3EH5B

Structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
b'DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
source organism Thermus thermophilus
publication title Combined microspectrophotometric and crystallographic examination of chemically reduced and X-ray radiation-reduced forms of cytochrome ba3 oxidase from Thermus thermophilus: structure of the reduced form of the enzyme.
pubmed doi rcsb
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3eh5B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3eh5B02
5B6VA 1E5ZA 4KNSA 4MFHA 3WNIA 1PNCA 4PXKA 5EN0A 3ABGA 1M0KA 4FAAB 3FSZA 3SBRA 4DPBX 3VVKA 2XV0A 1SJMA 3T6ZA 1QHQA 1OE2A 4LDLA 1NIDA 1OE3A 1J5CA 1DZ0A 1KGBA 2Y02A 4IARA 5G36A 2YXWA 3NSFA 1KGYE 2KS9A 2LLNA 3NSDA 2YAPA 4HCFA 2I20A 3CG8A 2PLTA 4JR8A 3NJGA 2H47C 3AG4B 1O0AA 3PLYA 3DQBA 2ZZLA 4GP8B 2J4YA 1A3ZA 5B6ZA 1KDIA 2B3IA 2BP8A 2Y04A 1CC3A 2HX9A 3ASOB 2A3TA 3X1EA 4A2GA 4E9YA 4N4YB 4IAQA 4Y9HA 4EJ4A 3TA4D 4X31A 2PCYA 1IW9A 3GYRA 5ITCA 2GI0A 2F93A 3VHZA 4NB7A 3T6VA 3QAPA 2VSKB 2XLLA 4BUOA 4X1HA 4A68A 4N4WA 2HZHA 3IE9A 2ZWNA 1ZDQA 4JKVA 1DYZA 2DV6A 3KW8A 4KO7A 2HLEB 1IBZA 4AI7A 2XVBA 3AZUA 3RYMA 4HCIA 1H68A 1JERA 2OJ1A 1JV7A 1KMEA 1S53A 4GYCA 5I5JA 1BRXA 3CZUB 3OMIB 2I35A 2RH1A 1X0K1 1MG2C 3NYKA 1PZCA 1A4CA 2VW7A 2TSBA 3ZPRA 3X1NA 2ZFEA 4YSQA 1P8IA 1BXUA 4JHUA 1VJMA 3RFMA 5B1BB 2PCFA 1KG8A 5D4JA 1GS7A 2VW4A 1JFPA 3FPYA 5H2OA 1L9OA 1F50A 5C1MA 2R4RA 4AKPA 4YSAA 1WAEA 3UTXA 1MGYA 1E30A 4K5YA 1KCBA 1URIA 2FQGA 4HWLA 1PLBA 3HAPA 1IKOP 4JKNA 3ZIYA 5I6KA 3SBPA 4EA3A 3GDCA 3UAEA 1L9PA 2PP8A 1J9QA 1QM8A 2HRGA 4UG2A 3AW5A 1BXVA 2IDTA 5B1JC 3UADA 4YSEA 1R84A 2YCXA 5I26A 1B3IA 1AOZA 4EF3A 4X4KA 4A2DA 4P5SA 3WI9A 4YVNA 1C8RA 1AG6A 1NZRA 1OOWA 2BW5A 3FQ2A 3NSCA 5BR5A 4ZK8A 3NYAA 5F7AA 1J9RA 1OCZB 1OV8A 4BVNA 1JXFA 4UHRA 5EHFA 3QJUB 5DYSA 4KO6A 2YQBA 2JAFA 5B6WA 1W8EA 1E12A 4G7RB 4MBSA 4MD1A 1PZAA 4YSPA 1JZJA 4YVUA 3PQRA 4PCYA 3NP3A 4DPCX 1FWXA 4KLYA 4IB4A 2PP7A 4GYBA 1BQ5A 4PXFA 1X0I1 2H3XC 2H5UA 2YAFA 3FU9A 3QJRB 5G2CA 1V55B 4E9SA 4YSUA 2P80D 4QI1A 5H2JA 1CYXA 1GYCA 3NJKA 3V9EA 1LN6A 2KSBA 6PAZA 4GPOA 3EH3B 4DJHA 3ASNB 1RZQA 1IXFA 4L35A 3FYEB 2UX6A 2I85A 1AR1B 2FNWA 2DYSB 1AAJA 1PLCA 3KJ6A 1IUZA 1JZIA 1GS8A 1S8JA 3QDCA 1AS7A 3NSYA 4YSDA 1XIOA 1S54A 1A8ZA 2YAQA 4FBZA 5B3SB 1AS8A 1PXSA 3OE0A 3PAUA 5B2NA 5TK4A 3WKQA 3OMNB 1R1CA 2Y1AA 2M3GA 2R7EB 2AT9A 1L9RA 3COCA 4YSOA 4KNTA 3VW7A 3OM3B 4LDOA 2XU9A 3FU7A 1JXGA 3WNJA 1SFDA 5AX1A 5KKHA 2BW4A 3OE9A 2YCZA 1XJIA 2AVFA 3S8GB 4XT3A 5B35A 1UATA 3CDZA 1F4ZA 3UZCA 1NICA 3PXOA 3HEIB 5PCYA 3OE6A 2PPCA 1KCWA 3S3CB 3HAQA 4F2EA 1PY6A 3AG3B 1KBVA 5H2PA 3QAKA 4L6RA 3ODUA 3TASA 4X32A 2Q5BA 3FQ1A 2BWIA 1AZBA 2P80A 2DWTA 2QDWA 3QBKA 3HARA 3FSWA 3IN2A 3QBIA 4E9WA 4A67A 4G72B 1W6WA 2KSYA 2BP0B 2EILB 1ZPUA 2JXMA 4UF7C 4W1TA 2PP9A 2HXAA 2WJLA 3FYIB 3NT0A 4CSZA 4QLWA 2EIMB 3AYNA 3IN0A 4J4QA 2FTAA 3DIVA 3NY8A 2UXVA 3H4FA 4XTLA 5D4IA 1JGJA 1R2NA 1CURA 3X1GA 2FQFA 3PCYA 5B0WA 2HRHA 6PCYA 5TK2A 3PPSA 2IDQA 4KOCA 1IBYA 2YDOA 1FFTB 2BP0A 3T6WA 1P8HA 5DHHA 4QKTA 1L0MA 1A4BA 4HYJA 2I1XA 4DP1X 1JXDA 3UGEA 4G7SB 2XYBA 1NPNA 4DP7X 5H2MA 2XV2A 1BAWA 3QPKA 2WO2B 2WJKA 3UTWA 2B08A 1BYOA 1N68A 4E9VA 2EIJB 1L9QA 3UTVA 1E0PA 2JAGA 1AG0A 1A65A 1ASPA 2YAEA 1M56B 1NINA 4XTOA 1GSKA 1IC0A 2QPDB 4TXVB 4PAZA 1EHKB 1UAZA 3X3BA 3UACA 2VW6A 2VM3A 3EHBB 4W9ZA 1OCOB 2DYRB 2I7SA 5I5MA 1CWQA 4MQSA 5A45A 1XB3A 4GY4A 5H2LA 5TGZA 5AHYA 2FQEA 1ZIAA 2NRDA 3CVBA 3L45A 5E9NA 3V9CA 2WO3B 4LDEA 3SN6R 2PPFA 2ZOOA 2EI4A 1W6LA 2BO0A 4HCGA 4F7KA 2J56A 7PAZA 1GS6X 2J5WA 1A4AA 1CYWA 1L9HA 2BZCA 2HX7A 2YXVA 1PXRA 1RCYA 2BRDA 1TEGA 1PNDA 3HASA 2LNLA 5IY5B 3QJSB 1GZMA 5B6YA 4K9JA 4E9RA 1HAUA 3EH5B 4KNFA 5I6PA 4GP5B 3S3BB 4Q8BA 2IH8A 3RZEA 1M9WA 3NJNA 2BZ7A 1HZXA 5ETZA 4AKOA 5BR2A 3EF4A 3NJJA 3WQJA 3OAXA 1WA2X 1PMYA 2GBAA 2GC7C 5G54A 2E86A 5B1JA 3SBQA 5J7AA 1I53A 2XUWA 3NJFA 4WTQA 4YSTA 2WSDA 4HZ1A 2Y69B 2IWEA 4KO5A 2PEDA 1QLEB 1AZNA 2BHFA 5AWZA 2AFNA 1ZIBA 4TL3A 5A8EA 1WA0X 3PAVA 4GBRA 1M57B 1AZCA 3TU6A 3S8FB 3ZDWA 1T5KA 1NWOA 5AHZA 1KG9A 1ET5A 5FC9A 4KOBA 3EH4B 4FPDA 4HYXA 1PZBA 3UAAA 2RACA 1ILSA 2BWDA 2UXFA 2ZONA 2YCYA 5AZUA 1C3WA 2MTAA 3NJLA 4BWWA 4M4RB 1FA4A 2Z73A 4UAHA 2VN3A 3BVDB 3TBCA 2PPAA 5D4HA 1KV7A 3X2QB 1NIFA 4ENZA 4QRYA 3NJMA 4DP2X 1ID2A 4A2FA 1AT9A 3TBBA 3PXLA 4BWUA 3P0GA 3X3CA 2FT8A 2GC4C 4A2HA 3HB3B 1GW0A 2W88A 1HFUA 3C9MA 3NS0A 1OCRB 1SNRA 2N0MA 3WG7B 5LDUA 2NTWA 4YSCA 1AQ8A 1BRRA 1JV6A 4G71B 3T6XA 2YDVA 3AG2B 5I28A 3NSBA 1RKRA 3A7KA 5F8UA 5G53A 4WKXA 3C75A 4YSSA 1NPJA 3OQRA 3BQVA 5B34A 3UTYA 4A2EA 1ASQA 3G5WA 4BWBA 4KNUA 1SF5A 4Q89A 2CJ3A 4OV0A 5G2DA 3UONA 1H2SA 4AMJA 2CCWA 1BM1A 4EIYA 1C8SA 5JJNA 4HHWA 3AM6A 1BYPA 2IAAC 1BRDA 1PCSA 1TU2A 1E5YA 4AX3A 1PF3A 2I21A 3FPXA 2NTUA 4E9TA 3PBLA 3QJTB 1OF0A 2PPDA 2KSAA 1J5DA 2GSMB 1Q5IA 4MD2A 4UANA 4GP4B 1FBKA 2QT6A 4HHGA 4RH4A 4N8UA 2Y01A 2QDVA 3T45A 4FA7B 3ABLB 3IEAA 5B1KA 3MX0B 1HAWA 3HAOA 1ZDSA 3ABMB 1S8LA 3JTBA 2DY2A 2ZIYA 2AZAA 3T9WA 4JHVA 1Q5JA 5AKRA 2EIKB 5H2NA 5A7EA 4BWTA 