ND0A 1BCIA 1F8TH 4NQED 1LE5B 1LK3L 2A9MH 1PG7H 1Z9SA 3BH8B 3LAFA 4IS6B 4XP9L 3WNMA 3V6ZB 1F6FB 1U8CA 5DA4A 2OXGB 1UKSA 5J12C 3TBBA 5F9JB 1PKQA 3CSBA 3NAAH 5GGRY 5CJXA 2DQTL 2DM4A 5L0QB 1J12A 4P3DB 2OTPA 1J1XL 4MZRA 1S7TA 3V4VB 3QDME 1SF5A 2HRGA 1M71A 3QAZB 2G4EA 4OQTH 4ZX6A 2C1PB 1FVCA 5E2WL 3QI9D 1XDTT 3FXIC 1GHFL 1KXHA 4AVIA 1VJMA 1G87A 2OTUA 5GRUL 1S7VA 5CEZL 4OBSA 4TL5A 4TUOB 3DHUA 2LABA 4KXDA 4GW5A 4HSQA 4K7PX 4QXUH 3DKHA 5SWQB 1I9IH 1OW0C 4WFED 4AQ1A 5E9DB 2VSKB 3MQIA 3Q9QA 5IK3B 3ZE1E 1H9DA 3NMEA 4PTTA 1NCOA 1B4JL 1FDLL 1MEXH 2YIHA 3FU3A 3IF1B 3O8XA 4LF3B 2HPOA 2B20A 4Y4HA 4RAUA 1Q1JH 3I50H 5C0IA 3SHSA 1MVFA 3MLRL 4ELDA 4APQA 2W60A 4QF1B 3S34L 3QFDB 1U8HB 2X09A 3WN6A 1CQKA 4JHAL 4TL4A 4FTVD 2ALAA 4B9YA 2GAZA 4AZUA 4JJ5B 5D1QC 4MQ7B 5BW7C 2R15A 1E12A 1ZLSL 1IM9A 1BAWA 4DCQB 3SJVB 1K5NB 4HIHB 3TV8A 3ILQC 1ZHBB 2PYFA 5CKGA 3KYOA 4BFOA 2O5ZH 4FQJH 4UINL 4C54A 2VGLM 5L9DL 4MWFB 4WY7H 4IHOA 5L7XH 4H13C 5DQDL 4YDJB 4MXWL 5K1JA 5KSAD 4PJ8D 3VXPA 1GR7A 4GUCA 1NCTA 4L8SA 4PI0A 4Y4FC 2FE0A 1KT2A 2BSRA 4K71B 4N28A 3UJJH 2RTTA 2ICWA 1A14L 3RIAK 1KGIA 4XX1G 5CZVL 4AYEC 4IRJD 3O2DL 4ZFFB 3X3CA 4XB8A 3IDGB 4N2EA 5E0FA 3S35X 5MP6L 2K7PA 1J5IA 1MFEL 4F27A 1EERB 1JNLH 2X4TB 4AIZA 2GUOB 1Q94A 2VDMB 3B9VA 3Q8BA 4LDOB 1NKOA 3AQZA 3BT2L 1T4WA 1K5WA 3COCA 4PRHD 1QR4A 1QSEA 4AOFA 1T1WB 3QQNA 3RWHB 3K4AA 5CEZE 1KIUA 4GAJL 3HC0B 4BFNA 1JN6A 1BXUA 1BYPA 2C3XA 2E9JA 2MTAA 3RPBA 2EDJA 3UTSA 4BGLA 4OF0A 3AS0A 4AUUA 1EXGA 2OZ4H 4J6IA 4W70A 2BS71 1D6VL 3X3FH 3JTTA 4ETQB 4UDUB 3GKWL 2BP8A 5EG6C 2Z92A 2GTZA 3O4LE 3OJ2C 4L8BA 3QT2A 2DAVA 4MNQB 3MOAL 3VMPA 4PCYA 1N67A 3PL6B 1IAOB 2CMRL 2CKBL 5EU4A 3A6BH 5AB1A 3VWKA 1DQTA 4MNHB 3VFMB 2KBGA 3DO7B 2VMFA 2PTUA 3NZ8B 4WO4C 1Z5YD 1WAAE 1KY7A 4YHLL 2R69L 3GXNA 3RAJH 3WLWC 1XGYH 5I17B 5EBGA 2B77A 2E59A 3OE8A 5FCUL 5HPMB 2VOTA 3GJEA 3CLEL 3PNRB 3TF4A 3H1ZA 1UCBL 5EF3A 1PCXA 2PP9A 1S8DA 3PJSA 3BT2H 1CGSL 4FQXA 5BRZD 4ZMWA 4TYUA 1DVUA 1T3FB 4HAFA 1JGLH 1CGVA 2Q10A 3MNZA 4JKWA 3ZPQA 1FNSH 1QSFE 1AGCB 3QULB 4PIBA 3B2VL 3AU1B 4NQXA 2J5WA 4OTXL 1SXZA 3JUYA 4D0BB 1UFUA 2I5YL 3E8UL 2APSA 2V2WA 2P48B 1NCDH 1M05B 2Z7ZA 3G6JB 5IP4A 4JN1H 4RGMB 4EUPG 3FT2A 1MLBA 4WEMB 1RULH 2YD7A 1NGPH 1AZRA 4NN7C 1MCKA 4WUUB 5F3HB 4DVBA 1E40A 5IJCC 4BWBA 5AZ2L 1E8XA 4L3EB 4LEEA 4JHVA 5SWSA 1E4KA 5GS1A 1TJGH 2D0GA 5JW4M 4JY6B 1DQVA 2ED8A 3B7TA 1FIGL 2PR4L 4J6RL 1J10A 4PWFA 2VLJD 4XNQA 3S37H 3ABGA 3FB6A 3QCVL 3I3EA 5DLMH 4C57C 1ZVYA 2ZKYA 3VRIA 2N7BA 5E9AA 4LMQE 5F3FA 1UZ6E 3IE9A 4FP8L 4ZS7H 1U6AH 5L4MA 2UX6A 5IJKA 4PY7A 4N26A 2RFXA 4BYHA 4CSSA 5KSBF 3T0DA 5B39G 2G0LA 5T1MA 3QC5X 1MRCL 4ZG1A 4GT0A 3U83A 3VXUA 5F21B 1IL1A 1R3LB 4I48A 3FCSA 1XR8A 4ELKB 2QSVA 4NUPA 3OM3B 3RZCB 2PCFB 2I9TB 1A3ZA 1MDTA 2EO9A 2ZF9A 4NQEA 5I71C 1UKTA 1QM8A 1PZUB 4AZ8B 2H2PC 4FKEA 2QZQA 3UBHA 1H0DA 3AAZA 4ZMZA 1ANUA 1MJJB 3VSUA 1JPST 3T0BA 2Z6FA 5DZVA 2IVFC 2YFNA 1UJ3B 4LCYA 3RURA 1HAUA 1MFDH 2OYMA 1G9MC 1ED3A 2DQDL 4A6YH 4XH2B 3NIFF 1ESOA 1BM3L 1Q90A 4X6DB 2OK0L 1KJ3L 2OW7A 3VQ2C 3RWFA 1N19A 3QZBA 2XYBA 1T4KB 2YPVL 4UOZA 4NWTH 4ZTPH 5I8KH 1G4MA 