3EH5B

Structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Combined microspectrophotometric and crystallographic examination of chemically reduced and X-ray radiation-reduced forms of cytochrome ba3 oxidase from Thermus thermophilus: structure of the reduced form of the enzyme.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3eh5B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3eh5B02
4HYJA 1WS7A 4HIPA 4PXFA 5AX1A 3VHZA 3T71A 4X32A 1N68A 4GP5B 3ZEVA 1AACA 3CAPA 1KCBA 1ASOA 1R84A 2XVBA 3QJRB 3MBWB 3TBBA 3UG9A 2PPAA 1PLAA 3PAZA 2Z73A 1BXVA 1I53A 4P5RA 3HANA 3ZPRA 1ILUA 1NIFA 1KDJA 3FSZA 4KLYA 2KSAA 1SNRA 1ZDSA 4HCIA 4L0PB 1E5YA 1IC0A 3NSFA 2CBPA 2HZHA 3ABWA 2PP8A 5A7EA 2IWKA 3X1NA 3FQ2A 3A7KA 2IH9A 4FA7B 1A4AA 1JZJA 1IBYA 1W8EA 2VMJA 3X1GA 4YSUA 4BK5C 4ENZA 1S51A 5G2CA 1P8HA 4E9YA 2KS9A 4A2DA 1XMEB 2QPDB 1ET5A 1IXFA 4MD1A 1ET7A 4RH4A 3UONA 2Q9OA 2UX7A 3FU7A 4HHGA 3OMAB 4BEYA 1TEFA 5TK4A 3NSBA 1HAUA 1DYZA 1N70A 1BM1A 1L9HA 1QKOA 3S3CB 2J5WA 1JZFA 1MG3C 3OE9A 4QIDA 1MDAA 1NTDA 1BYOA 2H3XC 1AS6A 3N2JA 3ZX1A 1KGBA 5H2OA 3NYAA 3SQRA 1GUEA 3PPSA 4DPAX 5G36A 5I6LA 1FBKA 4QKTA 2XU9A 2Y03A 5EN0A 5B6XA 4BUOA 1FBBA 4OV0A 4HHWA 3UTYA 4CSPA 5AWZA 3NSYA 2I85A 2Y01A 4YSOA 4PXKA 3UTWA 1MZYA 4HCFA 1V54B 3FU8A 2A3TA 3FSVA 5C1MA 2J57A 4UANA 1E30A 1RZPA 1CWQA 1ZV2A 1ETJA 2PPCA 2I20A 2LNLA 3HEIB 1L0MA 3PLYA 2LLNA 1NIAA 3P0GA 1R2NA 1UATA 3FS9A 2ZWNA 1VLXA 3OMNB 5D4IA 1RKRA 4MFHA 3AW5A 4BEZA 3NSCA 2VSKB 3OQRA 2EIJB 5B1BB 4XXJA 3QBLA 4N4WA 1ZIAA 2I7SA 3TU6A 2Z55A 2Y69B 3JT2A 4A68A 2XV3A 2UXVA 3AYNA 1KCWA 1FA4A 4JKNA 2X88A 1L9QA 2FJSA 3NJIA 2NTUA 3IN2A 2GHZA 2I7OA 3AG4B 4L6RA 1KG9A 4KO5A 3QBIA 5A8EA 1HFUA 1AS8A 5IY5B 5J7AA 4YVUA 5I6MA 3KJ6A 2B08A 4HZ1A 2H5UA 3HARA 4W1TA 1IKOP 4AX3A 1GW0A 4AKOA 1ASQA 4LDEA 1TN5A 5EHFA 4AKPA 4EF3A 1M57B 4G70B 2HXAA 1GS8A 2G87A 2CUAA 2UXTA 2AVFA 2ZONA 2WO2B 4A66A 4JKVA 2GI0A 5H2KA 2J4YA 1JXDA 2H47C 2AZAA 2XUWA 4Q8BA 2YCWA 5DYSA 5I5IA 1GY2A 4DP2X 5H2MA 5I5JA 2RACA 4WW3A 4YSSA 5B6ZA 1SHXA 3S3DB 2KSYA 1Q5IA 3CVDA 4N8UA 1E0PA 2XX0A 3QAPA 2AANA 2X87A 2AT9A 1SDDB 2JAFA 3DTUB 4YSQA 1L9RA 1AT9A 2I35A 3X2QB 2R7EA 1PMYA 1AANA 1BRDA 3ZPQA 3FT0A 1VGOA 1SDDA 2WO3B 1S8JA 3DKHA 3UAAA 3VGAA 4FBZA 1XB3A 2CCWA 2OCCB 2AZUA 3AG3B 5I6PA 2Y04A 1QLEB 1SF5A 2YARA 2YDVA 1ZIBA 2QT6A 2HRHA 3OE0A 2R4SA 2YCYA 2HX9A 2XLLA 4QI1A 3ABLB 1X0K1 1QHQA 3PAVA 3HAPA 2ZXWB 5I6KA 1AG0A 3ZIYA 4GRVA 2DV6A 5I6NA 4YVNA 3QJVB 8PAZA 4TXVB 3ZDWA 4QRYA 3WI9A 4MQSA 2Y02A 4DPCX 4XTOA 4YSAA 1IW9A 2ZIYA 1RCYA 2YAQA 3MX0B 5KKHA 2WJKA 2QPEB 1A4BA 1AP9A 1NPNA 5B6WA 3X3CA 2BP8B 2CJ3A 2YAMA 1GS7A 1ZPUA 3UADA 1AQ8A 5BR2A 3HAOA 4G7RB 3WQJA 4YL4A 2BP8A 4Y9HA 2WJLA 5B0WA 5FJGA 3HB3B 3RYMA 3WNIA 2GSMB 1NICA 4DP6X 2BRDA 3FSAA 5PCYA 2BW4A 3NP4A 3UGEA 2W8CA 4UG2A 1V10A 1TEGA 4F7KA 5D4JA 2IWEA 1M0KA 2HRGA 3GYRA 2BP0A 1NPJA 3CVBA 5DHGA 3FU7B 1AR1B 2CALA 1JV6A 1ASPA 1PCSA 4WAVA 4GYCA 1X0SA 1A4CA 4GYBA 4MD2A 4UAHA 5G28A 3D12B 1LN6A 3NYKA 4QLWA 2PP9A 5G53A 4M4RB 2FNWA 3ERXA 1C8RA 1L9TA 2YAHA 3BQVA 2QDVA 2IH8A 4NAJA 1F56A 3T6ZA 3OAXA 3X1FA 5B2NA 2BZCA 1PZCA 1J9SA 1F88A 2PCFA 4P5SA 1BXUA 1NIDA 5F8UA 1NIBA 3V9EA 1GZMA 2UXGA 4A2FA 5ANHA 2BHFA 4KO6A 2PLTA 1QKPA 3S3BB 1AZNA 4WTQA 2GC4C 4DP5X 3NSDA 1JZEA 5B3SB 1HZXA 1Q5JA 2FWLB 3WKQA 1FWXA 2VN3A 3PXLA 1KMEA 5ITEA 4KOBA 1ZDQA 1J9TA 1OF0A 2DY2A 1BXAA 2OJ1A 2W88A 1EZLA 3V2WA 1C3WA 1AG6A 2B3IA 2NTWA 3PDSA 3NP3A 3QJTB 2IDTA 3H4HA 3EMLA 4L35A 1TU2A 3U25A 5AZUA 3TA4D 1F4ZA 2GBAA 1C8SA 4WKXA 2EIMB 4GXFA 3NJJA 2MTAA 1H2SA 4EIYA 2VSMB 1ET8A 3EF4A 2Y1AA 3TASA 3NS0A 1NWOA 5ETZA 3QJUB 5G2DA 3UZCA 2YXWA 2AFNA 1CYWA 3JTBA 5B34A 2ZZLA 4DKLA 1U19A 3X1EA 4BV0A 4DP0X 2QDWA 2PPDA 4W9ZA 1BRRA 2FT6A 2JFCA 3PAUA 5H2NA 1PZBA 4DP4X 3CODA 2PP7A 1OCRB 1W6WA 3IEAA 1S54A 1IBZA 5BR5A 5B6VA 1R1CA 2IDSA 1GR7A 2VM4A 3V9CA 4E9RA 3ASNB 4X4KA 6PAZA 1SF3A 1IUZA 2XXFA 3CDZA 1KDIA 4HAKA 1MZZA 1JZGA 2FTAA 4LDOA 5H2JA 1NWPA 2UXFA 1RZQA 4AMIA 1OCOB 1KGYE 3QBKA 1PLBA 3L45A 1M9WA 2PCYA 3QDCA 1BQRA 2X72A 3QBGA 2HX8A 3UTVA 3PQRA 1DZEA 2OV0A 5JJEA 3NJKA 4HCGA 2BW5A 2CAKA 3WNJA 1KV7A 2WSDA 5A45A 4DP1X 5B7MA 3HASA 3QJQB 2XV0A 2YAFA 4E9TA 2I21A 3UZAA 4DP9X 1L9OA 3C75A 3NT0A 4NC3A 3EHBB 4YSTA 2YAEA 4EA3A 2UX6A 1OE2A 2F93A 2PPFA 4DJHA 3UTXA 2FQEA 1PAZA 1WA1X 3QJSB 3S8FB 1AS7A 2R7EB 1AOZA 2IWFA 1JVOA 3T6WA 4NB7A 2YAOA 5I28A 5AFAA 4MBSA 2FQFA 1S8LA 3X1BA 1H68A 3EH3B 1KBVA 3PWHA 1L9PA 2XV2A 2KSBA 4G7SB 1E12A 1UCQA 4A2GA 1OE3A 4G71B 1AIZA 4JQ6A 1T5KA 7PCYA 1KYAA 1NZRA 1A3ZA 1ILSA 3CVCA 1GU8A 4BVNA 2VW6A 4XTNA 4AI7A 4AKQA 4XT3A 4DPBX 1A65A 4E9SA 1J9RA 2BWIA 2FQGA 1PZAA 4G7QB 4N4YB 1CUOA 3EH4B 2N0MA 1OCZB 1IW6A 1BAWA 2J55A 3WG7B 4LDLA 5B1KA 1OE1A 3AYMA 1SJMA 3AG2B 4KNTA 9PCYA 1J9QA 1TKWA 4E9QA 5B7EA 2GB2A 3ABGA 5G2AA 4DP7X 4A4MA 3QPKA 2JXMA 3QAKA 1P8UA 1W6LA 1EHKB 2P80D 1GYCA 2YAPA 3NJNA 3C9LA 7PAZA 1URIA 3X3BA 1M56B 4KO9A 1CYXA 2ZFEA 2R4RA 4PCYA 4K5YA 4DAJA 1OV8A 1PNCA 5F7BA 1AZBA 5TGZA 5B35A 4AMJA 2FQDA 1FFTB 1ID2A 4BDVA 3IE9A 3NJLA 1YLBB 3FU9A 3ABKB 2L6XA 2IDFA 1JV7A 