1AS6A 4AZUA 3ZEVA 4AMIA 1AZRA 2YAMA 3PAZA 2VMJA 2VSMB 2Z55A 3X1BA 2XV3A 2IDUA 3DKHA 1SDDA 4GXFA 3OD3A 1PLAA 5B7EA 2FWLB 4XXJA 1NIBA 2IWKA 2F95A 1PY0A 1ETJA 1GUEA 1NIEA 2AANA 4AKQA 2XXFA 3REYA 1MZYA 4YL4A 4DAJA 4NERA 2IH9A 1FBBA 1L9TA 2J55A 4DPAX 3NJIA 1NIAA 2GIMA 1JZEA 2J57A 2X87A 1AACA 2CBPA 4BXVA 1AZUA 3FQYA 4DP6X 2Y00A 1JZGA 4BDVA 2X72A 3VG9A 1NTDA 1U19A 2ZXWB 3QQXA 2X88A 1E65A 3N55A 2CUAA 3WKPA 4N6HA 1ASOA 1ET7A 4DP4X 3AG1B 3ZPQA 1SDDB 2IWFA 3N2JA 5F7BA 2HX8A 3DTUB 1S51A 1UCQA 4G7QB 3NJHA 1TEFA 9PCYA 3ZBMA 3CVCA 5I6NA 1MZZA 4JQ6A 2IDSA 1ADWA 2HPYA 3CVDA 4HALA 4DP8X 1P8UA 1F88A 3ZX1A 5H2HA 5B1AB 2XWZA 3FS9A 1MG3C 3QJQB 1GU8A 1QKPA 5I5IA 5LWEA 4M3HA 4DP9X 1TN0A 3DDLA 3QBGA 2CALA 3OMAB 1JZHA 4BDVB 1XB8A 1PAZA 2XX0A 3SQRA 1XMEB 2UXGA 1KBWA 2YARA 1VGOA 3UZAA 3PDSA 2OCCB 1J9TA 5AFAA 1XB6A 1QKOA 1ILUA 1E67A 1TKWA 4XTNA 3AYMA 1AP9A 3EMLA 2AZUA 4KO9A 3VGAA 1BQRA 2JKWA 4L0PB 3HANA 1CUOA 1OCCB 1SFHA 2R7EA 3FSVA 2R4SA 1L9SA 1V54B 3D4SA 1NDTA 2XX1A 2CAKA 2YAOA 4HAKA 1GY2A 1M0MA 1KDJA 3FU7B 5ANHA 5I6OA 2I7OA 2FQDA 1BQKA 4BV0A 1DZEA 4GRVA 1GR7A 1QNIA 1YLBB 2OV0A 1NWPA 2UX7A 1OE1A 3CDZB 5B7FA 5G2AA 1WA1X 2JFCA 4BEYA 3D12B 1M0LA 4DP5X 3H4HA 3CODA 2FT7A 3UG9A 4DP0X 4F2FA 1J9SA 3ERXA 5JJEA 4BXSV 4CSPA 4MQTA 5PAZA 4HIPA 5A44A 2GB2A 1JZFA 2EINB 5AZDA 3OE8A 4NC3A 5G28A 3CAPA 4QIDA 2DWSA 1V10A 3GXUB 2UXTA 2FT6A 1IW6A 1X0SA 1SHXA 1WS8A 4DKLA 1RZPA 4YSRA 3FU8A 1MDAA 1BXAA 3KW7A 2Y03A 1VLXA 2FJSA 3X1FA 4WW3A 5B7MA 2QPEB 3H56A 3MBWB 3JT2A 1GY1A 4G70B 4A4MA 1EZLA 2MRYA 3QJVB 3QBLA 4A66A 4BEZA 2IDFA 3C9LA 4XT1A 3VI0A 1AIZA 1JVLA 3NY9A 2Q9OA 2VM4A 5H2KA 2XXGA 3ABKB 3V2WA 3NP4A 4P5RA 1X9RA 1BEXA 1QHJA 2G87A 3PWHA 1AANA 5ITEA 1ZV2A 2TSAA 3IBOA 5H2IA 4NAJA 3U25A 4E9XA 1JVOA 3FSAA 4BK5C 2W8CA 5B6XA 1S52A 5JJJA 1JOIA 1N70A 1WS7A 4WAVA 5I6MA 3WIAA 2L6XA 5DHGA 7PCYA 1SHWA 2VT4A 3FT0A 1TN5A 1F56A 2GHZA 5FJGA 3ABWA 4E9QA 3AY2A 3V2YA 1KYAA 5I6LA 1ET8A 5AX0A 3MBVA 1X9UA 3T71A 2BP8B 2PPEA 3UABA 2YCWA 2YAHA 8PAZA 1SF3A 3S3DB
chains in the Genus database with same CATH superfamily
4AK2A 1UACL 2EYSB 2WQUA 4FG6D 3S3SA 1PNCA 1FO0L 3JQOB 1MCKA 1JK9B 4KK6D 4IS6B 1BAFL 3CXHK 2E47A 3GHEL 3O2VH 3DGDA 4JPKL 5I1JH 2NTSP 2YPVL 3GMMA 4NJAL 3T8XB 2AXFB 1YY8A 1CIDA 4G5ZH 4RRPA 4Y9BA 3EJQA 2Y02A 3KYOA 1IT9H 2OCFD 3IJHA 3L5XH 1OF2B 4M48L 3WLWD 5IT2L 3O11A 5BW7A 1HZLA 4LVEA 2BP8A 2XVKA 1A3ZA 4XC3L 3ZYOA 3FUMA 1VKXA 3VXUA 4BHUA 3UMNA 3BQUD 3GKWH 4R83A 5FK9A 3WU1A 1I8MA 5KOVC 3GYRA 5C8JB 2YSSB 3ZZ1A 1BZOA 2DWEA 3G5XA 5EC1A 1SM3L 4FFYH 4A68A 1WFMA 2CM5A 1GGIL 4UQ9A 1I8UA 4OB5H 3BPLC 2Z31A 2LFEA 4L3AA 4TULL 3T0VA 2MHAA 3DV6A 4JFVA 1TQUA 1JERA 3OV6A 4KY1H 5AW6B 2R4RH 4AY0A 4GYCA 1MFEL 1XCQA 3IK2A 3WY2A 1BRXA 3Q9QA 5FIEA 4KJQD 2WZ0A 5D7IB 1VERA 3EYQD 5B4MC 1OAQL 3RILA 2ICWB 1HHHA 3ECBB 4N68A 4LU5L 1B0RB 1BXUA 1ZMYA 3S88H 5J12B 1INQB 3K5RA 1LO3H 1KGWA 1FNFA 3ARUA 5D4JA 2IPKA 5F3FA 3ZTJG 5IMLA 1FSKB 2NNFA 4YHML 2EDBA 2ZYSA 4ZQTA 1JZ6A 1SUHA 4PB9L 3EH1A 4AKPA 1A2YA 5HI5C 1U41A 4K5YA 5GRXG 4PJGF 2OI9B 1IZJA 4AG4H 1CICB 2O1AA 5HDQH 1SOKA 3SQBA 2HRGA 2MQCA 3CDGB 4XB7A 1CE6A 5I6XC 1WFTA 2BVPA 1UZ6E 5JA9A 3BN3B 3HZVA 4N2DA 4BSWB 3Q2NA 5E6SB 1AG6A 3DO7B 3HNVL 1TCRB 2YUZA 3LPFA 4J1UB 5IMMA 5CSBA 4XNUH 2XZQL 3EBGA 3P40A 5ISZE 5EDXA 2JKJA 4EDXB 1Z3GH 3FOMB 3FH7A 1HS6A 1NCIA 2D3LA 3IMVA 4Y5VC 3LNDA 5AW0B 5BVPL 3L1FA 1MJJB 4XPFL 3FTWA 4FMFA 5DO2D 4M02A 4YVUA 3W0WB 5L4MA 3IGAA 3L1EA 1NKRA 3QDGD 1MIMH 3CXFA 3KPPA 5C0IB 4IB4A 4YEFA 4P48A 1UYWH 1MCJA 2K7PA 3D0LA 3VD3A 4FF9A 2XQYK 5I1EH 3MFFB 4E9SA 5EIQA 5L7XL 1IBBA 4K3HA 4OIIH 1LN6A 3OXRB 3ZO9A 5IMMB 1T3FB 4Y1AD 3V4VA 3IU4L 5T3ZH 3V0DA 3T09A 1UWEH 1EZVY 3SCMD 2I85A 4M8RA 1TJGL 2CGRH 2PTTA 4NUJA 4YHNB 3G04A 1E7UA 5JW5A 1F02I 1ED3B 1HDMB 4D8OA 5HGDA 4CUCA 4TYUA 3KPRE 4JQVA 5E56A 1URLA 4MLSA 3WUWA 5EUOB 3UTZA 2GHWB 2QFPA 4LEXH 5D1ZB 3TWYA 4B41A 3RZCA 3DC0A 2AJVH 3QQDA 3LEVH 3A24A 4KY2A 1L5GB 5IR1A 5JW4R 1KIUA 1XJIA 2EJ1A 3D4YA 1RZGB 4OCWL 1TENA 4YWGH 5LXGL 2W0FB 3OZLA 3UO1H 2DIEA 3D48R 4UOW1 3LNFA 3HR6A 4B9ZA 1FDLH 1MCIA 4HSAC 4LPWA 1MLBB 1A4KA 1I1FB 1D6VL 3WJMB 3RFZC 5I1LA 4MJ6A 1BREA 3KM2A 2L4OA 3HE7D 4R7NB 3AITA 2IQAA 3DVNA 4X8XA 1A6PA 3QBIA 4N2BA 2VRKA 2KLRA 1TQVA 1EJOH 2BWQA 2CLRB 2NY1B 3FYIB 4CSZA 2CDFB 1IKFH 3HLKA 1KJMA 1YCSA 2VISB 1HYSC 3SGDI 3U2IA 1G7HA 4RMWA 4JL1A 5E8NA 2NTFB 4PS3A 4QUOA 2F5AL 4XN2A 1JGJA 3DOSA 1A14L 3DUUB 4PS7A 4CN1A 4KU1A 3SY0B 2EH7H 3IDJB 2V3FA 1TQCB 3RDJA 2VQ4A 4JHWH 2QSQA 1N64H 1RMFH 2R29L 4K5LA 4TUJB 4UDUB 1L0MA 1AR2A 2ED8A 1XF2A 4NKMB 2GW5A 4YXHL 5C0RL 2WWOA 4TVPE 4F93B 1RZKH 4OB5L 3L4XA 3NSJA 2B08A 2ZNXA 1HI6A 2DQIL 3PPEA 1TSHA 1AG0A 1G7LA 4Q4EA 4HT1L 4AL8C 3FT2A 3AREB 2GYSA 1RU9L 3SKNB 1MJ8H 4QEGA 4IJ3B 4QRPD 3P4MA 2DH2A 2FQEA 4KMTH 3O3AA 5E9NA 2Z64C 3AMKA 3EOAA 3JWOL 6FABL 4D9LL 1AD0B 3CLFH 1OPOA 1BF5A 2J6EA 1GS6X 2AXWA 4YDKH 5FCUH 3KVPA 3T4YA 4W9DC 1DBKH 3LXAA 4OZIE 1EFQA 4M8QB 5JHBA 2XIBA 4ZFOB 1HAUA 2F19H 3A0OA 5C07D 3WMPA 3ZE1F 3TESA 5DJ8A 3KGTA 4ODUA 2BMKA 2IH8A 2E27H 3GNML 3FT2B 4WI7A 2GC7C 4MAYB 4JVPA 4WUKL 4YHZL 