3EH5B

Structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined microspectrophotometric and crystallographic examination of chemically reduced and X-ray radiation-reduced forms of cytochrome ba3 oxidase from Thermus thermophilus: structure of the reduced form of the enzyme.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3eh5B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3eh5B02
4KOCA 1XMEB 8PAZA 1N70A 1SHXA 1NDTA 3EH4B 1HAWA 2ZWNA 1PLAA 2NTUA 1VLXA 4HWLA 4QIDA 1YLBB 2CALA 5G53A 1AS7A 1JZEA 1WA0X 5AZDA 2UXTA 2FT8A 4GYBA 4YSUA 2BW5A 2FT6A 3UTYA 5BR5A 1GS8A 2VW6A 3WI9A 1UATA 2H47C 2ZOOA 3FU7B 4WTQA 3X1NA 5AX1A 1X0SA 4GP4B 2GB2A 2I7OA 4N8UA 1BYPA 2Z55A 3WQJA 2BP8B 4L35A 4WKXA 1PY6A 3UACA 2VM4A 1JV7A 5H2LA 3PQRA 2VM3A 3UAEA 1SFDA 2XXFA 5B7FA 5PCYA 2IDFA 1AT9A 1KV7A 2VN3A 4DKLA 5I26A 1F50A 2FWLB 2HPYA 4HHGA 9PCYA 3P0GA 1UCQA 2PPEA 1E0PA 1JV6A 1M0MA 1VJMA 1AZCA 2YQBA 1A3ZA 4HHWA 4BK5C 4DP5X 1S8LA 3D12B 2JAGA 4BUOA 3T6XA 3FQ1A 1OCOB 4DP8X 5G54A 1PLCA 4X32A 3OE8A 3GDCA 4LDOA 1DZEA 1E5ZA 1NIFA 1HAUA 3NJIA 1ILUA 2XUWA 3CVCA 5LWEA 1ASPA 2WO3B 2BP0B 3X1BA 3ZIYA 4DP6X 3UTXA 5AZUA 2XVBA 3TASA 1IBYA 3PAVA 5F7BA 3WIAA 2W88A 3X2QB 2VSKB 3MBWB 2QT6A 5A44A 1S51A 4A67A 4YVUA 1S52A 1IC0A 4G7SB 1JVLA 2QPEB 1NIAA 2PPCA 3ABGA 5C1MA 1AS8A 2FQEA 2PPFA 4M3HA 4MD2A 4Y9HA 1AS6A 4UANA 5I5JA 1AZBA 1XB3A 2AVFA 1XB6A 2YAFA 5DHGA 1E67A 4G7QB 1SFHA 2M3GA 1SF3A 2HRHA 3NSYA 4A2GA 2BP8A 4AKOA 3ABKB 2YAEA 2UX6A 1AG6A 1NZRA 3ZX1A 4A2HA 1FA4A 3PWHA 1V55B 4NC3A 3EH3B 4BVNA 1SDDA 2IH9A 3OE9A 4DP7X 5I28A 4XTLA 1ASQA 5E9NA 2KSYA 2GSMB 1NWPA 5H2IA 4BWBA 2PCYA 4KO7A 3KW8A 5AFAA 1ZDQA 4HAKA 2UX7A 3DTUB 6PCYA 3NJMA 4JKNA 4G71B 3RFMA 1M9WA 3WG7B 3NYKA 2TSBA 1XIOA 2YCYA 5EHFA 1O0AA 1BXAA 3NJLA 3PCYA 2UXGA 4AKPA 3AYMA 3QJUB 4A66A 4E9WA 1IW6A 1FBBA 5H2HA 3N2JA 2FT7A 5B7EA 2PP8A 1SDDB 1PY0A 5ITEA 3FT0A 3WNIA 1RKRA 1U19A 2ZZLA 3NP3A 2TSAA 3PAUA 5B35A 2EILB 4DP2X 2CAKA 1CC3A 3FPXA 4X1HA 4NB7A 5B1BB 4E9QA 4MFHA 4GY4A 1M57B 3HEIB 4K9JA 4YSDA 2IDSA 2GIMA 3HAPA 2Y03A 5JJJA 2BP0A 5B1KA 1S54A 3FU9A 1M0KA 1ZIBA 1NPJA 3ZBMA 1QHJA 3TBCA 1GR7A 1HFUA 3AYNA 1ADWA 1JXDA 1NTDA 5DYSA 4P5SA 1AR1B 1ID2A 2YAMA 2B08A 1OE2A 2XU9A 5JJNA 5EN0A 4X4KA 5PAZA 3IEAA 3NJJA 5F7AA 1QM8A 4QI1A 2IWFA 4ZK8A 1N68A 2IWKA 2YARA 2E86A 4L6RA 1NICA 5G28A 5I6KA 2GC4C 3AG1B 1KMEA 3HASA 1ZPUA 1BQ5A 5G2CA 1NPNA 2XX1A 1NWOA 1CUOA 3ERXA 1JZJA 1R84A 5H2OA 1Q5JA 1J9TA 3OM3B 4UF7C 2X72A 1P8IA 4A4MA 2YXVA 4XT3A 5TGZA 1A65A 3C9LA 3AG4B 3ASNB 1BEXA 3IN0A 4FBZA 1E12A 3OMAB 1W6WA 2XV3A 4PCYA 3V9EA 2DWSA 3T9WA 4DPBX 4UAHA 4F7KA 4HIPA 4YSRA 1C8SA 3IE9A 3FU8A 4JHVA 3ZEVA 1L9PA 3NJFA 1P8UA 1KDIA 3H4HA 4BWWA 4HCFA 1IW9A 4CSPA 2WJKA 2UXFA 2FTAA 5B6ZA 2PPDA 3SBRA 5D4HA 1TN5A 3BVDB 1X9RA 1OE3A 1BRRA 4DP4X 2IWEA 3QJVB 5H2PA 1OOWA 3SBPA 4QRYA 5ANHA 4A68A 1ETJA 4NERA 3COCA 2J57A 1QLEB 4FAAB 2I1XA 3REYA 5I6OA 3GXUB 1T5KA 2LLNA 5BR2A 1BAWA 3CDZA 2GBAA 3TU6A 3NJHA 2UXVA 5G2DA 2ZONA 2DY2A 2OCCB 3SQRA 1NIEA 4XT1A 2GI0A 3UAAA 2XLLA 2AT9A 1JZIA 1GSKA 3PLYA 3FYIB 4GRVA 1OE1A 2J56A 2N0MA 1B3IA 3U25A 3HARA 4DP9X 1EZLA 3ZDWA 4E9SA 5H2JA 2Y1AA 1GS7A 4MQSA 3C75A 3MX0B 3QAPA 3H4FA 4MD1A 2BZ7A 4L0PB 2PPAA 1AAJA 2PCFA 4DP1X 5AX0A 3AM6A 2MRYA 3V2WA 1F56A 1SF5A 4YSOA 5H2MA 4YSQA 1KGYE 3GYRA 2YAOA 2YAHA 3OD3A 2IAAC 5B6YA 3X1FA 2IDUA 4A2EA 1PNDA 1FFTB 1R1CA 4AMIA 1ZDSA 3UGEA 1P8HA 2FQDA 3QDCA 3FPYA 4PXFA 1PNCA 3VGAA 5TK2A 1BXVA 3CODA 2BWIA 1SHWA 2PLTA 3OE6A 1L9RA 4GXFA 1GS6X 1AP9A 1JVOA 2IDQA 1W8EA 2NTWA 1J9QA 5B0WA 5I6PA 5AWZA 3SN6R 4UG2A 1MG3C 1S53A 5I6MA 2EI4A 3QJRB 2R7EB 3PAZA 1X0K1 4HZ1A 4PAZA 4CSZA 1PLBA 5IY5B 4MBSA 3SBQA 3KJ6A 4G70B 1MGYA 1HZXA 3T6WA 1GUEA 2QDWA 2RACA 4WAVA 3AW5A 3ABWA 4N4YB 3NJGA 2I35A 1J5DA 4MQTA 3HB3B 3T6ZA 1L9QA 1BQKA 5B6VA 5B6XA 3UTWA 4A2FA 2LNLA 2YCZA 3ABMB 2BWDA 3FSWA 3X1EA 1SNRA 1BM1A 2Y69B 4F2EA 3JTBA 2R4SA 1GYCA 3AY2A 1C3WA 4AKQA 1IBZA 1URIA 2FQGA 2HX7A 2VMJA 1KCWA 3OMNB 4YVNA 3AG2B 1NIDA 1WA2X 1OCRB 5G2AA 1XJIA 4E9TA 2EIMB 1JXFA 4JR8A 2I7SA 5A45A 2AANA 2Y02A 2XV0A 3X1GA 4YSTA 1CWQA 1JERA 3S8GB 2B3IA 2OJ1A 1AZNA 1OF0A 1F88A 1H2SA 1WAEA 3UTVA 3CG8A 3H56A 2H3XC 3FQ2A 2PP9A 2W8CA 1NIBA 5DHHA 2FJSA 2L6XA 4LDLA 4X31A 4DPAX 3MBVA 1L9TA 2WSDA 3NSDA 5FC9A 3T6VA 2XWZA 1H68A 6PAZA 3QJSB 2JXMA 1F4ZA 2FNWA 3FSZA 1L9HA 3NSBA 2GHZA 2R4RA 4UHRA 1Q5IA 1V54B 1DYZA 1TEFA 3TBBA 1OV8A 1GU8A 1E5YA 4JHUA 1L9SA 2EINB 2YAPA 4DJHA 1IKOP 2QPDB 2EIKB 4HCGA 3EMLA 1J9SA 2VW4A 3WKQA 2HXAA 5I5MA 4AI7A 3NS0A 5TK4A 1AZUA 1MG2C 5I6LA 3EF4A 2CUAA 1I53A 4HALA 1L9OA 2IH8A 4AZUA 1JGJA 4N4WA 5D4JA 4GPOA 4A2DA 3PPSA 3NJKA 5H2KA 2R7EA 4KO9A 2Q9OA 1JFPA 4BEZA 3TA4D 2DWTA 3UABA 4GYCA 1JZGA 2I21A 3NYAA 1A4BA 2JFCA 1X9UA 3UZAA 1WS7A 2DYSB 2WO2B 1KDJA 2XV2A 3IN2A 4YSAA 1V10A 5B34A 2PEDA 4BXSV 2F93A 2YCXA 1A8ZA 4BWTA 2XX0A 2MTAA 4YSEA 4YSCA 5ITCA 3DDLA 2AZAA 5F8UA 1KBVA 4AX3A 1AIZA 4G72B 1MDAA 4W9ZA 1R2NA 3DQBA 2HRGA 5B1AB 4LDEA 2XXGA 5B1JA 2KSAA 3OMIB 1J5CA 3WNJA 1RCYA 4YSPA 1GZMA 3D4SA 1KGBA 4XTNA 2Y04A 2EIJB 2Z73A 1PZAA 2I20A 1AANA 1TU2A 