2BP0B 3C9MA 1E65A 5D4HA 2P80A 1E67A 4IB4A 3UABA 3RZEA 3SBRA 1AZRA 2DWTA 3H4FA 2XX1A 3OD3A 5B7FA 3SBQA 1DZ0A 4JHVA 3WIAA 4YSEA 1UAZA 1JXGA 3H56A 5I5MA 1J5DA 4GBRA 3WKPA 3T6VA 5B1JA 2XYBA 3SN6R 1X0I1 4YSDA 3KW7A 1XIOA 3S8GB 1PXSA 1WAEA 4XTLA 5G54A 4KNUA 1SHWA 2PPEA 1PNDA 3FPYA 2FT7A 2Q5BA 1XB6A 3DQBA 4FPDA 4BXSV 4TL3A 2DWSA 4Q89A 2MRYA 4YSCA 4HALA 2TSBA 3DIVA 1PY6A 3ABMB 4A2EA 5H2HA 2RH1A 5TK2A 5I26A 4GP4B 2DYRB 4F2FA 3REYA 2IDQA 2E86A 2BO0A 5AKRA 4BDVB 4BWBA 1JZHA 2HX7A 1SFDA 6PCYA 2M3GA 2YQBA 4JHUA 2TSAA 4AZUA 1PLCA 5B6YA 4GP8B 1F50A 1GS6X 3VI0A 3AM6A 1GSKA 4N6HA 4GPOA 4A2HA 4BWUA 1M0LA 1QHJA 3VVKA 1E5ZA 5PAZA 3ASOB 2FT8A 3OE6A 2IDUA 3FSWA 4ZK8A 2XXGA 2YCZA 4G72B 2HLEB 3OE8A 3FYEB 4BWWA 1A8ZA 3PCYA 3QQXA 3N55A 3ZBMA 2VT4A 2YCXA 1BEXA 5AHZA 3AG1B 4E9XA 1OCCB 2J56A 5LDUA 5DHHA 3HAQA 4UHRA 1WA2X 4IARA 3PXOA 3CDZB 3IN0A 4PAZA 3IBOA 1CC3A 2EINB 5F7AA 3UAEA 1JGJA 4HYXA 1BQ5A 4E9VA 1QNIA 2IAAC 1JVLA 1WA0X 3VG9A 5FC9A 2Y00A 4HWLA 2GC7C 2I1XA 3ODUA 2EIKB 1M0MA 4K9JA 4KNSA 2DYSB 1L9SA 2HPYA 5ITCA 3NY8A 2YXVA 4BWTA 4KOCA 2PEDA 3T9WA 4X1HA 1BYPA 3KW8A 1S52A 5E9NA 2EILB 3MBVA 3D4SA 1QM8A 5H2PA 3AZUA 3NJFA 4YSPA 3UACA 1JOIA 5LWEA 3SBPA 3VW7A 1BRXA 1BQKA 2JKWA 3NJGA 1X9RA 5AX0A 2EI4A 1J5CA 1OOWA 3EH5B 5H2LA 3OMIB 3AY2A 4EJ4A 4J4QA 2ZOOA 1GY1A 1XJIA 4M3HA 3TBCA 1MGYA 1JZIA 5A44A 2VM3A 1HAWA 4KO7A 3RFMA 1PF3A 1TN0A 4A67A 3G5WA 1X9UA 3GXUB 4UF7C 1NINA 5B1AB 1PXRA 3PBLA 5AZDA 2GIMA 4XT1A 1JFPA 4E9WA 1O0AA 2VW4A 4F2EA 4FAAB 2BZ7A 4X31A 4IAQA 1XB8A 3NY9A 1SFHA 1WS8A 4CSZA 2BWDA 5AHYA 3OM3B 4KNFA 4MQTA 4JR8A 4NERA 3FPXA 3NJMA 1NIEA 3NJHA 1CURA 3V2YA 1V55B 1AZCA 1AZUA 1ADWA 4DP8X 2F95A 1P8IA 1B3IA 5JJNA 2XWZA 1AAJA 2JAGA 1MG2C 3CZUB 3T6XA 3FQYA 1NDTA 3DDLA 2VW7A 5B1JC 1VJMA 5I6OA 1KG8A 1PY0A 3CG8A 3FQ1A 4YSRA 2NRDA 2YDOA 1JXFA 5JJJA 3GDCA 4GY4A 1KBWA 3COCA 3T45A 1S53A 3BVDB 4BXVA 5H2IA 1JERA 3FYIB
chains in the Genus database with same CATH superfamily
2BVPB 1G7LA 3TESA 2BIOA 5GGUA 4F8QA 1TTCA 4I1NB 4KTGA 1NC2D 3LPGA 5C09B 4NQDB 4AL8L 3ROLB 1INDL 3MGTA 1DQTA 3ARGB 1QWNA 3FQRA 3PAZA 5DA4A 4N3TA 2JJWA 4EOWH 2NY6C 2IH3B 4J4PA 1SNRA 1GC1H 1G6RA 1E5YA 1JL8A 2HVJB 4P3WA 4WWKC 1NC2A 4AYFB 2VDQH 1JZJA 4FS0A 3TEXA 2IH1A 2OCFD 5FHBH 2WZ6A 1C08B 1EVTC 2IDCA 3RPKA 4W9GC 4DZBB 4PR5B 1ONQA 1WRFA 3D30A 1MHPL 1JV2A 1ET5A 4DK3A 3DPBB 3A4AA 4BFOA 1A0QL 3NSBA 4M9PA 2PYFA 4N9GB 5H37A 1LL1A 4DN4L 1J87A 3EBIA 2FX9H 1S7UA 2ZWKA 1JZFA 2VLLA 5IK3A 3PJNA 4LASH 1MF2L 3QEGH 1VF5C 1KGBA 4L1BA 5TGBB 4FYTA 3PPSA 5MI0B 1FBKA 4BQ9A 4MA8L 4FABL 4HUUA 1AD9B 2P5WD 2FZ3A 5J89A 1FGVH 4FJZA 3CSFA 4ZFGH 5EB9A 3TJHD 2Y01A 3H53A 1SY6L 1E8YA 2OQJB 2VO5A 2VIRB 2X0WA 3QNYB 4AEIL 2RALA 2E7LC 3PLYA 2XIBA 4G11A 1VLXA 3RBGA 1U8LB 2P5WA 2WUCH 1XZ0A 1JWSA 2WAHA 4BEZA 4Q0XH 4H5SA 4PRHE 5E94B 4KTDH 1DUZB 2DQCH 2O1AA 3OGCB 1MCDA 4N5ED 4LGRB 1ZGLA 1FZMA 3MCKB 3CFDB 3MUGB 2XV3A 2KYIA 2MHAA 3GKWL 1G9NC 3GIZL 3SE8L 4ZPVB 4QXTA 2EDOA 2XWBB 4TVSa 4YDIL 4HG4K 2CKBH 4KTEL 5D7SH 2I7OA 3PWJB 4L6RA 1E9OA 3HS0B 2VLRE 4LOUD 3WN5A 3MOQA 4IRJC 5BXFB 3IDGA 3FT3A 4Y2NA 1MQ8A 4KK9C 4I48A 1J0YA 3M17B 4G1EB 4QXUH 2XIIA 4NZTL 1E3FA 1XGZA 1ZT1A 2E8YA 2IADA 1TN5A 3UCRA 1Z9SB 2AQSA 2JKJA 4RX4D 2WO2B 4N5UA 4KGLA 4XMKH 5CN2A 2R4RH 3MV8D 3FTVA 1QUPA 4JMXA 2XTJE 1HSAA 5ID1A 4WW3A 4U0RB 2ZXCA 5CGYD 3RL2B 2C9AA 3HR6A 3MV7B 4JO5A 3OXRB 1HZHH 3CDCA 1G9MC 3KPSB 3MVSA 2XBZA 4MD4A 1RH8A 3MRBB 3FT0A 1LNUA 3H3KA 4RX4A 5JQ6L 5IMLA 3P9LB 1YC7A 3ILQC 1B3JA 4YHNB 7FABL 3PGCB 3LOWA 3MV8A 1RU9H 5C8JA 5BRZB 4LQFH 3P77A 2EYRA 4YHLL 4OZHE 1WDAA 3HE6B 1U92B 4NPJA 3VWJD 4DQOL 4LCYB 3DARA 1YJDL 3FTUA 3GD1C 5IG7A 4NKDB 3D3VE 3MUZ1 3PWVA 4KKAD 1QLFA 4G8AC 2EE0A 2DQUH 5KSAD 3UP1A 4BGDA 1WFMA 2B2XH 4XHJD 3VWKB 2H9GB 3L3JB 5A43C 3TCXA 1OSZB 2NY3C 2V17L 4NDMB 4MDRA 3VWJA 2DBJA 2W65A 3NIGE 3Q05A 3OTTA 4JPVH 2FO4B 5DJ6A 5DZJA 3W37A 1MWAH 5KSAA 1QRNE 4AGPA 1AP2B 4M6NL 5C86A 4FX5A 1CE1L 1EEYB 4P2QB 4MVBD 4DGVL 1I8IB 4IKNA 2CXGA 3B1TA 2GTZB 3FZUC 1FAKT 2KMWA 3QCUH 4WNQA 3E8UL 4ELKA 3HUJF 3OLEA 4FNUA 5FECA 1PG7W 4HWEL 4LVOC 5IQ9A 4QHLA 4ZQTA 1MPAH 3LS5H 2YS4A 1YHPA 3D4ZA 4JB9H 1Z9LA 2EVGA 2GTWA 4UAHA 5KS9E 3RIAF 1BD2B 3NA9L 2YAHA 3L3IA 3O6LL 3ULUL 4CKVX 2YEZA 3QIUD 4GW5B 4OI9A 4ZI8A 4RAHA 1E8ZA 2DQFB 3NRQA 4HBQA 2OMVA 4FI7A 1PZCA 1F11B 2C1PB 4EI6B 1DFXA 3LZFL 4LCWE 1NGQL 2CMRH 3RZCC 1WAAE 2W59A 3FB6B 3GZOA 3MGOB 1G0YR 4OGXL 5I1CL 4LLMA 4S10A 4PJ9C 4AOFA 2IPUK 1KMEA 3QIUA 3HFMH 1F1AA 2Z7UA 5DJ0A 2LE9A 4AQ8A 2FLBT 1SEQL 3U7YL 4J39A 3HJ0A 5D2NE 2IDTA 3LQZB 3QS2A 3ULAB 5B38G 3PXHA 2V5SA 2EDWA 3VI3B 1LK3L 1U8QB 2R2CA 1KBGL 4OJFH 3D69B 5MERB 2QVMA 2V9TA 5ETZA 2YXWA 4PV9B 4PJXA 1BVZA 1S2EA 2AFNA 3V2AR 4HFUL 4DKLA 1HYSD 2ADFL 2XBTA 1VADB 3GMPB 1FG2B 3OR6A 3BGFC 1XF3B 3JV6A 1UFUA 2X53A 3BIBX 1S54A 1LWRA 4NNPH 3T8VA 1P1VA 1OGAB 3ASNB 3N85H 2AGJL 4HAKA 5J1SC 3CHSA 3ZDYE 1JZGA 5FUOH 2OR9L 1F3DJ 4HV8A 4ZUUA 4RVBA 1G6RL 2E9GA 5FW8A 5BZDB 3SPHA 1RUAL 4ZT1A 2ZF9A 4FKEA 4M5YL 1PLBA 2VDMB 3MRLB 5DHVB 4F8LA 5JJEA 4JFED 1A6ZB 3QJQB 3ECQA 4FLRA 2DQGH 2DWDB 4YDJA 