1KTDA 2OJEB 5IM7A 4XNQB 1ETA1 2JLPA 4WV1A 2OS7A 5DQJA 2YGPA 3F12B 4KXBA 1QZNA 4PTTB 4JDEA 1E6OH 4JG5A 4LSUL 1Z3GL 1OPGH 5M95B 1NWOA 3SGJA 4U2YA 5C08E 3I9IA 3IFPB 4GW4B 4RZCB 3M86A 4IU3A 4QRRD 5AL0A 3HW7A 4CGUB 2CHXA 3A3YB 3LMJL 3SYOA 5GS0D 2YCYA 4G2AA 1G7JA 3FH5A 3MACH 4BWWA 1R0AH 3NIDB 4P4RB 1WEJH 3US0A 3V79C 1YNTF 3I85A 1IKNA 2XG5A 5CLYA 4JY6A 1IC1A 3CXDL 3ESNA 5DFAA 7FABH 1NIFA 2XBZA 3O6KH 4BFNA 3OPZH 3TBBA 4ZFZB 3FFOA 5DC2A 4GS7B 3TVMC 4FTDA 4JDEB 1DBKL 1BQHA 1WIUA 4QHNB 1KACB 1JNHB 1JNNH 3CQQA 4ZPVA 2D4DA 3ULVF 3MR9A 3QZBA 5HI5D 5IBLD 1KXHA 1BMWA 3VD9A 3RWCA 5JPMB 1FG2A 2FX9L 4PV9A 5IJVB 4OW6A 3RVVD 3VG0H 3ARGA 5DHVB 3WSQH 5CLWA 3LAFA 3PDOB 3SJVB 4K71C 2EYTA 4Y9CA 2CJ3A 1EFXB 2VSCA 3LKPB 4KMQA 4EIYA 3PP4L 3SJVE 2KQNA 1I7UB 1A14H 4RGNB 3GSQB 1E5YA 4JO8A 2I21A 2NY5C 2WLJA 1AGEA 2ATKA 3KPOB 3MLRH 2VRQA 1BA9A 1YYML 5E4OA 1Q5IA 2ZXQA 4UANA 5BOJA 4GP4B 3OB0K 1WC7B 3IEAA 3IDXL 4PD4K 1U3HA 5EU6B 5BRZA 4N2AA 1EWHA 3P4OB 3Q1SH 4UI2A 3V4LA 5FA3A 4X5RA 1N12A 2VDOB 2IFFH 3K4DA 3LNHA 4M5ZL 5ETUB 3BIBX 4YBQD 4CAGA 3M7OA 2IPTL 4RWYH 3U46B 1U8CA 5K9KB 1JZ2A 4HC1L 1EBAA 3EG9A 4G8IB 2QR0A 1IEAB 3NESA 2G2RB 2IH9A 3H3PL 1L9TA 1YYLL 4JMNA 1D9KA 2K8MA 3CDFA 1I75A 5T5FL 2J57A 1JAEA 2CBPA 2J6EH 4ZW3A 5ILTH 1M7DB 3DDGA 5DT1H 1KGCD 2CK2A 2WXQA 3PL6C 1JHLL 1HEZA 3OKNB 2CR3A 4GQ9H 1JYWA 1QVOB 3IFOB 4P2RA 5F96L 1OY3B 1ML0A 1OQXA 4JY4A 1NCCL 5DJXA 5F7BA 4WNQB 2VDRH 3QQ9D 4KFMA 3GM8A 3U0TA 1G9MC 2Z35A 3J2PA 1EANA 4JFDD 4PIRF 4C59B 4MDIA 3CVDA 5F9JB 3B8YA 4OD3H 5A16A 4ELMA 1YEDB 4JM2B 4Z7WF 2AEWA 3SPHA 3QJQB 5JPNA 4IK7A 4O2EA 3P0YL 1JWSA 3BSZH 3BVWA 1XZWA 4IHOA 4OZIB 3QCUL 2QFRA 2WNKA 1YN7A 3QBGA 4HHAB 4KK9C 4ODVH 1N4XH 1X7TA 2F7OA 4HXBH 4AQ1A 3QAZB 4H1LA 5KVEE 1HKFA 2YARA 4HIXH 1RZIB 5AFAA 5E24E 3ET9F 1E67A 3AYMA 1XVSA 2WYTA 1AP9A 3BXNA 1J0YA 3R06A 1JV5A 3QDJB 5SWZE 4AWJC 1T7XA 4AQEA 2VDLH 5CLZA 1KDJA 5E99L 1FYTB 5JUEH 1CFVH 5AD0B 3B5GA 1GIGH 4ZAKA 3K2MC 2X2YA 4LDCA 2NX5A 4LQFL 1WA1X 4DP5X 4F91B 3WUZA 2MPVA 1KYOK 4ILDA 1ZLSH 4B50A 1QG3A 4DW2H 4WNSA 2DQMA 4W70A 5JLZB 1QFUL 4MYWB 4JFYA 2IANE 5KVDL 4NT6A 5TFSH 2BOBB 2X4SB 5FKPB 2Y5EA 2EC8A 4HJ0D 2UXTA 5AZEH 5L6YH 1WS8A 1S7RB 1A1NA 4OZFB 4OZGF 1E6JL 3WMQA 2QJDA 3L8QA 3ZR5A 2WQSA 5HYSA 2O61A 3FCTA 5DZPA 2J5LC 5A2JH 4UQ2B 3KYKL 1VA9A 4OLVL 4UBDC 3IRCA 4PJCE 1P7KB 1WV7T 2VXTH 3NP4A 3RVVC 1UM6L 4B7LA 2DM3A 4KROD 2G87A 4NQUA 4X9GA 4G8GB 2ZOKA 5B3JE 1ZHBA 2GTWB 3DBXB 1T21B 2O93L 5I6MA 3WKNA 5BXFA 4NZRH 4QY8A 5K9JH 4W9HC 2GK2A 2GHZA 4ICWA 3EJYD 1E4XL 3CFUA 3D30A 3ARTA 4PJBF 3LQMA 2PWHA 3N6YA 4Y4FD 1EXHA 2DBJA 2OA9A 3BKMH 4X6DE 1ZCRA 3QHFL 3QUZD 2APSA 2BIPA 5DLML 4OJFL 2AABL 2UV3A 2B4CH 1VEPA 2RTTA 4OD1H 4RZKA 4TSBL 3G6AA 1P6WA 3SBRA 1WE5A 1KJ2L 2VWEE 3D2UB 4M9PA 5AYTA 1YPZB 2ZICA 1KPUB 1VFMA 1AGBB 3QUYC 1G7QA 2EACA 4HIEA 5DFWH 2X1QA 4EZLA 2WW8A 3STLB 3T3PB 3K72A 3L9RB 2CJSA 4LIQH 4DERA 1KYFA 3PJNA 3QJFA 4MKMA 1DJWA 2Y36H 2CMRL 4QRUB 3UGXA 1CC3A 3QGVA 4OZGA 3A47A 2R9HD 4EUPG 4LVNC 2DWYA 2CHWA 2WCSA 2GI0A 2L04A 3MLWL 4APQA 4HC1H 4RGOL 4NUQA 2LTQB 1BIHA 4MGXA 3IJEA 4NRYA 2UZIL 3VJ6B 2DV6A 4KO7A 3TO4A 4PS4H 3LEYL 3RDTA 4NSKB 3BJ91 4MMXA 3SOBL 4L3EB 4HCIA 1Q4NX 4XH2A 3L5IA 3WELA 3GT6A 3MRRB 4KRLB 4PJEA 3OMIB 1X0K1 1SY6L 3K8KA 4EE2A 4FQHA 3HBPA 1PBYA 4UOJA 4MYPA 1ECYA 2A74A 4FNPA 5I8CA 5FFOA 2L7JA 1U8OA 3B1TA 3EFOB 4LFHG 4RA3A 5IF0B 3TV8A 1C5DB 1DVUA 1ZA6A 3UG4A 1R5IA 2D7NA 5E2WL 1F4YL 4DN3L 1R3KB 4AQZA 1GTFA 7CGTA 2VXQA 3PP3H 3HJEA 3RDTB 1KXVC 3ZY7A 1A6UL 3UTXA 3FBKA 4OD2B 3OBAA 3HAPA 1RZKL 4HZAA 3QCTH 4FTVD 4DGUA 1U92A 2AQPA 1NKOA 4FFYA 1JI1A 5DYOB 3CMOH 4ZDHB 3II3A 3UBHA 2B59B 4NHCH 3ARDA 3G6DH 3H6AA 3LEXA 3E0GA 4GI8A 4N22A 2Q3XA 1AR1C 2YPLD 3BLPX 1PKQA 5EUKA 4CGTA 4S0TD 1OM3L 3SQOH 3BW9A 3A4DA 4KQ3L 3D69A 3SDDA 3T4AA 3UYPB 4N3TA 1THAA 1K4CA 1NL0L 1MVUB 2Z7ZA 4PJDE 2L8AA 3O0RL 3MUHL 5FAAA 4OZFG 3HE7C 4ZPTA 5DRNB 4JFUA 1A6AA 4Y4KC 2H3XC 4LCUA 3DVGB 4DF9A 2XFXB 1SBSH 2JKTM 1JV2A 4IGBC 1GYCA 3NJKA 4QRFA 2ED6A 3I75A 3V5HA 2KH2B 2DQGH 2KSBA 2Y2YA 3OKDB 4K7FA 1CQYA 1VGKB 4M93B 4EDWH 2VDKH 1U36A 2BOLA 2ZOUA 1IXFA 5T1LD 3IDYB 2ILLA 5BS0E 4YPJA 1DBBL 1I82A 4NQSB 4H8WC 1A7QH 2VN6A 5KYYA 4YSDA 1TZGL 1KN4H 3V0EA 3ZMEA 2FRGP 3O6FB 3X3GH 3LS5L 3CHXA 2XT1B 3KWTA 1U4FA 3GC3A 2Z93B 3NRPA 4LCUB 3WKQA 4GAYB 4GSDL 4I8DA 1OTTC 4KDTA 5IUSA 2QQNH 3WNKA 4GW5B 2RB8A 1KNOB 3VFWB 3TYGH 1I3RB 1F2XK 3QB7C 4D7PA 3VO0A 4AM0Q 4PGBA 1GPOH 3GMQB 2R69L 4BFOA 4IIZA 3QFJD 3X11A 3HEIB 4UBDD 4FJZA 2CJUL 2A9ML 2R2HA 5L8LB 4DQAA 3MGTA 1EO7A 5J11B 4YDIH 3D7PA 3S96B 4OUOA 1TQCC 1ZSHA 3P73A 1DDTA 4MB1A 5FUOL 1RPKA 3Q0HA 1LEGA 1QEWB 3OJDA 4FC3E 4QGTA 3OKMA 1LL1A 1HEJC 3B3IA 4QGYA 1QYGH 5J6HA 3GSRB 2WQAA 3FTGB 4HS6B 4HMDA 4TVUA 5HGBB 3ZYJA 4CA4A 4G72B 2KSYA 2EILB 2W94A 3FFCA 3NQKA 4V1DD 3ECUA 2WBXA 3GSNB 2BNRE 4CSTA 4NBZB 4CN6A 2NY1C 3TLRA 4X4XA 2P5WE 3SKMB 3HAEG 3LDBC 5EU5B 2V9UA 3ETSA 5INCA 1J7VR 2IPUK 3KVDD 1CXEA 3BP7B 2Y6TE 3S37L 4HSQA 4XHJD 5CGBA 1EAJA 3HC2A 1A9EB 1KTKE 1NUDA 4MDJA 2QV2A 2ZXGA 5BO1L 4HS6A 3UGUA 2ZOLB 3X17A 3ZIMA 2XXMB 1LTXA 3K81A 4FL4B 