1AG0A 2P80A 2VSMB 2Q5BA 1KCBA 3FQYA 1MZZA 4BXVA 4OV0A 1ZV2A 1PAZA 4P5RA 3RYMA 5B3SB 2YDOA 1KG9A 1J9RA 2HLEB 2ZFEA 3VVKA 3WKPA 3QBLA 2A3TA 3OQRA 3QPKA 3DIVA 4DP0X 4E9YA 1IUZA 4KNFA 3CDZB 5LDUA 3RZEA 3PXOA 3UG9A 1BQRA 3FS9A 4F2FA 2KSBA 1AQ8A 3UONA 3ODUA 1ASOA 1WA1X 2GC7C 1GY2A 1OCCB 2J5WA 3NY9A 2BHFA 5AHZA 4M4RB 1EHKB 5B6WA 3HANA 2Y00A 4EJ4A 1XB8A 3A7KA 1A4CA 4GBRA 1QHQA 1BYOA 4KO6A 1FWXA 3UZCA 3ZPQA 4DAJA 4HCIA 4KNUA 4JQ6A 4EF3A 5A7EA 3CVDA 3PXLA 2AFNA 4AMJA 3EHBB 3EH5B 2Y01A 5AKRA 5B1JC 1ILSA 1BXUA 3NSFA 4QLWA 5A8EA 1ET5A 1TEGA 1IXFA 3PBLA 4TL3A 2DYRB 2J55A 4W1TA 5H2NA 4DPCX 4BDVB 1PF3A 2ZXWB 4XTOA 3S3DB 3ZPRA 1QKOA 4EIYA 2BZCA 4YSSA 2YAQA 3V2YA 3HAQA 2JAFA 3QJQB 2ZIYA 3QJTB 4GP8B 4RH4A 3FU7A 2YDVA 4XXJA 3X3BA 2AZUA 2YCWA 3PDSA 2J4YA 4KLYA 4WW3A 3AG3B 2IDTA 2PP7A 1SJMA 3NT0A 1LN6A 3HAOA 1KBWA 4G7RB 2P80D 1GW0A 2NRDA 1VGOA 1M56B 3FSVA 1PZCA 1CYXA 4E9VA 4Q8BA 4FPDA 1TKWA 3VHZA 1E65A 3S3CB 2F95A 3NJNA 3FSAA 4YL4A 1JZFA 5G36A 3ASOB 4GP5B 1L0MA 2H5UA 2X88A 1BRDA 1BRXA 4JKVA 3V9CA 3UADA 4BWUA 1GY1A 2G87A 4K5YA 4TXVB 5JJEA 4EA3A 3QQXA 2HX8A 2X87A 3OE0A 4IB4A 1C8RA 5FJGA 4FA7B 3S3BB 3IBOA 5B7MA 4HYJA 3QBIA 4BV0A 3ABLB 3QBKA 4PXKA 1MZYA 2YXWA 3CVBA 1FBKA 2HX9A 2XYBA 5ETZA 3VI0A 2VT4A 1WS8A 5D4IA 2BRDA 3AZUA 1AACA 1PMYA 1OCZB 3NSCA 2VW7A 3QAKA 1TN0A 4Q89A 3S8FB 2CCWA 1PXRA 2CBPA 1CYWA 1RZQA 5I6NA 2DV6A 4BEYA 4HYXA 3JT2A 1E30A 1CURA 2FQFA 4N6HA 4QKTA 5AHYA 2QDVA 3L45A 1JXGA 1NINA 1UAZA 3C9MA 1ZIAA 4E9RA 2KS9A 1RZPA 2CJ3A 3X3CA 7PCYA 4KNSA 3BQVA 2RH1A 2HZHA 4IARA 3DKHA 1S8JA 4KO5A 4IAQA 4J4QA 2BO0A 4BDVA 2JKWA 1X0I1 1AOZA 1PXSA 3KW7A 4ENZA 3VG9A 4NAJA 3T71A 1AZRA 1KG8A 1DZ0A 5B2NA 1QKPA 1W6LA 3G5WA 2I85A 2WJLA 1JOIA 7PAZA 3QBGA 1PZBA 3VW7A 3CAPA 1JZHA 5KKHA 3NP4A 1ET8A 3N55A 3T45A 1KYAA 4E9XA 1ET7A 2BW4A 1M0LA 3CZUB 4KOBA 1QNIA 2OV0A 5J7AA 5I5IA 3FYEB 4KNTA 1A4AA 3OAXA 3NY8A 1PCSA
chains in the Genus database with same CATH superfamily
1XMEB 5C6WH 1O9VA 5J6HB 2CO2A 1WTLA 4YLBA 3SDXF 1QBLL 4UT9H 1DEEB 5KVGE 4K5NA 1Z5LB 2JJWA 4PHXA 2DBJA 4LHUG 4E36A 3TBTA 5C0JB 2A9BA 2QZQA 4GYBA 3DGGB 1E3XA 4MA8H 3WI9A 4KK8C 3B1TA 4J3TA 1DJZA 1R46A 2A6JB 5GGQH 1MJUL 4M5ZL 1MFDH 3Q6FB 4QRUA 3UEZA 2IV9A 1AHWB 1IC5H 4LQFL 3C60B 3OR6B 4HKBA 1UD4A 5LXVA 2WJ7A 5CJOH 2N7AA 5LAXB 1SFDA 1AXSA 4QHLA 3QCTH 1KV7A 1OSZA 5TGBA 4H2AA 4XPAH 1FCCA 4LK4A 1RHHB 4PRPA 3K4AA 5I8CA 1RUKL 1K4CA 1UCQA 1PBYA 1E0PA 2D7OA 4HHWA 4LAQL 3WOVA 3WIHH 4UQ3B 4O51A 3GXTA 4FQCH 1OCOB 4J4PC 5AW6B 4JFEE 2PETA 2HFGL 4X7CC 3PY9A 4PJ9C 4MB4A 1ILUA 4GXUN 4Q6IA 4IGBB 5KVEH 1C1EH 3BKMH 3FZUC 2DI9A 3ZIYA 4JZJC 1HQ4B 3QDGE 5JPMA 2A9DA 5AWNH 2CPUA 3X2QB 5KEZA 3OL2A 4TVPL 4Y9BA 1JWMB 4EN3B 5HYJB 1A7OL 1PAMA 3K46A 3ULUH 3L3IB 1R34A 2PPFA 1QLEL 4OKVA 3V0JA 3BPLC 3HE6D 1AS6A 3AXIA 3KCPB 3ZKND 1ZV5A 2DQFB 4ZAKD 1LO0L 1QTSA 2VMEA 2ICWJ 1NFDE 2YAFA 1P5UC 5HJGA 2PW1B 2GAZA 1O7DE 5JZ7D 2G60L 5JXEC 1I7RB 2X4NB 3CHQA 3X11B 1X7QA 3BN9D 4APQD 1XSOA 3ZYZA 2F6AA 3OX8A 1E2WA 5I74B 4UTBH 2OSWA 3H54A 1ASQA 4PBDA 5IJVA 2PCYA 4N8VB 2DQUH 4MYPA 4P5TA 2UX7A 1BYNA 2VLJD 4OJYA 4XMKL 1RP9A 5EU4B 5C0DA 1XIOA 4LOUD 5FYLL 4QKXB 3C12A 4I9WD 4RDQF 1T7XA 4XOEA 5C08D 3IJ9A 2IMMA 5KSBB 3D09A 3HI5L 3WKYA 2FGZA 3U4AA 2DQTH 3BAXA 4KV5E 2Y25A 4XN7A 4HETA 1RZJC 1HDMA 5DR5L 3VU1A 5C0BD 4D0BB 3T0EE 1CBVL 2P9RA 1OGPA 2TSAA 3O2DA 4JM2A 4AL8C 2EDJA 5HHXL 3C87A 1RUKH 4KXAA 4X6BA 4OT1L 4QHNA 3TNMB 2AEWA 1GPOL 4X1HA 2G5UA 1TZ8A 4PP1C 5TFSL 3TLRA 2W1NA 3T4AA 4X80L 3OHXC 5IUCA 1DBML 2NY5L 1KSRA 2XVKA 1SUJA 4PMFA 2WCPA 5CLXA 5CUSL 2YEQA 3HJEA 1NTDA 2FO4A 3EOAB 1BVLA 4TUUA 4NZ8A 1F02I 4F5CA 4GBXB 1GIGH 5CHNA 2ICWA 3NJJA 3P1VA 5DJYB 2E7LA 2FSEA 3T8XB 3BP4B 4JRXD 5CBEB 4LPCA 2VRAA 4FKEA 5G28A 4Z7UF 3AG1B 4P49A 5HTSA 4U1SB 1ZPUA 2P42B 1BQ5A 4G3YL 3TN0C 3ZTJH 3MKGA 1QFWM 2BVOB 1U91A 4NZDA 1V7MH 1UQSA 2V9TA 2YXVA 5TGZA 2P5EA 2Y2YA 3IFOB 3IN0A 1KV3A 1FH5L 4U1MB 1HHGB 2D3NA 4JJ5A 3VD3A 4ZMTA 3GKWH 3I6GB 2I9TA 1QLFA 3EFDH 1DQML 3C2AL 3L95B 1FAKT 1QA9A 5BRQA 1MHPH 2ORBH 3DV6A 3RY5A 3N85H 1Q0XL 3NCCB 3R19A 4MNGB 4IRJB 1BRRA 1D7DA 5IQLA 2N59A 2R1YB 5AD0A 1X6LA 1TJHH 2WWMD 2ZIDA 4Y9GA 3MGOA 3GDBA 4A68A 4BUQA 1HNGA 2E9JA 4MBOA 5KJRH 1T20A 3LJ3A 3SYPA 2B2XL 4TNWK 1GSMA 4LLUB 5F97E 3CDZA 2X2UA 4BZ2L 1L6XA 4YXKH 3A6CL 1NFDB 3EUUA 5TPWH 4IKKA 2WK2A 1NEPA 5C0IB 2MCG1 1ED3B 3MLRH 5IHZB 4XVUC 3QRGH 1DBKH 1EDQA 4POYA 2ODHA 3Q43A 1JRHH 1JZ2A 5C97A 3ZKNC 3T2NH 1JYWA 1BJ8A 5H2JA 2QHLA 3CBKB 4PWGA 1N18A 2CA3A 4AQ1A 4ATWA 3EIFA 2A9CA 3BKYH 1HI6B 2R27A 3PV6B 4OZ4B 4NN7B 5DF0A 1IV8A 5C0AA 4KNQA 4OZGB 3MLVL 3V0WL 1TSHA 1DSFH 5HYSA 2OMNA 4FXTA 7FABL 5LGJB 2ZUQC 3F58L 4MA7L 1RUAL 1F13A 4AMIA 1WZ1H 5CJBA 4AQ8A 5KVEE 4GUOA 2DQDL 1TZGH 3AWGA 1BXVA 4KI5E 2EIZB 3TFKC 4YOKA 2GITB 4H0HB 3S36X 1JVOA 1D5BB 1S7UA 4MYWB 3EH2A 3QW9A 5CP7A 5DXWA 1SOXA 5IQ7L 3QG6B 1BX2A 4I4WA 3VMPA 4UM8B 5IY5B 2K8MA 4MBSA 5G55A 5FO8B 5LBSH 4AG4L 2AERT 5KUKA 5A6MA 2XFGB 4M48H 3AU1B 3P2BA 4PG2A 5E0FA 1RURH 2HKFL 2CIIB 2VL4A 4MMXA 3QUZA 4Q74A 4N5UA 4WO4B 3DSNB 5IMLA 4R2GD 1T4KA 1UWXH 4CNIB 