2PWEA 5IQ7L 5IVXA 4LCIL 1QLEH 2UWEE 2W0KA 2FWUA 3WGUB 2YAEA 4KUCF 4WTZA 1UH2A 5D1XE 5HGAB 3LXBA 1NH6A 1IBHA 4JFEA 3X14A 4N2DA 1B2YA 2EICA 3CK0L 1HNFA 5AW1B 4NIYE 3Q44A 1S8LA 4D0CA 2XV2A 4KVNL 3CZEA 1F6FB 5DJXA 3LZPA 5I0DA 3RI5K 5ENWA 4GSXA 5HJ3A 5DUPL 2R9HD 1MAKA 1PLGL 1LD9B 2AJ3B 3R7RA 2FJGB 3JV0A 4XTNA 5AL8A 2L7JA 3VXOB 3WIIL 4PP2A 4WAFA 1R3KA 4YHZL 2EAEA 2ZCLH 2XFXB 4MLSA 4MJ2A 5KVFH 3CSYA 4B7IA 4XXDB 6FABL 4DTGL 3OPUA 3H9YA 3RVTD 3ZE1B 4D94A 5E6IA 1KB9J 4QXGH 3OG6B 3QUMB 4PJDF 4ABUA 5C0AE 4QYOB 3T08A 3WCYA 1E4KC 3FFDB 1TVDA 1QNZH 2V7HB 1GGCL 1KJ3H 1FL6A 4JZJB 3VXTA 4Z3EA 1D9KC 2NXYB 1MCOH 2A9AA 1N8ZA 1PNCA 3RFZB 3CC1A 3V0JA 3V5HA 1EAJA 1ND0A 3TN0D 4NCDA 1FO0H 3LKQA 1HDMB 3ABKB 3QWQB 4GAJH 4P4RA 5AZ2L 3C9MA 1W72A 1X5KA 3MOAH 2EDFA 4Z7UF 3V5KA 5I73B 4Y4KC 1I7TB 3GJEB 3R8BB 5F9JB 3P4MB 3NUKA 4PRAA 4B9GA 1N7MH 5DYFA 3L3GA 2OK0H 4OLVH 4GW1B 4N1HB 2X1PA 3RNKB 5CILH 3TN0A 4J23A 4IW4C 4GPVA 2BSBA 3GXPA 5A3IC 1RZJL 2LFEA 3QAZC 3F85A 3RB5A 3O3AB 3NZ8A 2O5ZH 3CPUA 2UZIL 4LSSL 3ATEA 3O6FD 3DQBA 4FPDA 2ZKHH 4OGYH 3UJTH 3MRMB 4ZJ9A 3WLBA 5D8JH 3T0XA 43C9B 1NM4A 2C9RA 5T33H 4LSRH 3TF7C 1K6QH 4XXWC 3ZQXA 3HBQA 1YJDC 3EG9B 2DLFH 3MXVH 3C87A 3T2NL 1TDQA 2NOYA 3QDMB 2Z8RA 2LQRA 3CZGA 4XPAL 3TX4A 3O6FA 1BVOA 4P57A 4BDVB 1HIMH 1S8DA 1KCRL 1LGVA 6PCYA 1CXIA 5K39B 1XF2B 3US9A 2PCPA 4FJ6A 3CPLA 4GKSA 4CUCA 3N50A 3I02B 3ZXAC 2ZUTA 1PX8A 2IDUA 3VSVA 4KZEL 3RWGB 1CDJA 2IALA 2NMSA 2VUOA 4JVWA 4ZOEA 1NL0H 1V27A 1W0YT 3BLBA 5C0FB 3QQXA 1ED3A 5FIEA 1XF5B 4M48L 4ELME 1WWAX 2GTQA 2VUYA 1SHSA 2YD4A 5DRXA 3UG4A 3BD3A 4LDOB 4JAMA 3OMZA 4F58H 3FTGA 4P2AA 4MS6A 3VGEA 4Q9QL 4NYLB 4H1LG 4MCMA 1CQYA 3BCFA 3N1GC 4ZTEA 5I1JL 1T83A 3IS0X 2EVFA 1NUFA 2WZAA 3BVVA 2X6MA 3X3FH 3ARFC 4JO2L 5F96H 4E68A 4AJVA 4GRLD 4PRHD 1JDDA 4DPRA 5I1LA 3QEQB 1RJZA 4ZUSA 1OKEA 2IG2L 2CBTA 5DSCA 4MA7H 4XMWA 3OV6A 3ULUC 5FAAA 1R33A 2Y7OA 3JTTB 1KTRL 1QR1A 1HSBA 4PVBA 3AAZA 3HS9A 3OKMB 2YKLH 3I6KB 1K9TA 1BMWA 1GY1A 1DP0A 2VLRD 4GRLA 1G7MB 4IJ3C 4PRHA 1MW1A 4C4UA 4I1PA 2CIIA 4JM2B 5H4ZA 3HHSA 4G6FD 2XG4A 5LAXA 1TTRA 3Q2VA 1ZHBB 2OJEA 5E95B 4LEBA 3RGHA 5IMMA 1WC7A 2YD5A 4LSTL 3DYMA 3I9PA 2P7TA 1JGVL 1JTTA 4N2CA 3NMEA 4KROD 2GBVA 4LQ1A 1PSKL 4H0IA 4P2YA 5DD6B 2VLRA 2ROYA 4E9WA 2JJTC 5L4MA 2EE3A 2XTJD 1CGUA 2EE6A 1DJYA 3UFIA 3I84A 1E6OL 3QQ9D 5BRZE 1MCPL 4I77L 1UJ3C 2IF7A 3G6JB 3LVTA 3TBWB 2BLFA 2VXVL 2Y9RT 4R96B 5SV3A 1MJ7L 5E9DD 3K91A 4FHJA 4WSJA 1IU1A 3TT1L 3LRSB 2FEEL 4RMWA 2OLDA 4WTWA 3H9HB 1IZJA 2QVKA 1XZWA 1SYVA 1F86A 4NXKA 2GY5A 1GGBL 2JJVA 2TRHA 3FQ1A 2QLVB 3ORJA 4J4PC 1EHLH 1HOCA 5LDSA 3WUWA 1KBWA 3ZDXB 5CWSA 2YPVA 4QRQA 2JMRA 5E9DA 2IPTH 4OLUL 4BXVA 3L2LA 1AD0A 5DURD 1JERA 2JKSA 4I13B 4H25B 3LPPA 1HH9B 4JR9L 3K6DA 4Z77A 2FNBA 4PHZA 1ZKAA 1OZUA 3L3HA 1DEEB 3U6RA 3TBBA 4L8DB 3PWUA 1BZ9B 3K0YA 1QFWM 1G5GA 1T5WA 3QDGE 4DKAA 4KKBD 1I53A 3MZTA 3OL2A 1T6WA 2QQLH 1RJYB 3KR3H 3OGOE 1UKTA 4B9FA 1QRND 2NY2D 3QULA 4F5CA 2CBPA 1JPGB 1DVZA 5ACZA 4KKPA 3M1CA 3WL9A 2UYLB 5IQOA 3B3IA 4WI7A 4TSAL 4X5PA 4W4OA 1EDYA 1AI1L 4PGDB 4ODXB 5D5MF 5E4OA 3H2QA 2DQHL 4ADGA 2NUPA 4PTTB 5IHWA 1I1AD 1NEUA 3E3QC 2NYYD 4WEBL 1QRNA 3MZGB 5LLIC 4A37A 3K2MC 4D0DB 1TR7A 4XOBA 2HWZL 4P4KB 2ATPB 1PYWB 2W95A 5ETUB 1MI5E 1Z5LA 5KVDH 4P5MA 3IS1X 1ACZA 1CU4L 3VG0L 2IFFH 4K4KA 2D2CC 5K69A 1E5BA 2WCSA 4PWFA 1I1AA 2AAVA 3PDOB 4YX2H 5T1MB 3ZUCA 4Y4HD 1QHOA 1YUKB 1C5CH 1DANU 5KS9A 4WO0A 1JZ2A 1KUMA 2YKKA 4HXBL 4NT6A 1KLFA 3BKYL 4A7VA 4GG6E 1NMAH 5AAMA 5CP3A 5EPMA 4HX1B 4MA3A 3ZY7A 4GSQA 2HFFA 3UIYA 4FLQA 2QQKH 3E6FB 1F02I 1FFNA 1UWXK 3T77A 1ZWIB 1EQWA 3FSVA 3RY5A 5I6XC 1WAAA 3ARBD 4Y4HA 4ETYA 3HA0A 3V4VB 3UL4A 4IIQB 3WN5C 4L4VB 4BRJA 5IEHB 3TIEB 1IEAB 4TSBL 3BRDA 1TO4A 4BHUI 4MGXA 2H4EA 4UQCA 3BPOC 2AQ2A 4K23H 1NEZG 4U6XB 5B8CB 4LXFA 3GMQB 3RPIA 3ARBA 2NXZD 4LOUC 4H0HB 3M46A 4IBUA 5CMAA 4GT0A 1DN2A 4PS4L 3ZZ1A 5CP7B 3I3EA 1QMUA 4FKHA 1JVKA 3RKPA 1KLUB 2IMNA 3SDYH 4RZCA 2DTML 4Z7WF 5TE4L 4V11A 4RGND 1DVUA 4CW1A 4P9HH 3FHAA 4FQLH 2E7HA 5T3XE 1AS8A 3GLZA 1BF5A 1V05A 1BBDH 2DBLH 3HARA 3KXFD 4XODA 3QJHA 1INEH 1E4XL 1ZD6A 2A6KB 3C5ZD 2BINA 1YO4A 2PTUA 4N2LA 4PS8A 5CGYC 5D2LF 3FUKA 4PH8A 2APWA 3D07A 5JZ7D 3RTQB 1T3FA 3PXJA 3P4OA 1M7DA 2L7QA 3B2MA 3HNSL 3KXFA 1SMAA 1O75A 4WWNA 1AXTH 5EZIH 1NCCH 4MJ6A 4GS7B 1L9RA 4LKCA 1BIIB 3C5ZA 3RGBA 5CZVL 2XNAB 1VGOA 2UWEA 3Q8BA 4U1GC 3MMEB 2CCWA 1QI5A 5I6PA 4PP1D 2AABL 3QR0A 3WTSA 4MBRA 2VR7A 1XF4B 4WI8A 3QH3A 4KKAC 4TQ8A 1Y18B 1YMME 4PB9L 2HFEB 3WXVL 5KSAC 4ZOAA 4K0OA 4XHJC 2H1XA 3AWEA 1N19A 1LP9A 3Q9PA 2ATKB 2NY5H 1T1YB 3BLPX 4NRXA 1TYEB 5MEPA 1QFOA 3ZE0F 5J06A 2VKXA 1CDBA 4M5ZH 4GRWB 2H8PB 4YGVB 1G1OA 4P04A 1O6VA 2XY2A 2EDQA 5J56B 1XL6A 5KVFE 1QBML 2WXPA 3LSOB 4MVBC 1C5DA 1JGUL 4J6IA 3HZVB 2X70A 1AGFB 4UT9L 4O4YL 3P69A 3RG1C 4R3SA 4X0NA 3BH9B 1BZOA 2ODHA 2VITB 1FAIL 4XP5H 1NMCB 3UGUA 4M8RA 4AW7A 1EJOL 2FSEA 4FCHA 4XVJH 3IYLW 2HRGA 1K2DB 2BP0A 2W60A 2ITFA 3WFCL 3QUYB 2GAZB 3QIUC 3EGDA 5EUOF 5GISL 4WSKA 4YHYB 4AQ8C 3QIBD 4MD0B 2PP9A 5DUJA 3NN8A 1AJ7H 1M1XA 4D9LH 1ZTXH 2IH8A 1N5YH 