4PP1C 4NKIH 4TQIA 5GGUB 5F6IB 4JGNA 1UEYA 3QI9A 5IUSA 1ZGLM 1P4BH 4M7ZB 3W57A 3OZ9L 5TGBA 1U92B 2R0KL 1TQWA 2CBTA 3PHAA 4OLWH 4MD4B 1E42A 5JQ6H 2FZ3A 3CLWA 1KNOB 4HEPA 4A2LA 4JE0A 4JQXC 1X4ZA 2XA8H 2Z0UA 3RY5A 3BWUC 5KBNC 5D1QD 4PG9B 4FQ2H 1OCWL 3ELAT 1RK0B 4KY1H 4OZFA 2DWDB 3O0RL 1RZJC 3ILQD 4PREA 4AMXA 2APWA 3LH2H 2GTQA 2DQIL 1DUZA 3T2NL 3WUWB 3CDFA 5JPNC 3MCKA 2ZUXA 5C1MA 2JJWA 2IALB 1VKXB 2NW2B 1IC4L 1IBZA 4QAMB 4JM4H 3QO0B 2KKQA 3HCVA 4BFJA 1A1MB 4CC1A 4PS8A 4LGRB 4AG4H 1GGCL 2XACC 2YPVH 3P0GB 4FTVA 2ITCA 3TIEA 1KPUB 1R9FA 3FHEA 2DIAA 4G8EA 1B2YA 2GJPA 4D3CL 3Q1SL 4NO3A 3AW5A 1FFNA 1U9KA 2FBJH 3DX9B 2VZ1A 1G9NL 2IXQB 5F89B 1ZLVK 1WZMA 4RMUA 1XGZA 5C07B 2HX7A 4XVJL 1XGRA 1C5BL 2IQ9L 4MMXB 5BS0E 5KSAA 1XIOA 3QDCA 3N1MC 4PJ8A 5HHXH 5C0JB 3ZDWA 2MKLC 4XNMB 3PHOB 4YEEA 3SCMB 1C7TA 1PD6A 2KERA 3TNMB 3V4PL 2Y1ZA 2IADA 3FCTA 1PZ5B 1HVXA 1I1RA 1U2CA 1BRRA 3K7UA 4MX7A 1M6OA 1MFBL 4N85A 4Y9GA 3ZL4L 5FKAA 3OKKA 1JMZA 4IRJA 1D5BB 3O4OC 5I76B 1I7ZA 3ZW3A 5I1LA 3IJ9A 2VDOB 3TF7C 3II2A 4QO1B 3V0WH 4ELMB 2XIIA 4JLRA 7TAAA 2VLME 4JFHE 1NJ9B 1CDYA 2J1KA 3G6AA 4TUUA 3ZTNL 4W93A 5FK9B 5KVFL 2NY6B 4FCHA 1IQWL 1G7QA 2V2TB 2WLYA 4MNGB 3GZOA 1V7NH 4E9XA 2FO1A 1CGUA 4OKDA 2YBGA 2YQ3A 3AG2B 4HFWA 4WO4D 3SBQA 3UTQA 3AM6A 3MV8B 4PRHA 3WLWD 1TQSA 1W8OA 3C5ZB 4F37K 5H2KA 1C5CL 1HQRB 1TO5A 2CO4A 2VR6A 5H94A 3NZUA 4G1EB 3IVKB 1OB0A 5HGAB 5C0AE 2EDHA 2GKIA 3VJ6B 1YMME 4NZJA 5JA9A 5EOCH 5E00B 1V55B 4PD4K 5DJDA 3WEMA 4Z3IA 5B4MC 3TOPA 1XXDC 5ANHA 1SBBA 4WHDA 2Y1YA 3KPNB 4OFYD 2OTWA 1A6AB 4EDWH 3OXSA 1YEHL 4OSUL 1ET7A 4Q52A 3PAZA 3QRGL 3W0WE 2RQEA 3UTPE 4JQ6A 3AS3A 3D0VA 4Z3GA 3VI4A 3P2TA 2G9HB 5AWNL 5HVHC 3RTLA 1SXNA 2R27A 5E51A 1E43A 3VFOA 2VN4A 3KWXA 1DQJA 2FUQA 3D4ZA 3GGWA 2O5XL 5BRZA 1FORL 4KROB 3SE8H 1FVDA 3PFQA 3NTCL 3HZYB 3K6SB 1MHCB 1L5GA 1L0QA 1A2YB 4BCYA 4G9FD 5D5ME 2R2EB 5LGHL 4OZGF 1DSFH 5AVSB 1WSST 1TYEB 2GTWB 4YZFE 2VISA 2R1YB 3H0TA 1X3DA 5CUSL 4WK4B 3VD0A 2KQMA 3B3BA 3U7YH 2BHYA 4L23A 1MCCA 3CXFA 3EYVA 3Q8EA 2EVFA 5DRZB 1OT2A 5JYLA 2VXQL 2YK1H 5TJWK 3TYGL 1HYRC 1Z5LA 3P11H 1VZGA 2OULB 2DYPB 2VLRB 5E99H 3V95A 2KSBA 1MQ8A 5DC9B 2NY4B 3T04D 3HEIB 2H2PD 1G9NC 1RIUL 4OV6F 4R7NB 2QQNH 2VLJA 5D72H 5BV7B 2BRDA 2HVJA 3ILEA 2IAMB 2YQBA 3QHTC 4LU5H 2W92A 3VGEA 3ZKQD 3PNWB 1W15A 2YUZA 1SUJA 5T5FL 4X5XB 5KVFE 3U1SL 1JHTB 3G08B 3ZKXB 1DJGA 2XX0A 1TTUA 4B27A 2E56A 3BZ4B 3QISA 2CHWA 4M8RA 4PP1D 4M6NL 2OJEA 2FUTA 2G2PA 2YXMA 1C3WA 2HWZH 3IFNH 3T6ZA 2OM5A 1FRGL 2CXKA 1MAKA 1UWXK 2CKNA 3BP4A 2CLRA 1IKOP 1TXKA 4LFHG 4NUJB 1FGVH 1KYDA 5EBMB 1ZPLA 1DBKH 2C9UA 3MYZA 5FS5A 3E0GA 4U6VH 4JUSA 3SDCB 1EXUA 1OW0A 5E0QA 4Z7OE 5I75C 4WI3A 1X9RA 3HN8A 1NCIA 4HJ1A 2MCMA 1EHLH 2A3TA 3QWOB 2BZCA 2AKRA 4I5BA 4LT7A 1CXIA 2Z8SA 2P42B 5FECA 5JXAL 2X4UA 4U3CA 4WSJA 1G6VK 3CVHA 4AV0A 1TSRA 4W9KC 4HWLA 1ILSA 2VM3A 3GIZL 3CHXA 4MS6A 5FWRA 1AS7A 4L4TB 2GPZA 2WJ7A 5K1NA 4WV1B 4F7EB 5LKNA 2XZAL 1CG9A 3U0WH 1L9PA 1BEYL 3WNPA 4HG4K 1PG7W 4MXVF 1XCTB 5D96C 2SODB 4DAGL 1S7UB 2EVHA 2WOYA 1F97A 3BWZA 3M45A 4JRXB 2X0WA 4B3EA 2C4FT 1RIHL 2P24B 2WINA 4JO5A 3QJFA 4N0UB 4HMEA 