3QQNA 1U3HC 3KWWB 3N40P 1RK0A 2BJMH 3VFRA 5F0JB 3OMNB 3TCLB 3ARGA 1PX3A 3UZVA 2XG4A 3MUGB 4DERA 4PJXB 5L7XH 4P07A 4P59H 2XV0A 4WI4A 4XC3H 1JERA 5MENB 4AT6A 5BS0E 1WAEA 2F54B 4X6BB 3TNMA 4H1LH 4RGMB 2L6XA 1CDBA 1A3LH 2X05A 2H2SD 2Y06H 1J86A 2IADA 3T6VA 4WO4C 4NRYA 6PAZA 1CYGA 5FGCB 1KEGH 1PG7W 1PZ2A 4UQDA 1RLBA 1Q5IA 3PGDA 4OIIH 1TEFA 2GY7B 1MFCH 2XYCA 4KKZA 2LOEA 2H1PH 1WJ3A 1Y6MR 2ZXCA 5CP3A 2JJSA 2ATKB 5F0LB 4B95C 3OAZK 3I50L 4HUXA 4L9LC 4EN3D 3SE4C 4LPTA 5TDOA 3L6FA 2HN7A 3WEAA 3N04A 4Y5VA 1JK9A 2ITCA 1JK8B 2IH3A 1LNUB 4ZAKB 2VN7A 3HIZA 3D2UA 1A7QH 5CSGA 3NIFB 3HZMB 2AXGA 1XR8B 2Y7QB 4DOHB 3IJYA 2AZAA 3W82A 1FO0A 4V1DE 2ADGB 3RU8L 6CGTA 4XVTH 3Q9QA 3N1QC 5E8EB 3OF6A 1CI3M 4DFIA 1E6OL 1OK8A 4HS6B 4MZRA 3Q8AA 3CUPA 1J8HA 3KS0H 3VI4B 1J5CA 3V4UL 2XDHA 4NZUL 3ZYJA 5FKPA 2PCXA 4HEMA 3ZL4H 3TC9A 2R2CA 4X6DB 3EYUH 3FQYA 4XWGH 5E8NB 4P5RA 1ZV2A 4PLKD 2VJ0A 4CKVX 1TJMA 2BHUA 5F44A 2PO6D 5JIDA 3NRPA 2VXSL 5K9QI 3V0AC 3T3MF 1RSYA 5DD5H 3CHOA 1FLRL 1FJ1A 2UZIH 1ASOA 2ZOUA 3LZPA 4KJYA 5D1QE 1C8QA 2Q6WB 3WY1A 5GS1C 2AK1H 4QF1A 4CKQA 4M4RB 3A6BH 1FFPA 1YAIA 4M7LT 5IW6A 4LSUH 3HJ0A 4J28A 5DHYB 4N8CH 5BUGA 4MZ2A 1QWHA 4IHOB 1YECL 4LSRH 2BSTA 4A1RA 1H3TA 3SDAC 2VDPB 4EDWH 4Z7OF 2DIAA 1TTCA 2FJHB 5L2KA 1KCVH 3B9KB 5DURD 5I8KL 4MNHB 3GLAA 5FAAA 4EQ3A 2J55A 5J6SA 4PJEE 5AW2B 4F7TA 3RZWA 1Z5LA 4JCLA 4OV5A 1MW1A 4G9DA 4DN4H 3QCVH 1TZOA 2GUYA 4OZGF 5EOCJ 3FRUA 5FA4B 2C3XA 4DZBA 3OBAA 3RDTC 5LG1A 2BFVH 1S9XA 2X4UA 3G5YB 4LKCA 2BS9A 4Z95H 3ULUC 1WPCA 1U8JB 2V5YA 3QIWC 2EDFA 2YPLA 2NUTA 4ZW6A 4N0FB 1AQDA 2O26U 3FULA 2BOCB 1A7PH 2X10A 5ITFB 3U0PA 5HSFA 2YD5A 1LE9A 1PZSA 4E9VA 4QRBA 3GT6A 2YIHA 4ODBD 4ADIA 2F95A 2YWYA 5E2VL 1E4KC 2KS0A 3LEXB 4YL4A 3RWFA 2DTSA 2E8ZA 2VLKD 4LHJB 3KJ6L 1TSRA 3NFPA 2HX8A 1P7BA 43C9A 1J0HA 2C1PA 1XH3A 4NP4L 3I9GL 4NM8H 4PMEA 2ARWA 3TNNA 4BV0A 1I1YB 3JYBA 1CXIA 2W65B 3QK0A 5DK0A 4LSDA 1OT2A 1N59B 2G2NA 2N3JA 3WE6B 2VQ4A 4TSAH 3KCWA 2H0PA 2Y5QA 3JTTB 2IANA 3L9EA 3UFIA 2HFEB 3VXRD 2ZG2A 3V8CA 3O0RH 4MNQB 2VDQB 1MJ8L 4J3OD 2BPBA 1S5HB 4N2MA 4MXWL 1IQDA 5EMYA 3UYRL 4EMZA 4L8DB 2XWJB 4YDNA 4JZJA 4L3EE 5DS8A 3D4ZA 3ZYOA 4FFYL 3BQVA 1QFUH 2JB5H 2WWOA 3QPXL 4HS3A 4YDMA 3H9SA 5HPMA 1CLOH 1TNMA 3CX5K 2VR6A 1OM9A 2C3HA 4GRMB 3RPIB 4Y5XC 3BSZL 1JPGB 2HKHH 3KHQA 3KR3H 4N2LA 3L3KB 4OVUA 4U6YB 2ATPB 5ESQA 4JM2F 4HJGB 2JIXA 1CGSH 1U30A 3DX9B 1DQTA 2ATKA 2X89A 5EORL 5B3JE 4TVPH 4WV1C 5TDOB 5B38A 4PJGA 2CA4A 3EH4B 3PL6C 4U31A 1NGQL 1PLAA 4P23B 1VLXA 4QYOA 4HWLA 5D7KD 1S7VB 5G53A 2IH1B 1MUJB 2YPLD 3N41B 2HFGH 4NC0B 5GRUL 3STZB 3U36B 3WAJA 3IXTB 3GNMH 1KJMA 3RG1C 3GTTA 4FQCL 4BFOA 2H47C 2ZYIA 1SYVA 5FCSH 1RVFL 3FU7B 4WTQA 4YHPB 3TZVB 4EQ2A 4GP4B 3HB3D 4XN2A 5D7IE 1JP5A 3F7YA 2BRQA 2BIOA 2FK9A 3T0VA 1S3KL 1PY6A 3GHPA 3QIUA 2BIPA 5TF0A 3CUPB 4OCWH 5DVKA 5T5FH 3WGVB 4FQXA 3PWPA 4OUUA 4P4KC 5HDRA 2YKKA 2VN3A 3LHPH 4M7ZB 4MJ6A 4KUZL 1T80A 1T1XB 4XCFH 5CZVL 2FWLB 2VDRB 1VJMA 1M0MA 2BCKA 3RURA 5CEZE 5KJRL 3UTTB 5C86A 3T6XA 1S7XB 1JGUL 4UNIA 4XXDB 2F7PA 4NCDA 2BVQA 4KROD 2UZXB 1NIFA 1X5GA 3WNNA 4OI8A 2XUWA 1S7TB 2WQAA 1HOEA 3FT3B 3NG5A 3TBYB 3OTTA 1AR2A 4HWUA 5J3HD 2IWGA 1UM4H 3PAVA 3IMWA 1X5IA 3BPOB 4I7ZC 5IW6B 3IAPA 1DQMH 2D2CC 5C0AD 1TFHA 2F2HA 4DGYL 4JKPL 1S9YB 3GKWL 5HJBA 1Y0LB 4BRVA 3CN4A 3DHUA 5EU3A 3DGCR 4MD2A 2FYVA 2DQJL 1YEIL 4WWKD 1AGBA 1RZ7L 1IQWH 2R29L 2PYEE 4Z7AA 3SQBA 3BDXA 4KUCD 4Y9EA 2ROXA 1INQB 1TTAA 3QS3A 2UX6A 3HR5B 4D9RE 4L3AA 5HHQB 4Z7VB 2FEEI 1ONQB 1G4RA 4GAGH 3DX8B 3BDYH 1XXFC 4IK7A 5KANI 1F0LA 1WZMA 1D6VL 3RFMA 1M9WA 2PXYB 4N8VG 4N6RA 4R7XA 5EOCH 4UQAA 4PRPD 1YEJL 1T1ZA 4JPSA 1MVYA 5D1QC 3IDIA 4GS7B 5HDQL 2B1HH 2H0JA 1OD9A 3J27A 4QLRA 5E94A 3MBEB 3UTPD 1RKRA 2ZZLA 4HIIB 4BKLB 4DVBB 5I76B 2VDKB 1B90A 1WFOA 4Q9BA 2F53D 2YLKA 3NH7H 4YXLL 1SJEA 1WEJH 2IALA 2FE0A 1I1YA 2WUBH 3EYOB 4UV7H 5D2NA 3LD8B 5B1BB 1GHFL 2IPKB 1ORQA 4RGNB 3A4EA 4ILDA 3GMOA 3DJTA 2V9QA 1U8CB 3IDYB 1S54A 4OM0L 4GG6E 3SN6N 3S3SA 1NPJA 1JMZA 1U0QA 4M1CC 5DK3A 1I8MA 2COQA 5IW3A 1U92A 1IARB 1ADWA 2FYYA 5DYSA 3GLDA 4OLWL 3VFMA 25C8H 5ENWA 3BZEB 5MEOB 5L88H 5ICZB 3LKSB 3CFCH 1YDPB 3BKCH 1CGSL 1I7ZB 5DC4B 1X4XA 2DQUL 2FEDD 5DFTA 1VAHA 2UYLA 2E86A 3NFSH 2YLHA 3MV8A 5EA0H 4JVPA 4P5MA 3OGCA 5C0IA 1JYNA 2P24B 4WI3A 1CLOL 1CFBA 1FNGB 4C4KO 3SOBH 2FEEL 3ERXA 3F62A 5BO1L 4J4PD 4B9IA 5D7JA 1P8IA 4WUUD 5C7XH 4YMPA 5B39A 1OAYL 3ZE1E 5TE6L 4JY6B 3V9EA 4HJGA 2WO4A 1RK0B 3R0NA 5CBEA 2KT6A 4MXWH 4YSRA 1C8SA 2F5AL 2XRAL 2NNAB 3GSNH 3B9DA 4AGLA 4OJDH 1YYMH 1BOGB 2ADIB 5AWNL 3FU5A 4OJFH 1IU1A 1IM3D 3GRWL 3U7YH 5K9KB 1A0QL 1J0ZA 5D4HA 1GZQA 1DJGA 1TN5A 4GUPB 4Z7NB 5IEHA 3LZNA 1DQLH 3BQUB 4C4UA 2E7HA 4PGEB 4GG6F 4U1MA 1FGVH 3GO1L 3W39B 2VXVH 5FO7B 1L5GA 1U6AH 2ZKHH 5I0YA 3K6SA 5KVFH 1CFMA 3L3HA 2G2RA 3I9GH 2WXKA 1UA6H 2HAZA 5FW6A 4P2CG 2DQIH 5A16A 1ZVSA 3TU6A 5DWPA 4YZWA 2AGJH 5C9JB 4R7VA 2BVTA 3QDJE 4XT1A 3K8MA 3MRJB 4HBQA 3FT2B 3L5HA 1AE6H 2NY6D 2PWHA 5KVFL 3Q1SL 3EKCA 5D2LF 2YD7A 1JV2B 3APMA 2JKTM 3FBQA 4MA8L 2Q8BH 4UTAL 2CBTA 4YBHA 4YSOA 4U49A 4YO0B 2YAOA 5DVLA 2AV1A 