3X11A 2NNCA 4JGUA 3QFDB 3RFRA 1CFNB 4NN5B 4R9HA 5DYOB 2N7BA 3SJVB 3V4PB 3LNGA 1PPIA 4R26L 1XGYH 4NQVB 1ZXKA 3QIBA 1G5AA 2Q3XA 4XMZA 2WQUA 1CLYH 4K3GA 3L5WB 2FWLB 2R0WL 3WFDL 4KI1A 1QUNB 3CMOL 1OF0A 4ZTPH 2DL2A 1GMEA 3UBFA 3V6FA 5FYKL 4MXQD 4ETQA 2KLRA 3MV9B 3E9UA 3QQ4A 4BSVB 3AU1A 1BOGB 4XO3A 2WLYA 1HYSC 3NJJA 1DR9A 1TJHL 1X7QB 1ET8A 4JRWA 4GO8A 4LVNB 3KPOB 5E1QA 1B88A 2F2HA 3A24A 5HJBA 3J7HA 4IKJA 3TIDA 2NSQA 2R83A 5HPMB 1U19A 2VRKA 1BGXH 2WBXA 4G6JH 3BSZH 4H8UA 4YDKH 1BRRA 3CV5A 4OFIA 5C0IB 5KSBB 4Z7NF 4NO0D 4X7EC 4FC3E 1U3NA 2P47B 1ZSHA 4KUZH 5IREA 4I2XE 5C0JA 4OCRH 1TZGL 1LQSR 3Q6GL 1Z2KA 3CDZA 4PBDA 3BSHA 4KUCD 3I9GL 2HRPH 3GSNH 2H45A 3DSFL 3LEYL 1TLMA 1M9WA 2X88A 4N2AA 1HWHB 1A1MA 3HMWL 4NO0A 3V95A 2J2ZA 4ELMA 1UVQA 1NPUA 2V0AA 4LK4A 2CR0A 4NC0B 3RKDD 2J8UA 1I1YB 4X6DB 2O30A 5T1KB 5IOPB 4N2OA 1HL9A 5I18L 3MLVH 1GYAA 1KCSL 3WJMA 5DO8A 1CGSL 2R9HC 3BVNA 1BQUA 1CGYA 2SEBB 3U79A 4G7SB 2WXGA 4JLRB 3BEWA 4UOQA 3ZYJA 2X3CA 5CJQL 3HC0B 4S0HA 4OGQC 2YA2A 3INOA 1KYAA 3CHQA 3ZKND 3IFPA 3SKMB 1I1FA 3CVCA 3N42F 4LPXA 5AYQA 3OZKA 4WUUE 5HGBB 1ORQA 3IVKA 4MJIE 4M7KH 4RWHA 2CKBA 3RVTC 4HCRL 1CXEA 1IBGL 4WGVB 2GYSA 4U1HB 2J55A 3UEZA 2H3NB 3EDEA 2WNXA 3LH8A 1GAFH 1NFKA 4I88A 2NY7H 1NDGB 3LIZL 4XN1A 5E8OB 4L3CB 3ABGA 4G1MA 3N44F 5DUML 5HYQA 2P80D 1OT2A 2B4CC 1H8SA 1Q8MA 3F01A 2O6CA 2VXQH 3BZEB 3TN0C 3QHFL 5DHYA 2R4RA 4ZODA 5HHNB 1PW3A 3HI6H 3DPDA 3LRHA 2BSRA 4PI0A 4NOFA 1FFTB 3BP6B 5E1IA 3IE9A 4M93C 1KG0A 4Z5RB 4QNPE 4YBHA 2NYKA 3TCLA 1Y6KR 2P80A 3GM8A 4ALAH 2HFTA 3OJVC 3DI3B 3RZEA 5C7XL 2D3LA 3SBQA 3D08A 3WIAA 1SDAB 1UAZA 4OF8A 5HVFB 2DD8L 4N2HA 5F7WC 4JVPA 3RWDA 4DEPB 4DW2L 2R23B 3MRQB 5ESAB 1YAIA 2YGNA 3IJSB 4DFHA 3LN5A 3B83A 4WRLA 3VXRE 4CMMB 4WIQA 1T0OA 2A9BA 1P7HL 4POUB 5K93A 4PJEE 4H1LH 4F15B 2Q6WA 1ITBB 5LB1A 4UILH 4EUPB 2Y5QA 1MFEL 1ETZA 3WKNA 5EZLA 3TGXA 4UT7L 3B3BA 1ZVSA 4OZGB 3ZJAA 3K71B 3KM2A 1XCQA 4UIMA 1MI5D 1MWAA 1YNTF 1JZHA 3NACH 4F7MA 5F6IB 2ZPKH 1JFQL 1PLCA 1TTAA 2OAAA 2DWEB 4WW2B 4YO0B 3V0FA 4S1DD 2BNQE 3P30L 3GI9H 2AEQL 1EJFA 4NKOA 3ZHDA 2J3SA 5F0JB 3I50L 3OAUL 3RAJH 4BWWA 4NQTA 1MI5A 2VGLM 5ESQB 2I5YL 3K72A 5EEUA 4OI7A 2NNAB 1K8DB 3IN0A 1A25A 4JRYB 4URKA 1KTBA 1O7DC 1JGJA 4HYXA 1UYWL 4OV6F 4E9VA 1QNIA 3D4YA 1OARL 2AQPA 4WQOA 2FK9A 4GRLC 3F5WB 1P5VA 3ODUA 5KJ7E 5DHEA 2F18A 2NPLX 4GG6A 2CCVA 2F53E 3PABB 4FTVB 1FGNH 4N22A 5CINL 2Z93A 3L48A 4ISVA 4KOCA 1QSEB 2B5IC 3MFGB 1ZT4A 2G4EA 1LWHA 1RY7B 5D1ZB 5L9DL 4KJQD 4AGQA 3ZL4L 1L5GA 1CE6B 3T3MF 4EPSA 4OM0H 1PFCA 4HIEA 4BQ8A 2X44D 4F7TB 4WK4B 1WGVA 1CFVL 1GGTA 4Y1SA 1KENH 3RWIA 3TBCA 3U4EA 5I1GL 4AQ1B 4H8PA 4KROC 2W9DH 2PF6A 5LAPA 4NKMB 5EZJA 4NM8L 4KVCH 1VGEH 1LO2H 2DI7A 1Z3GL 1QFHA 2XTJC 3D09A 4RBPK 4W6XB 3BP4B 5DTFA 5E8EB 3A4DA 2BVYA 4XMLH 3GXUB 3BT2H 3G9AB 3QQ9C 4YR6B 2GSGA 3L9RA 5FFOA 2G5UA 3RGVD 1S9KC 4AYMC 1MRDH 1NAMH 2VZOA 5TDPA 4F2EA 4L3FA 4IBWA 1FG9C 3O3BB 1HNYA 2Y07H 1A7QH 1GC1L 1WCQA 2CE6A 1MLCB 4OUOA 3VXMD 3KPNA 2F95A 4YXKL 3NTCH 2WQVA 3B2UD 3V4UL 3RGVA 1A14H 5HI3C 2ED9A 1F5WA 1ZLUK 3U6XS 1F58H 1YMMD 4ZX4A 4XNXH 1KB5L 3GRGA 1GH7A 3QYCA 1ZY9A 3FT4B 3MA9H 3QPQD 4NQQA 3VXMA 4GY4A 5F72S 3NGBC 3COCA 3TVMB 2FD6L 1OOAA 4W4OC 3ZTDC 2HH0L 5H2IA 1JJUA 3QIWD 4YQXH 3K74B 5FO7B 3QZWB 3OZLA 3W3BA 4TNGA 1Q1JH 1YMMA 4X32A 4XO5A 2NY2C 1A5FL 4W70A 5EUKB 1PDKA 4AK1A 3BPNB 3Q06A 4X4XB 2QR0B 5B21A 4G6AC 3QAQA 4IBLT 3C60B 3QIWA 2B0SH 1MCWM 4U1LA 4S0TD 5DVKA 4ZUTA 1NLDL 3ARQA 3OKDA 4MKMA 4B9ZA 1XTMA 3DUSB 5A7EA 1I1AC 1GOFA 5AZEL 2NYYC 3UAJD 1A4AA 4PJCF 1BQSA 2YD8A 3B7UX 4IMLB 3K4ZA 3HE7D 3ME0A 4FADA 3BQUD 3D0VA 2WUCL 5AAMC 3CSTA 3UONA 3GTTA 4KTDL 2DQCL 1C9SA 1I1RA 3UAJA 1FFRA 1KEML 1THAA 2VDLH 3FCTB 3G5ZB 4XPFH 4Y4HC 2FYYB 1T21A 2RH0A 4OZIE 2Z92A 5K1NA 2NTFA 4PRIE 5DDHB 3HE7A 3BQUA 2J5WA 2ZUVA 1KACB 1FO0A 3PHQB 4F9PA 2BCMA 3SKJL 5IW1B 1PKQB 4B97A 3L2NA 4ZNEA 2F0CA 5D9SB 2EYTA 2K6YA 5D71L 2E6PA 1A4KB 3VCLB 4LF3B 4ZMQA 2OTUB 1KPUB 3MN8A 4NQEE 3F65A 3IU4H 1R34A 4LLWB 3UTWA 4YSOA 3U0PB 5T1JA 2B59A 2J4WH 4ATTA 2A3TA 3MKKA 1RZPA 2R4RL 5D96B 1CWQA 3HEIB 5A6MA 3KYAA 5JIPA 1NIAA 3ECBB 1ZSDA 3MU3A 2NXZC 2DQJH 1QFUH 4JY6A 4ZMOA 4H4NA 4IOFD 3OQRA 1OP9A 4D8OA 3US1A 4RGOL 2YN5A 2Z34A 3EFOA 2H0FA 4RGNC 1RU9L 2FUTA 2EEFA 4P3CH 1UURA 2F74B 1P9MA 4L48A 3QYNA 1IL1A 3NJIA 3IGLA 4TPRL 1ECZA 3ZDZF 2GHZA 1A1OB 2HJLB 3EZJB 3EBGA 2A74A 1KG9A 3NEEA 4PSRA 5I75C 3C5ZC 2XKNA 1A6PA 1RIVL 1X6LA 2DQUL 3T0VA 3OBAA 5JZ7C 4G80A 3MRGA 1Z9OA 2CM6A 1CIDA 2CDEB 4MB1A 4EF3A 3NVQA 4G6ML 3LV3A 3O8XB 5CHNB 4AIXA 2B1AL 3F7VB 2VDPL 2VAJA 3BZFB 5CGBA 4BSJA 4JPVL 1WH0A 2RACA 5FUCE 2OL3H 1Z9MA 2VZSA 5F7KC 4PP1C 4B9CA 5IJVA 2AT9A 1TQCB 1KLGA 1MCNA 3EYFB 3POCA 2I35A 4WUKL 1NOLA 1PMYA 2DLGA 1BRDA 2D7OA 5HDBE 2A77H 3ETTA 4NHCL 5F1IA 3VGAA 4P2RE 2V3FA 2Y04A 3HPJA 2MOQA 3BP5B 3HNTH 1F00I 4OZ4B 2YDVA 1ZIBA 2YSSA 4Y4FD 2J20A 4ZRGA 3M07A 1R46A 2UY6B 2EDRA 1EEQA 1X5YA 1N2RB 2A0LD 1TNMA 3OE0A 1MH5A 2N59A 1E4WH 2Z9TA 2BMKA 3CVIL 4WUUD 4MJID 3RP1A 2D73A 2QSVA 4K3HA 3UMNA 1I9RL 3WXWL 5FYJH 1AG0A 4M6OL 3RX7A 4J6RL 4PJBF 5GGRB 3QJVB 