2YUVA 1E3XA 3JWOH 2XA3A 5D1QA 5I5IA 1FRGH 2E7CA 1J87A 4OLUH 2LV4A 5IQLA 5BW7A 3MCG1 3LKNB 5I1AB 4HWBH 2XG5A 2D7TL 1R17A 3CZUB 3LKRA 3AG4B 1V3JA 5BQ7B 3BZEA 3SZKC 3V0IA 3VI3E 1UOLA 4RFEA 1OSYA 3NESA 3PP3H 1RUKH 5ANMA 2WUCL 4QYOA 3AQXA 2OCFD 3LRKA 3NJKA 3RA7L 5CGMA 4M43L 1GGYA 3BI9X 4Y4FA 2Y0SA 2DKSA 3HG2A 5LWYH 2WGNB 5FUOL 1E90A 3MA7A 4X7SL 5ABAA 4LRIC 4ZOBA 4LHQB 5A6IA 4ZO6A 1W9XA 5F7NC 4XR8C 2QVIA 2FB4L 2ZUSA 4IB4A 3GRBA 5DD6B 4MJ6B 5JHDD 3FTSA 5L2JB 4TSAH 3Q1EA 5A2LH 3BIKA 1KLFA 5GRVL 3OLEA 4XN1A 4L3CA 2FSEB 2OS7A 3SD5A 4V1DB 3ZTCC 5GGTL 4ZW3A 5KVEL 1FBIL 5AVYB 3D05A 1QNZL 2A83A 4O5LH 3RUGF 3ZUNC 3I9GL 2J1YA 5EFIA 3L3DB 1CTOA 5ITBH 4YSPA 3I6LE 1PJWA 5DHVA 2E9BA 2DJMA 3EZJB 3UZAA 3B9EA 4WI0A 5CJQH 1U8PB 5CFHA 2F6AA 4ZW7A 1S7SA 3VXTB 3T1FB 2B5IC 3AACA 2CAKA 2GEQA 1UA3A 3H55A 1NBCA 3QEHA 3WXVH 4UDTA 4FXKB 1TEGA 1AY1H 3FTZA 3MRJA 4HIXL 4ODWB 1MI5B 2APTA 1AQDB 3DDGA 3SBRA 3ZL1A 2X1PA 5AQ0A 1I9RH 4KY2A 4M43H 2VLMD 2P43B 5CHNA 1W72A 4DWHA 4F2ME 2H32A 4PJHA 3ARSA 5D2LF 1A6WL 35C8L 4LLWB 5B4MD 1EO8H 3JYBA 5H8DA 5IB1B 4HXAL 1B0RB 4WGWB 2J6EA 2XZQL 3JTSA 4G8AC 4NZRL 1TQBB 1A1OA 2B1HH 5HVFB 2FCBA 2EUWA 3F7LA 3GSXB 4WO4A 3H9HA 4MA3A 5EU6D 2XY1A 2H0JA 2V3DA 3D9AL 5AOJA 1JGDB 1NIBA 2JLPA 1S3KL 4HS3A 1MF2H 2P52A 3MREB 2V9TA 3O3DB 5GS3A 3WTXA 3RWJA 4E5XA 1SN0A 2NZ1A 4XRCA 1T20B 1KFGA 4FZ8H 5DO2C 2UY6B 4HIJA 4PJCF 4YHYC 5ISZE 4WTQA 5BQDA 1J5HA 1TTRA 2XHNA 4R4FL 1RK7A 3ABLB 3LRHA 3HE7C 3WFEH 1NBZB 4PJFF 1XH3A 5K59E 3FB5B 2EYTA 3FRPA 3EO9L 3L2LA 4OFYA 5HYQB 3FQTA 4U7KA 5CP3H 4AMJA 3UTPD 2WVTA 3PWPE 4XGZA 3GO1H 3FU8A 3D09A 4WUKL 4XOBA 2P80D 5E2TL 4HC1H 3W9EB 2EP6A 5T33L 2YRZA 3L5XH 4RMWA 1ZMYA 2QGDA 3FQXB 2UUDH 1BAFL 3SO3C 1S7XA 3FQRA 5C08B 1JZJA 3V0HA 4HWEH 3D0LB 4O51A 4UAOC 3UEZA 1U2HA 4E9WA 3QK0A 5C0GB 2EUXA 3W2DH 1GSMA 2OL3L 3MRRB 5KSBB 5J1SC 2X4QB 4V11A 1IBFA 4TULH 1MQKH 4N0YL 3BD3A 3DTDA 3IGKA 1NGWA 4G9FA 3QJHA 1S3KH 5KOMC 1NWOA 4NOBA 2MJWA 3PDDA 2DLEA 3NK4A 1YPZF 5H2BA 4U1HB 4DP4X 2XV0A 2YLKA 2BY1A 5DMIL 1WWAX 2PTTA 3EO1B 3MV7D 4TF4A 3B7YA 3BSZL 1U19A 2LTQC 2XYCA 4PQXA 3UBXG 1IM3B 4F91B 2CRZA 1JPFB 1QHQA 2KDGA 5T3ZH 4DKFL 3ATFA 4XNXH 1EX0A 4N68A 1KCWA 1YQ2A 3NIFB 5DEFA 4PJIF 5JW4N 2F9BT 1FFPA 1J5OH 1MJ7L 5T33H 5IVXA 2Q0ZX 1C5DA 5GRZA 1VPOL 2P3YA 1ZLWK 5J9PA 4HIIA 2X7LA 5EZLB 4AQAB 4AMWA 1GZPB 1AQ8A 2FIRT 1T04A 4PGBB 3FHAA 1JNHB 4W81A 3NFSL 3VX0A 1N26A 3FB7A 1KIRA 4FFZH 3QXWA 2RALA 1F41A 2C5DC 3GBNH 1CFQB 4Y2OB 2DB8A 2ZWSA 1YEGH 2EXSA 3IMUA 1B4LA 5AZEH 2O6EA 1NPNA 2Y23A 4YXHH 1H15B 4M4RA 4TRPL 3HZKA 2DW5A 4Z3HA 5INDB 4Z0XB 2BJMH 1MUJA 4YR6B 5F96L 5DHYB 2WB7A 4JAMA 1GC1C 4G43B 5TK2A 5E1HB 3D33A 1X6LA 2GIYA 4JQXA 3VTTA 5C7ZA 1TZOA 4WNQA 4PXKA 4WJG3 5LXGH 1PVHA 3W5MA 1BD2E 5T1KD 3RDTC 4AUJA 4B5ZA 2CKBA 1AFVH 2UWEA 4EEEA 5KBDA 4DJMA 3BAYA 1VGEH 1SJXA 1UD6A 1CXHA 2Z35B 4EXKA 4JRYD 1KC5H 4Y1TA 3EF7A 1KTLA 1YEFH 5GGSY 2MPAH 5JPNA 4XXWC 2P46B 2XN9E 5CEXB 2WN2A 5G55A 2ZAGA 3CSYA 3QZNA 1RURL 1BIHA 3WTSA 4FAAB 4N24A 3VFNB 2Q87A 2VDQB 3M46A 1E5CA 3RBGA 1EEZA 4DFHA 3F2LA 2VZUA 1S53A 3CHSA 4NCC1 2Y25A 2ORBL 4QI3A 1NCHA 2AEPL 5AHYA 