4FTVD 5DLLA 5J06A 1R1CA 1ZANL 4L4VA 4ORZC 3WAKA 4C8XA 1OM3H 1QSZA 1VGEL 4DKFH 5KBKA 4G1EB 2A4ZA 3MNDA 5D5MA 1FF5A 4RGOL 4I85A 3HPLB 4BELD 5F9OH 3BRDA 1CVSC 3PJNA 2Z31C 4NQTA 4S10A 3UL4A 4H0GA 2IDQA 1Y0LA 4K7PX 3IFNH 1OAYH 4L9LA 5B0WA 4HFWA 1MCRA 3JVFC 3WJJA 5SV4A 2CO4A 1Q1PA 4P2QD 3QJRB 4N5EC 4CSZA 2NSQA 2YC1A 5JPNA 1FQ9C 3PWPD 4IDJL 5GS0H 4YX2H 1CTMA 1GUEA 4UU9B 3AW5A 4J6RL 4ZUSB 4Z3GA 4NZFA 5KG9A 4TUKL 4R7NA 2WLJA 1IEAA 1W0WA 3T6ZA 2ODIA 2XJLA 3D48R 1BD2B 5DD5L 4KKRA 3HMXH 4H25B 3QNXA 4P23D 4HWEL 3TV3H 3CXDL 1E4XH 3KPRB 3MA7B 1AOHA 1TQTA 3ARXA 4LSTH 2Q7YB 5DRWA 2XN9D 4O2EB 4PQXA 2NY0C 3N50A 2HX7A 2IEPA 5AVRB 5ICYA 4XE5B 4G8EB 1F6LL 1SN5A 3IFPB 4AJYV 1IFGA 2W9EL 3HFFA 1PZDA 4Q6KA 2DLEA 4GNKB 3N3EA 1DBJH 4P9ML 4CDHA 4YSTA 3WLWD 5A7BA 3IWVA 2BERA 3S4SG 3SDCB 1WLHA 2EH7L 3VW3L 5F71A 4Z77A 4ZMVA 3HC0B 4DPAX 4WTXA 3Q01A 5E4EB 2OSXA 3M6DA 3O3BB 4M7LL 4HPHA 1XGPA 1CF1A 3D85B 2R0WL 3J07A 1S2EA 2F19H 4GMTL 2ENJA 1U92B 1V54B 1MH5A 5H2BA 3GUFA 4TMPA 3VI4F 2J8UF 2VO5A 5FGBC 3SKOB 3VGAB 1E3FA 5DFWH 1KGUA 2Y24A 3QFJB 4XMPL 1KIPB 3AT8A 1J9SA 5LCVA 3CPLB 4YHKL 2GI7A 5FYKD 3Q13A 4YFLF 1OAQH 5I6LA 4OGQC 4X5XA 2DIEA 1HILA 5BZWA 1SXBA 1IGFL 3PDGA 4PRHD 5AVYB 3I85A 5CWSB 4BQ9A 4F37F 1IKNA 1WS7A 1YUHB 2Z64C 5BRZD 2ALAA 1HH9A 4QRAA 5LB1A 1MREL 1SXSA 4QCIB 5L6YH 5CZKA 4Y19A 1KYFA 4ZMQA 1U9KA 5FOBA 5FHAL 3OZ9H 1DUZA 4R90H 4TNVK 3VJ6A 3QULA 2AXFA 5CHNB 1GGTA 2FH6A 2H45A 1BQLL 1H6FA 1MDAA 3PHSA 2R2HB 1C08B 1XCWA 4JFFB 4EUPH 5AB2A 3IFLL 1PG7X 3DTXA 3D0AA 3CVHA 1LNUA 2WVUA 3BZFB 4PM1A 1GZMA 4ZAKA 4FXGC 3MLSH 4DAGL 3OWEA 4YVUA 4L3ED 3LH8A 1UD2A 1L6ZA 3WNLA 1UM5H 3SCMC 2DEYX 2OMTA 4IU2A 2H9GB 2YD8A 3HZVA 2HVBA 5GISL 5GS0D 3UG9A 1XD0A 1LO3H 2P44B 4FQIH 4N3UA 3BLKA 2ARJA 3BVXA 5KW9H 2E4TA 5CAYB 1XB8A 5ERWB 2C9QA 3D51A 2ZICA 1RULH 3P4OB 4R2GC 1OHQA 3SY0A 3GFUA 2VIRB 2J43A 3QRLA 1UCTA 1KN2L 4JQIA 4NJ9L 1J8KA 4JO4H 4HWZA 2X1OA 3E2HC 3GHBL 3PG2A 1VESA 3UAJC 3QZLA 1KCUL 1GRWA 5E2WH 2APVA 2XA8L 4F24A 3WHXA 5ACLA 4NI3A 4F58H 5C2UB 5IESH 1V3MA 1P7HL 1NMCC 3V2YA 1I9IL 1L0QA 2WOYA 3ECBA 2X28A 2B59A 4G80A 4PD4K 3FU7A 3T0EC 2CIKB 3TZVA 2YDVA 1DANT 1EEUA 4MA1C 2VCOA 3FDWA 3C60A 3OR6A 1W80A 1DO5A 1EHNA 3IJ7A 1FFNA 3AG3B 3BWUC 1XGUB 3K7UA 2K78A 5E4AA 3UZQB 3T2NL 3VXOA 4S1SL 3VVWA 1MFBL 4TNEA 1HK6A 4M6ML 3H2QA 5ABZA 1WFNA 4GP5B 1L0MA 4R7NB 3TTSA 2WBJA 3D18A 3D25B 2B8OT 3GSRB 4PJCA 3AQYA 3L3KA 4IJ3C 5JHMA 1SLXA 2H6PB 4G9FE 3PWPE 4K8RL 2X4RB 2NX5A 1D2OA 3ILEA 1J12A 5IG7B 2PR9A 2YK1L 3QWRA 4P57A 4PLOB 4HIEB 2X4PB 4YHML 2D3VA 2HX9A 4GPVA 3ARVA 5I1GL 3CU7A 1OCZB 2D0HA 1S5IH 5TE7L 3IFPA 3S8FB 1A7BA 3ZSTA 1N2RB 3P0GB 2C34A 1MQKH 1X5XA 2DV6A 4K5LA 2A9NL 4ADGA 1F90L 2I5YL 3RU8H 4FZEH 3TNNB 1NDGA 1P4IH 3BWZA 3MXWH 3QHFL 5DC9B 2Y0SA 2FO4B 4PR5A 4IJ3B 1X5AA 2K9FB 1T0NA 4YHZH 3FCGA 2A4CA 2WN2A 3ZZLA 3QAQA 5KVMC 2CJ3A 4FLHA 2WBWB 4QRTB 2HZHA 1I9IH 4XP5L 4KO5A 5T5NG 3NZSA 4Z7WA 2PTVA 3EZJB 2AQ3A 3QZWA 4NQDD 4YR6A 1MCHA 2JKLA 5JDJA 3DVNB 5DJCA 3S3PA 2GBTA 3ELQA 1Q94B 3US1A 1JZHA 3MMEA 4JAMB 1QPPA 3IXAB 4LB8A 1VERA 4FNTA 4NPJA 1AKPA 2UZXA 2IPTH 4JFDA 4ZTEA 4RX4D 4PV9B 3NY8A 4NXSA 1W72H 4HWBA 4GMSL 1ID5I 1G43A 1TJIL 1YZZA 2IADB 1HAWA 1PD1A 1M1XB 3IF1B 4DEPC 1FVEB 5F8RC 1S7WA 2FT6A 3INOA 5TFSH 3RVWC 4OGZA 4HBCL 4X8GA 2N7BA 3V0HA 2XT1B 1MF2L 3L1GA 2C9UA 3TO4D 1X0SA 4LNRB 1QUNB 4PJDE 5AKVA 3WFDL 2BP3A 2WTRA 1CZ8L 3BIKA 2BSSB 1NGWB 1G1CA 5BRZA 1P0SE 2RR3A 2AXWA 5B4MC 3FJTA 2EVGA 3LRMA 1BV8A 1CR9L 2VM3A 1KELL 1HOCA 4ODWB 1N7MH 5FCUL 4HGWA 1AT9A 3NK3A 1XBDA 4ZTOL 2Z1KA 4E42B 4KROB 2YQBA 1MCNA 2V5MA 4X4ME 5FGBA 3C9NB 5EDSA 3U6XS 1NANH 4JHBA 4KI5C 3FQ1A 1JZDC 3ZLQC 4MQXC 2EXYD 2X12A 4P48A 4FXLA 3S36H 1NDMB 1U8PA 2G75A 2X70B 3QUYD 4MJID 1BBJA 2GQHA 1J5OL 1CVRA 3SE9H 5HDLA 1K4DA 5A44A 5BXFB 4BYHA 3UTOA 5DJ8A 4C83B 2RTTA 2GEQA 1S52A 1JVLA 5FUCC 2C8NA 3UMNA 4MKTA 4R3SA 2EIZA 4BKTC 5I5JA 2O5XH 3GUTA 3VGFA 1MCSA 4M6AA 3DX6B 4IW4C 2C4XA 3ALXA 2M3GA 4LFHD 3ABKB 5T1KB 4B41A 3D0VA 1XBRA 3NPSB 4XNQB 1PVHA 1FA4A 1YPZF 2NW2B 5AB1A 5KYUB 4BVNA 3ZT6A 1K6QH 3EJJX 5EF0A 2GSMB 3MJGX 5TGBB 4F27A 5BNXD 3V79C 3KW8A 4QNPE 4HAKA 2WKLA 1IT9H 4G71B 4NI6A 1YEWA 3GLEA 4Y7MA 3NCYS 3NYKA 4AITA 1OCWH 4FERA 1OAKL 2WP3O 3PCYA 4I2XB 5E6IB 5IR1A 4FF9A 3KBEA 3QDMD 3US9A 2ZUQB 4E9WA 3ZE0E 5D7LD 2BNQE 2WNXA 4FQIL 4JN2B 4G6MH 1F3RB 3C5ZC 3KLLA 3FRUB 4XN8A 1I1FA 2EILB 4DEWA 5CFHA 4JRWA 1CC3A 4O9HL 1HX0A 1DUYB 2B39A 4JB9H 4M8QB 3FT9A 4E9QA 4GY4A 1M57B 1PPIA 2EIEA 4YSDA 5L4IA 3EUDA 3LKOB 1J1OH 1QFWH 1WTGT 2VITA 4NKOB 4YE4H 5ITFA 1C9SA 3F3HA 4ZUTA 4YUEL 1ZLSH 3U2IA 4U1LA 4Q6IC 2DQHH 4LPWA 2VDMB 1YAZA 3WUWG 5GS0L 4FTVA 1OK0A 2FAUA 1ID2A 3MV9A 1KXVC 3U9WA 4JM0A 2P47B 2O6EA 4GQRA 3UP6A 4HBCH 5EH1A 3C5ZB 3QQ9C 4DKAA 5MI0B 1QR1A 4A6YA 3FUJA 2WZ0A 3BKJH 4NKMB 2A2QT 3B9AA 5JW4R 1BVOA 3WJMA 3RJQB 4D2NA 2Y3NA 3GBNL 4GMSH 3HASA 1GMEA 1QBMH 3PREA 1T0PB 1L4IA 2YJLA 3LPOA 3BZEA 3ZDXF 4QRPA 1QKZL 1E8ZA 4YHKH 1UOLA 5JA8B 1E4WH 2XV3A 2DF3A 3DA0A 3WEOA 4JFDE 5J7CC 3TH4T 4YK4C 3MV8B 1D5ZB 3T9WA 4UAHA 1GIGL 1X5ZA 2OMZB 5J5EA 1SVBA 1OSPL 