5HYJB 1YEJH 1FVEA 4HFWA 1TQSA 1U42A 3MNVB 1OAXL 2WYHA 3WI9A 3CC5A 4Y4FA 3LKRA 4FMVA 4IHOA 3G08B 4WUUA 4HPOL 4PJ5B 4NFDA 3GBNL 4MJIA 2YAQA 3B5HA 3L3OB 2I07A 4R5VA 4B5ZA 4W9EC 3TFKD 3GMOB 1A9EB 1P4IL 2YAMA 2EVJA 3ARXA 4DKDC 4XNUH 1S46A 3HAOA 2YN3A 1CDIA 3WNIA 1GYWA 1I3RB 1WISA 3RNQB 2CO6B 3IGFA 3EZ8A 4Z7QB 1AGDB 3BDYH 3FULA 3WTTA 4XBGB 2WAQA 2P1YA 2KZ1B 3DO4A 5IUCA 4JZNA 3QIBC 5CBEA 3FUIA 3MHZA 3CVBA 2F15A 3N0PB 3F05A 4PJFE 4Y88A 1ZVNA 4GG8B 2DYPD 4MQXD 5IV2B 1IFRA 5E99H 1C8RA 4LMQI 4PY8J 4Q6IB 1P4LA 1GC1C 3FCUB 1VSCA 2HG5B 3D1MC 4PJIB 3T04D 4AC4A 1TJGL 4WHTB 1CF8H 3N85L 4XR8C 5EDXA 5IHUH 4AEFA 1BAGA 3ECVA 3LD8C 5FUOL 3SE9H 1F4WH 3QXDA 4P5SA 1BXUA 1NIBA 2OMZB 4JANA 5SWSE 2FX7L 2DYPA 5IROD 5IKCB 4RDQG 5ICZA 2Q1EA 1WG3A 3BSGA 3I6GB 4MXQC 1JZEA 2FJFB 3HPLB 1KJMB 1T6BX 3PV6A 4FL4C 4X6EA 5ISZB 3F62A 4P06A 4OD3H 4NLHA 4NZRH 2JK5A 4NOBA 1QPPA 1C3WA 4HK0A 1I9JL 1TZIB 5IB3A 4RAVA 3TO2B 4JJ5A 4Y5XA 5IROA 1BECA 1H2SA 2MTAA 2VSMB 5LCVH 3V5DA 5AYUL 2BNQD 3DOSA 3A0OA 3N6YA 5B34A 4KXZI 2VDRL 3X1EA 2KQMA 3QCTL 1USQA 3PGDA 2BH0A 2IANB 2JB5H 3SKNA 1FZOB 1M2VA 5AVVB 5HHVL 1VB9A 2BNQA 3ZPDA 5FW7A 4XP6L 5EF1A 2D7NA 2EIBA 4C58B 1FORH 3FU5A 1IT9H 1BLIA 2NY1D 3LQAL 4ABWA 2ZOTA 4AH2B 1G7IA 4R7XA 3S3SA 1OAYL 1REIA 4IDLA 3WY1A 2ZCLL 3CDGA 3F84A 2F53D 1RZGA 3RKDC 4QF1A 2YLKA 1E27A 4L9LA 5FB8A 1OTTC 1P69B 3DGDA 2Y1VA 3LMJH 3QZNA 3WN6A 3FF7A 4KJYB 1WBYB 2WKOF 3OJDA 2XZZA 4TL5A 2I32A 3T4AB 4E9TA 3BWUF 5K9OB 4TQPA 3C75A 4G8FB 3EHBB 4QXGL 25C8H 1GTFA 5F9WB 3IDNB 5IFAL 1JF5A 3ZR5A 2XQYK 3CFNA 2DICA 3A67L 1QNZL 2F53A 4FHBD 1FDLH 1WA1X 1DANT 1MCOL 1XD1A 5IHLB 3SCMB 1Q9LB 2OMWB 3AS1A 1NBQA 5J12C 4GQZA 3ZKNC 1H68A 1FO0L 4A2GA 2RAMA 5IHZB 1ZRUA 3H9SB 4DUWA 3POHA 2QVTA 3UXFA 1WK0A 3MRIA 2WC7A 7PCYA 2H6UA 2QSTA 1A3ZA 4ZOCA 2OK0L 4X8GA 2Z64C 4OLVL 1SZNA 5AB9A 1PS3A 3MNZA 2NW3B 4UB0L 1HH6A 5IFHL 2LHAA 2BWIA 3FB8B 2FQGA 4FFVD 4XP1H 2PMZA 4MQSB 4UV4H 4QAWA 4WSGA 4IBTA 2O5ZL 3EDFA 3N9GL 4LDLA 1ES0A 3EJSA 1NFIA 3AG2B 4OZHF 2ENSA 1PZ5B 1UUNA 5T33L 3H3PH 1T7ZA 5CCKL 5AW3B 3JXAA 1GYCA 1BZQK 3SN6N 2PXYD 1P1ZB 4YXLL 1A7NL 1YNKH 2VDKH 2EXWD 3FOMB 3MXVL 3O6MH 3WY2A 4OIIL 5A2JH 1FN4A 4FG0A 3EO0B 1C12A 3NAAH 5BOPA 1URZA 1MEXH 1DBJL 5CD3B 1YLBB 2Y2TA 3TO4B 3DO7A 2E6JA 1ZLUH 3NIGF 2PXYA 2SODB 2AEOA 1UGNA 1T20B 1X5LA 2IV8A 5CLZA 5D6CA 3VX0A 1DZ0A 4JHVA 2BXYA 4O9HH 1OWWA 4NN6B 3C6EA 4ODWB 5EU3B 3VRJB 4MDJA 3UTZA 4NKIL 5TQ0H 4NSKA 2VLJB 1I31A 5GGVL 2PCFB 1G7HA 2G9HA 3FNKA 1V7NH 3GRWH 4XCCH 4Z9KB 2P42B 3HZ3A 3OJMB 4KFZC 1SVBA 4YSCA 4UQ3B 4UDTB 3B9DA 1J05B 1H0DA 2UZXA 3VMOA 3QRLA 1WGOA 1M05B 4MB5A 5F96L 5MP6L 4OQTL 3REYA 3HLAB 1XDTT 4HP5A 4PYGA 4S1DC 3U30C 3U2SB 1QG3A 5TE6L 5KYWB 3D39B 4YGAB 4PGCA 1GSKA 3FQXA 4PRID 5F89A 1QHJA 2DOCA 1E5ZA 5GGSB 3KJ6H 2J25A 1KXTB 1INQB 5B38A 5E4IA 3S5LB 1PY4A 3QC5X 4XN8A 1DFBH 5FO9A 2YCZA 5AKVA 4G72B 5GGTL 4GLRI 4M7LT 4UIKH 3TH3T 3AQYA 5AHZA 3CNKA 1QBLL 1RULH 1AH1A 1OCCB 1ETB1 4NQED 4OZIA 3GMNA 1WA2X 2XWTA 4PRIA 3UAEA 3O9WB 2ZKXA 2WKLA 3M8OL 2Y00A 2W9LA 4UM9D 2YEQA 2VE6A 1XR8A 2Y7MA 5J1AB 4TSCH 2VABB 4NQEA 3EOBA 1ZT7A 1FBIH 1XR9A 1QSZA 4LVHB 1HC1A 1SN5A 5EN2B 3ZDYF 1TQBB 2HUHA 4UM9A 4XNMB 5BV7H 1UACL 3LIUA 5HHMD 5SWZB 3KWWB 2LGNA 5IMOB 2ZKMX 4URTB 4J4QA 2WQSA 4P49A 4RMQA 3MRPA 2V3DA 4TQIA 5I1EL 3PF2A 2ITDA 2D4DA 3A4EA 2ENPA 3BIKA 4LIQH 4Y7OC 5FO2A 2X4PB 4H44C 2JB6A 3T0ED 2ZSVA 3FFCE 3LN9A 5HHPB 3RGVC 3CLWA 4KX8A 3RFMA 4HT1L 3BSZA 5DMKB 3JV4A 4WO4B 3KGUA 5BRQA 4WI0A 3ZK0A 1H3VA 4DGIL 5I30H 2EDYA 1NINA 2DLHA 1KIRA 2C9XA 5C0EA 1H9DA 2VW4A 1NBZB 4WWID 1AZZC 2AK1H 4HDIA 2V2XA 3QG7H 4U1KA 1XH3A 3B2UC 3KR3L 3RUGB 1R5WB 1I3GH 1I8UA 1GIGH 4ANVA 5GS1A 3K46A 4ZW6A 4ZMWA 2JI2A 3GSNA 1CURA 1ID5I 1UA3A 5KYXB 2P44B 3NEXA 5FW6A 1VKXB 4L8BA 1B3IA 1AAJA 4P2RD 4KRMB 2G60L 3CZUB 1AGCA 2P5EB 3QPQC 4B96A 3WFBL 4XCNA 4U6HB 32C2B 2ADYA 3QIWC 2J88L 3B34A 1TPXB 3LQAC 1BZ7A 4XH2A 3DROB 5F3BA 4ONGL 2PUQT 3GDCA 5I74B 1F90L 1DLHB 4KV5E 3TEUA 5KVDL 4P2RA 5DUBA 4J3UA 2BM3A 5GJTH 3CZFB 3WNLA 2DMHA 3MLYL 4NQXB 3AB0C 2JCCB 5FYJE 4F9LA 1HESA 1GOGA 1KIUA 2NYZA 1AIFB 2VSCA 4HKZA 4M8QA 3CAPA 2Y1ZA 3EUDA 3OKYA 4M1GH 4F27A 5I1KH 1TO5A 1PLAA 4ONHA 3V7AE 3LHPH 4NWUH 1NMAL 4M7JH 4JJHA 3F7RA 2D7TH 4PTUA 4EO5A 1YNLH 4QRRB 3BI9X 3WEXB 4FXTA 2QQKL 1DQKA 3HE7C 4L1TA 2Q2LA 3BQUC 3H2PA 3A7KA 3X1NA 1RK7A 4F9PC 3FONB 4PJCA 1E6JL 5C9JB 5HVWA 3O11B 4XVUC 1S51A 1QA9A 2P24B 1MCJA 3ES6A 5D7IE 3FCBA 2DB8A 1PIGA 3KHQA 2F8VA 5F7EH 1YEHL 3FUNA 3I74A 2CRMA 3Q2NA 2UX7A 3V0VB 4HHGA 4MQ7A 4K23L 5D7LB 2VXQA 2V37A 5DMYA 3ATFA 4MMXA 5KOMC 2VDOB 2A9ML 2DM2A 3VH8B 3O3DA 3WHXA 3VU1A 1Q94B 4Q14A 5A40E 1Z5HA 4TKWA 3MRNB 1HXMA 3EDKA 3L7FB 4PJFA 1EIBA 3MJ9H 1NTDA 3SPIA 1BYOA 1BJ8A 1NQBA 3IAPA 3NRFA 4HD9A 5EIQA 4XRCA 4AK2A 2CO7B 3MLTA 4KTYA 5EOCJ 1T4KB 1I7RA 5FDWB 1PZDA 2EKJA 1L6ZA 5I6LA 5LJYH 2Y1YA 4XPGL 3H7BB 4Z0BL 2Y03A 5B6XA 1INEL 2HPOA 5BJTA 3NCCB 4WU7A 4KXZH 3AFLA 5G4MA 3TP4A 1KTCA 5IOKA 3BWAB 3S34L 3G04B 1WICA 1E0OB 2J57A 1BQHB 1YPZB 4IOFC 2W80C 4MCZA 3QO0A 3RLSA 3SGKC 4ES9A 2XV6B 3P3TA 1Q9KA 3EADA 3GMMB 