5DHHA 4AENA 1MFDL 4AIZA 1JWUA 1JXDA 4PJFA 1RZ8A 2WXJA 3L3DB 1NPNA 3RX9A 3T0WA 3UGEA 4AC2A 3ECVA 4HJGA 4Q6IB 4XPBH 4B5EA 4IBYA 4FQQA 1DZBA 1CQKA 4GRLB 5FA4B 4N1HB 1TJIH 3MYJA 1IAKB 4H13C 2AEQL 1JPST 2YAEA 3HZKB 4JO4L 3VFGL 1C9SA 2MQ0A 3F5WB 1GSKA 5SWSD 1GOGA 1WD8A 2KDGA 4EJ1C 3E80A 4IDJL 4KJQC 4AGMA 2DYRB 4J6IA 1YYLH 1KLUA 4FD0A 4UT6L 3U79A 4LAJH 5ADOH 4P23C 4YJZL 1B4TA 4AENB 3SKJH 2CCVA 1MEXL 3EZ8A 3V7MA 4B9PA 2R51A 2AV7B 3J7HA 4HJGB 3VA6A 2M83A 4O2CA 1CYWA 1CDJA 2ZUQB 4HGKC 4NN6B 1IFGA 1XCXA 2J8UA 2PWEA 2QSVA 3QJSB 1CL7L 3C6SB 1I8AA 2DI9A 1AXSA 1AHWC 2DQJH 3VRIB 4OKVB 1CD1A 4XPAL 1WFIA 3WFDL 2HJKA 3GZPA 4JRXE 4WTQA 5D7IF 1SXAA 3FRUA 3S4SB 3SD2A 2VDKB 4ODTH 1LK2A 1NFDA 2HYMA 3N0AA 3S8FB 5KBMA 1JRHH 1KLFB 2LGNA 5CEZH 4ZMLA 4TUUA 3QJXA 4KOBA 4XN9A 4NBXB 3UAAA 2EDTA 5C2UB 1T7YA 4JGUA 5GS1C 4NNPL 2JWYA 4K3EL 2V17H 3IFLL 1JRHI 1WBYA 3L3KA 5D4HA 4ZS7H 5MEND 2QQLL 4JR9H 2M8XA 2YXMA 3CSBA 4PVMA 4CC0A 5J6GA 3BZDA 2YK1H 3CFBA 1LK2B 1NFDB 4N1EA 3BISA 4PI0A 1GW0A 5I76A 2H1PH 1Z9SA 2BY1A 1GL4B 1TSRA 3A6CL 1WPCA 1TTBA 4XMPH 4DWHA 1Z9LA 3IGKA 4R4FL 2I24N 3ZHDA 3VDCA 5D1XD 1COBA 4L3ED 3CVHA 4UMGA 4LKXA 4N0FB 2BJMH 2O5YL 4J3VA 2ZXDA 2ROYA 4JFOB 3JUYA 2WIMA 4L05A 2K6YA 2HFGH 3IF1A 5CZXC 3QVAA 3V4PB 3V0JA 2XQYG 4OV0A 2WTPA 2Z31B 4LHUG 5GGRY 4Z0XA 3EO1B 3HE6C 1MN4A 4JQIH 4BEIA 1PCSA 1T89C 3CSFA 3ZT7A 5D7IA 3H42L 3TVMD 5F70A 4AUYA 3HE7B 3MFFA 3T3MB 4LK4A 3VXSA 2WXMA 3JVGA 2TRYA 1CL7I 1FBKA 2V7HA 4HHGA 4MCYA 1JGEB 5IVNA 2VABB 1IBGL 4PVBA 4MMZC 1L7IH 3MX0B 2I69A 5EOCL 4XPBL 5EO9B 2B8OT 2CDEA 2AZAA 3KHQA 3QUXA 5LGYA 3C2AL 1Q5JA 1KY6A 1J1XL 2BFVH 1A2YB 4U4IA 4BWTA 4Z7VA 3IDGB 1XH2A 5D72L 5J1AA 3BRFA 4IBUA 5JW5B 1SQ2N 3VWJB 3KLHC 3NIFF 5B7EA 2R29A 5CSZB 5I1HH 5GJSH 2EXSA 5CMAA 2W59A 2MWCA 4GXVL 1WHOA 2XQYA 1W72B 2BJML 2O5YH 5D5MA 2N7AA 2I9TB 3WIHA 2V7HB 4U6HA 1S5HA 1EEUA 2NYYD 5JR1H 3RDTC 4HH8A 3GJFK 3BAEL 3W37A 5KEZA 5GGTL 4WI0B 5HDLA 4XVJL 3VG9A 2MH4A 3FB7A 2XWDA 2X88A 4E42A 1FO0B 4E0RA 1PL3A 5CP3A 1IT9L 1S8DA 4L1TA 2EUZA 3UTSE 3DX7A 1NLBH 2WZPA 5HY9B 2JSFA 1MCPH 4ZOCA 5DHXB 2BC4B 2HX8A 3L2NA 3VWKB 4HS3B 4PMEA 1FZKB 4DO4A 1OW0C 3APCA 5E94B 1J11A 4WHCA 1RIVL 2BY2A 3ZE0E 5LNDA 1MHEB 2G3NA 1YEIH 1AP2B 3ZRSA 1EAPB 1L7IL 5GIRA 3DGGB 3I6SA 2VIRA 1KCVL 4PJ7A 4ZW8A 1O6SA 3GSVA 3T0ED 3IB4A 5JIIA 3VI4E 1YJDC 2CALA 3MOQA 4WI0A 2Q7YB 4AGNA 4PBVC 1F11A 1P7QA 1CFSA 3DX1A 3DX9A 4UMSA 4FULA 1TKWA 2GY5A 2P42B 2DYPB 2NXYD 5TDPB 2MIZA 2WTRA 4A7GF 1J0IA 3HANA 5F1SA 1UWXK 3FUKA 4JRXB 2R4SA 5LCVA 3TF4A 5F71A 1IFHH 5DDHA 3HNTH 4ZUUB 2PXYB 1BQKA 4KVPA 2YR3A 4KZDL 1R24B 2KUTA 2R1XB 1EA9C 4Y2DC 2DM7A 2DB8A 1TJHH 3PNWA 2OTUA 3UC0L 2A6IB 3CMOL 1J0KA 3RPKA 4WCYL 4W81A 3GXMA 2CE6A 3R0MA 4ADGA 3DJZA 4R2GC 3MBEB 4CC4A 2JKRM 4KRPB 5BZDA 3CSYA 4R7NA 2M26A 5KS9B 1QTPA 4JPKH 2ADFH 3TV3H 3GSOB 3LQAC 2OSXA 3K80A 1D7CA 4OR1A 2AK4B 3RNKB 5GGSY 1RPQA 1TTGA 4L2LA 2GBTA 4I18A 5FYLD 1BLIA 1QFWM 1BEXA 3PWHA 5HHMD 1PKOA 4ZW6A 3O3UN 3IDJA 1HZHL 1GJWA 1CXHA 1Q9WA 3VFPB 1JOIA 4MZIA 4WAVA 2D73A 3SODB 2OYKA 1S7UA 2HVKB 3MV7D 4P07A 3NZHL 5AOJA 3ZUCA 3F12A 1DSYA 2X6VA 1A1OA 1V5JA 2PPEA 1U9KA 2ADIA 2YAHA 2EIZB 1VFAA 3GHBH 2VDRB 2E9GA 3VD1A 1Z9PA 2BVQB 1BBJA 3ALWA 4ORZC 4RQQB 1G7LB 2NXYB 4MJHA 3WNIA 2H1LM 4KJPD 1JPFA 2P8LA 1T6BX 4YNYA 4NO3A 1II4E 4P57B 1NBQA 1NSNH 4NDMB 4K94C 4PBXA 1EEYA 2ZE0A 4NNYB 1OE3A 2DQ6A 5G36A 4HC1A 3NCFB 1EEQA 1YN6A 2PLTA 2WVVB 2HFTA 3NDZE 4JKPH 1JZDC 1A6TA 3LRSB 2VITA 3FQUB 4UT9A 2E9BA 2C7UB 3T1WA 3NH7H 1XGYH 1WP6A 4OI9A 4C58B 3RTQA 1YDPB 1E28A 3DMMA 4NB7A 2AGJH 5CCGE 1E0OB 4PJBE 3SB3A 4AYBA 4YGVB 3BE1L 2OMVB 3MV7A 3EJYC 4XOEA 4GKSB 5IQNA 1CI5A 5TQ2L 3RYMA 5BVPH 1RZFL 1I7UA 2N0KA 3KPRA 4HT1H 4TNEA 3I9AA 1MG2C 2WLKA 4OZHA 4N0YL 2KERA 3L5HA 4K94L 4N2FA 2TSBA 4LL1A 4P2OA 3RTQB 4JHUA 4NO0A 3IXTB 3N85H 1F45A 4TNWF 4H0LC 3NFSL 2WYZA 4A7UA 2JCCF 1UXMA 2WMPB 1J0ZA 1JWMB 3HRZC 4HIJA 5J57B 1F50A 5JOPD 4YSAA 1RUAH 4BK8A 1H8LA 2FQGA 4X6BA 1V7MH 4HWLA 2GSGB 4YHKL 3SPVB 4MSWB 3ZZLA 3LZFL 1OP4A 3ZDZF 5DMIL 1HHJA 4PPTA 3CPUA 3GI9L 4AEHH 4QHPA 1YEEL 3OHMB 3MV9E 4LCYB 5HPMA 3R1GH 2YBRB 2XJLA 3WI9A 1U0QA 1NZRA 5KSVA 1TPXC 3E1ZA 4OZ4B 3VFRB 2EDMA 3DMMD 2X4OB 4UTAL 5FHBH 2J20A 5EHFA 2Q76A 1NGPH 2VJ8A 3IETB 3PDOA 2R27A 4BFGA 2X4TB 5LQBL 4UWQB 4RX4A 4X6BB 1ETZA 5IIEA 4P06A 5BMFL 1H5BA 1GJUA 2JKSA 3APFA 2VR4A 4KLYA 2VDNL 1TU2B 3HBQA 4M43L 4OTXH 1OAQH 3U0TB 4FDWA 4XBMA 1NDMA 3HRPA 1RZJC 1MWAL 3F05A 3N43F 3V2AR 4I9WE 1BV8A 3FQNA 3CIQA 4CBZA 4OSUH 1NFAA 1JWSB 4RMUA 3ZE1E 4M7LT 3D4ZA 1AAJA 2VLJD 1GS8A 4IOSD 4GUOA 1T1YB 1R9FA 5F9DC 1FCCA 1LP9E 2F1AA 1S54A 5ETUA 1WTLA 3MRLA 3POCA 4K3GA 3R7QA 1AVAA 2LU5A 1U8CB 2F1EA 4MJJA 4QHLB 3QZOA 5J8OA 2KZBA 4EN3B 1NC2B 4WHTA 1QI3A 3QIUD 4IIQA 4TUOA 2NXZC 5DJ0A 3WNJA 4PR5B 3MO1B 4U3XA 3TCLB 4OQ1A 1FVDB 1NBZA 2B3RA 2J5LB 2NZ9D 4XVUC 4M6NL 4HISA 1M7UA 3CXHJ 1UKQA 2GTZA 4KAQH 3FO2A 5EUOF 2GCYB 1QNZL 1U3YA 4JGJA 2XN9D 3OE6A 4XX1G 1DE4B 4WW2A 4XMPL 1KCWA 2NT0A 1AXIB 3RKDD 1YNKL 4FNLH 5EU3B 5FYLL 5BNXD 4ZSOE 1DJSA 5KYXA 2DQIH 1DP0A 1M7IB 2QKIB 3APMA 4YZWA 3KPRD 3AWEA 4WHTB 