3NA9H 3Q5TA 5EA0H 4FADA 3BVUA 4PVMA 4MB4A 3V5HB 2WN3A 5F88B 2DIJA 5DO8A 3UJIL 1KXQE 1E4WL 4XMTA 4P3CL 5D7LD 4D9RD 2ERJB 1CLZL 4B9KC 1WCBA 5IROC 3ELQA 3L1OH 1SF3A 2VDKH 4R90L 4N9GB 1X5KA 2AEQH 5D1ZC 2ATKB 2BM3A 1S46A 4PJDF 5HI5C 5KJRL 4NQSA 3NABL 5DRNB 4NNYA 1AOHA 1WZLA 1E9PB 4LO9A 2J1XA 1R24A 1BWWA 4MDIB 2X40A 2JQAA 3S5ZA 2ILLA 5JHDA 2OMUB 3ABKB 1VFBA 4BFIB 3BQVA 5C0CD 1BQHG 4HS6A 4PRAA 3VWJC 4D9LL 1AP9A 3IJ8A 3L3OC 4R96B 3N43F 3IAGC 1KB5L 3CMOL 2D2OA 4NAJA 3PIQA 1KXTA 3I6LD 3IMBA 3BFQG 3S8WA 1L4IA 2XRAH 4XN2A 4L1HA 5FA4A 2XBDA 1XGTB 4NKDA 2AXFB 4U0RB 1ZGLP 4MCZA 4JZOA 2ZG2A 1JZ5A 1A4AA 5EDXA 4IOSD 1PLBA 2V5RA 4LCWB 4JPSA 3GBDA 3NZSA 5EEYA 1JWMA 2J56A 1FZKB 4E42A 3NACH 5HHNA 2O5YH 3HNSH 1QPXA 2K6YA 3CXDH 5DO2D 5MHSE 1F13A 1G5GA 5DURB 3D2TA 5JUEL 3SDDB 3LV3A 1KLUB 1OL0A 3DV6B 1N6QH 3QIBB 4YBLB 2EI4A 4X5LA 1U3YA 4ZUUA 5EBWB 2ZX8A 3HE7D 3SDYL 1AC6A 5E56A 4FI7A 3LY6A 5IEKA 3P77B 3ARPA 1I1FA 3NCCB 3J27A 3MROA 2EH7H 4MKTA 1Z5HA 4UYQA 1P1VA 4XB3A 4XP6L 5EU6A 4APQB 1WISA 4ZSOE 2ENSA 4LL9A 4NFBA 3L95A 1Q38A 4NC3A 4OZGB 3O6FC 4O2FA 1E0OB 3GSQB 3FT4A 2A9BA 5HHMB 3ZIMA 4Z7VA 2ZOUA 1HH6A 1L9OA 1OM9A 4X8JB 5BJTA 5I16A 5DUML 2VITA 2ZOWA 4XN5A 2G5UA 4HA1A 4QY8B 5EULV 3UTZA 1I85C 1LO0H 4LOVA 4J4PA 1ML0A 3RIKA 3ZZSA 1FN4A 1T5KA 1JFQL 1G94A 5JUEH 1XMWA 2XIBA 2YKLL 1K6QH 3TTSA 1DN0A 2YPLD 5LUMA 1LO4H 2P80A 1B90A 1XF3B 5I1EL 3O2WH 1OOWA 2W1NA 3GNMH 1KGBA 2CUMA 4LSTL 4Y8AA 1ZLUK 1LO3H 4ERSL 4HH9B 3DETC 3TO2B 1WF5A 1UA6H 3NSFA 4H2AA 3II1A 2IBZY 4V33A 5FOBB 1JF5A 5E8OB 4H8WC 4Z1PA 3PWVA 2MPVA 1ACZA 3QCTH 4XVSH 4FFYA 2JKIS 3CFBB 2QHLA 5FV2A 3CUPA 3ATEA 1B3JA 3EBHA 1IE5A 3E1ZA 3HBZA 2WIIB 2X6CA 3NPSB 4U6XB 2BPBA 3MV7A 4C4BA 1X5HA 3V4PA 3K2UL 4QNPF 3T3ME 5C0RH 2Z93B 4EIYA 2LU3A 4UI2A 3ZQWA 4Z7UA 5IOKA 1JFQH 1E5ZA 1U4FA 4MJ2A 5C86A 1CDJA 1NLBL 4OJFL 4P57B 3HC2A 3MBVA 2NSQA 3HZVB 4OR1A 5K9OA 1KCRH 4KXZH 2Y69B 1MJUH 4HSAC 3X1EA 2BO0A 4IOFC 1BRDA 4R97B 4LVEA 3BFWA 4Z5RA 4CUCA 1DUYA 3LNFA 4R2GC 3RDTD 1RZ8B 4U1GB 4YSRA 1H8LA 4IKNA 2CDFA 4XBMA 1HDMB 3JXAA 4OFKA 3WFDH 5DK0A 5F6HJ 4F1SA 2Q7AA 5EOTA 2GHZA 4FXLA 3VW3H 2Y07L 4WCYH 4WNSA 5I73C 4P2CG 4PVLA 2D3JA 4OJYA 3DHJA 2VW7A 1Q0YL 3SKNB 3W39A 3FO1B 3C2AH 1IGTB 4XT1C 1S8DB 4P49A 4HKXB 2JI2A 3FH8A 1EHNA 1IILE 3K2UH 4JPWH 1OQXA 4FNLH 5G54A 1YEDA 3TPUB 3EH3B 3UJTH 4LKCB 2VDLH 3R0MA 5T1KA 4PCKA 1G7LB 3LVEA 4BVNA 1MRFH 1OAKL 4MTMA 5IROD 3MUGB 3P3YA 4JRYA 2RBLA 5D93B 5D1ZD 1MELA 5I8EB 2XWZA 3Q8CA 1HU8A 1NC2B 4U6HB 5HI5D 3RWCA 4PPTA 1QBLH 2E7HA 3SYOA 1J05B 4K94C 3D25B 4I3GA 2Z91B 5E4OA 3F6IA 5E5MA 4N0CC 3QUKA 1WAAF 3UG3A 4LRIA 1F4XL 1ETZB 3HLAB 5EEWA 3RUGB 1JPTH 1LD9A 3NVQA 1MY7A 2VLLA 1INDL 4EOWH 3MRLA 1TVDA 3VWJD 3UO1L 4M3HA 5DEJA 3GMOB 2GJ6B 4BE5A 1IC5L 2WY3B 1MPAL 1WCQA 4PY7B 5D7LA 4WKXA 4FQHA 4RGOL 4IEFA 2J88L 4UG2A 3M17B 4HJGA 1A66A 4XHJC 3MOQA 4Z23A 1E2VA 1YN6B 4L4VD 2MOGA 1YC7A 2VXQA 2YRBA 2IV8A 3CZJA 4UT9H 4OJCA 1MJ8H 2YN3A 5I1KH 3P0YL 1S8JA 1OGTB 4NN6B 4QEGA 4C83B 3R8BB 2J55A 5D2LB 2VLKB 5A45A 1HS6A 1NEPA 1FE8H 4R8WH 5FDWA 3FSOA 5C0CA 5J7AA 5DHEA 3ZTDC 4RAVA 3OMNB 4JKPL 4NO5B 4FYRA 