4HOWA 4K5MA 1AXTL 1XO8A 5EZIL 1NCCL 2C9UA 4H1LA 1AQDA 2VZ3A 5F88B 2AC0A 1B0GA 1O5PA 4XXJA 4OLZL 3KYOB 3PIQA 4JDZB 1QLRB 3NSJA 4NC2B 3C2AH 1W2KT 4WNSA 2Y06L 3AWGA 3VQMA 1NAKH 5FWRA 4KQ4L 2X1XR 1HEHC 3AXLB 3ZRCC 1W0VA 4EI0A 1ZA3B 1FNGB 5F3HA 3KLLA 1F42A 2FWOA 4JDTH 2WIIA 3W81A 4KY1L 3UTTE 4S2SB 2AERT 4WJG3 5BUAA 3VGAC 3BZ5A 2VB5A 1GW0A 3D2TA 4N6RA 1J1PL 4JUSA 2Y6SD 1BXXA 3QA3A 2CUAA 2AVFA 3F12B 3BUTA 2ZWSA 1BBJB 4FI6A 2YCWA 1D5XA 4L5FE 3HZMA 2ZOWA 2WWNA 2UUDK 3H9SE 1KN2L 5C0RH 2KSYA 5D55A 3CVDA 4AMKH 3L3DB 2DKMA 1E8XA 5ELIA 1JGEA 3GINA 4QKXB 1SXSA 4N9OB 4Y4FC 2V5YA 2ODIA 2A0LC 3MODH 1BFSA 1EEZB 4Y8DC 3ZMRA 3ZZSA 1CICB 2G2NA 2WQXA 1LXMA 2ROXA 4XVJL 2Y4SA 4HXAH 4B5EA 3O41A 1T0NA 2F5BL 1UFGA 1KY6A 2FBJH 1G0XA 1GRWA 5T8IA 2YCYA 4OFQA 1UM5H 2IMMA 3JBG7 2VDNB 3NIDB 4PJ7E 1JCVA 3V6OE 1AJ7L 4MKTA 1MDTA 3SD2A 3DHPA 4K3JL 1ZTXL 4NI3A 1N4XH 4ZZKA 2VWEE 5GRVL 5EIIG 3TFKC 4FQXB 5HDQL 1U36A 2KQNA 4IU3A 5H35A 4XI5D 4PG2A 1AQMA 2AEIT 3P02A 4BM7A 5A6LA 5BS0E 4UTBL 4B41A 1KOAA 1WIOA 1CLYL 4P2OD 3MX0A 3ZMEA 2M83A 4OI8A 1NAMA 3ZTJG 4Y9HA 5B0WA 1WTGT 3WEOA 3FL7A 1MUJB 3VI4E 4XCYB 1NICA 3S48A 1YRKA 1UWEL 1B0IA 2EKSA 2VUKA 1A7OH 1MNUL 2OTWA 2KI6A 3CUPA 3ZTNL 2YD7A 4L4JA 4F7KA 1CDUA 2X38A 2IWEA 4QRUA 4P2OA 1ZHKB 4DOHE 1AR1B 5EFIA 4GFTB 1PCSA 1OAUH 4YNYB 4UI2A 2MTPA 3SPVA 3BSZL 4JGMA 3S9DB 4NUJA 4NUGL 2E27H 3DO3A 2FNWA 2AK4B 3BQVA 4Y5XC 5IROC 1HHJB 5A16A 2WZ5A 4O02L 1U6AL 1NCJA 3L7EA 4Y19D 3GSVB 3C6LB 3V6ZA 3DXAB 2F8IA 2BVOA 3VSTA 4C4BA 2C9SA 2EO1A 2HRPL 2CUMA 4BCXA 4RNRA 4ZUWB 4EUPG 3L81A 2J6EH 1U3ZA 3SYCA 2N4IA 2XIDA 4J27A 4S0SD 1V3MA 3APMA 1IBBA 2DQMA 1EMTH 2R51A 4KOBA 5J4MA 4ZPTB 4PEEA 5F21B 3R0MA 1BXAA 3AT9A 4TMPA 5E2TL 4Y19A 1UWGH 1EJ6A 2CRZA 2BX5A 4ZAKB 1OQOA 4GLRH 4WI5A 5IB1B 4HUXA 3TLRA 1PX4A 4NQSA 3FOLB 5GPRA 1KTDA 1UEMA 4YFLI 5CGTA 4ZYKA 2Y1AA 1C7SA 3FB7A 4LSPH 4OJAA 3TASA 3ZKXC 3QJUB 2HLAA 4L9LC 4Y2DD 3BDXA 2WVTA 4NI6A 3NQIA 4U7MA 3VI3F 5ILTH 3FQNB 1N8OE 1J10A 3VXSB 1IGJA 4UMSA 2NY1C 2AXGB 2DRUA 3ZO0A 1IGTB 1NEZA 2DQTH 5L0QC 4HKJB 2CR6A 3OVUB 3QUHA 4I0PD 4Y2DA 2BNRD 1RP8A 1RZ8A 1T03L 5HPOA 4V2CB 4JFUA 2YPKA 2HX8A 3D9AH 5DVLA 1DZEA 2OXGB 2UZYB 2XFGB 2WSDA 2OJZH 3EYOB 3PHAA 4UTAH 1JUFB 4I0PA 2BNRA 1CD8A 1R5VA 1BJ1H 2AF2A 3NPSC 5I8OH 4Y16B 4J3OG 4B9YA 2P3YA 1OGPA 3MI6A 1U0QA 5MEQA 3E2HB 1IGCL 4MD5B 3U36A 3V0IA 3HI6L 4XAKD 3T0BA 5DVPA 4GSRA 3SOTA 1XGTA 3GHBH 4EE2A 3EOTH 4IBQA 2PETA 4UINL 3GIVB 3FFCD 5HBBA 2AS5M 3MRCA 1E12A 3AT0A 1TCRB 1WZ1H 4APXA 1Y0LB 4LOFA 1EJ8A 1HOEA 4LIQE 4AITA 4ZQKA 1BPVA 2R0KL 4FFVC 1DJSA 3APCA 3GUTB 4O00A 3AADB 4OM1L 5TF1L 3GSXA 4JO3H 4AKQA 5GS2H 1YN6A 4E9SA 1RZIA 3G3LA 5BZWA 3W9DA 3FFCA 2B3RA 3CFBA 4I3RH 3KG5A 3G5YB 4HSCX 2HT4D 4X9HA 3LEVH 1LO5B 5IGXH 1S7TA 3X3GH 2B9AA 4KJWD 4PJGA 2PXYC 1HKLH 2BY3A 4J5VA 1SJMA 3H0TA 4R0LB 3IFNH 1BFVH 3F8UB 2EXWC 3KLSA 3A23A 5AKTA 1UB6B 3ZE1F 1XXFC 4XAWH 1N5AB 3QK0A 5DZVA 4D7BA 2FAUA 4N0UB 4XBEL 2H3KA 3GXDA 2NY5C 2OL3A 3QZWG 3SQOH 2EXYC 1LHZA 2B15A 1I8MB 4BIKA 5IB2A 2Q8AH 5FYJD 3GI9L 3PGFH 1NGYB 3CFKB 1EO5A 4YSEA 4H20L 1RQ5A 4JO4H 5I1HL 2VNCA 2A9DA 3U83A 5DFTA 3WY3A 3ASWA 3OR7B 1WV7T 1PXSA 4NENB 3CLEH 4OF5A 5SV4A 3N1FC 3OSVA 3VXNA 5FKAB 3EFFA 1X5IA 4UU9B 1OTUD 12E8H 4L37B 1ZJBA 2ZOLA 3QEUA 4IOIA 4PJAB 3AQZA 3MFFB 2DJSA 3ULSA 1OCWH 5CEXB 2RH1A 1FLTX 1U4EA 2D0HA 4Y2OA 3MRRA 4E0RB 1AO7B 3ZL2A 4YHMH 1P6WA 4UMGA 4LP5A 3VM7A 2I9TB 5C08E 3KPLB 3VFWA 5DHDA 2P46B 4IK6A 3AM6A 4GQRA 3A6BL 4L1SA 3LDBC 2OZ4L 5J6SA 1FRGL 4Y1AD 2ZX7A 4X99A 4YC2B 5HGDA 1M9SA 2F68X 2RCSH 3LYRA 5DGQA 4OJDH 3OZ9H 2E5EA 1WITA 2GVYA 3HRZB 4HOZA 1RIHH 2YCXA 2A83A 3DX4A 4TL4A 4Y9EA 4DKFH 5JIIA 1TFHA 5AKSA 4KRPD 4BH8B 4FQCL 4XMLL 4YHPA 4TNVF 1KYFA 2CLVA 4PLOB 2BK8A 1R5IA 3QPXL 4L18A 4Y1AA 4IRSD 2EE2A 2ESVB 2PYEE 3IXAB 4GQ9L 5A2IH 3VYNA 3NZUA 3EJQA 3ML8A 1J5IA 4WGKA 2NUTA 1Q4NX 4FFWC 4MAYB 1KPVA 2FATL 2AXFA 2HG0A 4RGMC 3NABL 2EABA 5EN3A 4DCQB 2XDHA 1DN0B 4JX0A 2P8LB 1A14L 4GKNA 4LHQB 4UNTA 5I17B 1U91A 4IRSA 5MENB 2AJXH 2X7LB 1F58L 3GJFB 4AZ8A 3T0EC 1H3PL 3GB7B 4GFXA 1DLFH 2VAAB 2XWRA 2FHBA 4XPTH 5GS1C 5FDYA 2H1PH 5LCVA 3DJRA 2PNDA 2WXJA 4XVTL 1KCLA 5E2WL 1DO6A 1JRHI 3PWPD 1BZDA 3L1FA 3TPUA 4JM2F 4KU1A 4JPKH 1Q1JL 5FUCC 4IMKA 4U7KA 4K9EH 5KZCB 3MLSH 1F3JB 5B1AB 3MO1A 5CAYB 2QPUA 2WVSA 1OP3H 4ZUVB 1AXSB 2H2SD 2ZWYA 1SFHA 3GPEA 2PABA 5DZAA 3L95A 3PWPA 2B0SL 3WYRA 5AHYA 2EUXA 4A7QA 4LL1A 3K81A 3PYCA 1QYGL 2VQ1A 4U49A 5EZOL 4EDXA 4AQOA 4D9QD 3CZJA 4F9LC 3UBXB 3G6JF 4FQ1H 2KH2B 4OZFB 1BFOB 4J3SA 3DIFA 3DX3A 2GIXA 4JG0H 4X98A 3L4VA 2NY4D 3UDWA 1PY0A 4MNQB 4KXDA 4HKBA 2GUOB 1AE6L 1TETH 5C09D 4R4FL 5GGQL 5JJJA 4HWZB 1TZHB 3ARGD 2VDLL 4AEEA 4C56E 4PGEA 3UYRL 1FJ1A 4ZS7H 2CM5A 3ZDXF 2L7EA 3V4PH 1R75A 5I76A 3MUHL 4RFEB 5C09A 1M2OA 4PJ7A 1AVAA 1QZ1A 3ROLA 3SY0B 2Z73A 3ARGA 4P5RA 4MMXC 5FGRA 1MJ8L 3I75B 4IU2B 3MLPA 5DCCA 4O51A 4L0PB 4MA1C 4IM8A 3CFTA 3HTLX 3Q2LA 3IU4L 3WFHA 3HUJB 3QI9B 3C5SA 4LPCA 1E9QB 4X8CA 2HVJA 3G5XB 1UM6L 4CU6A 2XOTA 4ALAC 3C09C 1EH9A 5LBVA 3T8XA 3LEXB 3QBTB 4NJAH 4HKXA 2OYMA 4ODUB 2JIXB 3AQXA 2MIZA 