3NCJH 1XGQA 3L3OB 3F01A 3NZUA 2WD0A 5AOKA 2ZYRA 4QWWC 1MFCH 4ELMB 1R19A 4A67A 5H37A 3F6LA 5HDBF 1ZPUA 2JB6A 3VG0L 3C8KA 4NKOB 1SJXA 2CGRL 4PS4L 3RWDB 2PUQT 4XHJC 3SDXA 3SOBH 2B15A 4NUGH 1I8KB 2GFBB 4ABVA 1CR9L 3L7FB 5DJ6B 1DE4A 3BZFA 1T1XA 2R0KH 4Z7WB 4PJBB 4YXLH 3SO3C 4HJSA 3BAJA 1R2NA 1F4AA 1CURA 4H26B 1MI5E 4Z7WE 2KL6A 2EDLA 5J11C 5FECB 1XSJA 5D6DC 2A9NL 4J12A 5EOCH 1NGQH 5SWQA 5FYKU 2JB6B 4FTVA 4L3CB 1A4JB 4DVRL 3D39A 3ZZQA 4Y5XC 3QDME 3SDXB 5FS5A 3EGSB 5DURB 2VLJB 3D2TA 3ZYZA 4GAJH 2HFFA 4UT9L 3MUJA 3F62A 2OULB 2OMYB 4PJXF 2EIJB 3CZGA 4TOYL 1NINA 1IC0A 3UACA 2Y7OA 3Q3GA 4HX1A 4FX5A 2VMCA 2H2SD 5IFAL 1HTYA 5TD4A 2I7SA 1NLDH 4FP8H 5I74C 3CXDH 1KCKA 5SWQB 1Z5LA 3K72B 2O61B 2MPAH 1VFBA 4U3SB 1L9HA 4UQ2A 2NY7L 1Q94A 4LCIL 3RY6C 4AW7A 4WIQA 3AJ7A 3G08A 4B5ZA 3BAWA 3TN0C 4HKJB 4NM8L 1MF2L 4PJFF 2MCAA 5KZCD 4FQPA 4ZX6A 3NJNA 3OVUB 4PRAA 3CN3A 5JNYB 3I84A 3KL3A 4KV5F 4APQB 5B1JA 1TVHB 4I4WB 3MKKA 2HVJB 3NJFA 3VJ6A 3OAZH 4IGBD 4PJ9B 1OP3K 2Y69B 4PG9B 5LNGA 2FR4B 1HXYB 3F58H 2V9RA 2F5BH 2W92A 3PAVA 4APXB 1SN5A 2R23B 3TZVB 5F7EH 3QXTA 1JK8A 1RLBA 2H6OA 4YEEA 4JLRB 1XZ0A 4KJPC 2ZONA 5C0BE 2ALAA 2FX8H 4LCCB 4A6YH 1C3WA 1P2CB 5GRWA 5FUCC 5D7KD 1J8RA 3D18A 1RU9H 2MCG1 3T77A 1B2WH 3VXNB 2F7RA 2QLVB 2VZOA 1CG9B 2XBDA 2JTDA 5K1JA 3RTQC 1CO1A 1R3KA 3ROOB 3Q8AA 4L8CB 1T4WA 4DVBA 4JN2A 3DURA 4XNDA 3MJ9H 2Q86A 3STLA 1IGJB 3P0GA 2P3YA 4Y4HD 4DNLA 3QH3B 1Q9LA 2ZKYA 3A5VA 3UJIH 1F86A 5ERWA 3Q2LA 5C0DB 1NCAH 1H3UA 1YNLH 4WU5B 5LDUA 4GIOA 5SX5K 3BQUB 2GJZA 1UM4H 2YD5A 4S2SA 3QARA 1BRRA 3LHPL 3SYQA 3WTSA 4CNIA 2ZG3A 4Z95H 3LKOB 1KMGA 4QXTA 1X5HA 2IDCA 4XC1L 4YSSA 5ICYB 3HG4A 5I8OL 3IJEB 1CJYA 4HLZH 3ROOA 1V27A 4AYID 5D6CB 4Y5YC 1HHKA 4PJAA 1R4XA 2CKBA 1IC4L 5CCJA 1BM1A 5LGHL 3VH8G 4HHWA 1HCZA 3REVA 2YLKA 4XCYA 2Q8BL 4HWBL 1UQSA 4CVWA 2DW5A 1CXKA 1O5DT 3CLEH 3H9HA 3RVUC 4OCXL 2Y22A 5E2TL 2GUYA 1MW2A 2DJMA 1CDBA 1PYWA 5FOBB 5K9OA 2UYLA 2QDVA 1ZLUK 1ZSDA 2CG9X 2NX5E 1AGFB 2R0LL 3ARGD 5FR3A 5JQHC 1N4XL 2EXYD 4GAGL 4M7KH 4LP4A 3H2WA 2FUTA 1BEYH 1HDMA 5L88H 4OJCA 1PLAA 4I13B 2RALA 2OSWA 2DF3A 3DX6A 2YFOA 4HJJH 4N20A 3L2LA 2DDQH 2X3CA 3SCMB 1F6AB 3HE6B 2OPCA 4G43A 1GRWA 1YYCA 4X6DF 4V1DA 4XOBA 3QNFA 2BNQE 4OJAA 1N5YH 3AVEA 4G1MB 1E65A 5CJ8A 2CUAA 4FCHA 1D5MA 1ZVSA 3Q5TA 3WKPA 5IB5A 1S9WB 1ZT7B 3MV9B 5I74B 3QDGB 5C86A 1VHPA 3WEXA 4YHOH 3MLRL 4KPHL 2HRPL 4Z7VF 4FXKA 3APDA 3B3IB 4HALA 1ID5I 1VPOH 3P9MB 1BWWA 1L7TH 1IL1A 1YNTB 4H2CA 1TTCA 5HGBA 2W9EH 2EADA 1T5WB 4PJ5D 3KGUA 2KMWA 2YEVB 1E3ZA 3BPNB 1ORSB 2A1WL 1F4XH 4GO6B 2W81C 1BZ9B 3US1A 4XN1A 2LW3A 3GIZH 1DQQB 3L3JB 1OGSA 1O5PA 4O58H 2VR9A 2JJWA 2EIEA 3ETBJ 4OM0H 1XMEB 2E76C 1E4HA 3GGWB 3VSTA 2YHGA 3BAKA 4AQ1C 1N19A 3QDGA 5E2VL 2EICA 1ONQB 1UM6H 2ZKWA 4R5VA 5DLLA 2WLZA 4ZO8A 2DPKA 3D08A 1F18A 5DQ9B 1GY2A 2HJLB 4FZ8H 1JTTA 4IYKA 3C08L 1NQBA 3LN5A 3O41A 3HZYB 5KSBB 4OCMC 1NEZB 4W6XB 3QUKA 5LBSA 43CAB 1IAII 2XRAH 4AG4L 4MA3A 3KJ6L 5IBTL 1ZLWK 1LQBC 1T20B 2WWMC 4YDMA 5FKAB 2MCPL 4BQ9A 4WO4D 4E5XB 1K9TA 2YXFA 1OPGL 1FZJB 4Z7UA 1ZS2A 2BCKA 3MRHB 3OKMB 1SLUA 1WRFA 2MOGA 1XBRA 5JHLL 2OMXA 3TA3D 3GMOA 3SGDH 3QG6B 1G9HA 2P5PA 4PJDB 4DKLA 4NC2B 2XKNB 1CK0H 3AB0C 3FQTA 3PWVA 3UROR 4GG8B 4QNPF 3HI5L 4JZJC 2Y5TA 2UWEB 2VLRD 3NIGB 3B6SB 3SKMA 2J1XA 43CAA 3FONB 5T1DL 1B2YA 3OPZL 3C9LA 3RWGB 4O5LL 1AGCB 5INCB 1JVLA 1I9IH 3CH1A 3RY5A 3C5JB 2AJXL 3U4EA 4HEPA 5J6SA 1C8PA 4Z8FL 1NCAL 4ODUB 5DVMA 3MODL 1DHKA 3KXFA 1K8IA 3MVSA 4FZ8L 4LOUD 4YQXL 2YGQA 1BGXL 2AQNA 2H41A 1YY8B 3GXDA 2UZIH 1KULA 4NNXB 1JPSH 4UQCA 1T89A 3TC9A 5EIVA 1K2DB 2BVTA 3B6SA 5TH2A 1IAIL 5JZ7D 2BIOA 2GK0A 2QADD 3POHA 4JM4L 4U1MB 3ISWA 4F1ZA 3QC6X 5KVMC 3GS0A 3QFJB 4DEWA 4LB8A 1FNGB 1CF1A 2DL9A 1G7JB 1MCHA 3C5ZC 3KCPB 2FSDA 2FNBA 3MV11 3QFJE 1C7SA 3PDGA 1U8QB 3G6JA 4XCNB 3T6QC 4FGMA 4I3RH 1XIWB 2VAAA 5L6YL 4Y2DB 3ARWA 5ILTL 4JM2F 3B37A 1VEOA 2NR6C 3D05A 3NJXA 4MJIB 4YMPA 1E2WA 4JNXA 1H3GA 2LLNA 1LVEA 1U8KA 2F08A 2WBKA 1PIGA 3BUPA 4OCRL 4P5TD 4M1GL 1BQHB 5IGXL 1BECA 1O0AA 4OIAA 4F27A 4FKEA 2DKMA 4ZPVB 3LKSB 2KPWA 5DRWA 1TVBB 4PJGE 4IAQA 1SOXA 4LGRB 1ZOXA 3K1DA 2H1XA 3MC0A 4X7TA 4DQOL 4POZD 5I6XB 2LE9A 1INQA 2K7QA 2OXHB 5JXED 4J3SA 4EI5C 1EJOL 2V7NA 3IJHB 4XI5C 4FMKA 5IQMA 5E9DE 1SJVA 1QBLL 4ZXBC 3T0BA 3IS1X 5I9QC 3KS0H 3MRFB 2H0EA 1S53A 1LM8V 2NYZA 3JV4A 3WUWG 2F8OA 5EWIL 4G6AC 2TAAA 4HGWB 3RIAF 2IGTA 5C2BL 1E40A 2D0GA 1JE6A 1ZK9A 3X1NA 2NY2C 3WFZA 1X6LA 1U8IB 2YS4A 3AS0A 4U31A 1VJMA 2AS5M 1H3TA 2DWEB 3QPQD 3W57A 2VW4A 3NZ8A 2NSQA 4ZUTA 5KS9F 5EZIH 3TWCH 4LIQL 1WAEA 1MGYA 1YMHB 3CFBB 2ZYHA 3WFCL 1M6UA 3L3GB 4EBQH 4W9LC 4HEPG 4XAWL 3LQZB 3KEHA 3WJJC 1R3HA 3K4AA 1QM8A 4F7TB 5CSZA 1MOEA 3MNWA 4QRRA 3ZTNL 1LDPH 4JPIA 1G9EA 4WFHD 4EF3A 1MJ7H 5DMGC 3QA3B 4NPYB 2ZCKH 1T3FA 5CEZE 2R2BB 1NBCA 5KVFE 5BRQA 2AI0L 2H45A 1Z9NA 3AM8A 2AJYH 5IHWA 2GITA 2NY1D 4HA1A 4A7TA 5C1MB 1NANI 3WTXA 5B6WA 2MPAL 1PS3A 4OFQA 4O5LH 4UU9B 2HKAA 3WTWA 3QP3A 5B1CA 1ROWA 3WYRA 4QYOA 2YUXA 3EO1A 5JHLA 5IEHB 5I16B 5HJDA 3ZDYB 1D7DA 4PTUB 2VL5B 3IDNA 2PP7A 4OLYH 2NLJB 3B2UD 4ALAL 1X0I1 4UT7L 5G4OA 