3EH5B

Structure of the reduced form of cytochrome ba3 oxidase from thermus thermophilus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined microspectrophotometric and crystallographic examination of chemically reduced and X-ray radiation-reduced forms of cytochrome ba3 oxidase from Thermus thermophilus: structure of the reduced form of the enzyme.
pubmed doi rcsb
molecule keywords Cytochrome c oxidase subunit 1
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3eh5B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3eh5B02
4BEYA 2N0MA 3QBIA 2B3IA 4F2FA 1RCYA 2FQEA 2VW6A 1N70A 1RKRA 1NICA 2YAEA 3AG4B 5A8EA 5ITCA 5G2AA 3OQRA 3MX0B 3FSWA 1QHJA 1L9RA 2XV3A 4YSDA 2BHFA 4QI1A 2BW4A 5H2KA 3FSVA 5PAZA 3ZIYA 2DY2A 1R1CA 1BXAA 1AG0A 3T45A 1BYPA 1GS6X 1GSKA 2Y00A 1OCOB 1MGYA 2YCZA 3JT2A 4QLWA 5A7EA 1L9QA 2HX8A 4Q89A 5I6NA 3QDCA 2IDFA 1FA4A 4HYXA 1TN5A 1JZGA 5I26A 4A66A 2JAGA 1C8RA 1KMEA 1NPJA 5E9NA 1X9UA 3CDZB 3S3BB 4A67A 1JGJA 4BV0A 1AS6A 2TSBA 1IXFA 2Q5BA 3ABLB 4N4YB 1PNCA 3OM3B 2YARA 2UXGA 2IDTA 3EH3B 2YXWA 1XJIA 5B1JC 2VSMB 4BWTA 3NS0A 1CWQA 4W9ZA 3X1NA 2OV0A 5I6OA 1XB6A 3NYAA 2ZXWB 4E9RA 2YAHA 1TEGA 4YSAA 3S8FB 1H2SA 4GBRA 1IC0A 3FSAA 4N8UA 1E0PA 3UTVA 4KNSA 2YXVA 3A7KA 4LDLA 1YLBB 2FTAA 3FPXA 4JHVA 5I6KA 3NJFA 1JVLA 1R2NA 5H2IA 2DV6A 1S51A 3QJTB 1L9PA 2A3TA 5ITEA 1XB8A 2PLTA 4JKNA 1TKWA 1AZNA 2GI0A 3REYA 2ZWNA 3DIVA 3HAPA 4YSOA 2NTUA 4MQTA 4PXFA 4BXVA 3C75A 3PAZA 2RACA 2BO0A 2XX0A 3ODUA 5B6XA 2BZCA 3D12B 4KLYA 1A4CA 1NWOA 5F7AA 2I85A 4A2DA 3UONA 4PAZA 3UGEA 3V9CA 4BDVB 2FT8A 5DYSA 1AZCA 1CYWA 1RZPA 1AIZA 4DPAX 1P8HA 1S53A 3QAPA 3AW5A 1SDDB 3MBWB 5EN0A 3IBOA 3UABA 2GBAA 4DJHA 2QDWA 2X72A 3S3DB 3X3CA 1URIA 4YSTA 1AP9A 3TU6A 5B3SB 1AS7A 2F93A 3V2YA 4Y9HA 1B3IA 3HEIB 2YAOA 3UG9A 3FQYA 1GY1A 1E30A 2BWDA 4QKTA 3UTWA 3VHZA 4G7QB 2IDSA 2DYSB 1UAZA 1OV8A 1QHQA 3CAPA 1EZLA 2PPAA 3OMAB 1SF3A 2AVFA 1MZYA 2Z55A 2FJSA 2H3XC 1KG8A 3QJSB 2FQDA 3NP3A 1UCQA 1V55B 2PP9A 1BQKA 2P80D 3IEAA 4UHRA 2ZZLA 5B34A 1JXGA 3KW8A 3DTUB 4DP7X 5I5MA 4F7KA 3PDSA 1JZFA 2GSMB 2VMJA 2J56A 5F7BA 4KO7A 4A2EA 3TBBA 2X87A 3UAAA 3WIAA 2JAFA 5AZDA 3T6WA 2BW5A 4YSCA 1X0K1 1IBZA 4AKQA 5A44A 1BRDA 1PF3A 5I5IA 4XTNA 2H47C 3NP4A 1JFPA 5G36A 1SHXA 3UAEA 3OE9A 1GYCA 2HRGA 1AR1B 3AYNA 1SFHA 1JXFA 4E9TA 4HYJA 3NJLA 1NDTA 3FYIB 5EHFA 5B1JA 2R4RA 3PLYA 2HPYA 2GHZA 2CAKA 2FT7A 3TBCA 3H4HA 3IN0A 2IH9A 5B0WA 3AY2A 5G2DA 3C9MA 4WAVA 4HZ1A 1W6WA 3WG7B 1C8SA 1GY2A 2XYBA 3SQRA 1PY0A 3T6VA 3HASA 5B35A 2I21A 2Y01A 5TK2A 1W8EA 1E5ZA 4MFHA 2J55A 1ZDQA 3UZAA 1J9QA 4M4RB 5PCYA 3T71A 1GS7A 1OF0A 4FBZA 4DKLA 2UXFA 2UXVA 1PLCA 2IAAC 4AZUA 4XTLA 1GR7A 4N6HA 2CBPA 4E9QA 1KYAA 2LNLA 1ASPA 4XTOA 3GDCA 1NIEA 2OCCB 1BXVA 4WTQA 3T9WA 5BR2A 2UXTA 1PY6A 1BQ5A 2FQGA 1P8UA 4GY4A 1BYOA 5JJEA 1SHWA 1M57B 1I53A 3TASA 2IDUA 3GYRA 1BRRA 2XXFA 