3F7YA 4DZBA 4MD1A 3VI4A 1DVQA 4QTHB 3A5VA 3T0AA 5I1IL 1CLCA 4X4MA 4J12A 4D7PA 5CXPA 1S7SB 4PJEF 5JW4M 5ALCH 5HHOB 1J5HA 5IEKB 3STBA 2CK0L 1CXFA 3KVPA 1DQJB 4K94H 2OZNA 3WO4C 1ACXA 1JPSL 3CVHB 1NCTA 1YAZA 3QORB 1ZVHA 4YBQD 5TGBA 5E6UB 3OB0K 4YWGH 2F58H 1LO4H 5L4IA 1WQVT 2W0FB 4JREB 1AY1H 1P6FA 4X8XA 1MIMH 1ZV2A 2LNLA 1L0MA 1MW0A 2VIRA 3GRWA 3QNYA 3MLXH 3AW5A 3PWNB 2R2EB 3P3RA 1JGDA 4A39A 3TBSB 5I9QC 1SBSL 1NFDB 5AQ0A 4APQB 2NSMA 1IQWH 2YBRB 5E94A 4EDWH 5DS1A 5J11C 1K72A 1CG9B 1FF5A 5SX5K 4XMUA 1QFWI 2CJSA 3HNTL 3VE0B 5TFSH 1NUNB 5EEVA 1RK1B 5LBSH 2VISA 2ICWI 3CFCL 4WJ5B 2EH8H 3L13A 4XVSH 3EO1A 1Z7JA 4ZPVA 3UERA 5JHBA 3BW9B 1MELA 2Y6SC 5A8EA 1ZS2A 3D0LB 5J7AA 5I6MA 1IVTA 3KJ6A 1YEJL 3BUYB 1R24B 1MFUA 4OAWA 1ZS8B 4ONFH 4DKEH 5E2JA 2ENYA 3IDMA 5IB5A 1EXUB 2R1WA 4CMHB 4G70B 3HHMA 2UXTA 1S9VA 1IARB 2GSIB 3KPSD 4F3FB 4NO3A 5H2KA 1Q0XH 1Z9SA 2PTTB 5AW8B 1DDTA 1KTLB 5H2MA 3TBVB 3VFRA 5B6ZA 5DD5L 2RQEA 4XNUL 1M71A 3O81A 2X9XA 4M5TA 2ICES 5DEGA 4WDIB 3KD4A 1XGRB 5E5MA 1GGIH 1AANA 1YMHA 4AXWA 3CQFA 3BDYL 3OXRA 2DTSA 4PG2C 4RFOH 4AENB 3KPSA 1H19A 1KXVA 1NBVH 3MRBA 3DI2B 2AZUA 4LOVA 4XMTA 3HI1B 2C3HA 3Q13A 1UXWA 5L88H 3ILPB 4HUMB 3K3QA 1U3HB 1GJIA 3VWKD 2F54E 4U4IA 4X7TB 1JYNA 5E99L 4JHWL 3WFZA 5IHHA 1KCUH 4XI5C 2FR4B 1BDYA 4CVZB 4P46B 5CEZE 2BP3A 2C8NA 1JZ7A 4D8PA 2X4OB 4NKDA 3T0DA 8PAZA 4TNWF 5IHUL 1UA6H 4P2OC 3QUZB 3SE9L 2MEJB 3BHBA 1F4WL 4UAOC 5G5DB 3WE1A 3VWKA 1JV5B 1FZJA 4GRWF 2HFGH 4P2QD 4X5XB 1OSZA 4EUPH 4XNBA 4NDMA 5KJRL 4KX9A 3NJVA 1AQ8A 1KT2B 1QHPA 1TIUA 3KAAA 4FZEH 4LE8A 3GSUA 4TNEA 1M4KA 3D2UB 2FO4A 5FR3A 2G2RB 3IPBA 5IQMA 1ZVYA 3JWOH 5D6DA 4HIQA 2CG9X 4DP6X 2IGFH 3FSAA 1JN6B 3U2IA 4GI6A 1BD2D 1EEYA 2F8OA 2O5NA 3DX6B 4H26B 4KFMA 4P2QA 2D03H 1O6SA 1EFXB 3HI5H 3QG6A 3QHZH 3RI5F 1JD7A 3DX8A 2GJZA 4L29A 2BOLA 1L9NA 4GYCA 1ACCA 2NY6B 3L3KA 2FGWH 4BKTC 4HU8A 2JB5L 4M4RB 3UZQB 2BFGA 3CBJB 1BD2A 4FULA 3WNPA 4WWKB 1FYTE 1IC7L 4EI5B 3OAXA 1A3LH 4ZFZB 1Z1WA 4PBWD 3UROR 2DQFA 1FORL 1KYOK 1PY9A 1NIDA 1QSFB 1UZ6F 4Z0XB 4X7CC 1JPTH 1YVLA 3BIAX 3MGOA 4J3WA 1FWXA 3TA3B 1JNLH 1KJ2L 4AE0A 4EN3D 1E50A 1HS6A 4LAQL 3V9FA 2B3IA 4ZNCD 4GKOA 4N2KA 2AV7B 4NM4H 4Y2DC 2H0PA 3QO1B 5C08D 5TH2A 5IT2L 2K6ZA 2BVUA 3BZ4A 4J3OH 1FDLL 3S5LG 3JWDH 4EN3A 1WEJL 1NJ9A 3JTBA 3MNWA 2RGSA 2C4FT 2ORBH 1OGAD 5G2NA 3SQBB 4I0PC 1DBBH 5FX3A 4BFIB 1FG2A 5C08A 4IK7A 5CJOL 3TEWA 2HUEA 3LKOB 5BR5A 3HMXL 4GNKB 2VM4A 5KSBF 5MEOB 2IQ9L 3SDXB 5KSUB 4UYQA 2EEAA 3O3UN 1RL1A 4ZXBD 2WUBH 1B2WL 1OGAA 3DUUB 5AOKA 2PYED 1UT2A 3KLKA 2YZ8A 2CBMA 3ARYA 3L45A 4X6CE 1BQRA 3MJ9A 4HJJH 3PQRA 3D06A 3CH1A 1LJMA 5EBGA 4KC3B 5DHVA 4CJ1A 5IW6A 1BX2A 3HASA 2XV0A 1SYSB 3HN5A 4EXPX 2MWCA 3DURB 5A2FA 5CFAA 1DJWA 3MRKA 3EGXB 4ZXBA 3BP7A 4GMSH 1TTBA 1JRHH 4JKWA 2XKSA 2PYEA 1QEWB 2HN7B 2PPFA 4R7NA 4DJHA 2YD2A 4ZX6A 4H8WL 4TUKL 3QJSB 4IRJB 2H41A 3LRGA 2BHZA 4X6DF 5TQ2H 4XN9A 4K07A 1A21A 1Q0YL 2WINB 5EO1B 3ZKMD 4QRPB 2FQFA 4Q4EA 1MEXL 4JFDE 1S5HA 3X1BA 2BPBA 1N6VA 3R4DA 5ANME 4ABVA 2KSBA 4QCIB 5HHQB 4G71B 2F6AA 2XZQH 4BZ1H 2XVKA 3FT2A 4PRNB 5C7ZA 1KMGA 1VFBB 1NGZB 4BVNA 2R2HA 3UO1H 4KJWC 4YN3A 2AJ3A 4XE5B 4YFEA 2HKAA 4CVXB 4KDVA 4ODTH 5TQ0L 2Z3FA 3F7PC 2VJ8A 2QPFA 4OLXH 1V7NL 3GRWL 4MNQE 2XPGA 4U6YA 2ERJC 4XCCL 2P52A 5KVGL 3UTQB 1YEEL 4JY5H 1ODUA 1ZLWH 2D31B 4MXVE 2X4SB 4D9RD 2XTLA 3Q6FA 2X4QB 1M56B 4KO9A 1BQLH 3UTSE 3OAWA 4Z3FA 4AIZA 4ZFFA 5B35A 4JDEB 4M8VA 2E56A 3HAEB 3MRFA 4M7LH 4C56D 3W38A 4HS6B 3RFZA 2Q3ZA 4WKZB 3P73B 3W0WB 4G9DB 4DFIA 1IGMH 2NY3B 1HDMA 4G8GE 2CRYA 3B56A 1BMGA 4NQCB 4F8TA 5JPNA 1IAKA 1OHQA 2J8HA 3MJ7B 1CD1B 1DFBL 1C1EL 1K85A 3KYMB 3O4LB 3T6VA 3KPRB 3GRBA 4R4BB 1KZQA 5TDNB 1OM3L 1PX3A 4ILDA 4YIQA 4C56A 1OTUC 5HY9B 3D34A 3BAYA 5L6YH 4KNUA 4MAUL 2B39A 3CCHA 4YXHL 3VDBA 1HJBC 2H32B 2EADA 3O3AA 5ICXA 3RWJA 1D6VL 2AJYH 3QQDB 2TSBA 3DIVA 4UNIA 3MRMA 1ZHNB 4DHLA 2YPLB 43C9A 1GPOL 4YBLC 3KS0H 5B39B 4N26A 2I60H 5T5NF 1GMIA 4F2FA 1FBIL 1U33A 4KMTH 4A6YB 1JYWA 3MTRA 4WEUD 3Q2CA 3IT8D 3PJSA 4OZGF 5K9KB 3NCJH 4QD2E 4JM0A 3VVKA 5K39A 2I27N 5CF3A 1INDH 2FT8A 3HN3A 4KRPC 1XCTB 3SE6A 4WW2F 4PJ9B 1HNGA 3A6CL 3FYEB 4U3SA 5E8PA 1DVSA 1T5XA 2L4OA 4L4TE 4GUQA 2MKLC 1K8IB 4HZAA 2VT4A 1BEXA 4AQAB 4PJHB 4LHUB 3PP3H 4IRSC 1NDMA 2I9LA 4FXKA 1X5FA 2YRZA 3S8WA 1BQHG 1MFCL 2KT6A 2ZWLT 5E1AB 4U1IB 3P2BA 3V0DA 3OAZH 5IVZA 2AK1L 1QFWH 4POZC 2ZAHA 4U3CA 1RJCA 1U8MA 4BKLB 3VFNB 4C4KO 3GPSA 1I3GL 4HH8A 5ITCA 4I8DA 5K59F 3I6SA 3W11D 1F0LA 4X1HA 2J6EA 1P2CB 1L7IL 1M42A 1QWHA 1DBAL 1XMWA 3DSNA 1KGCD 4IMKC 1A0QH 4OV5B 3QE5A 1FE8L 3SGJA 1XIWB 5DC0A 4Z7WB 3VW7A 2ID5A 1QBBA 3WO3B 1OQXA 5ALBL 3OMIB 3B4NA 4OTXL 4Q2ZB 3HCVA 3OKMA 2QGBA 3M7OA 5E4AA 2FBRA 1MF2H 2WXHA 1ML0A 3ZT7A 1A6UH 2FJHA 4KMQA 4RRPA 3VFOB 3GUFA 4FABH 43CAA 4F7EB 4UQ9A 5GJTL 4QRBA 2YD1A 3VFMB 1ZHBA 4A67A 1SY6H 4HLZG 3UDWC 4NUMA 3ESVF 4M1GL 1I7UB 2QGCA 4J3BA 3DRTA 4AEIH 5I1KL 1JHTB 3FO1A 3SIKA 4NWUL 4M7JL 2BNUA 5EORH 4Q6YA 4LPYA 1YNLL 3EYQD 2IIJA 3PRZA 2QKSA 1MCRA 4K5OA 5IJBC 4NRYA 2NY4C 1A66A 2EIZB 4R96A 3KYNB 3IJHB 1KBKA 2D3JA 4IHBA 3DDLA 3GKWH 4NJ9H 