5C0BA 4HCFA 2E9IA 5C3TA 4CSPA 3LRSB 4PVBA 2XICA 4KKCC 4EKXA 4RFOL 1CCZA 1FE8H 4M7LH 4WWKC 4CN6A 5E9DE 5C0FB 2XXCB 5H8DA 3DJRA 3HZ3A 3MRDA 2Y2TA 4LVHC 5ANHA 1BW8A 1E5AA 1JGDA 5AAWC 3SHSA 3MFFB 5DHMC 3VXNA 2R23B 3REYA 5I6OA 4QHMB 2FWUA 4LHQB 3RWDA 2O72A 1HXYA 3CCHB 3PJSB 4L23A 1WBXB 4IU3A 4WU5B 4DNLA 2CQVA 2W9EH 2DY2A 2QFPA 4KWUA 5ABDE 3UAAA 2AV7A 2XLLA 3DBXB 3KPPB 2XFXA 3ZDYB 5EEVA 3GJFH 1NEZB 5KBNC 5DJXA 4YJZL 4YZFE 4LSTL 2FZ3B 1FZJB 2YJQA 3I02A 5CIPB 1ZSDB 3WHE0 4OI7A 2HJFB 3VU2A 3GMNB 4ZMXA 3H85A 4PJ5B 2MRYA 5DZNA 4K9EC 2IH3B 2YD1A 3PHAA 4KTYA 3RGVC 2NX5E 4QTIH 4G1MA 5KS9F 3DROA 2AABL 3S3JA 3MV9D 4TLSA 2H4EA 1HH9B 3TIDB 2WVSA 2CM5A 4FS0A 3LKRB 3TVMA 3T09A 1HVXA 5CINH 3CODA 1U8QA 3N43B 1X5MA 3TV8A 1GS6X 4HJ0D 4F7MB 1OW0A 2R69L 3L5IA 3FUKA 4AGPA 1PQZB 2CHXA 4UG2A 4MNGE 5IHBA 4MASA 3ULVF 5L88L 3CVHB 5TDPB 1FI8C 4B27A 1OM3L 3CXHJ 4TM9A 3UDWA 1UCBH 2FWSA 4ZD3L 1XL6A 1NAMA 1P2CB 4F80A 3BKML 3ARWA 4E5XB 3Q2VA 1L9QA 1RZ8B 5E03A 1JSYA 5EULV 3FU0A 5DJDB 2LNLA 4N20A 1AY1H 1EZVY 4NQUA 4UDTA 5ELIA 1HKFA 2FJFB 5G5DA 4UUJA 5D2LE 4GAYA 2AEQL 1II4E 3OAWA 2HH0L 3PV6A 4OZ4A 2ZX7A 4PW3A 4BH8A 5DQJB 1BD2D 3QI9C 5I71C 2Q3XA 5IFHL 3CSBA 3NEXA 1A6WL 3ME0A 3HTLX 2DMKA 1AIFA 1G9HA 3DI2B 5JW5A 2DI7A 2BVPA 2FX7H 4AM0Q 4KZEL 2MNWA 1KT2B 1QI3A 4WCYL 3CMOL 3D6GA 4JANA 4Y1TA 3IT8D 3FNKA 3QDME 4S1RL 1EO8H 3VI4E 4OV5B 1VCAA 1N5AB 5C0GA 3S5LB 1FGVL 4LBEA 1DN2A 1QYGH 1XIWC 4ZO9A 2XBZA 1DQLL 1AFVL 4GKLA 2AEOA 2VDKH 4JG9A 2IQAB 4ZUTB 4NRZA 1Z2KA 3HI5H 1MQ8A 4XXDA 3VQMA 2A99A 3SDXE 3UBHA 1YN6A 2P8PA 1E5YA 1DQDH 2A4EA 5EIIB 4DO6A 3F85A 5IGXL 3O2WL 4R9HA 5HPMB 2FL5A 3B6SA 3FCUB 3P3TA 2NY0D 3W9EA 2HXAA 4F1SA 5I5MA 2AQNA 3RNKB 1RHFA 2NNCA 5LAPA 2GSIA 1L0PA 1SBSL 2R9HD 5D1ZC 3SOBL 1TOXA 2Q9OA 1UWGL 3C2SA 5LNGA 4PUBL 2A1WH 3KPOA 4PJCB 3TESA 5AAWA 2XG4B 2JFCA 2K9UA 5CD3B 2RFXA 3IN2A 4KY1L 2ED7A 6FABH 2F93A 2YCXA 4P5TD 5FWRA 3VFUA 1MCOL 4PJ9D 3IU3B 1DCLA 5I17B 4HWZB 4LOEA 4NNYA 2IVFC 4AX3A 3LKSA 5JXAH 25C8L 5F9JB 4XCCL 4F7CB 4U0QB 3MSPA 1N0LA 3HMXA 3MRNA 2QADD 3EYQC 5CEXB 3PDDA 1RZJL 4LCCB 3WYRA 1BQHG 4QMEA 3NSXA 4MAYD 4IBLT 1E8YA 2D7MA 5FO8A 3O9WB 3UTQA 4R84A 1BJ1H 2WYHA 4OV0A 4YDIH 4CADA 2AJZB 1RJLA 2R23A 2OJZL 4H26B 3WNMA 5D1ZA 5IFAL 1WZAA 1VFBB 4RDBA 3MI6A 4YH6A 5KVDE 1NMAH 3BH8A 3WN5C 4WV1B 1BSIA 2DOCA 4HH9B 1QSFA 4ZFQA 3ARDA 1J0KA 4GINA 5B6WA 3U6RA 1J1PH 1V3LA 1MIEL 1CD8A 3TV3L 2GK0B 3ZPQA 1C7TA 3O41B 1F4XL 2Z8VC 2E6QA 3OXRA 3M1CA 4LPUA 2OL3A 1A7NH 2FEJA 2OKMA 4MWFB 4ZRGA 3NBNA 4M9OA 4AMJA 5TQ2L 1QZ1A 1DVFA 4UTCA 3J7HA 3IDNB 4J2QA 3IETA 1RQ5A 1A6ZB 3LB6D 3F83A 4RLDA 4UNTA 4X7SL 4EZJA 1B4TA 3JTSA 3SGDH 5L8LB 3QVAA 4IDLA 1ZE3C 5FF6B 4L37A 1XCQB 5HI5C 3UTSD 1WIOA 2AZUA 4F37K 2P24A 4HAGA 5DYOA 3MLWH 5IQ9B 4AMKL 1AYOA 2KMWA 1YNTF 1TCMA 2AI0H 1OPGH 1T03L 4Z7QE 2Y1ZA 3WMQA 4TSCL 2V3FA 3E1F1 4DK5A 1DJHA 2EECA 4CVWA 1R47A 3B9VA 3ASOB 1XZWA 3GSOA 4P4RB 1M4KA 2R2EB 1XIWD 1PY4A 1LTXA 2F61A 1L0YA 2CR6A 4OF7A 4EA3A 1GJWA 3RWHB 1HEJC 3MR9B 2X87A 3VWKC 1EO8L 2B1OA 5FJGA 1IGTA 3IBOA 5B7MA 5JXED 1JN6A 2AAAA 3TN0D 2LAGB 3ABLB 4L9LB 3P3SA 3TYGH 4D7PA 5ETZA 3VI0A 4FFTA 5CJQH 2NY6B 1R17A 2WVVA 2BWQA 4KFZC 4JK0D 4FQQA 1S3KH 3IDJA 2FHCA 2BH0A 5IHUL 3D4GA 5C9JA 3WTSA 1A6VL 3PFUA 3VGHA 3VI4A 2A74B 1O7SA 3H6AA 2VXQL 5K9JL 3VFMB 5L4JA 1QUNA 3L45A 2KZ1B 1QEWA 1UAZA 2OS7A 3WXVL 4JW3A 1K6QL 5ICUA 1IZKA 5CEYA 1DQIA 4PJIA 3CZFB 1NGXB 3Q06A 1GGIH 1S8JA 3KMDA 1OGTA 1N2RA 2YOAA 1JD7A 2ICEC 2NUPA 4D8OA 5B38B 4E42A 1A2YB 1BZ7A 5LHDA 4RWYL 4BE6A 2O5XL 1QWUA 1DZ0A 4OF5A 4LU5L 4OKVB 1A4JA 4UT6H 1QKPA 3L1OL 3BVTA 4OD1H 5T1JA 5JHDE 1IAIM 4GQPH 5JQ6H 1YNTA 1G9MC 2A74C 2O5YH 3LQZB 5GRWA 5AW8B 3W9DB 1MHHB 1GGCL 1I7RA 1QNIA 1HQRB 2X4NA 2V2WB 4LSRL 4RA0C 3R7RA 5I5IA 3OAXA 1TVBB 4UIMB 2QSCL 3T0AA 2UVEA 3MLXL 8PAZA 5GS1B 3G6DH 1R9FA 2ITDB 3DJSA 3QZWB 3O3BA 1NDTA 1NCBL 2NTUA 3V4PB 4KPHH 4IBWA 3NEOA 3D3VA 4CMHB 1D5IH 1ZT1B 2ZOLA 4POUB 4UU9A 3ARED 1UATA 1WWCA 1TQUA 1VZGA 2CDGA 4GI8A 3WEXA 2HH0H 4I9WE 1MFAL 1BVZA 3K6IA 4JKMA 1QSEE 3B9EA 1ZE3H 2NUTB 4L35A 2X6UA 1IM9B 4C58B 4QRQB 4HW6A 3H3PL 2AF2A 3RWIB 1ZCRA 5PCYA 2BNUB 3JVGA 2YD6A 1SEQL 2VDQL 4A6YB 3F2LA 4XCYA 3WFDH 5FUZL 4ZW8A 3V6OC 1F86A 4HLZH 1TITA 4BK5C 3IDMB 3O3EB 2BS8A 5ACZB 4GT7A 1T6VN 4IRSA 2EDOA 3VXRA 5GGVH 5C09D 1ACYH 3V2AR 3SYOA 3X1BA 5B8CB 5ILTH 3ZO9A 4PJGE 2QQKL 3QQ4B 4NQCA 5F7BA 5TH2B 1SVCP 1EJFA 1WT5A 3LMJH 3E80A 1IGIL 3EYVA 3F05A 2WUCL 3H2PA 1P7QB 2RH0A 1KLGB 4YAQB 3CC5B 4JG1L 3V0IA 3OJMB 2FQEA 2A6DA 4KY2A 2Q2LA 5BOZG 4UANA 3NCXA 3LTVA 4KQ4H 4IOFD 5CILL 5DJ0A 4PWHA 5DHGA 4G7QB 3VWKD 2YAEA 5BZXA 3K6SB 1DE4A 3CHSA 4GO8A 3JTSB 3VSTA 3X3FH 3HG1A 4LEOA 1OWWA 1CICB 2F9BT 1K8IA 3P69A 2DEXX 2I24N 4GRLC 2KI6A 3DYMA 3S0PA 5BQDA 1UWEL 3MKKA 4GAAA 5CN1A 4JBSA 2X9WA 4BWBA 3C6SA 1JAEA 6PCYA 3NRFA 1YUKB 5I19L 1RIUL 4NBZB 4ZYKB 3DOHA 5JMRA 5KWYC 2TSBA 1KCSL 4Y8DC 3GJFB 1Z6JT 4K8RC 3OC8A 2NY4C 3EGDA 1BVKA 1ZGLM 4NQED 1KLFB 1L0XA 2FO8A 1NUNB 3GMNA 4FQ2H 3FT0A 4TUOB 1T5WB 4WJ5A 4P46D 3LZOA 3D34A 4PTUB 1E6JL 1W9XA 2OULB 4QYOB 4FQ1H 4BGLA 3L3OA 1EGJA 