1ZLSL 1B4LA 2D3JA 5DUBA 1AO7B 2DEWX 1SMDA 2EDNA 5F89B 4O4YL 4B9CA 3T3PF 4YAQA 3ULUH 1JF5A 2H0JA 5BVJB 5K9QG 5SV4A 4PJFE 1NAMH 2W0FA 2W91A 1V3JA 3GM0A 4OI7A 1HHGA 2VLLA 3KJ6A 5JW3H 3J27A 1NDGA 5ESVA 2JKIS 3IFNH 1MLBA 5CS7A 2L7EA 2XY2A 4ORGB 5E6IA 3R06B 4IBZA 1IEBA 3QQ4B 1ZJBA 4TSCL 2XTJD 3WJMA 4QXGH 4ELKB 2W60B 5L2JA 4S1RH 2OM5A 2OQJB 1H8NA 3H6JA 3OXRA 3E9UA 1IC5L 1A6VH 1SFDA 5AD0A 1MRFH 2NY4B 5BUPA 5D1XE 3ZYIA 5BRZD 2NX5B 3NIFE 4K3DL 4PLKC 2CLRA 4Q74A 2QQLH 4XO4A 1R3IL 2DICA 3O2DA 2PPCA 2YRLA 2BSTB 3H9SA 3ULSA 1MFBH 3AG3B 4FYSA 4U4BA 4L6RA 3UZQA 3Q6GL 3BESR 2FJHB 4CVUA 4JDVA 3WIHH 4Y4KD 1FP5A 4MQXD 4CJ0A 1KSRA 3HOGA 3MRQB 2DWTA 3CFCH 3IJ8A 5D7KE 1TMQA 5E4AA 5A40E 2CGYA 5BQDA 3MLZH 1CDIA 2VNCA 4MD5A 3GRWA 4UF7C 1TEYA 4NKMA 4W1TA 4Y19A 3NT0A 3U1PA 3BEWA 4KJYA 5TQ2H 5CF3A 4QLWA 3AYNA 2A83A 4BFJA 5EWIH 3H4FA 2FK9A 4I18B 1RSYA 4HWBH 4ZW7A 5SWSE 2Q8BH 4HIHB 5DHEA 5SX4I 1QFWH 3QYCA 4GEIA 1UUNA 4NO0D 2DQJL 2ZWZA 3QI9D 3BC9A 4LU5H 3GRWH 3F7LA 2IDQA 5IHUH 3VFPA 5DD6B 43C9A 1X4XA 1ZHBB 3DBXA 5F0LB 2YDOA 3FQXA 4U6YA 4U1JA 2RH0A 2I1XA 3HN8A 3CCHB 1ZV9A 2FH8A 2WBJB 5H2MA 3ZR6A 1JFHA 3PWUB 3GEWB 4M5ZH 2WO2B 4TPRH 2OI9C 3UTWA 1BYOA 5I1GL 2EC9T 4KI5D 2R56L 1L9QA 4LO9A 1G1CA 1ASPA 4U1IB 4OGQC 5BW7C 5D1ZC 1VZGA 3EHBB 3DHMA 5I1CL 5A45A 1XB3A 3NAAL 3DX4A 5IB3B 5J4MA 1FORL 2H0FA 1ZHLB 5D7JC 4X7EC 3ORJA 2FH6A 4Q56A 4HKZB 4XO8A 1M6OA 4LLYB 3EHBC 2XWXA 1PVHA 2DQEL 4YDNA 4UILL 3C5ZA 4OLYL 5FLUA 3GBML 1RCYA 3N41B 1OSYA 1R3JB 2ENJA 2IFGA 4TUKH 1Q1PA 4UZSA 2I07A 2YOCA 3IAQA 1BQLH 4Z7QE 2GPZA 2O5ZL 2IV8A 5JOFA 1J1OH 3HVNA 3W1ZA 3LKQA 1RK0B 3HI6H 2OZ4H 1Y6MR 4JO2H 4ABWA 3NEXA 4Q9QH 2E9IA 1TJIL 1U42A 3HMXL 1VFAB 2JJVA 3MUY1 3Q2WA 4DAGH 1UM5L 1PZBA 3HKZA 1RIUL 4OGXH 3PGCA 1PEWA 2AKRA 1WT5A 3LSOB 2AERT 1KB9J 4BH8B 2G30A 2Z8SA 3U0WH 4FEMA 1FZMB 4FA6A 4AL8L 1KV7A 4X4MA 4JFEA 4FHBD 3CN4A 4MMXC 4L9LA 1AT9A 3S3JA 1KG0A 1RURH 4XTRC 4OD2A 1KCUH 5C0CE 2MKWA 3CZNA 1DBBH 1SNRA 5CU5A 3FQUA 3VU1A 4L1LA 3ARDB 3G3LA 4PYHA 4LLUB 3QJHB 3S6CA 1JDAA 3S37X 1QSZA 3MGAA 4ISVA 3C5XA 4FQJL 5D2LA 4CL7A 4BQCA 3QEUA 5F8UA 3H8NA 4I87A 1T03H 4YO0A 2R8SL 3F84A 1QSFB 4S1RL 4X80H 1ASQA 1P4BH 2AC0A 2CO3A 1Z1WA 2OZ4L 5D1QA 3QO0A 5E1AA 3ZDYF 1ETZB 3QAQA 4AGPA 5DUJA 4H1LG 4OY9A 3CFEA 5JJNA 4K3DH 4M5YL 5LXGH 4HJ0C 4QHNA 2E7MA 1A6AB 2F5AH 4H5SA 1BD2E 3MR9B 4F7EA 3LH9A 1M05A 2KYIA 3IKCB 4PJ9C 5I19L 2VDQH 1G6RH 1FG2B 2ICEA 4MNGE 1MCCA 3QEUB 4FKHA 1PGRB 3ARGB 5DHVA 3ARVA 2B16A 4CMHC 1FL5A 2FSEB 4ZO6A 3MA9L 1S8LA 4LHJB 3RURA 3RGVA 3QIBD 2XWCA 2EIKB 5H2NA 3ZU8A 3KD4A 3QXAB 4EUPB 2VLRE 1H6TA 2VMJA 2VSMB 1HHJB 4LCCC 3WN5C 1U8MB 3D25A 3IXAB 3IPFA 4KXZH 1N0LA 4BD4A 4F7EB 3DV4A 3X3FH 4XMKL 4PWEA 3D8MA 4AQAA 2NT1A 5BZXA 1QFWI 5ADOL 1DVYA 4PR5A 3V4VL 5CLTA 2X4OA 3RB7A 3NJIA 5F7UA 1P1VA 1WF5A 4W4NA 3QYMA 1AACA 5DURD 1NSNL 2A2QT 5SWZB 1NTDA 2NZ9C 2R15A 1PFCA 2WP3T 2A6KB 1E9PA 3N55A 1MH5A 4M5SA 3VH8B 1T6WA 4BCYA 5EB9A 5FW7A 5FGCB 3QIWC 4NQED 1ITBB 1BBDH 1R46A 3LJ3A 4Z18A 3N42B 3GXNA 3MRKA 4GNKB 2BIQA 1BQLL 4WW2F 1X6NA 4G8GD 4XPAH 3ZBMA 5JQIB 4WWKC 2AITA 4HH9B 3O6ML 5SX4H 1H3PH 5B1AB 4P46B 2J2ZA 2LV4A 1WBXA 1FBIL 4A2LA 5HD8C 3EO9L 4U6TA 4ADIA 2XICA 2UY6A 3RVTD 1LXMA 1ZGLA 3B9EA 4YIQB 1ILUA 3BP7A 1EH9A 4KKCC 4QOKB 1WH0A 3UCQA 4A7SA 5JOPE 2WXRA 2FX8L 4CMMA 4NT6B 2XA8H 4XNBA 2LAAA 2WZPD 1V54B 1UFGA 4OFDA 5TPWH 1KB5L 2XX1A 1E9OA 3HPJA 4JAMB 1YEDA 5BUAA 2V5YA 1CZ8L 3LS4L 2Y9RT 2Q3AA 3N42F 5CFHA 5A6MA 1XD1A 2J88L 4MX7B 2VLMD 1QLFA 5IHHA 2X4PB 1SYVA 4NM4H 3GPSA 1C8QA 3PV6B 4RSYA 2IANB 3B9KD 4AC4A 1YNLL 2X40A 2UZXA 1MWAH 3MV8E 4UQIM 3RFRA 3U9WA 2ZCZA 4G8GA 3VYPA 3UIZA 1HL8A 1XGPA 3IDIB 2G9KA 5FLVA 4QHKI 2B2XH 4V2CB 3CQFA 1MFMA 1FFRA 4K9EL 3NIFB 1L3NA 1KN2L 1N8ZA 4PJ8D 1GZQB 2ADGA 4K8RD 3MLXH 2IDFA 1AIZA 4Z78B 2G9HB 2CRYA 2XG4A 4ZTEA 3DIDA 2DQDL 3M1BB 1IO4C 1WHPA 2H26B 3OF6D 4OKVA 2ZG1A 4XP5L 1D2PA 1GZHA 3KPSE 2EDFA 5H37G 1N70A 3O6FC 2K8QA 4H25B 4NQCE 3BWAB 3O0LA 2VZ1A 4PJ9A 2CGZA 2VDNB 3ZE2B 1GGIH 1T4KB 4DKEH 3FT0A 3L9RA 5JW3L 1Q9OB 3AY2A 4N87A 3GPEA 4X6CE 5I6LA 1IAOA 1WISA 1PDKB 3FB8A 1C16A 1A3RL 1FE8H 4G3YL 1KTCA 3FQ4A 2BY0A 3N44B 3H9YA 3VXUB 5AZ2L 5JMRA 2NY6C 4X6CB 4XN7A 4DGYL 5IVXA 1A3QA 5DD3L 3M1BA 4Y2NA 1WAAE 3CN2A 1EHLL 1IX2A 4WU7A 1NCHA 1RK1B 1P2CA 5AQ0A 1RERA 1VACA 3BIKB 2ZKHL 1NMBL 1ORQB 4MXVF 3CHQA 2NZ1A 5EN2A 4DPBX 5D7JA 1TPXB 4PJXB 4BM7A 1U93A 2F58L 5JHDB 2YXWA 3WKML 3AROA 3PXJA 3I6LE 3CG8A 1B6DA 1G1KA 3AY4C 2WY3B 2NNCA 3A67L 3DRQB 3EBAA 4F33B 1SDYA 4HD9A 2A9MH 1TQBC 5FYJD 3WTTA 2EH8L 4P3CH 1SQMA 4Q9RH 4YHOL 5T5FA 1AI1L 4X31A 2FX7L 4Z7NE 3CC5B 1TTFA 3OAYK 5C0JB 4FXGC 1A47A 1IGTA 4JUTA 1TVHA 2VSKB 4I4WA 5EU7C 2ZSWA 3RRQA 3VSQA 3FQRB 2HUHA 2IBBA 4MD0B 2MOVA 4XPGL 4Y88A 5C09B 3V6BR 1DYZA 1GHFL 3M46A 4YHPB 3QNZB 1WBZB 4BINA 2X1OA 2J4WH 3D33A 5IROD 1TTRA 4PJAF 4R6UA 5DEGA 4H4NA 4X2UA 2I35A 5C6TL 2B59A 1EV2E 1M3IA 1EXGA 2BVPB 1T0OA 3O45B 4GAAA 4TF4A 2IADA 2AK1L 5E6ZA 1HILA 5DYFA 4B60A 4MA8H 4NQVA 3O2VL 5EBWA 2EO9A 4N85A 3QPQC 5FF6A 2QGCA 3KDMB 2WM0A 4P59L 1XFPA 5AUMB 3SGJC 5C0GB 1NM9A 1PG7W 3HB3C 4PWGA 2NW3B 