3V9EA 1N68A 1FWXA 1GS8A 4P5RA 4XT1A 3QBGA 3T6ZA 5B6YA 2AFNA 2QDVA 2W88A 4JR8A 1J9RA 5I6PA 1AZBA 3ERXA 2Z73A 2BRDA 5H2HA 1AT9A 1M56B 5AX1A 5LWEA 1AG6A 2AANA 3WNJA 2Y02A 1ZPUA 2R4SA 3H4FA 1MZZA 4E9WA 2QT6A 3NJKA 2UX6A 4HALA 3DKHA 2IDQA 2YDOA 4HWLA 1A3ZA 5I6MA 1IW9A 1IBYA 2VN3A 4XXJA 1NIDA 1TU2A 2RH1A 5B1AB 6PAZA 2WO3B 1HFUA 4GRVA 4DPCX 1GU8A 1QKPA 3P0GA 2CCWA 2YQBA 2IH8A 4YVNA 1NTDA 3U25A 3SBPA 4HHGA 5D4HA 4X32A 1OCCB 4IB4A 2XWZA 4X1HA 5IY5B 2CUAA 9PCYA 1Q5JA 3RFMA 3FPYA 2EILB 1SFDA 2PPDA 1S52A 5D4IA 5I5JA 1WA1X 4PCYA 4GP8B 4OV0A 5H2OA 4BWWA 3X1EA 1FBKA 4ENZA 2IWEA 3OMNB 4GP5B 2J57A 1F56A 3AG2B 2BWIA 2FNWA 3ABWA 3NSDA 3NJIA 1NWPA 3T6XA 5AWZA 2BZ7A 4NERA 1BXUA 4W1TA 2VM3A 3ZBMA 1BM1A 1WA2X 1M9WA 4EIYA 2R7EA 5AKRA 4JKVA 3WKPA 5B6WA 1SJMA 2JFCA 2FT6A 2MRYA 3FYEB 3COCA 1V10A 1DZEA 3QJRB 1OCZB 2DYRB 2NRDA 1ILSA 2Q9OA 2XUWA 4HAKA 3ZPRA 4WKXA 1FFTB 3PPSA 2I7OA 4IAQA 3QBLA 4E9SA 3QQXA 7PCYA 2WO2B 4AKPA 3FU9A 1JZJA 3JTBA 3D4SA 1FBBA 2EIMB 5TGZA 4DP0X 1RZQA 2BP0A 1L9HA 2KS9A 3OE8A 4JHUA 1NZRA 2CALA 1SNRA 1ZDSA 4KNUA 4NB7A 3L45A 1VJMA 3OD3A 2XVBA 3ZDWA 4YSPA 4DP4X 3ASNB 5LDUA 2P80A 3NY9A 2BP8A 1A8ZA 3PCYA 3SN6R 5B6ZA 4CSPA 4LDOA 4N4WA 2YDVA 2LLNA 1F88A 2ZFEA 4PXKA 3WKQA 2GIMA 1PMYA 5FC9A 1W6LA 2H5UA 2WSDA 4FA7B 2EI4A 2OJ1A 4X31A 4AMJA 1P8IA 1NIBA 2YAFA 3EH4B 1JVOA 1SF5A 2ZOOA 3PAVA 4AKOA 1E67A 2I1XA 3ABGA 4A2GA 2AT9A 3NYKA 2Y1AA 1BQRA 4BUOA 4KO5A 2PCFA 3NY8A 1V54B 2L6XA 3ABKB 3FU7A 3X1BA 1CURA 1F4ZA 2W8CA 3AG3B 3HAOA 1OCRB 3EF4A 3KJ6A 1NPNA 3SBRA 7PAZA 3QJQB 2GC4C 3UZCA 1PZCA 5JJNA 4G72B 1QNIA 4G71B 2FQFA 2B08A 3DQBA 1TN0A 2HXAA 4L0PB 2X88A 4L35A 4EF3A 5H2JA 1S8LA 4K5YA 2UX7A 4BWBA 5JJJA 1OE1A 2XLLA 5B2NA 1ET7A 3NJJA 3X2QB 4DP8X 3AZUA 1M0LA 3BQVA 1AZRA 5G28A 1PAZA 1KCWA 2J5WA 2GC7C 4HCGA 3NJNA 5AZUA 5AHZA 5G2CA 5G54A 2XV2A 6PCYA 1C3WA 3S3CB 3VI0A 3IN2A 4GXFA 5B1KA 3OMIB 4MD2A 3QBKA 1PXRA 2YAMA 1KGBA 1AACA 1WS7A 1BEXA 3ZPQA 3MBVA 4G7SB 1NIFA 2JXMA 1XIOA 3CVDA 1KBWA 1S54A 3FU8A 5TK4A 1VLXA 4UANA 2DWTA 4KO9A 4F2EA 3NSBA 1DZ0A 1QLEB 2MTAA 1M0MA 4DP1X 2XXGA 4YSUA 5B1BB 1BAWA 1AANA 1ILUA 3N2JA 1JOIA 1PZBA 1JZEA 1ET8A 3FT0A 4J4QA 3FQ2A 3NJHA 4MD1A 1XMEB 1ZV2A 3BVDB 3PXLA 2G87A 3UTXA 4E9VA 3X3BA 1ZIAA 2VSKB 4QIDA 1UATA 2J4YA 1AAJA 3EHBB 5DHGA 3PAUA 4AX3A 1KDJA 4YSSA 1WS8A 2CJ3A 1KDIA 2R7EB 4BXSV 5A45A 3UADA 1O0AA 2KSAA 4HIPA 4KOBA 3AM6A 2EIJB 1LN6A 5B6VA 1PXSA 5B7MA 5H2PA 3PQRA 1KG9A 3PXOA 1CC3A 2KSBA 5BR5A 1QM8A 1ZIBA 1ASOA 4K9JA 1U19A 2HZHA 1GUEA 1J9TA 1AS8A 1X9RA 1GZMA 2HX9A 1X0I1 3X1GA 5G53A 4E9YA 3ASOB 4AMIA 3EH5B 3FS9A 2BP0B 3WI9A 5AFAA 4GYCA 1IKOP 1ETJA 1F50A 2PPEA 1KV7A 1M0KA 1A4BA 1JERA 1PNDA 4HHWA 5I6LA 2XU9A 4Q8BA 2AZUA 1L0MA 4RH4A 2I7SA 2ZIYA 2VW7A 2FWLB 5H2NA 5B7FA 2VT4A 4XT3A 2BP8B 3QJUB 1QKOA 3H56A 4HCIA 3GXUB 1BRXA 5J7AA 4BVNA 3PBLA 3S8GB 5DHHA 1JZHA 1WAEA 4MQSA 2YAQA 3FSZA 