3OJDB 3N1GC 4P2QA 3IXTA 2VDNL 4OLEA 2NNXA 3ZKXC 4FDWA 5C0BB 4KTDL 3L9RA 1ED3A 5JOPE 4G7VH 4KRPC 3Q48A 3HAPA 1FIEA 3PL6B 4CMMB 4HFWB 1XFPA 1YN7B 2NY4B 3LS5L 3VSQA 5DFVC 4HKJB 3S97C 3D85A 1BGXH 4FG4A 4I3SL 1RZKL 3SPJA 5JJNA 4R4BB 3OKDB 2D73A 4IIQC 5F7AA 4K5PA 4BH7A 4BRJA 5GGSA 4HUVA 1JV5A 2XCMC 3FQXB 3QJOA 4MS8C 5F7MC 4KX9A 1U2HA 1XIWA 4RFEA 1GC1H 4P9HL 4ODUA 4C4BA 2K7QA 2AQ2A 2YPVA 3R06A 3S34H 1F42A 4CJ0A 3OF6D 2PYEB 4KI5D 5ITBH 5DJ6A 4ZUUA 4LPYA 3AG4B 2VKXA 5TQ0H 2WV3A 1B88A 3MJ9A 3VD5A 5E1GA 1QFWI 2ED6A 4DF9A 1ZK9A 4ZS6D 1KGCD 3MRGA 3P30H 1I4FA 2HSIA 2VH5H 4AYDC 2FTAA 1LEGA 4D8PA 3WIFA 1WRFA 4NQSA 1U8CA 2JB5L 5I0XA 1QFUL 4QOKD 3MLRL 4UWQB 4DP4X 1LHZA 5F3BB 2IWEA 5AW0B 5FOJA 4F2ME 3POHA 1DVSA 5K69A 2VDNH 4ALAH 4R4FL 1PX8A 3VFSA 1AP2A 2WXLA 3BVWA 3ZRFC 5CFAA 2I1XA 4MKMA 1MAJA 2H32A 5IJCC 4Z7UB 3RWCB 2CLVA 3QSKB 3QXDA 3M17B 4ZNEA 1VKXA 4ZTOH 5G2DA 2ZONA 4CGUB 2BY1A 5IB4A 1CFQA 1IT9L 3QFJA 3HG1E 4H8QA 1UJ3B 4OKDA 1OE1A 2J56A 2BNUA 2CR3A 3U0TA 3FQTA 3D9AH 2IANE 4FQLH 3FF8A 3MX0B 1BA9A 4XH2B 5KJ4A 5D1ZI 2BOBA 2YD2A 5JYLA 1IGCL 2PXYC 2B16A 2W81C 2X6VA 3AM6A 1IE5A 1MRDL 1KUMA 1QSEA 2VIRA 1NFIA 2NYYD 4WK2B 4U1NA 2C9SA 3D69B 3UGEA 2Y72A 1P1ZB 3VRJB 5LGKA 3QDCA 1T0OA 4OJCA 3O4LA 3BZ4B 1DUZB 1JWSA 1K85A 2XNAA 4EOWL 1L9RA 2GCYA 2BIHA 5D7JC 1J9QA 4JO5A 1NGYA 4ZPVA 1TU2B 1GJIA 3SN6R 3LD8C 3MRBA 1JHKL 3EDDA 4IKLA 1IGIH 4PAZA 4AV0A 5JA9A 3RVTC 3P9LA 3I9PA 3LPPA 2ESVA 4F1ZA 2C26A 3SDDA 4NLHA 3NJGA 3QQ9D 4KZDL 1S78C 1WCQA 1MEXH 1GXEA 2OI9B 5FYKL 2DDQL 3OJVC 5KS9A 1JL8A 3R4RA 1NMAL 1U58A 4KK9C 2YCZA 1MVUA 1K4DB 4X98A 2K6ZA 1PX4A 3P4MA 2BDNH 2VRQA 5LN4A 3JV0A 1RP8A 3CPUA 3DX2A 3POCA 2JJTA 2VZ3A 4JY6A 4BK5A 2VZVA 1M7XA 4MB1A 4B9JA 1IFHL 1KCWA 1DBKL 4G6AC 2X3CA 2ZXDA 4E9TA 1JNJA 4HULB 4JR8A 1DQVA 5FYKH 1MEXL 2AANA 3INUL 4QRSB 1IEHA 4OGXH 3T0XA 3OKMB 3FFDA 4O58H 2OJ1A 2WQUA 3KDPB 3IETB 2AJUH 1TUPA 3AT0A 4W70A 5DQJA 4QXUH 1G6VK 4XCNB 5ADPL 2MH4A 3NN8A 5J9PA 2ZCHH 1A6AB 3IBEA 3SDDC 3EJSA 2WXGA 1KNOA 4GSDH 4MXVF 3PE9A 1Q0XH 5JPNB 3NSBA 1BWWA 2YXFA 4HEME 1CTNA 3AU0A 5J6GA 2FB4H 1A6UH 5C09B 3CLWA 4NZJA 3P2DA 4Z7WB 4PSRA 1XF3A 2WINB 3EO9H 4TOYL 1WBZA 3IFNL 1MCIA 2VUYA 1YQVH 2R1XA 4PREB 1NCTA 1RIHH 2QHRH 3F7RA 4IKJA 1GZPA 4HU2A 1RZGA 2Z8RA 5ESVB 3DO7A 5AUMB 1FDLL 3U9PL 4KO9A 4BA0A 3IVKA 1C08A 4BEZA 1F6FB 5GZNA 3VUAA 4OLXL 2XA8H 3RWHA 3LPFA 5E2WL 4LP8A 3UZAA 3GHBH 2WO2B 4OB5H 1U8HA 4KXCA 2M1KA 5KAQF 4LSSH 1JHLL 3QIUD 5H4ZA 2ZWSA 5B34A 1S9WB 4OVVA 3OLGA 4LLQB 3HPLA 4NWUL 1YHPA 1NFAA 1ZOXA 1M1XA 5H37G 4HF5L 4LT7A 1KBGL 4ODVH 5J3HC 5LXGL 1TR7A 2JNZA 4AM0B 4G5AA 3QJFA 4FQQB 4WUUA 4NAMA 5BRPA 1E9QB 1XGYL 2AQQA 4JL1A 2DICA 4K07A 5B1AB 1NBQA 1A1NA 3QHZL 5FGCE 4NN6B 1F6AB 4YSPA 4NKIL 1D5IL 2OR7A 4WWNA 4Z7UE 1NGWA 3VGBA 4AK2A 4X80H 1AANA 1I1AD 1WFTA 1EXUA 2BMKB 1T2XA 2KLSA 4N90D 4MXQC 1IBGH 1MFBH 2XIDA 1EZSA 3EJYD 1KIQA 1UZ6E 3OQRA 4DP0X 3P30L 3CDZB 1X5YA 3BVUA 1FHGA 3RZEA 2VDLH 4X6FB 4XNBA 5GZNC 1AQ8A 2CHDA 5DC2A 3UP1A 2MSPA 4FLOA 5AKTA 4GBXD 3AGWA 4KKBC 4Y2OB 3H1ZA 5JHDD 1EK3A 3L1OH 3LZRA 2G2PA 3VXRE 5F0PB 1JF1A 3BP6A 3ZVVA 4DEPB 5FYLH 4F58L 4P9HH 4WKZB 1TZIB 2MHAB 4KJWC 3UO1L 3S96B 3RIFK 3KDMA 2R69H 3L7FB 2VWEE 5AKRA 5DMIH 2V33A 5HYSB 3PBLA 2W9LA 5H2NA 1EAJA 4NDMB 5AZ2H 4J3VA 3H3BC 5BQ7A 5JNYA 4OIFA 4BA8A 4U6XA 3NACL 2WY3B 3EHBD 1FFOA 3VB8A 1R3KA 4HGMA 1Z9NA 4GP8B 2DM4A 3GBLA 4RH4A 4JGUA 3VH8A 2EE3A 4KROC 1C16A 4MGXA 1TT6A 4WI5A 1JMXA 1LWJA 3DC0A 4WW3A 3I02B 2RHEA 5CIPA 1NOAA 3RAJH 1AVAA 2DQDH 2XVGA 4B53A 3J2PA 1IGMH 2A9ML 4Q8BA 2DWEA 4KH2A 3FTXA 1MUJA 2YKLL 5BW7C 2OZ4L 1VIWA 3NJNA 4WY7H 3A0OA 3ULVC 5G36A 2JMRA 5EF1A 2NQ3A 4BWUA 3CVHH 1BRXA 3MLSL 3RKPA 2OXHA 4DAGH 5MERA 6TAAA 2X9XA 3G08A 4FYQA 1C5CL 3W11D 2Y23A 4FJZA 4XI5D 1CL7H 2HUHA 4JGMA 4PXKA 2Y3AA 3LEVL 5DK2B 3S5ZA 5IEKB 1P4LB 1FBKA 2HWZL 2FATH 3QEQA 2HJLA 4HG4J 3VJ6B 5T1LA 4K55A 3STLB 4N2EA 4LQFH 3FH7A 3T0WA 2E56A 4I3GA 4P0DA 2VGLM 4TRPH 3DECA 1UWFA 4W6WB 1G94A 4J3UA 1FPTH 1SY6L 2P8LB 4HX1B 4PS3A 3P0YL 1YEKL 1PEWA 3LRHA 3A4FA 3HMXL 1YEEL 1S7SB 2ZF8A 2QKIA 4NX0A 2C4FU 3KG5A 1FIGH 2CG9X 1KEMH 1REIA 3CFTA 4L1BA 1E42A 1L9MA 1QKZH 3L8QA 1OSYA 5GHWH 5CCHE 3BH9B 2RH1A 2YMOA 4BH8B 4IARA 2IBBA 2GJ6E 4J4QA 2DRUA 3DRQA 2WXIA 4NNPL 5I66B 4G5ZH 4TRPL 5AZ2L 5KBMA 4XOBA 2BSBA 4DGVH 4FQXC 4FKKA 3FB8A 3HBZA 2X6MA 4B7IA 3C5SA 3BO8A 1E28A 3FRPA 1DEEA 2FR4A 3FTVA 3A23A 5IBUB 3RVVD 4DK3A 4L4TD 1CLVA 1V7ML 4RZCB 3UGUA 3Q5OA 4P57B 1INQA 3MYJA 2OV0A 3Q8CA 1ADQH 4MXQD 4F92B 1J8SA 1ACXA 1F3DH 4G9FB 2SEBB 4GXUM 3X13A 2CGRH 2JE8A 1YEHH 4PRAA 4ZFFA 2FT8A 3CVHL 4YAQA 4PVMA 4YSUA 2ZX5A 4GG8A 4UTAH 1NLBH 2OZ4H 4FJ6A 3KVDD 2AKRB 1LO5B 2YA2A 2ZOOA 5D2LA 2GTWA 3Q1SH 3LKQB 1QATA 4LDEB 5TJWK 2PTUA 1J05A 3ZGIA 1CFTA 4H8HA 2F74A 4NIKB 1BMZA 1I9EA 1AD9A 1JV7A 1CICA 5BV7L 3B37A 3RL2B 1YYLL 4PU2A 3UG4A 1KBBA 3D3VB 1LM8V 4UBDC 2HTKD 1LO4H 3DBXA 3KLDA 3B7YA 3KPPA 4MA1B 5FR3A 2ZAGA 1E7VA 3DRTA 2R8SL 5DJXB 3JXAA 1U3HD 4LOFA 5ANMB 2JAGA 3B7UX 3FW6A 1B9KA 5DR5H 2NR6D 1CBVH 3NTCH 4X32A 2JQMA 1T21B 4U1JA 1SOQA 3MCKA 3CD4A 3V9FA 1UH2A 