5G4NA 4DKAA 3UYPA 2PR4H 1HL4A 3ME0B 3LD8C 5IT2H 1F90L 4Z3EA 1URIA 5DJDA 1E90A 1MDTA 5T1KB 5J1AB 3SBPA 5AWNH 4R7DA 1J9QA 2GTQA 4ZPTB 5DRNA 4ZS6C 5AAMC 4B9FA 3VXUD 2AMGA 4WFFD 2BVOA 3S5YA 2HLAB 4F24A 4BH7B 3P9LB 4LPUA 1KYDA 1Z5YD 5EOQL 4A2DA 5MEPA 4JB9L 4YVNA 1ZA3B 1OOWA 4ZYKB 2M2DA 3WIFB 3LKOA 4JGMA 1QRNE 4RAVB 1WYJA 5E23A 3LB6D 2CK0H 4KUCF 4E2OA 2BY3A 1W0YT 2JQZA 3BIAX 3BWSA 3FRPB 3I02B 3IMWA 4MRBA 4R0LA 4XAKE 4WO4B 4YWGL 3PUCA 3T65B 3VTAA 1BVZA 4KJWC 2UY7A 3PQRA 2YD9A 1FRGL 2VERA 3DVIA 4PCYA 3WO4C 4ZDHA 4GYBA 4ODXA 4DGVL 1FI8C 1PQZB 3E8UL 4ERSL 3QHTC 5C08B 3MODH 3NIGE 3P9MA 5IV2B 2R4SH 5LCVH 6PAZA 4KXCA 2X4QA 1P5VA 1EBPA 3VFWA 3MN8A 1FLTX 4QJ4B 3EBIA 2ZWKA 3KH3A 2PO6C 4J4PC 1JUFA 4F7CA 2FNWA 4G83A 5DEJA 4WO0A 2YQ3A 4WEBL 4FI6A 3TM6A 2LAGB 5CP7B 4AIOA 3ZL2A 4IOFC 1LMKA 3LZOA 4JCMA 5B3SB 5EEZA 1BVLB 3AWGA 3KNBB 5D5MF 5D2NC 3R1GL 4KK5D 1JZ4A 4A04A 5IJCC 4ZNEA 1DQDH 4RFEA 5C7ZA 4Y19D 4LDOA 4I3RL 5L0QC 2O26U 3DVNB 4KKLD 2BM3A 1BJMA 1ZLEA 4LAQL 1R24A 4TL5A 4R7VA 3N1MC 4MA1C 2B20A 3PREA 1QWUA 3LIZH 1D5IH 3QEGH 4GSRA 1DANT 4L9DA 4E5XA 5I75C 1MI5D 3DYPA 3QAKA 5IROA 4HKXA 3KWWA 2XWBA 4MVBD 5GRYA 3P77B 3BCFA 4X0NA 3ILPA 5E8DL 2QSCL 5HJGA 3OXSB 5DHMC 1YEGL 2ZX8A 4D0BA 5JYMA 4FS0A 4LXFA 2WN3A 3FN0L 3E1F1 5H4YA 3FRPG 4X5XB 2D2CC 4G42A 3LXCA 2GUOB 2HXAA 2WWNA 4BRJA 4N8CH 5T1MB 3H55A 3GKZA 1HVXA 3BP5B 5J13B 1J8KA 1Q9KA 4N0YH 5FO9A 4JG9A 3RNQB 3GZQA 3IMRA 1J18A 1JF1B 4KKBD 1KZYA 4WI8A 3QSKB 3LH2L 2ISDA 1BFVL 2HB0A 5C0BA 3CX2A 1RV6X 3NFSH 3WJLC 5I8KL 1B9ZA 1FZOB 3HCVB 1AI1H 3FUHA 3BRDA 3GUTA 2P5EE 3HE6D 1CLOH 5DRZA 4HBCH 3WXWL 3G9AB 4N5EC 3O3AB 3T6WA 2ZD0A 3QAZC 2JI2A 5D6DA 3DHJA 5CZXD 1S46A 5TH2B 4JQIA 3F3HA 2CXKA 4BQ6A 1DBAH 3VRJA 1C5BH 4PJEE 4TKWA 2HPTA 2J8HA 3ZT6A 1CU4H 5I30L 2K4AA 4PY8J 2J3SA 1E3FA 4ZFOA 3SDAA 4N8VA 2BCMA 3UBXA 2BMKB 5HYFA 3DARA 3LPOA 4PGDA 1GVIA 1U8QA 3FCBA 3G6JB 3MRHA 3F6IA 2DTSA 2ZCKL 4AZ8B 5A2FA 1NCJA 1X4YA 2X9XA 4OGYH 4Y16B 4DCQA 2Z3FA 3ZHLA 1EEYB 2X38A 3S4SA 3RE0A 2VXUH 1E4WH 5IEKA 4LDEA 4YUEH 3Q8FA 1IVLA 2P46B 1UXWB 1KIPB 4Q6IA 3ZE0B 4QLRA 4MJ5A 2HX7A 4M43H 2BVEA 4LPTA 1KEGL 4L48A 4PJ5E 4DIXA 5FA4A 3A22A 1F3JA 3RWHB 4HOWA 2V3EA 3VXMB 2E59A 1A3LH 3ZTCC 3ZQ9A 2PO6D 1AKJD 3BFOA 5DS1A 1IQDA 5SX5H 2BZ7A 1CDCA 1D9KD 1J5HA 1OHQA 1GIGL 2GBAA 4KPHH 4FABH 5AVZB 5DVOA 4Q97A 2EIBA 3SBQA 1DQMH 3GB7B 4GKLA 1S7QA 3PHQA 1DJXA 3EO9H 4KO5A 1NCBH 2UZYA 1HZKA 2AFNA 4PWHA 1OTSC 4LCWA 2VC2H 5B8CA 1KIPA 1ZPLA 1TZGH 4KDTC 4K8RL 4XO5A 4HYXA 2Z31C 4D94A 3ARBC 4LKXB 1CD1B 4OCXH 4MZ3A 1NUNB 2V2XA 4JZJA 4KKAC 4QRPA 4V1DE 3MRDA 4ZUTB 4G59C 2UZYB 4D3CH 4Z7OB 3BN9D 4BE5A 4L8BB 1OF2A 3CX5K 1CWVA 3LNGA 2I60H 1CFTB 4IGBA 3GJFA 4KVNH 1KFAL 4M7KL 3NS0A 3SQBB 4QTHB 3U2SA 1FVEB 5CAYB 2HT4C 2FGZA 1U8PB 2XTJB 4OFIA 5EEWA 6CGTA 1BVNT 2ALWA 1J48A 4RWYL 4XB3A 3OLIA 3VXSB 5TE6L 1NFIA 5B39G 3O8XA 3VFNA 5J89A 2GJ6E 2ZXAA 4OI8A 4FNRA 1CLZH 1P9MA 3G5XB 4AV5A 2NX5D 3U7YL 3O4LD 1U3HB 2VE6B 1MREL 2ZOWA 3UTTA 4L8SB 4ZD3H 5FB8A 1INDL 2VC2L 5FA3B 3DHPA 4KZ0A 4NZDA 5CN3A 4F7PA 4WF7A 2WXOA 1C1EL 3Q6FB 2P48B 1U8NA 1C8SA 4XXWA 4E41E 2HLFD 2WLIB 5D55A 1JS4A 2J73A 1TU2A 2FYYB 4OLXL 4AX3A 4HULB 4KKQA 4DKFL 1Y7VA 3AWFA 1HOCB 2DQHL 2NTUA 2CLVA 4HUXB 3CVHB 1G7IB 3SDAD 5I8EB 3FHEA 5DEFA 4FCAA 3GSXB 3RL2B 1IMHC 1YEHH 2QT6A 3JTTB 4AMKH 2E5EA 2Y01A 3DI2B 5FDWA 5L4JA 1RIHL 4Y5VB 3MNDA 1L6ZA 2V5RA 1L0YA 2XPGA 5A7EA 1YMHA 4AZUA 2V2TB 4PW3A 3JWOC 1AIFB 3QIUA 4L1DA 2Z55A 1CICA 1CLCA 1QBMH 4XMUA 1AXTH 3Q05A 1SDDA 4I3GA 2RR3A 4ZFGL 2WXLA 2R2CA 5E2VH 3DX0A 2Y7QB 3PQYD 1HINL 1RFDH 2L0DA 2HA1A 2ZKHH 1NIEA 4N2KA 1S2EA 5FWRA 4CVXB 3O8XD 2C4FU 3VXRE 4DAJA 4AUUA 2R2BA 2W07A 1FBBA 2WVUA 2VXUL 5I1IH 3QORC 4EIBA 4A37A 4KHXL 4QRSA 3QWNA 5EBGA 4NKQB 4DUXA 1J5OH 3TN0D 5D2NE 3M1OA 2X72A 3QQXA 5DD1L 2EDRA 4LPXA 2GCYA 2XRAL 3AG1B 5F88B 3AS3A 2ICES 2NLJA 2OMWB 9PCYA 3EYVB 1MZZA 1GC1H 1U6AH 1OAKL 3KXFE 5DF0A 1UWFA 2QTEA 4TOYH 5DDHB 1MHPH 2JK5B 5IQ7H 2P5EB 3FS9A 5EOTB 1QKPA 1U3HD 4TRPH 3BGMA 3TEWA 2WGXA 1JZHA 3LVEA 2ZG2A 2YZ1A 5A2LH 3QORD 3CFMA 3JWOH 1S8DB 4J23A 4R4BA 4JO1H 4RRPM 2VDLB 2WB7A 1FFQA 4D8PA 1WWBX 1JP5A 3MGOA 4H26A 2JKWA 1XH3B 3BKYL 4NJ9L 4XMXA 3KPLB 3O3DB 1G7PA 1LNUB 4DTGL 1IM9B 2JK5A 2K70A 3U7AA 2YQ2A 1K5NA 4CDGC 1A7PH 4YX2L 2C4XA 5JW4M 1T04B 1RULH 4FTVB 4JPQA 1QR1B 1V3MA 5F44A 1MRDL 3D12B 4OF8A 1OWWA 1ZS8B 3M1CA 2VLJA 5DK2A 4MQTA 3WFCH 3FQWA 2OMYA 5A44A 15C8H 1QRKA 4D8PB 3H3BC 2HRPH 3WY4A 2YUWA 5ANMA 3U6XS 5JIPA 4OUUA 1V10A 3C6LD 4HXAH 4P2RE 3IAPA 2AQSA 3L4WA 3QDHA 4WW1B 4Y0GA 4L5FH 1S7UB 3AXIA 3LYRA 1E5CA 3D0AA 3C8DA 4JRYE 1AY1H 2DRUA 4K3JH 1YEFH 1SEBB 1O6TA 4KQ3H 5BPPA 3D85D 3QORA 3PNWB 4BEZA 4CC4C 2XN9A 3N06B 2BXYA 5BOPA 2XXGA 1ZTMA 2C9RA 5D7SL 3VGBA 4M6ML 2AEPH 3PJSA 4KVNL 2XWJB 1QHJA 4NAJA 4NPKA 1OHZA 4H0GA 3Q48A 2Q1EA 5DZJA 3IDXH 4PV8B 4RISL 3MLWH 5FM5M 1F1DA 4M6OL 4XBPA 4UQBA 4UQ3A 4XNQA 3SKOA 3QIUC 3FQXB 2WQXA 4M1CC 2L6XA 3FN3A 4Y4FB 2XJKA 3EOBB 1XF2B 3TA3A 3V4PH 3NG5A 3KJ6H 5IBTH 3T04D 3AGVA 3QORB 4NRXA 3TN0A 3UABA 3WNOA 1U3ZA 4TNFA 4N9OB 3LRGA 1G7MA 4YOKA 1OCWL 4L5FE 3VWJD 1A9BB 