3NSCA 5B7EA 3WNIA 2WJKA 3CDZA 3QPKA 3G5WA 3OE0A 2WJLA 3RZEA 2PPFA 1E65A 1PZAA 3KW7A 4HCFA 3AYMA 1VGOA 1PLBA 4M3HA 4A2HA 4QRYA 4GPOA 4NAJA 2XX1A 4BEZA 2IWFA 3UTYA 1L9SA 2F95A 4KNTA 3EMLA 3AG1B 3NT0A 1IUZA 4A68A 4FPDA 1J9SA 1L9OA 4G70B 1AQ8A 2EIKB 3FU7B 1JZIA 2DWSA 2YAPA 3TA4D 1JV7A 4DAJA 2ZONA 4AI7A 2PEDA 4MBSA 1DYZA 1E5YA 1NINA 4JQ6A 3HARA 1ASQA 1KBVA 4GYBA 4YSRA 4IARA 1ID2A 4UG2A 4TXVB 4DP6X 2YCXA 2M3GA 3VG9A 4BWUA 2XV0A 2I20A 1PLAA 2Y69B 3CVBA 4UF7C 2QPDB 3NSFA 4DP5X 4DP2X 5C1MA 3N55A 3V2WA 4BK5C 1L9TA 4BDVA 4E9XA 1R84A 3QJVB 3X1FA 4DP9X 1J5DA 1PCSA 3ABMB 1H68A 1NIAA 5H2MA 1SDDA 2YCYA 4EA3A 4DPBX 2QPEB 5ANHA 4CSZA 4TL3A 3CG8A 2E86A 2PPCA 2Y03A 4EJ4A 3CODA 2KSYA 1AOZA 4KO6A 3VW7A 1CUOA 2IWKA 4WW3A 3C9LA 1KGYE 3UACA 2HX7A 3IE9A 3VVKA 1HZXA 1Q5IA 3PWHA 4X4KA 3HANA 1JXDA 5H2LA 5AX0A 1CYXA 4YL4A 5F8UA 3RYMA 2HLEB 5D4JA 1OOWA 5I28A 5AHYA 5KKHA 1MDAA 2Y04A 1IW6A 1ET5A 1E12A 2AZAA 2HRHA 4UAHA 4G7RB 1JV6A 4YSQA 1A4AA 1OE2A 2TSAA 1S8JA 1HAWA 3QAKA 4YVUA 4P5SA 2GB2A 3OAXA 2PP7A 3HB3B 1AZUA 4ZK8A 1OE3A 2VW4A 5FJGA 3VGAA 4A4MA 3NSYA 1MG3C 4KNFA 3OE6A 1ADWA 2PCYA 2YCWA 4L6RA 1A65A 1HAUA 4YSEA 2NTWA 1XB3A 1GW0A 1KCBA 3NJMA 3ZX1A 1T5KA 3DDLA 3FQ1A 3NJGA 3SBQA 1J5CA 3CVCA 3HAQA 1WA0X 2EINB 8PAZA 4GP4B 4A2FA 5ETZA 1EHKB 1X0SA 2I35A 2JKWA 2PP8A 4NC3A 4LDEA 2VM4A 3WQJA 1TEFA 4FAAB 4KOCA 3CZUB 3ZEVA 1MG2C
chains in the Genus database with same CATH superfamily
3GSNA 4FULA 4JG0H 5JLZA 3AG4B 3ZYOA 3PHOB 5AW3B 5ITCA 3KNBB 3MUZ1 4P2OA 5LGJB 3KE0A 3FSWA 4XH2A 1QHJA 4ZW5A 2R0ZH 4M6NH 3BDYH 4PJHF 4XHQA 5C0RL 4RIRB 1Z3RA 2WZ5A 4R4BA 4UT7H 1XSJA 2YCZA 4QLWA 4ZTEA 1L9QA 4BK5A 1JGEB 4KUZH 2IDFA 1QZNA 4KJWD 4KGLA 5F8RC 2KLTA 4M5SA 1Z0NA 2QQLL 2YUZA 4IU2A 3C2AH 1JGJA 1YHPA 3WIHL 4MJ5B 4MNGA 2OKMA 3M1OA 1Z9NA 3RUGB 2Y1VA 3RY6A 5HVHB 2GFBA 1XJIA 3TC9A 4Z23A 4BWTA 3SY0A 3VXQA 2N4IA 1QSZA 1FYTE 1RUQH 1SY6L 2OV0A 1UADC 2Q7NA 2XN9D 1C08A 1DO5A 5I30H 3CN2A 5ESQB 1G9ML 4MMYB 1HCYA 3DIDA 2HJKA 1R3IL 4I87A 3ZR6A 1E0PA 4MJIE 3MRCA 4KNSA 3DURA 3WUWA 4Y2LA 5EA0H 3OKEB 3IGLA 4F7PB 5GRYA 1JZ3A 2NTUA 3II3A 4XNXL 3PXHA 5D7IB 3TO4C 2YUWA 1KSRA 1JDAA 3UTQB 2APBA 4XVJH 4H2AA 1T1YB 4PLOB 1A4CA 5IBLC 5F7AA 4HG4K 1LILA 3QDMA 3L6FA 5F7EL 1ZA3B 2PYEE 3LH9A 3RBSA 3V4LA 5JW5B 4JKPL 1I9EA 3LJ3A 3CDGA 2GAZB 5HYSA 4Y8DC 3QORD 4X5WA 3C60B 1MF2H 4FYQA 1IFGA 2VE6B 2EH7L 4LL4A 4AGLA 2V2TB 1B3IA 2WGXA 5E2UH 4XGZA 4X9YA 1IGTA 2DAVA 3LZFH 4NKOB 3UTWA 1Z32X 3OMAB 3TNMB 5J12B 1JWMB 1RJZA 4OQTH 5GSVB 3AT0A 4NC0B 2RHEA 4MZ2A 4LU5L 5DEFA 4DKAA 4XMKH 1CD1A 3KPTA 3FRPA 3ZE2B 4UUJA 3UAJC 4NUGL 1NGXA 3VFVB 2ISDA 1UCBL 2CM6A 4B0MM 5C0FA 1CLOH 2A74B 2B16A 3JZYA 5L2KA 3ZDZE 1QFHA 3FUMA 4XODA 1CGSL 3VCLA 1PSKH 4N8PA 4DCQA 1U8LB 2WYTA 3UAFA 3VXOB 5E8EB 5EG6C 1FVDB 2OA9A 3HS0C 3MCKA 1JFPA 1SHXA 2QPFA 4DN4L 2I07B 3BP5B 2B2XH 4H20L 4JFEE 4ODUA 1KV3A 