3DXAD 5F3FA 3RLSA 3UTXA 3CLEL 1AJ7H 3MRNB 3ZL2A 3E9TA 3RA7L 4WWKB 4QO1A 5C2BL 1ZJAA 4AC4A 4FL4B 1IC7H 2VDKL 2E7DA 4M3HA 1KIUA 5I0ZA 4Y9HA 3L9RB 4KMTH 1X5KA 1XB3A 3NTCL 3EBHA 1B0RA 1XB6A 1E40A 3B8SA 4XMLH 2HVJA 1NH6A 2R56L 1YJDC 3AREA 4OF6A 3RDJA 1KC5H 1U4FA 2P26A 4FQPA 1RXLA 4JL2A 3CMOH 1NZRA 4FLRA 3HRZC 1XGQB 4A2HA 4ZMYA 2VXQA 3PWHA 1A47A 5HVHC 5KYWA 2B77A 5H2IA 2YD0A 2EUXA 4TVUA 3II1A 4H40A 1YMME 4JRYD 4X6CB 1QFHA 5GGSB 4Q58C 3MV7D 4XRCA 2VLJE 5J56B 3SKNA 4KKQA 4HUKB 1MLBB 3UPRA 4P46B 1Y07A 3HHRB 2V2XA 4PJHE 5C07A 3CFEA 5BJTB 3MV8E 1DO6A 2G75B 4OCSH 2IG2H 3WNIA 3H9HB 5CD5D 2OJEB 2XWDA 3CFMA 3MJ7A 5FLUA 1JGEA 3WIHL 2ZWLT 1N4XH 1CDYA 4DCQB 1FDLH 1M3IA 4OZFA 1BG1A 5JMOC 1N67A 3CZGA 1R5WA 1YO4A 1M9SA 4V2BA 1RJLB 4W9LC 2GIMA 1DQQB 4URKA 2XNAB 2XTJE 1A4KB 3QG7L 3ZPDA 2D7NA 5SWZD 1CFSA 1J10A 5GGQL 1KXTB 3KWVA 4FGMA 3ZTCC 2FBJH 2UZYA 1JV2A 2IQAA 3LIZH 5I16A 4X7SH 4KKAD 3OSKA 1AGEA 1FZOA 3VTMA 3F7VB 5IV2A 2AHIA 5DQ9A 3KE0A 3VRIA 1E3ZA 4PGDB 4L6RA 1L7TH 5DCCA 1XGZA 4PBVC 3GIZL 3KGUA 1F4XH 1NPNA 1YEKH 2BC4A 4J1UA 4XB3A 4GUCA 4NO3A 4OLWH 5H2OA 3VXSD 1P6AB 4XPFL 2X72A 4NS0A 3VI3A 4I77H 2ID5A 1F97A 5E1AB 5MENE 4U05A 1CL7I 3TWCL 4X4ZA 1AI1H 3WO3B 2IQ9L 1D5RA 5FF6A 4TQIA 4U1GB 3BAIA 3MXWL 1OALA 2NDFA 4PFEA 2DKMA 5EBMA 4DGYH 3WO4B 4LHUB 2DM3A 5EUOB 5HYFA 1XIWB 2YRBA 4UAOB 3E7JA 4KX7A 1Q9LB 3IU3A 2X6BA 4IKIA 1QHOA 1B0GA 4U2ZA 3V95A 5I17A 2WAHA 4I18B 1O6VA 5D7IA 4PI0A 4P3DB 4XTRD 1X9RA 3SPCA 3EZ8A 3TN0B 2XPYA 1S7VA 2IH1A 3CFBA 4O00A 5EZIH 5E1HB 3MLPA 5HYJE 3MBXH 3ZW3A 1GVIA 4UI2A 2VAJA 2M83A 4YGAB 3MRBB 4M3KB 1BP3B 1LDPL 3D52A 2XJKA 2W0FA 4ZMWA 1DFXA 3KPSD 1ODAA 5DO2D 5I0DA 1D6VH 5JPMC 3GSVB 1EGJH 3PNWA 4OLVH 1KTKE 3RI5F 4BJLA 1E4WL 2FL5B 5IHHA 3FYIB 3VXUE 1MAMH 3L08A 4I18C 3TIDA 3NDYE 2HJKA 1U8OA 3MRRB 3ES6B 4XPTH 2J6EA 5E7FA 1UWGH 4LCVA 5I75B 1H15B 1HJBC 3BEVB 4NWTL 3V2WA 1BQUA 1A7QL 1GW6A 2KBGA 4TPRH 1WFJA 3OAUL 4A6YH 4LL1A 3FQNB 5KBLA 5AD0B 3X1FA 3MRQB 2IAAC 2A6JA 1WGOA 3WTWA 3TYFA 4HWBL 5TK2A 3VM5A 4R5XA 2GTZA 3HUJE 5FYJH 1NCDH 2JTYA 3L2LA 5KSUA 1EJOL 5EBLB 1G87A 3OWRA 3P54A 1ZLSL 3ZZQA 2JWYA 1EEQA 3L3DA 4YIQB 2D8KA 3H3KA 3TOPA 5ID1A 4Y19D 5I6MA 1F6AA 1RZKH 1NCGA 3SEPA 4OFPA 2GW5A 5DC0A 4DETA 5EF2A 3V5KA 4CU7A 1LJMA 4Q6IB 2F58L 3VWJA 2PNDA 5CMAB 1S7QA 4JM2C 4AYGA 3GMRB 2ETWA 5TE4H 1A6WH 4FKHA 1UUNA 4Z7WE 1SEBA 4PGJA 3C6LA 3QORB 5IF0A 1XVSA 2QSTA 4FQ1L 4PJ5A 2IGTA 2BVOA 2I69A 2WBXA 2ITFA 3VXTA 3UPRB 1YA5A 3KAAA 3GZOA 3AACA 2VOTA 5JTWA 2D9CA 5A3IC 3RVXC 1KELH 1CR9H 4HSCX 1JHLH 1ZA6A 1R3JA 3FN9A 3GZPA 3HAEB 5D7JD 3WDJA 1DVFB 5IVXB 3FQUA 3KLAB 4AEFA 5KSAA 4DEUA 3BX7C 2WWKT 3QCUL 3RWEB 3X1GA 2C1OA 3OZLA 4K2UL 3V6FB 1T6BX 2B3IA 5IWLA 2VDOH 3MRPA 4DCQA 4G8FA 1FVDB 2Q86B 1T2QH 2PP9A 4FJYA 2A83B 3QUMH 2DS4A 3GLZA 2KH2B 4K3JH 1L9TA 2G9KA 2NY3C 4A6YL 2W9DH 2G0KA 3BYYA 4GSUA 2VDRL 4W4NA 2PF6A 5D8JL 4ODXB 1EFQA 4U33A 4CC4A 1W72L 1TTBA 1N64L 2FYYB 3QUZB 4I3SH 1VHPA 3T04D 2YO3A 4LVHB 2A9AA 35C8H 5DQDH 3ZTEA 3LRGA 3PHOA 4DJHA 4KUCF 3ZRSA 5IQ7H 2Q10A 2BS71 1AO7A 4FFYH 3BLPX 5EO1A 4NZTL 5JW4Q 5LVEA 2X1PA 4OCNC 2EC9T 2F0CA 3OKNA 5F7EH 3WUZA 3UABA 3W9DA 3EYFA 2DWTA 5EO0B 1WZ1L 3EBIA 4AENA 4N6QA 3VACA 1FNSL 4FYRA 4KDWA 4KXBA 7FABH 5EZIL 4JFFD 3K6FA 4H0LC 3FO1A 4HS6A 4KXZI 2B3RA 1A8ZA 4LEXL 1P4IL 3A22A 3NSJA 1J87A 3UZQA 5F8UA 1KBVA 1QFOA 3O2DH 5EUOA 1HEZB 1DR9A 1A8JH 3ZTNH 4NDMA 5CM1A 3DOSB 4P3WA 3HVDA 3DQBA 1I1RA 1OARL 3MOBL 1OP3H 4AY0A 4Z6AT 3MLTB 4H8UA 2IQ9H 1UOVA 1MNNA 2E9GA 3ARYA 2QSVA 3KYAA 4Y5YA 1AG0A 5I9QB 1FJ1B 4FQHB 3PWJA 3HE7D 4JRXA 5C0CE 2YBGA 3ARFB 1F58H 5DD0L 1JUFA 3E3QC 4NQCE 5A16B 1UD8A 2J20A 1WHPA 3H7BB 4LLWB 1GTNA 2KSBA 3BEWB 2KZKA 3DJ9A 4YHLH 1I85A 2BHFA 2ZCKH 3CDGB 5HGAB 3QXUA 1TENA 3PGCB 4G8IB 3J8F7 4J6RH 1LEKA 1QA9B 3N85L 3RWJA 4B9ZA 3MLXH 3R4DA 5INDA 1MHHA 3K6DA 4KO6A 5IB1A 3HLKA 3H55A 4BFIB 2MOQA 1XCQA 1FVCA 3LMJL 4HCIA 1JPSL 2AQSA 3K8LA 2YBRA 2ZP0T 2VQUA 1CXLA 2CKBB 2HTLD 5GGVL 4BE5A 1LDSA 4QRTA 4HIJB 1BXUA 4JM2D 1TZAA 4P2RD 5DUML 2XACC 5DUJA 4PJHF 4NC1C 5KBPA 3Q9PA 2DPKA 1PF3A 1A1MA 2AXJA 3C5ZD 2WQVA 1ZLDA 2FH8A 4B9FA 1YECH 2B7DT 1QKOA 5D9SA 4ATTA 1GGIL 3AGVA 3QCUH 3MRLB 4U3HA 1HCYA 4O2FA 3AUVA 3SDDD 4RFEB 1SHSA 2J8UA 3K0YA 1KN2H 2WQWA 1K8IB 4NJ9H 4YPGA 3T1FA 5F0MB 3OC5A 2VUKA 3RTQC 2IDTA 3B9KC 4NT6A 3VXSB 2H6OA 3CJJA 3W0WE 1U8LA 2VXSH 4AW4A 2P52A 4OY9A 1M56B 1CFNA 1O5PA 2GIXA 2VSCA 1UKTA 4JQVC 3DRQB 3V7AG 1H3GA 3IF1A 4FFZL 5A2LH 3VXMD 2E59A 5E8PA 4M62H 2WZPD 5TE4L 1RD6A 5IBTH 1ZHLA 3UADA 4QXWA 4TXVB 1GAFH 4UQ2A 2KPNA 1KCLA 3PXJA 3KM2A 3W1ZA 3LDBB 1T21A 3AWEA 4PS4H 4U1JB 4DK6A 4G8GB 4ZX6A 4F93B 2W0KA 1MWAA 3QC6X 2Q3AA 3CVBA 3BH4A 3UOAB 3JV5A 1UENA 2ILLA 4P59L 1H8NA 3S8WA 1HEHC 3L3IA 4C56E 2GABA 4JDTL 1IC7L 1JPTL 5IMOB 3AS0A 3KLQA 5FYLE 1LP9E 4WI0B 1FNHA 3HCVA 5D6CB 4U4BA 2YSSB 2GY5A 3CVIL 2P5WB 5AAPA 3X11A 2OR9H 4FN0A 2R59A 2WNGA 1CGVA 1KCUH 2EKJA 2CIIA 1T7VA 2KQMA 5F1KC 3OAUH 1Q0YL 4JFOA 1PGRB 1XGQA 3K81A 2ZTBA 4Y4FA 1YMMD 4DTGL 4KRLB 3Q7JA 1BZ9A 3CH1A 5F1NB 3MUY1 4PY8I 2EEAA 5DJ8B 3KW7A 4C83A 5GZND 1QSFB 3DVGA 4LOUC 