4BH8B 5HVWA 3QHFL 3BGMB 2V17L 4LVHC 3BIAX 1S7RA 2A6KA 4GW1A 5IIEA 5I8OL 5FA3A 2R59A 2YZ8A 2QSCL 3TBWA 3SY0B 2WXOA 1WAPA 3TXAA 5AD0B 1MHHB 1UZ6F 2X4SB 4N9OB 4KRPB 3LD8B 2Y06L 4X0KA 2A6JA 3NCMA 1XIWB 4PJCB 4AK1A 4IOSA 3RX7A 4WI8A 5A44A 2VYRE 4OIIL 2FJUB 1BLNB 2ZYSA 3DX7A 5B1CA 5B7EA 4Q7DA 3QUYC 1DDHA 4PJFB 3O6FD 2CRIA 1DJYA 3F7PC 1JXJA 5IF0A 1JGJA 2D7OA 2V3EA 5EOQL 3WLBB 3FFDA 1TJMA 3MV9D 1D5ZB 5FB8B 2IWKA 2NY1C 1AO7B 1VESA 1T1XB 5EOCJ 3HE7A 1A3RH 1QPKA 1Q72H 3BGAA 1T2QL 5CFAA 4LCCB 2Z73A 4P5MB 3E8VA 3EGSB 4PM1A 3MLSH 3BWUF 1AZBA 1KGWA 3MRMA 1K9TA 3Q13A 2GSMB 5HYSA 2HKHL 1RUQL 1A6ZB 1N5YH 3WNIA 4Y5VC 5A8EA 1KGYE 3CDGA 2FJHB 3IBEA 2J2ZA 1GPOH 2F1AA 2FATL 1ZS8B 4CMMB 1YPZB 3DETD 4DGWC 1B2WL 2FHBA 1ADQL 3P9LA 3RNQA 3B1UA 2P7TA 1V5JA 4R26H 5CKAA 3RIFF 3UERA 2BY2A 4AEHL 1EJOH 4UTAH 1VADB 4CU6A 4Z7NE 4JO4L 1A9VA 3BEVB 3IJEA 4KVNH 4QJ5B 4F3FA 3PY9A 2ZUQC 3CN3A 3TJEL 4G5ZH 5DI8B 3P73B 4PJIB 1SYSA 3VGAC 1T1ZB 2XXFA 4P9MH 1YNTF 2YPLA 4BH7B 4Y8DC 3LQMA 4FEIA 1XF2A 4QRAA 4XNYH 1JGIA 3HZ3A 4OB5H 3KWVA 2CRYA 1C12A 2CGRH 2ZXQA 3MUJA 3MRHB 4JB9H 5IFHH 4DKEL 4AVHA 3U0PA 2Q8BL 3LNGA 1HINL 2WBXA 3LKQB 1I7ZB 1RLBA 3NFPB 5AKRA 3VFGL 3WUWG 3F83A 2YD9A 3TJHC 4G80B 5GGTA 2ZUVA 4IOFD 3RGVB 4EUPH 3BRGC 4JO3L 1TQVA 2ZX7A 4JANA 4K5YA 3LRSA 4R2GD 2XVBA 5FYJL 2G3XA 3CSFA 1JF1A 2OCJA 4X6EB 1QFHA 4MAYB 1MREH 5A16A 3Q6GH 3DJTA 3K72A 4PJ9B 2WZ5A 4QLWA 2QEJA 3MJ8A 1I1YB 5LQBL 1JPSL 1KJ2A 1JRHI 1VACA 3DUSB 4QCIB 4EI6A 2X72A 2QBWA 4XCFH 3H6JA 4QI1A 2DQHH 1F11A 1N8OE 4IMKC 3QO1A 3UROR 5F1KC 5DQJB 1C1EL 2WC7A 1JAEA 2XQYG 4KKZA 4PWIA 3S88L 4YHZL 1FJ1B 1XF4A 3CQQA 3RDTA 1IFHL 1OCRB 4PCSA 3WYRA 4HGWA 1LYQA 2PPEA 2V7NB 4JZJC 5CCKL 2IGFH 3GJFB 1J8HE 3NCEB 1KBGH 3TNNB 5I6KA 4GG6E 4NQQA 4EDXB 2FAUA 4CGTA 4ZOCA 3C09B 4XXWA 3ZQXA 4KRMB 1WLHA 1MCDA 1TCRA 1U21A 4N0CD 1RVFH 3C5SB 4DO6A 4DZBB 4F2EA 5H2MA 4Y2DC 1M3JA 4OI7A 3GGWB 4F93B 3QNYA 1AGFA 4BDVA 5MEOB 4XMKH 4PJDB 3DTXA 3FU5A 4QXGH 4DGIL 3VA6A 3KW7A 2HXAA 1GZQA 3TBSA 1A6VL 5FDYA 1NLDL 2RCSL 3JT2A 2AJYH 1CO1A 5IROA 4YWGL 3TWCH 3MMEB 3MJ6A 5IHUL 4W9IC 5D1ZA 2BDNH 3AREB 4NZ8A 1VCAA 4X98A 3FS9A 4M02A 4OV5B 1RAMA 3FDWA 1U3NA 4J8RA 1VEOA 5INCA 3ZOAA 2HVBA 5HY9B 1H8OA 1Z0NA 2WKOA 2Y2WA 3N43B 2OL3A 3L9YA 3U6RB 5J11C 1H3UA 1CZ8H 2Z0BA 5JOPE 5KG9A 3Q6FB 5E08L 3NEEA 2JIXB 2XQYK 4GSDL 4ZUWA 3LKSB 1Q9LA 2W9EL 3ZDZF 4NGHL 3D06A 3VWJA 4PCTA 2J73A 1OF2B 4CKQA 1OTUC 1DQKA 1NEZB 2P1YA 3L3OA 4PYGA 2F1BA 2RR3A 5FYKH 3T77B 3A47A 1FPTH 2ZONA 5FYJE 1JGEB 3EO0B 5E24E 5D5MF 4JPKH 2ZNWA 2AXHA 4HZLA 5F8QC 2HMID 1A4BA 3GB7A 4L4VA 1JUFB 5GRYA 2DQEL 2JJUA 4YZFF 3HAOA 1IV8A 1KGUA 2VR3A 4JREB 2CIIA 3MLXH 4CN4A 4LCIH 5IHWA 3SYCA 4MQSB 5KAQF 2XKNA 1JS4A 2WAQA 4BFRA 2X9YA 2J5LB 1HHJB 4NRZB 4DZ8A 3QUYD 3L7FB 5KVEH 3NJMA 4JFDD 4OD1L 2LE9A 2YXWA 4F7CA 4P0DA 1JWSA 3MBEB 3QXDA 4HT1H 8CGTA 3TGXA 1EZVX 3BH4A 2G3MA 4G6MH 4L9LC 1PTZA 4URTB 3US1A 2NY1D 4OFPA 4NIKB 2FH8A 1A0QH 3LQZA 3S9DB 3OPZH 5DD0H 3NDYE 1F1GA 5D7IA 4Q9QL 4GXVL 3QDMB 1CK0H 1HNFA 3PFUA 2X4UB 3MRPB 4UZUA 1DBAL 3THML 5PAZA 4YVNA 1HL4A 3IDYC 2HN7B 1NAKH 4N2CA 4X4XA 2XOTA 3FBQA 1RHHA 