3NFPA 5KANG 4XNXL 1XEDA 5FO8A 4XMKH 1E9QA 1KGCE 2FWOA 1GMEA 4YC2B 2G5BA 5AALA 1OSPL 1OE2A 2PYFB 1ES0A 4JJOA 4KH2A 5HHOD 3HHSA 3PG2A 1I1CA 3ROLA 5KBKA 3KLSA 5HYIA 3HNSH 1KGYE 4KRPC 4P2QA 4Z7VE 4MMXB 2X6UA 2OR7A 1ZLUH 2VZTA 1O0VA 4NKDB 4GP8B 1FDLL 4DEUA 1MCWW 1JNHA 2YMXL 2CBOA 3ASOB 5KANI 4F37F 1T1WA 3VYOA 3WTYA 1BEYL 3TA4D 3ELAT 4AE1A 2MQ3A 1T0NB 3MJ6A 2DZEA 1UZGA 5F3HB 1KJ2B 1B0WA 4MRCA 4XRCB 1S7WB 1FN4A 3ES6B 5DZVA 3RWFB 3RHWF 1KIRA 5KSBF 1Z3RA 1HWGB 4IU2A 3I6GB 4J3OG 1NH6A 1FF5A 3KL5A 3LIUA 3UIYA 2YPKA 3U30C 1WT5C 3K6OA 1I1AC 1UQSB 4D0CA 2Z1PA 3G5ZB 3EJPA 3MBXL 4JRWA 2LU3A 3T0AA 2IAMC 4BBWA 2FECI 5G5DB 3ZKNC 4RFNC 3W38A 4NQXA 1NGQL 3CZEA 1JFPA 2R29H 3FSOA 3LNIA 2E4TA 1AMYA 2BS71 2EDQA 4ONGH 5EEYA 2EO1A 5DHVH 3TL5A 1I1AD 2K3HA 5IIEB 4JQXA 2BNQB 3V8CA 2W65B 3JVGC 2X0WA 3UAEA 4CVZA 4U1HB 5SWSB 3LQAH 4JANA 3U48A 4KUCD 1VESA 3IDUA 1T83A 3DX6B 3RUGE 4WEMB 3TBSB 1AOZA 3UJTL 2DWDA 2HWZH 3SCMA 4JS7A 2Q8AH 4QXGL 3G6JF 4BIKA 5IFAH 5BR5A 2QBWA 2ZCLH 3CZJA 1YQ2A 2H32A 5IMOA 1LE9B 2I9LB 3L54A 2ZWYA 4UHRA 4XR8C 1ZHKA 4JO2L 5E99H 1N3NA 3WD5H 1ZT4A 1BFOA 4OLVH 4CW1B 4JJ5B 2A6KA 4BK4A 2R0WH 2OCJA 1S9WA 5JXAL 4PYGA 4DPCX 4X9YA 5SWSA 3HFML 5KVGL 3IFLH 3TBSA 5FXCH 5C3LD 4XP5H 5BOZG 3E6FA 1EEZB 3GFUA 4NZTL 4AJVA 3P2TA 1UB5B 3TVMA 3F85A 4P46A 2YK1L 3QR0A 4IHOB 4HAFA 5EZIL 2Q76B 3QHZH 5EULV 3UC2A 2OMBA 4U0QB 1OLZA 1PZDA 2CDGA 3QXAA 4EUPA 4GRLC 3CHRA 3QUXD 1V7NH 3VWKC 4I2XA 4XNXH 3L95A 3S96A 1VFOA 3BPNC 3HMXH 4L8DB 2AT9A 1FO0H 4KNTA 3C2SA 5T8IA 2H2PD 2DM4A 5HHQB 2G2RA 3ARFA 4KKNA 4GPVA 2N01B 3FFCB 4PVLA 2FJFB 3C87A 3C8KB 4D3CL 2FYVA 2KZ1B 5KBPA 4UNUA 3TBYB 4L1BA 1MI5B 3HC0B 4OKDA 3CHOA 4HFWA 3UTQB 3MOAL 4IBWA 1PEZA 4FG0A 5EU5A 1G9MH 5PCYA 1E27B 2ZQKA 3IFOA 5AEAA 4XC3H 4F2EA 3WEOA 2H1PL 5BO0D 4LSSH 4WNQA 3QULB 5IQ9A 3WL9A 3TFKC 1EGJH 3FQ1A 4MXQC 1WAPA 5EEXA 1MLCB 5ID0A 3VGGA 4XBGB 4HG4K 4BFEA 5I8OH 1RAMA 1J12A 3ZQWA 3A23A 3QWQB 1QUNA 4GO9A 5BJTA 2K9UA 1FORH 3ATAA 3MJ9A 3W9EB 1TZIA 4GRWH 5E2JA 5L2KD 1RY7B 2DQUH 1OAUH 3ECWA 3MROB 3B2VL 2F74A 5AB9A 1KIQA 2Y72A 3HLAB 2QKIA 3HHRB 1A0QH 5D70H 1THCA 1OGPA 4OVVA 1ECZA 3ESPA 3PCYA 4TSAH 1YSOA 6PCYA 3PPSA 4MA8L 2X5PA 3OLEA 4KOCA 1HE8A 1YJDH 4IRSC 4X4ME 1FFTB 1UD5A 3MMEA 2G75B 4YHMH 1P8HA 1F42A 1YMMB 1R3IH 3RWJA 1VFBB 4MJIE 1YEJH 2GK0B 1AHWB 2IV9A 2W38A 2ZNWA 1NCWL 3EFFA 4MMZB 5DJ6A 3VFOA 3MRBA 3QDJE 4LSSL 1IIIA 4N2LA 1VSCA 2VDMH 3UTVA 1A1MA 1RZ7L 5DZAA 5DS8B 2L3BA 3T0EC 2CO6B 2VM3A 3KYMA 4KQ4H 4LGPB 5AB2A 4MQSA 3W11C 1CD9B 1BVKB 5TGZA 1AGBA 2WLMA 4AL8H 1HEHC 2FR4A 3VFMA 3HZ3A 4FQIL 5CGTA 3DTXB 5HVHC 4HCGA 5LQBH 4ZTOL 2J5WA 3GTVA 4H20H 2BNRD 5LBSL 2HFEB 4NZ8A 1TEGA 3EFFB 3PU7A 5GSVB 5F0JB 4DN4L 1AGDA 2XZCL 3LKSA 5LUMA 3RL1A 1XR9B 4U0RB 1E2VA 2Q2LA 1DUZA 4IBVA 1WCBA 1LO2H 5F0MB 3WDJA 3EBHA 3PQYE 5D9SA 2FBJL 4HUVA 2YSSA 5G2NA 3WQJA 3HBGA 1MCBA 5AAMA 4OLUL 4B3EA 1IGCH 5CD3A 2IMMA 2Q8AL 4PRIB 1ZGLM 2VJ0A 4L8CA 4JO3H 1J10A 3FT3B 4X7FC 1AZNA 2IH1A 2B77A 3OGCB 2IH3B 1YUHA 1TJGH 3JBG7 2OYMA 4GBRA 3FTUA 1I9EA 4WEBH 5LBVA 3KLHD 1KG9A 3BCDA 3PHAA 1XR9A 3G5YB 5JXAH 1UKSA 2A77H 1UA6L 3D3VE 2A74B 5T33H 1FIGL 2F2HA 4U1GC 1FA4A 4WJG3 4QF1B 4UT7H 4G8FA 4WGWB 5EN2B 2FWUA 3TEUA 4N2OA 4R7XA 3V8OA 1BM3L 1KPUA 2VDMB 1ID2A 4EI6B 4YH6A 4I5BB 4M6NH 3LN4B 4EDWL 2VDKL 1YUHB 4GIPD 1AJ7L 3M17B 2HT2D 5AVUB 4DGIH 4R7DB 1OWRM 2F18A 1DN0A 2GT9B 5L2KA 4DW2L 2FLMA 1Y18A 2APWA 1WICA 4PJIA 3HE7A 4YSCA 5E7BA 4LKCB 2K78A 1TCRA 4WCYH 1PYWB 5IESH 3BQVA 4GQRA 3BW9B 3JV5A 2A9AA 3QRGL 3ISYA 4OFYD 2OW7A 4BWBA 3GTTA 4L4JA 3VXPA 3GMRB 3FRPA 3DWTA 5G2DA 3QNZA 3FT1A 1FVCB 3CFQA 3UONA 1MJJA 4TNVF 4ZSOB 4B95C 5CBAA 4NUGL 4RCAA 5GQBA 4GRWB 3AM6A 4YZFF 1B88A 4GT0A 4GG6A 3EJCA 4FEIA 4YE4L 4JHZA 4Z7NF 4X7DC 2IGFH 4UZGA 2CLZA 3AMLA 1G9ML 3LIZA 4F3FB 3HZMB 3LDBB 4E9TA 3HC3H 5CXPA 3QJTB 1YJDL 2DH3A 2P7TA 2Z7WA 5D5MB 2GSMB 3V52L 2CR0A 4KKAD 5IV2A 3NACH 5FGBC 5J5EA 3H7BB 1FNEB 1T66C 1HYSD 5KSUA 2VTFA 4AEFA 4PB0H 4OLWH 1OGTA 3SDYL 4YDJA 1DVZA 2FLBT 3GMLA 3V4PL 3ME0A 4YLBA 2C1OA 1FO0A 2DJ4A 2B14A 5CP7A 2C9XA 4QRTA 4Y4KB 1OK0A 5HGDB 5FYJU 1HOEA 3RWIA 2EO7A 4MXQD 1MHCB 1FFOA 3MXWH 4HCRA 2IC2A 1FAIL 4XVTH 4KKCD 4GW5A 1QSVA 4MNQB 4OLZH 4UYPA 3WIFA 1UA7A 3AAZB 2OJZL 1SYSA 3N5AA 1RZGA 1BJ8A 1AOHA 3FQYA 3IT8D 3MQIA 5GGSA 4P2YA 3UG5A 1SJEB 3CSTA 1EZVX 4HJUA 5C0AD 5J9PA 3C8HA 5JPMC 2H2PC 5KJ4A 2IWFA 1AKJA 1BVOA 4RSVA 4R8WL 5J06A 5ICUA 4H40A 4XPTH 3WFHA 1JI2A 5I6NA 1AE6H 5IK3A 4WK4B 3KPSA 4PGCA 4NX0A 4LOUC 5T3XH 4AVJA 3K6SA 4NQQA 1CF8H 3Q7JA 3UDWA 4HMCA 3UAFA 1XSOA 4PRHA 5HYQB 2DD8H 3VVWA 4OF7A 1ERNA 1QLRA 4M3HA 4LSPH 3DDLA 3OMAB 4ZG1A 2VLKB 3PXHA 2ESVD 3BDXA 1WG3A 3QXUA 3BT2L 1SHSA 4NGHH 4L4VA 1QKOA 3J8F7 3P4NA 5I1HL 3QCVL 2A7BA 1AKJB 1FIGH 1XXFC 1KT2A 4IOSA 4NFBA 1E42A 1RK7A 1FHNA 1WZ1H 2XZQH 2R7EA 4PRIE 4A55A 1Q38A 3HCVA 2XY1A 3APNA 5E5MA 3TA3C 35C8H 4OV6F 3OKOA 4OVUA 3I3DA 4Y9FA 3BZ4B 4KXAA 1EHXA 1OE1A 5G2AA 2BPBA 2PYEB 1ZHNB 4RNRA 4F2FA 5FW8A 2WWMD 3D3VB 5EFIA 5PAZA 3BFWA 3L6FA 3P4NB 1FH5H 2GG1A 4XX1E 1MW3A 4XXDA 2E7DA 2FDBP 4FFZL 4N8VB 3UBXB 3P77A 1NEZG 3QFDB 3F7RA 4CC1A