4XMTA 5KSBE 1GAFH 1XGYL 2V5SA 5FO9B 1GIGL 1P2CB 1CD0A 4TUUA 5CEZD 2PKDA 5EC1A 4P2YA 3PE9A 4OCRL 2CHXA 3H4HA 1MIMH 5TQ2L 5D6DC 5G2DA 3PL6B 3E80A 1KZQA 3F3HA 3H8NA 4NRYB 5I18H 4DN3H 2F5BH 4G42A 2CD0A 4WV1C 3UDWC 4CVXA 3VM5A 4KVCL 5E1HB 2EO9A 1N5AA 3N9GL 5FKPA 5FM4A 1QEWB 4PJIF 3J7HA 2CJUL 3T4AB 4HQQL 4E41E 3QYNA 1SN5A 4IBUA 1IT9H 1FVCB 1GOGA 1PLCA 4M93B 4XTLA 5D4QA 5FYJU 2NY4C 2WIIB 1TEYA 4AK1A 5LBVA 1BXVA 2XIDA 1KLGB 3W81A 2X6VA 3Q2CA 1KXHA 4PP1D 5LAXA 1XH3A 3V4VB 1UT1A 3VXME 4IEFA 5ILTH 4DUXA 4XOCA 1HE7A 5D1ZI 4X9BA 2EADA 3VXRD 1FWXA 5KG9A 1NAMB 3B8SA 3KPNA 1GS8A 5I9QC 3X13B 3QEQE 1VGKB 5L6YL 1SXZA 2ESVA 2ID5A 2ZT9C 4PD4J 1H15A 4R6UA 4OVUA 2PTTA 3NMEA 5J6HB 1KLFA 1S7QA 4HKXB 5KYUA 4X4MA 3UJJH 4ZYKB 1YC7A 1BVZA 5DHYA 5CR1A 4X8CA 3ZO0A 3A23A 5E4IA 1IAIL 1IE5A 4B53A 4XXJA 1QLRA 2ED7A 3TN0B 3ZW3A 5D55A 2OMUA 3K6SB 3S0PA 1OAJA 1U3NA 4P57B 1NLDH 2FECL 3CMOL 3C5ZD 1DVFB 1IBFA 1YNTB 5ADPL 3WJLA 1YEEH 2YKLL 5IVXE 1E8YA 2HKHL 2OPCA 3OAYH 4W9EC 1H5BC 3MV8D 4TLUA 5DHMC 1KFGA 2H2SC 4BJLA 1URLA 3RFMA 1HHGB 1J9CT 1KBGH 2GT9B 3FPYA 5EIVA 3SE9L 4APXB 2FO1A 1PD1A 2P45B 4LOVA 4UT9H 3HMWL 1AXIB 5L7XH 2NW2A 3ETSA 1VPOH 3G9AB 3VXNB 3L9RB 5ITBL 1FBKA 4GRWH 1FNLA 1NBYB 1G6RA 1YNKH 4K3GA 1D9KC 4OM0L 1X5XA 3W2DH 2JCCB 2WLIA 2A6DB 3GI9H 4ECNA 4IRSC 1HSAB 4LSVL 1Q9OB 5ENWA 3QFJB 3HN8A 2GJRA 2K8QA 2Q9OA 4OY9A 4Y5YC 3N1PC 4WUUB 3ZQXA 1DQDH 3QXAB 4NN6C 2OP4L 1MAKA 5ACZA 1CQKA 3VNYA 4EDXA 3MLSH 4HZAA 1AKPA 3CSPA 2KMWA 5CLTA 4JZJA 4HW6A 3L3OA 1MWOA 3GSNH 2H26B 4GQRA 5EPMB 4ENED 3VXPA 5CSZB 1INDL 3V5KB 3SCMA 1QASA 3ZDWA 3CSFA 2C3VA 3W37A 5H37G 1ZLSH 4ZNCD 3SKJH 2PCPB 2AERT 1BZ9A 4GG6B 4OKDA 2YDVA 2FBJH 3CHQA 3VVWA 2NTSP 5K9QG 3MV01 5E5UB 1F6FB 5FC9A 3DMMD 4CN4A 4MDIB 1M7XA 5I8EB 3MLRL 2WSDA 3O3AB 2AI0H 4OR1A 3CSYA 4PJHB 3BVTA 3A21A 1JD9A 2OMBA 1IGCL 5EBMA 3T09A 1TF4A 3B6SA 4MKMA 3QQ9C 4JFFD 5D7SH 5MENB 3S2AA 3ATDA 4M5YL 5DFVC 4JAMA 3TTYA 3HI5H 5I1KH 5GSRA 2NUPB 5K69A 1OCRB 1FL3A 1G7IB 1GMIA 3F6JA 4NZDA 3SBRA 5HBBA 3GMOB 3C5XA 2V37A 3F7PC 4JDZB 5T1LB 2D9QB 4KZCA 3P9MB 2LFEA 4JRXA 2X05A 2ARJQ 3VGGA 3QHZH 4L2LA 5LUMA 1TUPA 4WZ9A 2MTPA 2YD8A 3G5XB 1BWWA 4QWWC 3AWFA 4TL5A 4XPAL 1G9NH 4XVOA 3IPEA 1BGXL 2Z0BA 1T6VN 4N9GB 4Y4HD 3BW9B 1A8JH 1ZCRA 3I6LD 4XZUB 3GRWA 3TBVA 4N2NA 1FGVL 1EJOH 2YEVB 4KBPA 4U1GB 3L1GA 4YDNA 5EUOA 5C2BH 2DTMH 1P1ZA 4K3DL 1HESA 1TVBB 2ZSVB 2QR0B 4J5VA 1KIPA 3QWRD 4WWNA 2R2EA 3WDJA 4FZ8H 4XVTH 5TF1L 1CF8L 1MRDH 3DHUA 1EEZB 3AM8C 3B43A 4F33B 2XG4A 1GYWA 4QIRA 3UBFA 5A43C 1KENL 1QG3A 5GRWA 2O6CA 4PJDE 5IQ7L 4C47A 3IJ9A 4QHNA 2QGEA 5IQMA 5DYOA 1SJEA 5J1TC 3MOBH 3QUXB 3L2NA 4HLZG 1FZMB 3LHPL 1MCOH 4U1SA 3D08A 4K07A 2R7EB 4MJ6B 3UPRB 1G9EA 4P3DA 1RUPL 4FFVD 5I19L 1L3WA 2CGRL 2HB0A 3QO1B 2DL2A 2ED9A 1D7CA 4Z7QF 3OB0K 2BNQE 5BO0D 3OXSB 1ZIBA 1G1CA 2HWZL 4ZUUB 3BZ5A 4BELD 3GZPA 3WSQL 1J9TA 