1C08B 3SOBH 4KKRA 1BQ5A 3HBPA 4NENB 4HIQA 3WEXA 3RY6C 4PGDA 3WKMH 1FVEA 3O6FA 1NKGA 3DVGB 1S5HB 2KZWA 2NTUA 3OE9A 4RMVA 4G9DB 1A7QH 4HUWB 3MV9A 4K8RL 5JOFA 2R7EA 2XG5B 1FFOA 2E6JA 4GPVA 1I85A 1BGXH 4Z7OF 1GU8A 1R5WA 1RJCA 3DX6B 3S4SA 5KYUA 4W9GC 4UT6A 4MASA 4ZSOA 4J3BA 4H88L 4XMLL 5IGXL 3RVXC 3IJYA 4CDHA 4KVCL 5EEUA 5EN2A 4B9JA 1UOWA 4GXVH 2V7HA 4X5PA 2WWOA 3H9YA 3PYCA 3VFVA 1BECA 2WTOA 3LEXA 3QDGE 4FL4B 1AD0A 2PW2A 3NJFA 2Z31B 2YD5A 4JW3A 1BFOA 1G7JA 1XCXA 5GHWL 1B0GA 3AQYA 5B6VA 5HJDA 1KLFB 4PGJA 4LQFH 3TJHD 1Q4NX 2DQJL 2NT0A 1KTDA 1RFDH 2IPTL 1LVEA 2X70B 5H4YA 5BZDA 2EE0A 1TR7A 4PLKC 5JORA 2G75A 2F8XC 4BK5C 5CZKA 5DHXB 2WVVA 4GBXC 3WIFB 3T1WA 1S9XA 3ORJA 3HNVH 1BMWA 3S48A 3LX9A 1WPCA 4U05A 1KG0B 5KVGL 2X6UA 2JKRM 3GLEA 1PZSA 5EU7E 4MD2A 1P5VA 1O75A 4YX2H 1W80A 3GMMA 3OE0A 4OFQA 2OMVA 1OPOA 4UT7L 1IIIA 5C2UB 4O58H 2N01B 4J4PC 5IMLB 1KBBA 4LL4A 3V8OA 1ZHLA 4HOZA 4WWKC 1RXLA 4ZOAA 4GMSL 4LESA 2XNAA 4WLCA 3AG1B 1O9VA 2VJ8A 5L4FA 2AV7A 3L3IB 2ZUYA 4LDEA 3G04B 1T0NB 4UOQA 3SGEI 2V3FA 1WYJA 3I02A 3M8OL 3TJPA 2BSCA 4ODTH 43C9A 2C8NA 2Z34A 4ZFZA 4XT1A 4Y2DD 4GYCA 1T7ZA 4GRMA 4KQ3L 3QS2A 4Z76A 1MH5B 3BDYL 3O4LB 15C8L 1U3HC 5CJBA 2XN2A 3RP1A 4HUXA 5D6DC 3MJ9L 5EWIL 2BMKB 5IHZB 2BSTB 2N0MA 2HVKB 1I4FA 5B38B 4YSUA 1FP5A 3MGAA 3BMVA 2VDPL 1J8HD 1MCWW 3HFMH 2AQNA 4U0QB 5EUOA 2BCKA 1SDDB 3OXRA 1MWAA 2C4XA 4OD2A 5FO9A 2Y04A 4UQBA 2ZSVA 4TXVB 3SE4C 3V5KB 4WW3A 1U33A 3QUMH 4JG1H 4N5EC 1NUNB 3DOSB 3GZKA 3SIKA 3KPRD 1FSKC 3DA0A 5FUCC 1SJHB 3R7RA 3KR3H 4MQXC 1CD0A 1P7KA 2AJZA 2ZCHH 4N2DA 4K8RC 4KDWA 4LOEA 4M62H 1M0LA 1QSFB 1X4YA 5JYMA 1QHPA 3RWGB 5AEAA 5G4MA 3ULUL 1EHAA 2GK0B 4QHNA 5TFSL 1EWHA 2PP8A 4K7PY 4PJGE 4Q14A 3KMDA 1OTUD 3ZVVA 1XH1A 4F8TA 1B0IA 1JSYA 3ZYJA 1NCAH 5DD3H 3ULVL 1XVSA 2GCYA 3HZMA 2CE6A 3VSQA 5C0BD 4TNVK 2P4AB 3PBLA 2QV2A 5E2UH 5KVGE 4C56A 2B0SL 5ID0B 32C2B 1EK3A 4JDEB 4JDVA 5C3IA 4U4BA 3TYFA 3FO0H 3AB0C 3G5WA 3LH9A 4YAQB 1F3DH 4XWGL 1TQTA 2GSIA 2H45A 1WA0X 1HZHH 1I3RB 1ZK5A 2BOLA 2BWIA 4PV8B 5DR5H 5A40E 3HAPA 3MU3A 3X3GL 1TZGL 4TNEA 3C6SB 2HT4C 3NCYP 1HEZA 3VD2A 3LXAA 2WZ6A 3TASA 1SYVB 5AVTB 2R29L 2K1MA 5HGDB 4BV0A 5F3BA 3UX9B 1Y6MR 2OSLB 3MRBA 5LO7A 2HCZX 5L8LB 1DANU 3KBEA 5I1GL 2CHNA 3NGBB 2BC4A 1MFVA 2CRMA 2OP4L 3G6DL 1QFOA 2Y5TB 2J4WL 2VXSL 5EZJA 3MRKA 2W94A 4JUTA 1J0IA 5LNGA 3EH5B 2OX5A 3HHSB 4OGYL 3LH8A 3S3SA 3MODL 1QFWH 4P5KB 3IM1A 1ZVHA 4A2GA 4IRSB 5TH2B 1LMIA 5GJTH 1OIOA 3GSNA 2VUKA 5TQ2L 5D8JL 5DUPL 4UU9A 3QUYA 4JZNB 1ZLDA 4JFDA 5IW3A 5BCAA 1D7FA 2VL5A 4XX5A 4YC2C 1U4EA 3NSDA 1GMEA 1WICA 3TA3C 1T2JA 3D85D 4NYLB 3ASOB 4AVJA 4HWZA 4XMPL 3N1GC 2P8LA 1S7QA 4DP0X 2JK5B 3HAEA 3X11B 3KPMB 4DOHE 5ADOL 2D8KA 4S1QH 1Y1DA 3LZFH 4MMYA 4N8VB 2AEIT 2HRHA 3SYAA 1PMYA 1T6BX 3MFFA 5IMOB 3QIWB 2C7UA 2CO6A 2W8CA 2W9DL 4HHAB 4Y5VA 5AAWC 1BW8A 1WK0A 1YN7A 3CWGA 3HR5B 3VXSD 5JW5A 5J89A 3O3AB 2Q1EA 2HH0L 5DJ6B 2VXSH 4XOAA 5B1JC 4E68A 4LVOC 4LSRL 2X9ZA 1YY8B 5BNXD 5LVEA 2VQ1A 3ULUE 3L1EA 5AB2A 2YAEA 2JNZA 5FCSH 1R2NA 4CVZA 3K4ZA 4K7PH 3GK8H 3FTGB 4LIQH 1XF5A 3UC0L 1YNTB 5KVDL 4NPYB 4PLKD 3KPPA 5CXPA 3ULVE 4UQ3B 4NRYA 