1EX0A 1ACCA 2MOGA 1J9CT 4Y2DC 3NFSL 4MQTB 1QLEH 1HHIA 1ET8A 2GJ6A 4LIQL 1A7NL 4ANKA 3WN6A 2MMXA 4NQDB 5I1HH 4QJ4B 4JRLA 1TZGL 2FVNA 4KK8D 4IM8A 5A2IH 1OANA 1TTGA 1ZAGA 1RZIA 4KJWD 4KOCA 1LO2L 4P4KB 1E6JH 4PWKA 4FNLH 2OTUB 3O3DA 1WA0X 4ZX3A 2HCZX 3WIFB 2OMUA 3QUGA 4H1LG 1DVTA 3UTYA 1WISA 5E8OB 2VW6A 3C5JA 1R75A 3FB6B 4PJBF 5J11B 3LNFA 4HJJH 3Q0HA 2Z55A 3KEHA 5EBWA 4WTZG 3GSWB 2NQCA 1XMWA 4GQQA 2Y7LA 1RURL 3PQRA 3FCBA 3GQFA 5IMKA 2EDBA 3X3GH 4Y1SA 5B7FA 3AS1A 1NBZB 4J8QA 5E23A 5KSAD 5KAQG 4BZ2H 1KENL 2OYLA 5IV2B 1F11B 9PCYA 4L29A 4RAVB 5I6XB 4NHCH 2H9GA 2MCMA 4CVXA 1MCOH 3ULVD 4BUOA 3AITA 3FQRB 2BVYA 1AKJA 3OE8A 4Z0BH 3C6LD 3FTGB 4UINL 5HHVH 5MEND 2GVYA 3HC2A 2Z91B 3CHRA 4NO5B 4X7EC 5JLZB 4YDKL 2E9WA 5AZUA 4D3CL 5DEFA 1KFGA 4ONFH 3LXUX 5TF1L 3MBWB 3TJHD 1TF4A 2ESVD 2XN1A 1RUAH 2PPCA 2H0FA 4YN3A 1YY9D 3BFWA 1CXFA 5IGXH 2ZCZA 1T1WA 3QHFH 4RGOH 1SF3A 2VQ1A 3A4DA 3LIUA 1JDDA 3Q44A 3VFSB 1CD0A 1F90H 1BX2B 2CO7A 2I5YH 1AG6A 1Y7VA 4X9IA 4APXB 1WSST 3ZDXB 5LWYH 1UXWB 3MNZB 2V3DA 1OGTB 4O2FB 2F7OA 3NGBB 5D96C 5DEGA 4N0CD 5CLZA 5BZDA 1RL1A 4AH2A 2X89D 4JFDD 5DQ9B 5GRJL 2YKLH 3T8MA 2RD0A 2A9MH 2XV6B 4MMYA 4XCCH 5FX3A 1O0AA 4AKPA 4KUZH 1CDJA 3QJUB 1ZHBB 4UM9D 5IMMA 3N2JA 3ASWA 1QVOB 3PDOA 3ES6A 1P1VA 3A21A 3IU4L 3WY4A 1E7UA 3MTRA 2D3JA 4GSXA 4YE0A 3PPEA 5LO7A 4F15B 2V2TB 3S2AA 1F3DJ 3D30A 2OM5A 3PUUA 5DRXB 3SQBB 4DVRH 3QIBB 4HT1L 2X9ZA 4PJGB 4LCWD 1P9MC 1MWAB 4LRIA 3FFDB 1X5LA 3BWUF 1VFOA 4N0YH 3ZHNA 2X0VA 5B1KA 4JS7A 2DQTL 3GF8A 1I8UA 4RMWA 4KQ0A 1NGYB 4ZPVB 4GS7C 4I77L 4NKDA 4QYAA 3AXHA 4P5TC 1ZHNB 3FF7A 1AGFA 1UXSA 2LFGA 3ARGC 3QDMA 1DDTA 4P2OB 2YAMA 5ID1B 4LXFA 2J25A 1YNLH 3BHBA 1T1ZB 4XC1H 2XIIA 3EGXB 1AFVH 3VFPB 1IFRA 3HI1B 3KR3L 4LRNL 4BFFA 3CC1A 4JFOB 3VE0A 2L7JA 5D7HA 3PNWB 2MNUA 5G2CA 4AGMA 5E6RB 1E90A 1NWOA 2IBZY 4GQZA 3QNFA 1CUOA 2Y22A 2NR6C 1HE8A 2AABH 4UF7C 5AVQB 1O6TA 4X6DE 1U8NA 1A65A 2EDHA 3QEHB 4WUUE 1P9MA 2R29A 4OUOA 3FT1A 4L4VE 1FN4B 3IYLW 5EN3A 4GSQA 4N86A 4F7KA 3VFWA 4R7DA 3RUGA 2NSXA 3NJFA 4TVPD 3WD5H 4N0UE 4OZIE 3V4VB 3O0RL 3L3HB 2YA1A 4Y0GA 4JPWH 1SQMA 3I6KA 3GMMA 4MMXC 5GGRY 5LBGA 2E3VA 4UZSA 2LVEA 5IB2B 1RK7A 2ERJC 3I84A 1AD0B 1KPUB 4NERA 2R9HC 3IFLH 2ZSWA 3IKCA 1OXYA 1W8NA 5FV2A 4E68A 2WB7A 1EANA 2BMKA 1AXTL 4MSWA 2FR4B 3SQRA 4AGNA 2IOMA 4P3DA 5AL8A 3FTUA 3KPMB 5K59F 2AJ3B 5TE6H 1FE8L 2QMJA 1HOCB 3LXAA 4U1HA 3HARA 1NBZA 5E6SB 4OZFG 3LKPA 4JANB 2W65A 5KS9E 2PYEA 1I8KB 1W0VA 1I3UA 3H4FA 3L3GA 2NZ1A 3O11B 4MD1A 4JR9H 2EDNA 2FSEB 5AVTB 2DWYA 4Y2DA 3KYNA 4R83A 5C7ZA 2PW1A 1AKJB 1EHAA 2VZSA 2MIZA 4LRNH 3U0WL 2VE6B 2E5EA 1I3GL 2QLVB 3MO1B 2IDUA 3APFA 3BE1H 4XNXH 1KYOK 1MIMH 1F3JA 2FQDA 1U8OB 5C2BH 4HJIA 3UYOD 4WDIB 4JQIL 4P3CL 4XX1E 3T77A 4FQJH 3VDAA 3OXSB 2DQGL 4D7BA 5KVEL 1SBBA 2GSIB 1UB6B 1LP9A 2K3HA 3GXMA 3KGSA 4Y89A 3U2JA 4TV3A 1S9XB 1TFPA 2X4UB 3QXAB 2EI4A 3PIQA 2F8XC 4CN4A 1JPGA 4L0ZA 43CAB 2AMUA 4KKAC 4K5OA 3TYFB 1HDMB 3DX9A 2FSDA 4N4YB 1U3JA 2H7WA 1G6RH 3BUDA 4BGDA 3NIGB 4BSVA 2KLRA 3ARSA 2V9RA 5CZRA 1JWMA 3CZLA 4EN3A 2V8LA 1TPXC 4L1DA 1WAAF 4JFPB 1MFDL 2APSA 1TXKA 1BREA 5IM7B 1I9RH 1DVFD 3QIWA 1XH2A 1PS3A 4LCWA 4XZUB 4XCEA 4ZW7A 1WA2X 2GTWB 4IK6A 5G2AA 3PUCA 1XJIA 2J6EH 4KAQH 3R8BB 5T1MB 4QJ5B 3OKOA 1EFXB 1XF4B 3K74B 3ARDD 4FG0A 5EFIA 3S37H 4F7TB 3SGKC 4DO5A 5I1CL 1H2SA 1YC7A 4LMQE 2BNQB 3N44F 1SBSH 3U83A 5DHHA 4JG0L 1XF3B 4XTRC 5B21A 1RJZA 4RNRA 2WYTA 4BCYA 5LGHH 4XVJH 3RDTD 4BBWA 4GJTB 3BGFC 3SKOA 4KV5F 1WZKA 2P8MA 4H13C 3SY6A 2NY0B 3AREC 1LEIA 1SGKA 4QAMB 1OV8A 3CQPA 3DURA 3Q2LA 1QPXA 3W0WD 4A2LA 1UM4L 2VR5A 4ZX4A 4BFNA 5D72L 3JV6B 4ZPTA 1QLFB 2JKJA 4HCGA 4AJ0A 4DVBA 3GRGA 2WN3A 1FYTB 1ZVHA 4JRFA 1QFWL 4RFNB 5HD8D 2CRZA 5CCKL 4KZ0A 2Q8BL 4X8JA 1DJIA 1TMCB 2QPSA 4FXGB 3SPHA 3FTZA 5T5NF 4WFGD 4Y1AD 4EKJA 2I21A 3NYAA 4KMQA 2WYIA 3ISWA 1JBJA 1X9UA 5T3XL 3UCQA 4A63A 4GRWB 1OTSD 3EDKA 4ONHB 2CLZA 4L9DA 2NY3D 4IYKA 4YSCA 3STLA 4OCRL 4A7GA 5I30L 4ZFFB 1NPUA 4JX0A 3OKLB 5FYLD 3KS0J 1A3RH 3QFDB 4MB5A 4XN5A 4OJEH 5L7XL 1KJVB 3OHXA 1H6EA 1JFHA 1B4JH 3QI9A 3ETTA 5CZXD 3TL5A 2QKIB 1M7IB 4BZYA 4EO5A 2P80A 1ZVNA 3MRLA 2HKAA 2VSMB 3CPLA 1KCBA 2OMXA 3KHOA 4WY7L 1LXMA 2ISDA 3BUQA 4B9PA 3AXLB 5ITBL 1QI4A 5E5RB 2BSCA 5B3SB 4NQEB 2X2YA 1UT1A 3FMGH 1JGLH 3B2VL 4MD5B 5L4MA 5EZJA 2R1XB 1RIVL 1MLCA 1DBBL 3HE7B 2GC7C 2WLLB 1LQBC 3TONA 2J5WA 3HNSL 3BSZH 1EHKB 2BVQB 2Y00A 4K7FB 4JRXB 1A4CA 4PVLA 3TBYA 2CDEB 2QKIC 4JHAH 1R3KB 4BD4A 1ZSDA 1ZTXE 5CP7B 5A7EA 3A4AA 4Z7QF 3L3JA 3ZDZE 5IW1A 4ES8A 3S36L 1NGXA 1ILSA 5EZOL 1EZUA 4TQHA 1UFGA 3Q6GH 3VYOA 5LDSA 1AQKH 5K9OA 1I7ZA 4JFVA 1KXQE 1TZHA 4CC0A 3KYKH 4EIUA 3UYPB 4W9HC 2ZP8A 3MRJA 2EEDA 1GL4B 2XKNA 3L48A 4IEFB 4EDXB 3X3BA 3CFDA 1ZV9A 1Q90A 1MFVA 5F93C 4M1DH 4A7GF 5IROC 2X0UA 3L5WB 3FXIC 1WEJL 3MV01 4PY7B 2O93L 4IBTA 4YDVB 4OV6F 1G1OA 4NM8L 1TYEB 2V5SA 4PCTA 5EU6A 5FUOH 2NTSP 3V4PA 4WGKA 2EH8H 4KJPD 3KL3A 3PP4H 3M8OL 4L8CB 4LZKA 2N7SA 3UG3A 3F12A 1VB9A 2KKQA 5AVSB 1M71A 1BAGA 3QHZH 4TVSa 4BEIA 4CILA 1TJIH 3QNZB 3S3BB 2XWXA 3HMWL 4HIIA 5F7EL 4EIZC 3IB4A 3QBKA 1P5VA 3L54A