3APCA 1EO8H 2Z34A 3EH5B 3D1MC 3FS9A 3IAQA 5C9JB 1WZMA 4HEPG 2CBQA 4GYCA 2F15A 3MRGB 1SYSA 4G7VL 3V0HA 2FEEL 4NZRH 5C07B 1TLMA 5E8DL 1FO0B 4Q8BA 5CGYC 5K5YA 1MELA 3BC9A 1D6EA 2A74C 1SBSH 5I1IH 2WWMD 2R1XB 1I8KA 3RVUD 4ETQA 3HPJB 4IU3B 1BRXA 4TSAL 4FP8L 5AOIA 3E3QE 5EEYA 3WNIA 2IANB 4NZFA 3U1SL 3RU8L 2V9UA 2YPLB 4NLAA 4YXHL 4BZYA 5DLLA 1NCTA 2J20A 1QOKA 3FO2B 4W9LC 4M3HA 3OKOA 5DUML 2KUTA 4EI0A 3RKDC 1P4IH 3Q8BA 1X9QA 4OW6A 5HHXL 1M71B 2ZWKA 2Z6FA 3GJFB 1F3RB 3G5VA 3UIYA 3PL6C 4GBXC 2EH8L 2KLRA 4K9EH 1X7QB 2EIKB 2YAPA 2ZKHL 2EIZA 4OLYL 4AV4A 3IXTA 4RAHA 1QKZH 1XFPA 1QBLH 2OX5A 1YJDC 1GGIL 4JQ6A 3IDIA 3KEHA 4NI6A 4IARA 3HZKA 4KK6D 4V33A 1JI1A 1V05A 4M93C 3GGWA 4FYTA 5L4MA 3MACH 4L8DB 4E9XA 3B5TA 4PRHD 5IBUG 5BJTB 3V0WH 4DKFH 3PUCA 3U9WA 1FAIL 5KYWA 4KMTH 3O9WB 4TYUA 1MSPA 1HNGA 1R0AL 4WK4B 4HKJA 2OI9B 3S37H 5T1JA 3HR5B 4FEIA 1QW9A 2BRRH 4OZFG 3HANA 1JXDA 2VLKD 3RYMA 4WWID 1V27A 2R29A 5TH2B 1CGVA 5JDSB 5TDNB 2QV4A 1K2DA 4K94L 5G4MA 3D39E 2DQEH 1OE2A 2WB7A 2F2HA 4FKHA 3WNKA 1CXKA 3GS0A 5F89B 3TN0C 1F3JA 5D5MA 3L7EA 1P7HL 3VDAA 2RMNA 2J1ZA 3LKNA 4TSBH 1XCQA 5DT1L 5HYIA 1FH2A 1ROCA 2BFVL 3I50L 1DVFC 4XPHL 1DJHA 3WN5B 3L5XL 4MQ7B 5GZOC 3FT4A 3SE3A 3VXRA 1XB3A 3E6FA 4QYOB 1ZXKA 3FQ1A 2W9EL 1I7TA 2EINB 3L3KA 3IETA 4A6YB 1ZV5A 2EXWC 2JKWA 3T2NH 1YYCA 2A9CA 1R17A 3ZEVA 3LKSB 1X5KA 2HTKD 4OD2B 4OI9A 4LCUA 2B1OA 2ZUUA 4DZ8A 5INCB 4MLIA 5AVWB 2WWKT 2FHCA 4ORGB 3SE4C 2V33A 3MNWA 3N3EA 2IFFH 2FYYB 1UOWA 4JJ5B 4G8AC 2EXTA 3U36B 4Z7AA 3VFRB 3H9HA 3LTVA 4D9LH 5FYKL 1U95B 3X14A 1N26A 5EO9B 1DVTA 2HFEB 4F7CB 3C5ZA 1MGYA 1IZJA 4WI0A 4LFHG 1FA4A 1WDAA 4KKBC 4OB5H 4ETYA 1M2VA 2A9NL 3MV8A 4KHXH 3BEVB 4AIZA 4KXDA 2A1WL 2XXMB 1JBJA 5FYLD 4LEOB 4PG9B 4XXDA 1RZFL 3TOPA 3WEAA 5FOBA 1IXFA 4M9OA 1AGCA 3ABLB 3GMNB 3K1KC 4JVWA 3T0EB 4S2SA 2E7DA 2MNJB 3VTAA 2BVOB 2X4RB 4QAWA 1RSFA 3MVSA 3TJEH 4YPJA 3LSOA 43C9B 4AMKL 1TEGA 4O58L 2IPTH 3S8FB 2MPVA 1HX0A 5DS8A 3CK0L 1OANA 2HVJA 4LMQE 4X6CF 3O11B 1W16A 3QK0A 1QNZH 5I1HL 4WW1B 3AS3A 4TQIA 5BZXA 1CG9B 1G43A 2XWJA 3VQLA 3SB3A 4HJJL 2OBGA 1WBYA 2BZCA 3KG5A 4WRLA 3IFPA 1OK8A 4PJFA 3HC4L 1A9EB 2X6MA 3AU1B 4Z7UF 4ZMTA 1EDYA 3GRWH 4WFGE 1WWCA 4JL2A 3KPOB 5GZND 1QW8A 5B38A 1K6QL 5A16B 4M7ZB 1S53A 3FZUC 4HP5A 4BH7A 3S3DB 1U0QA 3U82B 2BHZA 1KT2A 1U8CB 2YAOA 1IQDB 1KELL 2ZOUA 3F7VA 3ULVD 5HJ3B 5DI8B 4Y1AE 2DIJA 2P5EA 4JB9H 4UU9B 5ISZE 2F74A 4N2LA 3CAPA 3DMMA 5BNXD 5I74B 5I1AA 5DMKA 2FJSA 3U0WL 3HC2A 4ZJ9A 2AJZA 4W9DC 1P9MC 2PP9A 4ZO9A 3T3PF 4Q9CA 2OMWB 2ZG3A 2YO3A 4PJXF 2NNFA 4IQHA 3ARPA 2FO8A 4YR6B 3SDAD 3STLB 3D52A 3HB3C 1ORQB 1WP6A 4WAFA 2OAAA 4S1RL 4KO7A 4JFFA 1KACB 1U3HA 4CW1A 4P5MB 5E1GA 1MFDH 4Q7DA 4U1GC 1I85A 3B2MA 2H1LM 5DD6A 5I0YA 1MPAL 4NJ9H 1Y07A 4KKCD 1G1OA 2G5UA 1CDCA 3EYFB 4LHUD 3ROOA 5GS0D 1UB6B 4KXAA 4PRAA 3LEXB 2VNCA 3RGVD 1KXQE 3GMLB 4EI6A 1HSBA 1BVOA 