3BX7C 1XXFC 1Q5JA 1PIFA 3RNKB 3VHZA 1AACA 4GBXD 1IGCL 4N2MA 4YHKL 4F57H 4AYID 1NOLA 4PBXA 3PJNA 2ADIB 3WO4B 3VGAA 2WXKA 4P2RB 5IFAH 3NJJA 1UM5H 2R8SL 2CJSA 1BEXA 4MZ2A 2VWEC 4XMUA 2IBGA 4AT6A 2YPKA 2DQUH 3S6CA 1WD9A 1P5UB 2VZOA 4BZ2A 2NW3A 4GUOA 3ULUC 2WCPA 4UOJA 4X99A 5CGBA 2B4CL 4ZNEA 2AGJH 5DRWB 1MHEA 2HFGH 3V2AR 1JERA 2R0ZH 5GGVY 1ZTMA 5CIPB 4H20H 4LPVA 4J4PD 3DUUB 3RX9A 3TESA 3DMMC 3U2JA 4Z7IA 4WWKD 4ZFOA 2LAGB 4WU7B 3GSVA 1EFXB 5MENE 4ZODA 2H3NB 3F7VA 1YDPB 2AK1H 5BS0B 3UZQB 5IJBC 4N6RA 4ZBJA 5E8PB 4GLRI 2G2RA 1NGQH 4KZCA 1ZSDB 4MJIE 1QI5A 2YHGA 5I1JL 2FIKB 4G70B 3A67L 3IFPB 2VN7A 4GKSA 4NBXB 1YYML 2NTFB 3ZT7A 2ALWA 1HZLA 1JHKH 3QZPA 4NQTA 1ROWA 4L3AA 2YKKA 1I1AB 3S5LG 1UACL 1SXAA 3E6FA 4IDJL 1EEYB 4JJOA 4Z7WA 3T0XA 1NGYB 4IMKA 5IMMB 4M56A 3LKOB 4DGVH 3PREA 1QW9A 1U3HD 3M6DA 4JQIL 5DVMA 4V2BA 2NNAA 2EILB 5KKHA 3UZVA 3S35H 2X87A 3QORB 1N59B 1T0MA 2B1OA 3DSFH 2OAAA 4XNUH 4JZJA 3FULA 3D39E 3MROB 5DK2B 5D2NE 3U0TB 1GAFL 1ACYL 4O9HH 4OZIE 5AAMC 1MCHA 1JE6A 3MNWB 3ECUA 3OAUH 4N5ED 1OHQA 1T22B 5CJ8A 1INEH 5C0AB 4Y4KC 4BKTC 1NMBH 3LPGA 1YMMB 3FT3A 4UUJA 4ABWA 2HZHA 4KNUA 4R0LB 4MQXD 4FERA 3KWWB 3DPDA 2K6WA 4Y2DA 4A7VA 1LE9A 1Q9KA 1AGEB 4O2EB 2OCCB 4K8RD 5MERA 2ZP8A 4QHKI 1S6NA 3H9SB 5KSVA 1Z1WA 4X6CA 4ZXBB 2QR0B 3RWEA 3OHMB 3SE9H 5KVDE 1VFAA 4PRID 2W59A 1YY9C 5AOLA 2ZWZA 2NR6C 1J8HA 4AC2A 4F8QA 1RIVL 1PEWA 3SKMB 3W0WB 2AZAA 4PUBH 4HPOL 3UYPB 2F95A 1EGJA 1PIGA 4WTZG 1OP9A 4XBGB 1HHKA 1V3KA 1YEIH 3G5ZB 4RA0C 3ZDZB 4NM4H 3KPRA 1GW6A 1IAIH 3L5WA 1DTUA 2L3BA 3BXNA 5GS0H 1C8QA 4XAKE 1KY6A 4HUVB 4HYTB 5D5MB 2HT4D 5GGVH 2BRRL 2JB6A 3KYKL 4GQ9H 2H9GB 5DJCB 5L4IA 3TBTA 2DKMA 3CFJB 4Q2ZB 5JPMB 3BKJL 3O3BA 2W65A 5DFTA 4XOEA 3T4AC 1DLHB 1G6RL 2Q76A 4AJVA 3NN8A 4AGOA 3TT3H 3QNXB 4J3OH 5FYLH 5DMKA 5C0BA 4YXKH 2FR4A 5B8CB 4PBDA 4KX8A 2XPGB 4AVKA 2NQCA 2F61A 5EMYA 1AXSA 3RFZC 1S5IL 3ZU8A 1KENH 1R34A 4QDGA 2A6DA 4UBDC 3FO2B 1WZAA 5E2VH 5F71A 4BM7A 3BKYL 4XPAL 4BIKA 1NCNA 2VDNH 5I66A 1TU2A 1R3HA 5C6PB 2FT6A 3EOAA 2YBRA 3TA3D 3U4EA 3F58L 3OX8B 4L9LA 1RCYA 2OQJA 4CILA 2W80C 3KCPB 4FQQA 4N8UA 4IJ3B 1Y6KR 4RMSA 4KU1A 5J3HC 5DYOB 5C0FB 2I07A 4N8CL 3NRFA 3PUUA 5IG7A 3QBGA 3RVWC 1W0VB 4MS8C 3FUKA 4O00A 5IESH 2BVPB 3MO1B 3EDFA 3L81A 4PGCA 5DC0A 1H5BB 1HQ4A 2ED7A 3FH5A 3T3MF 4MJJA 4AYFB 3RY6A 4DN3H 4XPBL 1AP2A 4BINA 1P84K 3OSVA 5C9JA 1RHFA 1ZVSB 4Z7OB 1WFOA 1DBMH 3H56A 5IB2A 4IDLA 3WTVA 1CLYL 3D85A 4S1SH 2FX9H 2X4OA 1HH9B 1TTFA 4AXWA 3Q8FA 2XJLA 5F7LB 2AJ3B 2P8PA 1XB6A 4G6FD 4ZRGA 4B9PA 3RZEA 2YCXA 5DFWH 2IDTA 3WS6C 3B56A 1E27B 5G2CA 3H2QA 2FYYB 2KPNA 4OQTA 5DS1A 3N9GL 4OJEH 3BKMH 4MAZA 2QLYA 3PGFH 1U8OB 5DJ0B 3JWDH 1FNHA 4GAFB 4M1DL 3FU0A 3VXSA 5DSCB 3HMXL 3MAWA 3EYUH 3ULUD 3V9CA 1RUMH 2W07B 3GIVB 4LARH 4EAEA 2VLLB 2PO6C 3T0AA 3UADA 4OY9A 4GP4B 1KCKA 1QRNB 3MBWB 3CQFA 3BGFB 4AMKL 2DKUA 3NYKA 1VCBC 3DMMD 5D71L 1YUHA 1DQML 3GHBL 3SKUD 4RNRA 2WLZA 1MFMA 5LGYA 25C8H 4BK5A 1FH2A 4GBXA 4KI5C 3QEQD 8FABA 3SPVB 1S2EA 2VB5A 3L2MA 3V4VH 3UP1A 3OHXC 1TQCB 5IQ7H 1JCVA 1NCBL 1SLXA 2X2IA 2NY2B 1N70A 2EJ1A 2DQ6A 1CICC 3BWAA 3DSNA 5CILL 2PPAA 4JFYA 