3BH8B 4UTAA 3SE8H 2ICCA 3ARGC 4HJGA 4P3DB 1X4YA 2LU4A 2WTRA 4YDIH 5EBWB 3GS0A 3CG8A 2DM4A 2VWEC 4ODBD 5FYLL 3V7MA 4ODVH 1CCZA 1JWUB 4MJ5A 4NXSA 1T6VN 4HWNA 5FOJA 4MNGA 1S53A 2HJFA 2BIMA 3TS8A 2B20A 1MSPA 4NZTH 3WNNA 4Z78B 3NBNA 5GS2D 3T65B 2ICEB 2G3NA 4JFHE 2XA8L 4A2MA 1AACA 1HH9A 2VDML 3LX9A 3BXNA 1IIKA 4ZFOA 3SDCD 4M6MH 3ZPRA 3OKEB 1ZDSA 1TJXA 1JF1B 1U8JB 2Y3NA 3GLDA 4W68A 2PP8A 4B95C 4EZJA 5JQ6H 3NFNA 1UZ8B 1JPGA 3L4TA 2Z35B 5FK9A 7FABH 3VD2A 3H3BC 4P4KD 4DGUA 4LKXA 3SDCA 3RJOA 2FGZA 1HQRB 4PGDA 4YHLH 4HH9A 4DNLA 1XMEB 4PGBB 5DXWA 1FNAA 2OMYB 2WBJB 1SLWA 2G0KA 4N0CC 2C3GA 1Y1UA 4PPTA 3TYGL 4BEYA 3WS6A 3BWZA 4HIIB 3ZYZA 4D0DA 3BAIA 3QAZB 1HAUA 4P4KA 3D87B 2FEEI 1PYWA 3QR1A 5ETUA 4XWOD 1NAKL 3WGVB 2IWGA 3AS2A 4YBQC 4JG1L 5T1MA 2A9NH 3IKCB 3SQRA 3UC2A 1R0AH 3ISYA 4JE0A 3KHOA 4NWTL 1CDYA 1FYTA 1WZKA 1PD6A 1R3IL 5AWZA 2B14A 3FN0L 4M6NH 1TMQA 4W9DC 4F80A 3K6IA 2ARJA 4S1QL 3SO3C 1CE1H 3QUML 3MJ8A 4UANA 4MS8D 4HIHA 4E9LA 4W6YB 3E8UH 3GI8L 1ZWIA 4CDGC 1R2NA 3V4VA 3GLAA 5AW6B 4Z7NB 4UDUA 3TV3L 5B1BB 2A7BA 2WXIA 1DQDH 1OZTG 3MODL 3NA9H 4FTDA 3CN0A 3O6LH 4OB5L 5GZND 5B4MD 1T7VA 4EN2A 5DJ2A 4JKNA 2X4NB 1L9QA 1B4JH 3IK2A 1DQLL 4QY8A 3LZFH 5HD8D 2EDEA 4U0RC 4Q6KA 1UM5L 4D0BA 1BJMA 1R17A 3QBIA 4HAFA 4OGXH 5I1CH 1JNHA 3ARFB 4OGAD 4ZSOA 1A9VA 3RWCA 4JFSA 1KXVC 1N4XL 5GZNA 3BAEL 3Q01A 5ID0A 4FRWA 1UB5B 2FBOJ 1M57B 3U7YH 1MVUA 1ZLVH 1Z3RA 2EDHA 3FN9A 4PY7B 1MVYA 4A66A 4JKVA 3RWEA 4WY7L 3FRUB 3MLRL 1JXDA 3KL5A 4RA3A 4BINA 3HE6C 5BV7C 5JOFB 5J13C 4X6CA 1LK3H 1KBGH 4IJ3B 4MQTB 2ZYIA 3MLWL 1FC2D 4RSVA 4TRPL 5C07E 1J0HA 4HFUH 3VXQB 2JAFA 2ADFH 1P5UA 1FZKB 2GJRA 1MREL 4JFDD 4UUJB 2WO3B 5ESVB 3V10A 3ARED 4TV3A 3VWKC 5K33A 4FBZA 3N42B 1G6VK 2AEWA 1MJUH 2MPVA 2VQUA 3R8QA 5CCGE 4KH2A 1M7IB 1NCIA 4NN7C 4M3KB 2ARWA 5CIPB 1OAUL 3ESPA 1Y18A 1DDHA 1X0K1 2DLEA 2X0UA 1RUAH 1HILA 2E27L 4JFDA 4M5YH 5D6DC 5LGHL 2DV6A 5ANMA 1CTMA 3AREA 4QHPA 2F19H 1TCMA 2YGQA 5GGUB 1LE9A 2IXQB 4WI2A 3EGSA 4XTOA 3MGTB 5IQ7H 2EDBA 4LCIH 4U0QB 4YGVA 2YRLA 5F7FA 2XN1A 1W0WA 3OB8A 3E6HA 4K3EL 1BVKA 1ZPUA 3GTVA 3UTSD 1E4XI 2AW2A 4CGTA 1NC2B 3TC9A 5KW9H 1AGFA 2IH1B 3JT0A 1AOHA 4X6FA 5JOPE 4KVNH 3QSKB 3KGTA 5CU5A 3BH9A 3U2JA 1ONQB 1TEGA 3PJLA 4NUPA 2OSYA 1UC6A 4G8GD 3SYPA 1JV2B 5DUPH 2O6DA 1PLGH 3UTSA 2WIMA 3R06A 4KAQH 4LU5H 5JLZB 2QQNH 2YFOA 4FXLA 4MBOA 2BWQA 2WLMA 3STZA 4FMFA 2VLLB 2DH3A 4G8GA 2DQTL 3ARVA 5IK3B 3AMLA 6FABH 3VGDA 1CFNA 4PJIF 5DFVC 4EN3C 5DYOA 1GZMA 2OMUA 4JG9A 3C9NA 3BVXA 3V4PA 3VQLA 4HUUB 2WO4A 2FZ3B 3Q5OA 2MH4A 4NQVA 5AVWB 3WKQA 4MLIA 1GGCH 3LZQA 5F7LB 3NIFE 5TPWL 1J9TA 2X1QA 5CEYA 1I4FA 4P99A 5H8DA 5AAWC 3SDAB 2YGPA 5LG1A 5HHXL 1RVFL 5AZ2H 5C6TL 2QJDA 3OPZH 2P5WB 2YD3A 1EO7A 1XZ0B 4FA6A 1JWSB 1HCZA 5G2DA 4H5SB 3IDJA 3KPOA 5LWYL 4B0MB 4BV0A 3QHTC 1FZMB 2PPDA 2JF1A 4L4TD 1J1OL 1JDCA 2FT6A 5LXGH 4DP4X 2MHAB 4ZXBC 4NKQB 3GXFA 1WZ1L 2K78A 3RA7L 4DWHA 4QXTB 2BS71 1RZJH 2Z91A 3UTPE 2NNRA 5FXCH 1BLNB 2H7WA 1E9OB 5T1LD 2UZIH 4LSSH 3CHRA 2XXFA 4XN5A 3FT3B 1RZQA 3K1KC 4L4TA 4PIBA 4FFYL 2QV4A 4I3RL 2IADB 1GYVA 3ZT6A 3WFEL 5T1KD 4Z3JA 5AW0B 5CS7A 4I1RA 5BQ7B 4RETB 3T2NH 4GUPA 5T1LA 3MKGA 4NC3A 1KCRH 1HSAB 2WQWA 2E0PA 5ID1B 3WJJC 1JPFB 3HFFA 3ZKMC 2UY7A 5E2UL 5T1KA 5E24E 1LNUB 4KZEH 5IMLB 4HBCL 3PHOA 2L3BA 4ES8A 5C8JB 2TAAA 3P77B 1N59A 4M48H 2SEBA 4F33A 2Q8AL 2XJLA 4ERSL 4X6BA 3OAYK 3PGFL 3Q9QA 4UT6L 3TTYA 2Z7ZA 1PQZA 5IG7B 3LAFA 3PWVB 4Q9QH 1QLFB 2J72A 3IJ9A 3WAJA 5LBSA 2NXYC 5CD5D 1PZAA 4LSVH 3UPRA 3L5XL 1MVFA 2WBWB 2AJVL 5FS5A 3RFZC 2OP4L 2QEJA 4JO2H 1KN4H 3BFOA 1EGJL 3CLEL 3S96A 1JK9A 3UBXG 2GJ6E 4U1GB 3VWJB 3V4VL 3NFPA 5E00A 3OHMB 5JPNC 1A1NA 4DP7X 5EIIA 5DJ6B 3VTAA 1I8KB 1OCWL 4PS7A 2A6JA 3X3BA 1A47A 1CYXA 2DQDH 1X44A 4DAJA 2BIIA 2ITCB 2C9QA 1AZBA 2ZTBA 1U3JA 4WNQB 3KEHA 1VGKA 4ELKB 5JIQA 5FECB 2L6XA 3K80A 5DI8B 3BP6A 5IQ9B 4QHLB 3OX8B 2OI9C 4LSTH 5I8EA 1JGVH 4Z5RA 3STLA 2GI7A 1HHIB 2VL5B 2DWTA 3H4FA 3WSQL 3L5HA 5FPIA 3H56A 1KV3A 3WU1A 3VB8A 3L3IB 3ZE2B 3PP4H 1R3HA 4MB4A 3FO9A 2YEZB 1RIHL 2YIHA 4DKFL 1CFBA 1MCPH 1JFHA 3T2QA 3WIHH 3MLUL 1GKOA 1P84J 2OMVB 5SWQB 3QCVL 5D1QE 1SBBA 1MCIA 5KBMA 3MC0A 1JTOA 1WHOA 4LLMB 1Y6NR 3GBML 4GJTB 5JHLH 1KXHA 3ECUA 2ZG2A 3GNML 3QIUB 4LLAA 1JK8A 5EOQL 3MREA 5I26A 1SUJA 4GAGL 1GGBH 3MJWA 2JELL 4MJJA 3GS4A 4FD0A 4FXKC 1FNHA 4EUPA 5EOCL 1NCBL 1CYGA 4G7VH 4LNRA 5C2UB 3K6NA 2HLFC 3IWUA 3K71A 4OLUH 3SKUD 2N1KA 4FNTA 1AKJD 1GS6X 2CD0A 4N6HA 2CKNA 1GHFL 4JR9H 4BWUA 4XPTL 2DWEA 3OR6B 4R8WH 4YO0A 4WCYL 1EBAA 3JV6B 4ZX5A 1E8WA 3INUL 5IWLA 3REVA 3KNBB 4XO4A 3SGJC 5JXED 4AUUA 2ZKWA 1HTYA 3ARDD 1BOYA 1OAKH 1AKJA 1M6OA 4J3VA 4YDLC 5J0BA 4HHAA 3D25B 5F7AA 2F7OA 2VH5H 3MLSL 1QSED 3GSRA 4HLZH 4HV8B 3HS8A 3OF6D 1JVLA 5D1ZD 3W11C 2F5AL 1AI1H 1LEGA 2DQHH 2EEBA 2XZAH 4IBYA 3CBRA 5KN5A 5JXEA 1P7QD 4PYHA 5IVXB 1J8HE 3ARDA 4YDJB 4J8QA 2PEDA 2BSED 2HWZH 4X80H 4J3OD 2EILB 4X9BA 1X4ZA 1MFDL 1QSEA 3OF6A 5D1ZA 5M94B 1B0WA 1S4IA 1I3UA 3NJGA 4BFEA 2DI9A 4O5LL 1CU4H 3VG0H 1CE6A 3QNXA 4JFEB 4N8VB 1E3XA 1ZK5A 4JRLA 1P7QA 4TLSA 5EC2A 3X14B 4OLYH 1FSKB 1CFTA