4H2CA 2A99A 4PFEA 3IMTA 4GI8A 1S9YA 5EHFA 4ELKA 5CLWA 3SEPA 5K1NA 4Z7QB 1D5IH 2K4AA 1YUHA 2WINB 1XCWA 4TLKA 3QUXC 4PRNB 3FCSB 5FOJA 1DBKH 2A9AA 1WRFA 1UGNA 2IG2L 3Q48A 3EYOA 1ADQL 4MNHB 1NSNL 1JUFB 3UZAA 1J9QA 3OKMA 3V7MA 5EEVA 2K7QA 2B4CH 1C8QA 3U0TA 3HNTH 2WUBH 3QWRA 1SVBA 3VH8B 1IFRA 1CLYL 1KOAA 3JV6A 3EYVA 2FQGA 1BZQK 4GY4A 4TKWA 1OAXL 5JJEA 3TASA 1BRRA 3OKLB 5GIRB 2D7NA 3SY6A 4WEMB 4YGAB 3EJJX 4JRYD 4NWTH 2VUKA 3EGDA 4TVPD 4FNPA 1ETA1 1L4IA 1R19A 5F0PB 1EFQA 3NABL 2QDVA 1PG7X 1UFUA 3P3TA 2FIKA 5EU5B 3APFA 1B0RB 3SPCA 4Y2DC 2K9UA 3UJIL 3OBAA 2EVHA 2EE3A 3L7FB 3OHMB 3DO3A 2Z73A 3MRIB 5C8JA 4L3CA 4GNKB 1UA6H 3DOIA 4V2BA 2Q7AA 3UCRA 1ZPUA 4ZFGH 5FLVA 5EIIG 5M95B 4HWLA 1VA9A 1Y6MR 3KYOA 5AVUB 1CR9H 4JPWL 1IBYA 1R9FA 5BPPA 5DJCA 3H9SB 5ADOH 1TYRA 3HNSL 3DX7A 4OZ4A 5B3NA 4HHGA 4XOEA 4I1NB 4J3OF 2B14A 1VACB 1S7UB 2WBJB 3IS1X 2R29H 3V4PB 1I75A 3UCQA 2R1YB 2E6QA 3BPOB 2QPSA 1IC1A 1I1RA 1JPSL 3FB6A 4HWZA 4LOEA 1WIOA 2BSBA 2DLTA 5LNGA 3QO0A 1MHHA 2WTOA 3KPSD 4I85A 1KB9K 5JZ7C 4FQ1H 1YPZA 4X80H 2LLLA 4S10A 4WO4A 2ZNWA 4ZUWB 5FO8A 1M9WA 5FYJL 2CLVB 3VWKD 2G75A 4OCYL 1KB3A 1Q1PA 4JKVA 5FDWB 1OP5K 3WEMA 3O9WC 3EBGA 4H88H 3CFUA 1NGZA 4U4IA 1CMOA 4UINH 3E6HB 1FC2D 1AQKL 2BM3A 1YJDL 4G7YH 1KCVH 1RK0B 4GSXA 2YLHA 4E2OA 4N0CD 2XKUA 2UUDK 4H8HA 3QUGA 3D4SA 3KYNB 4LPXA 4AEIH 4Z77A 2RCSH 3B2UD 2XHNA 3U9PH 5D1QC 4MKTA 2VN7A 1K4CA 3QEGH 3OG6B 1IJ9A 2J6WA 1AE6H 4OZGA 3V4VL 1Y6KR 4X4YA 2C7UA 4RISH 1ZLVK 4ELDA 2E7CA 4KH9A 4PRHA 4NOFA 1NAML 2VMFA 4GEJA 5G5DB 2HT2C 2VXQH 3MRLB 4R9HA 5GGTH 3WN5C 4M6OH 4LKXB 1LM8V 4XBMA 2ICES 2QJDA 2ZCHL 5LKNA 2WSKA 1CDJA 1RIUL 1WAPA 4J28A 4NSKB 3VXSD 1NDGA 5GXBB 1TVHB 1MHPL 2FH8A 1JHKL 2VLKA 4IRZA 4AKOA 1FGNH 4XBGB 1N4XL 2ZX8A 5KVGH 2V5MA 2APVA 2WBXA 2PCFA 3SYAA 5D7EA 3S5ZA 4R3SA 2H8PA 3D51A 3OZ9H 3QSKB 3BLKA 3D69A 5JQ6H 5T5NF 4ZS7H 4E5XB 4LFHD 1TJIL 4UQ3A 3WIFB 5E8NB 4Q6KA 3UZCA 3OJDB 5AW2B 1V3MA 2R2BB 1WUNT 3D25A 5CILL 2WMPB 4JW3A 3AB0B 1IGML 1T2XA 3V6OC 3MLVH 1QQDB 2APTA 4QRQB 3RA7L 3IDNB 4X6CB 1ET7A 3L2MA 3IU3B 3VFMA 3BQVA 1T7YA 1Z9SA 2FEDD 2J5WA 4X6BA 2VLRB 2XV2A 4KK9C 2GHWB 3I85A 6PCYA 2IH3B 1PX4A 4NAMA 4GXUN 4QJ3B 1Q0XL 4GQ9H 3KXFA 3CBKB 3ZE1E 1X4XA 4M7LL 3CFKB 4EKJA 1KGBA 5FA3A 5CJQH 5IB2B 1M1XA 3ZPQA 3BP7B 1NIFA 4JCLA 5EZIL 2BOLA 1CFTB 2A6KA 3ARDC 3QYCA 3SQBB 5IB4A 4KZ0A 3U46B 4AQOA 4W4OC 3UC0H 5TFSL 4BH8A 2EICA 5EWIL 3C08H 1LO2L 2QKIA 4J4QA 4GRWF 5T1KD 2CHZA 5AG8A 4HX1A 2X1WL 3VD1A 3PWUA 1T0NA 4KDTC 1LXMA 2VT0A 3NCWA 4LCVA 3T3PB 5F1NA 4PJXB 1OAQL 1WS8A 3DRTA 2YR3A 4N8CH 1FNHA 4HH8A 5IMOB 4JDEB 3HI1B 4AYID 5BO1H 3AM6A 4LVNC 3MR9A 5H2PA 2P44B 1XX9C 4Q52A 1IBGH 3D0VB 1SPDA 3RL1A 4ERSL 3DSFH 2UZPA 3WGVB 5F9OH 1E28B 3GXTA 2Y72A 2Q86A 5I74C 4A7GF 3O2VL 3STBA 3X1GA 1RERA 4JFSA 3PWLA 2IV8A 4LCIL 5F3HA 4FABH 3PIQB 4XHJC 1SN2A 3QCTH 4QRPD 5C0AD 2F9BT 2I7SA 