5B3JE 1PQZB 1ODAA 3EYFB 4UILL 1BXVA 2D7QA 4XPHL 4PW3A 5GSVB 3EXJA 3ZTJG 4RAHA 1EZLA 3CZFB 5IBTH 3KD4A 4WSGA 5TQ0H 3D2UB 3CE1A 3C9LA 1FV1B 1CGYA 1DFXA 2A1WH 2WBKA 1UXLA 1NIAA 2A73B 3ASNB 3JWOC 4KKNA 2FDBP 4WWKA 5D70H 2D2CC 4M1DH 1NGZB 1YNLH 4UB0L 4L0ZA 1X5JA 3WV0A 2Q8AL 3IGAB 2UVEA 1NFDA 2XQ0A 3C5JB 5FR3A 5DHMC 3REWA 4ONHB 2NY0B 4FABL 2NT1A 3LIUA 3QG6B 4OCRH 1ASPA 3WDHA 3ALWA 5JHLH 5SWZE 3QP3A 1GGIL 4Y4KD 3CPLA 2JCCF 2X3AA 3QFJE 1JRHL 3QWRD 4NEHB 3W56A 1DDHB 5IQMA 3TFKC 4JL2A 4N0FB 4OM1L 3B8YA 3FN0H 4G5AA 5B0WA 1SLWA 5F7EL 4NJ9L 2IDQA 3BH9B 4PTUA 4F2MB 4J5VA 2ITDB 3MRGA 4X4ME 5LG1A 2QFRA 3CDCA 3PDOB 4YHYB 2B1AL 2WYTA 3ETBF 4JFEE 4JKMA 1U3HA 1SEBA 5FX3A 1X5XA 3G5YA 5D6DA 4BQBA 1XFPA 3B7SA 2ZXBA 3MLZH 2BVUA 4HP5A 3TH4T 1TITA 5ESQB 3AXLA 1YY9D 3BVXA 1CL7H 2NR6D 2A4EA 4OGAC 4XZUB 3BVTA 3RIAF 1OGPA 2PCPA 3K0WA 3X13A 1BVLA 4Q9RH 2WKGA 4LCVA 1NC4D 3GSOA 2E86A 2F5BH 3AABA 5EF1A 3WIAA 4PH8A 3SE4A 5BZZA 3FONA 3ARVA 4DQOL 3LVTA 2JKXA 4AM0Q 3OBAA 3TO4B 1A3LL 1RY7B 3C12A 3MNVA 4P2YA 1FNGA 1UB5B 5ISZB 3VH8A 4FXGC 4XCNA 1HXYB 1MOEA 1UM4L 4G1MB 1A6TB 4OGZA 5EO1A 1ONQB 3ZR6A 2OZ4A 1NA8A 3REVB 1ES0A 1XTMA 4QHLA 5DVOA 5T3XE 2AJUL 3G5XB 4PRIA 3VI3A 1VFUA 4HKBB 4PGEB 2DWEA 2QSQA 3VXME 4R7VA 3PWPB 4HVBA 4HXBL 2Z1KA 4HEPG 2P47B 5IUCA 1M2VA 3BVNA 4MVBC 4OZHF 2VDMH 1RH8A 2YN5A 3P4NB 1KEGH 3L7EB 4KJYB 1OGAE 2MFNA 4HEME 3V0VB 5HYJD 1XBRA 2XTJE 3U2SA 1QKPA 3AUWB 4P04A 4UBDD 3VGGA 4RRPA 3WXWL 4M93C 4H1LA 5TD4A 3PGDB 1L9RA 2DQCL 3WO3B 3UG5A 3FCBA 1IJNA 4LKXA 3DARA 4GQZA 3EMLA 1MFUA 1N0XH 5IBUG 2R0LL 1P7QD 4FQ1H 1NBYA 2CDEA 1TVBA 3VCLB 1H8NA 4UV4H 5ENWA 2AABL 4JMNA 3GHPA 1U93B 4YDVA 4JX0A 3BQUB 2XPYA 3X3BA 2OSWA 4G7YH 5J3HD 4KMLB 4Z7NF 4U2YA 3HG5A 1OAYH 4CVXA 3RVWD 1IO4C 1M7IB 3E2HB 4MS8D 2J21A 4GKZA 2AJSL 3TEWA 3MTXA 1ZPUA 1IAMA 1RZKL 4UCFA 4JGJA 1ZEAL 1IGML 1P2CB 5ALBL 2DI9A 1KPRB 2WD0A 2EICA 3DRTA 4RQQB 3HI6H 4M5SA 5H2NA 3NPZB 3R4DA 1N8ZA 4RWHA 5F1IB 2DEYX 4PD4J 4DETA 4PJXE 3TA3A 4GBRA 2B8OT 5E6ZA 1CYWA 3NYAA 3RDTB 1BFTA 4QRRD 3RWDB 3WXWH 4DP7X 2FBOJ 2M26A 4ESKA 2FJFA 4KWUA 3CFEB 1BJMA 4K7FB 3QXAA 1V7ML 2E27L 3CC5B 4FD0A 4I3RL 4JRWA 4Y1AE 1F1AA 5DT1H 5CZRA 4P2QD 2AFNA 2F1EA 1U8QA 1XSJA 4GAAA 4IBZA 3QQ4B 2RIKA 1MZZA 1WG3A 1E2WA 1HE8A 4XNDA 4YN3A 1QFWI 5AAWA 4FNPA 1O6SB 5C7XH 2IANE 4Y5YB 1WV7T 4ONFL 5BUPA 1GCYA 5B1JA 2PO6D 2C3GA 1BD2B 4HCRH 1ZHKB 1S9VB 1J1PH 1WBYB 3FT0A 4WKZB 5GPRA 1DJWA 2ZJSL 1P7BA 3IN2A 3PRZA 1TJIH 4DHLA 3VD5A 4D8PB 2XN9B 4ONGL 3IFLL 4N2LA 1ZT7B 4LLQB 5ID1B 3QWQB 4KI5D 5F0MB 2Z9TA 4CNIA 3JZ7A 1AXIB 3HB3B 2Y5EA 5KTEH 4GG6F 1T80A 3QDJB 3FMGL 1CICD 2ZKHL 1CD9B 3QUHA 1DL7L 5KANI 4QRQB 3RTQC 1U8IB 4Y16B 4H8PA 1LO5B 1ZT4A 2ZXAA 5I5MA 4EMZA 1B9ZA 1A4KB 1IC7H 5DRXB 2PCYA 3DMMA 1J5CA 4OAWA 4CA4A 2CHXA 4HKZA 4DVRH 1HJCA 1SY6H 2YR3A 3NG5A 3UPCA 2OR9H 4MHHI 1F58L 2VZ3A 4PLJC 3QEQA 1IGJA 2ZKXA 3TCTA 3L6FA 1T5WB 4GIAA 3ME0B 4ALAH 2Y2TA 2IGLA 5D7HA 1T7WA 4KMTL 4MD0B 5IV2A 1QLFB 3KJ4C 1A7PH 2Z8VC 3V52L 1DBJH 4I3SL 2ZCKL 5F7AA 4QHUA 2EVIA 1RL1A 3TFKD 3TBYA 2XJKA 4A7GF 1K8DB 2BZDA 3KEDA 2YMXL 3KAAA 4MFHA 1QFUH 5IJVA 4TNGA 3S36L 4R5TA