1JPGB 1RZIB 3GS7A 5H2NA 2EE9A 1N6UA 1R3HB 4QXUL 4FDWA 5GZNA 3SJVB 3WNPA 1QR1A 4YFLF 5DJXB 5L88H 4Z7NE 4GAAA 1BP3B 3D0LB 4R0LA 4L5FE 2KKQA 4OF3A 3EHBD 2WWOA 3HTLX 5DMJB 1HWGB 2V2XA 5FM8A 3VFUB 3VFPA 4FA8A 5JHLL 1C16A 3CFDB 3UTSB 3O6LL 4FJ6A 2Z7ZA 1RURL 2NZIA 5IFAL 2YN5A 5DJ2A 3FU7B 2DH3A 1T20B 3SDAA 2ZONA 4Z3HA 4H40A 25C8H 4N5ED 5E56A 1YEJH 3BVVA 4RAUA 4D9QE 1PIGA 5A6MA 2FZ3A 2ZTBA 5CIPA 5HGBB 4NJAL 2J5LC 4DP2X 2VR3A 2R0WL 2XY1A 4UDTB 3V0IA 1J5IA 3DNKA 4LHUA 1AD0A 1R84A 1I9RL 2NXZD 4LB8A 3OGCB 3RGVA 3ABMB 4MAYB 3NUKA 4R8WL 2MPAL 1TCRB 2H0JA 3D48R 4WJ5B 3MXWL 4CSZA 4XPFH 3FCBA 4WJKB 4FXKB 2CDFA 5DK2B 1U2HA 1XR9A 2HLAA 1E4HA 1UUNA 4N2CA 5IROD 2K4WA 1Q5IA 3DECA 2H32A 5MP6L 4NQVA 1CYXA 4HS3A 3CDFA 4GW4A 1DVXA 5FXCH 1DJYA 2ZJSH 4JFDE 1MCKA 5D2NA 2Y04A 4OJFL 2O5ZL 3ARQA 4IOFC 2HJFB 2CR3A 3DHMA 3FHQA 2X4PA 4OD3H 1U3ZA 3RUGE 4ZXBD 4JFVA 5IIEB 2F0CA 4OQ1A 2AW2A 4YVUA 3RWFB 1PG7W 3OAXA 2XKNB 3MTRA 3UP6A 4UQ9A 2A38A 1FO0L 1XIWB 3NSYA 1XVSA 1MG3C 2VITB 5GGSA 3OE6A 4WCYH 4L6RA 2W60B 5HSFA 5ICYA 2B7DT 2WBJC 1UD2A 1HAUA 4PHZA 5E8OB 5HJDA 1GW0A 4JRYA 4PWJA 1J5CA 3BPOC 1J1XH 3QPQD 1MW0A 3PWPD 1P7KB 3BZFA 2I60L 4FQXB 3M8OL 4A2FA 1ZEAH 3EDDA 3EYUL 5TE4L 3DJTA 3IDMB 3AQXA 3CZUB 2EYRB 2C3GA 2R23A 1FLTX 1RCYA 3SO5A 4WI3A 3ATEA 4NHCL 3WENA 4F92B 5K59E 1NICA 2UYLB 4LLQA 1JPFB 5A8EA 3WJJC 3L3JB 1JPST 5G2AA 1R5VB 5IEHA 2ZXQA 2DQCL 3PQYD 4OJEH 4KTEL 5KUKA 3L4CA 4MZRA 4OAWB 5PAZA 2N7SA 1QFWL 4Q2ZA 1DSFH 2CIKB 1FORL 1BXAA 4PJ7A 1BYPA 1PYWA 4JG1H 1OCOB 4RMQA 1YEFH 1S9XB 4DGWC 4K73A 1E5CA 1PX3A 4IRZH 1JZGA 3ZU8A 1D2PA 3GXDA 2XWTA 3P0VH 1R46A 1A6TA 3MC0A 3OR7A 4JRLA 5E9NA 3CDZB 3RDTD 3SGEI 4YHLL 4G1EB 5EC2A 1IM3D 1JFQL 4QHMB 3OM3B 2YA1A 3UTTD 2X6CA 3WNNA 2YXWA 4EVNB 5KYXB 3KPSA 5EEZA 1FZOB 1YEIL 2PWFA 2XTJB 4HS8L 2HVKA 1S8DB 1S5IL 4HOXA 4ZUSA 5K9KA 3VWKA 3KHQA 5F3BB 5H2IA 1PLGH 5ETUB 4PJ5B 5JNYB 3QJTB 1L9PA 4P49A 3HAPA 2EUVA 4IS6B 4P46D 1A21A 1LK3H 1QX1A 2Z91B 3C75A 4J2XA 1JN6B 2XX0A 4L1SA 5J9PA 2CLRA 2P52A 3K8MA 3BO8B 1S7RB 1TYJA 1IM9D 4A2DA 3BD5A 5ICXA 1U93A 5LBSL 3V9CA 1JHTA 4M29A 2YGNA 4AW4A 4OLXH 3V52L 4ONGH 3CPLA 1E27A 3OPZH 4HDIA 4GO9A 1VRSA 3QI9A 4ODVL 3UABA 1HQRB 2EKSB 3QDAA 4QT5A 3QA3A 3BP4A 3GSWA 3ZVVA 2OL3B 4XP1L 1A7PL 1GY1A 2XETA 1JPEA 2WXQA 4TULL 4PU2A 1UAZA 3AB0C 1V3KA 5SWQB 3NAAL 1JWUA 3QDGE 4JHAH 1M9SA 3VRLE 2GABA 1JXGA 4DP7X 2HG0A 3ZDYF 1L7IH 1HZKA 1XO8A 3CC5A 4NAQA 4ZPTA 4F5CA 4GRWB 3E8UH 3HBZA 3IDGA 3EYQD 4YDJB 5EN3A 4UQBA 1RU9L 3O3BA 2WXNA 3WEOA 1AFVH 4G6KL 3W9EA 5DDHB 5AW5B 1NCIA 1L7TL 4FYSA 5CP7B 2A73B 3KDMB 2MCPL 1AY1L 3N85L 1ZHLA 3DPBB 2DMCA 1H8OA 4GAYB 4YPGA 1JXFA 3GBLA 1TQWA 4WHYH 1HH6B 3FYIB 1RUKL 2Y7LA 4HUWB 5IW3A 4K8RD 1GKEA 4NNXA 2CAKA 2WLMA 1DDHB 5I76B 1G7QA 2QVTA 1IIIA 4IKLA 3BP6A 3APNA 3UTPE 1LP9E 2W94A 3VB8A 3O6MH 3GSNB 3ZT5A 4DQOH 2OMYA 2QHRL 1AXSA 3OHXC 3NFSH 3T6VA 5JLZB 2VR9A 5F7KC 2WAHA 2JI1A 2Y01A 4P2OB 1YAZA 5JQHC 2P8MA 2JELL 3HLAA 4XH2B 4JM4L 4RLDA 1JGUL 1I9IL 1IILE 1PL3A 4N0FA 4R4BB 1IVLA 5C92A 1TZAA 4LPYA 4J6RL 2X44D 4UILH 4Z7IA 3MLYL 4JPSA 5BS0D 2JCCE 4R4ND 2X10A 4IU2B 4TF4A 1CVSC 2WW8A 2E75C 4I9XA 4MCYA 1KTJA 2DQJH 2LE9A 4MNGB 5AAWA 2AK4D 3QFJE 4OIAA 2GFBB 2EXYD 5ANME 2WXKA 4LLVA 1CTOA 1AR1D 3SY0B 3MLWH 1EWHA 3GI8L 3PHQA 2ZG2A 4PWGA 2YBRA 1C08B 5J1AA 3LQAH 5CIPH 1MIEH 4YDIH 2HJKB 3B5HA 5CCHE 1AZBA 2WUCL 2IOMA 2N7AA 3MRCB 2VIRA 4FHJA 1DQIA 4X7CC 3DURB 3WUWB 2C9AA 2A4EA 3WY1A 4BK4A 1SOSA 3GSUA 5F8QC 1VFBA 3BAEL 4PUBL 4AYFA 4P04A 1E8WA 1AQMA 1HN1A 3BFWA 4WEEA 1SJVA 1OVZA 4L3EE 1HFUA 3QDMB 2XWEA 4XE0A 4GG6E 5EUOF 3L6FB 4RESB 3QDJD 5JA8B 4F57L 1QSFD 2H32H 1BJ8A 5D4HA 4RSVA 5CLYA 1PTZA 3CDGB 4JHBA 4QRPA 3TPKA 5C0AA 3VA6A 4X5WB 1I1FA 3HVNA 2EDFA 4AY0A 1WA1X 4XGZB 1EAPA 1IGTB 1G1KA 5KSUA 1HZLA 4MJ4A 3P0YH 2CZNA 3NZSA 4ENZA 3WU1A 3NG5A 1JF1A 4YHZL 3H85A 1RJZB 4QNPE 3IJYA 2AK1H 1Y0LA 3EKCA 5DEFB 5FB8A 1GCYA 1CD1B 1WA2X 4A39A 1YN6A 3FRPB 5AKRA 4UUJB 4UTBH 1NGXB 1H6TA 3SQOH 3FYEB 4DGIL 3D33A 5C0FB 3QJRB 2FBOJ 1ILSA 1CI5A 5L2KB 3RIAF 1NLBL 3Q7JA 4Z7OF 4M1GL 4MMXC 5C0CA 4ONHA 2OZ4H 1OAUH 3VCLB 4XO3A 5EBWA 4U6TA 4DCQB 3FTUA 1MJUH 4B3VA 4LF3A 4Y2OA 5DZAA 2ZAHA 2CO7A 3MCKB 4JO3L 4ODUB 3N06B 2VDMH 1OCWL 3KGRA 5JHDD 5KANI 4ZD3L 5EC1B 1A8ZA 4LDOA 1KFAL 1XIWC 3Q9QA 1Q1JH 1V7MH 2MNWA 1FVEA 4G42B 1L3NA 3BUDA 4D9RE 1NL0H 3CTTA 2ICCA 2K7PA 1FNSL 1UEMA 4A7VA 3MXVL 4TUJA 5HHMD 1CFQA 1SXAA 3U7AA 1N5AB 3LYRA 3OAUL 5IROA 5FKPB 1UC6A 2ZOKA 4J23A 4G6AC 1J5OH 1B90A 1QBMH 4UMSA 5F96H 1ML0A 2YD0A 4XPBH 2IIJA 4UQ2A 3ZSSA 1PKQA 4U49A 1E8XA 5CJ5A 2XOTA 2FK9A 2NOYA 5LAXB 4TVUA 1XH3B 3WFDL 4ZXBA 3FTZA 5TDPA 1JNHA 3DVNA 1UD4A 1B4RA 5HVWA 1I7ZA 5KG9B 3KZ8A 3CHRA 3EO9H 1HKLH 2ZP0T 3KPNB 5DK0A 3V4PL 1T66D 2KBGA 3ME0A 4L2YA 4FG2A 2ESVB 1H15B 5BRZA 3LAFA 2CKBA 2PTTB 3SGEH 1KLFB 1S7QB 3X2QB 3QWOA 5M7QA 2BNRE 3LKRA 5KYUB 5K39A 4RFOH 3ZTJH 2RH0A 5DHYB 5HYFA 4HCGA 1HZHH 4A2LA 4FX5A 3MODH 5C07E 3S88H 5HHVL 2BWQA 4QTIH 2EAEA 3JYCA 1QLRB 3POCA 1F4XL 5AW6B 2OMUB 4WEBL 2XTJC 2BP3A 3CVDA 3V5HA 4F37K 3SDCD 1ZD6A 1E42A 3NSBA 2MTAA 5CCKH 1CI3M 2L0DA 1D5XB 4KQ3H 3S35X 1QEXA 1JRHL 2YD5A 2WKOA 2FJUB 5A7BA 4FNLH 2QGBA 4H25A 1N64H 4IDLA 3NJHA 4R2GC 5BOPA 5LGHL 2FATL 2XA8L 1F3DH 4NPJA 4CBPA 2G87A 5D5MF 2V5RA 3RDTA 1G6RB 4PJBE 3UTXA 1H3GA 3ZO9A 3ARRA 5BMFH 2VSKB 4QIDA 1J5HA 4PGCB 5DHVH 1IM3A 2I5YL 3BAWA 2WLIB 4WEUD 5EF0A 2WAQA 4PJCF 3UTTA 2W1NA 5CS7A 1QABA 4IJTA 5ENWB 3ZDYB 3LCYA 4X5RA 2AQ3A 2E47A 3BRDA 1H6UA 1F97A 1OD7A 4LIQL 4JM2D 1DQVA 5E4OA 1UWGL 5JIQA 3T4YA 5ACZB 2L3BA 4EDXB 4RWHA 4R96A 1C5BH 3IJ8A 1EHXA 3I3DA 4JZJB 3A5VA 1MI5A 2FDBP 3L3OB 4GAGH 4G3YL 2J1WA 4GRLC 3VXPB 2WYZA 5T33H 2AXFA 2VXTH 1GA2A 1UENA 4YOKA 5DZNA 3SCMB 2DB8A 2O1AA 3AUWB 1FCGA 1IM9A 4WNJA 2H1PH 4Y9EA 2C3VB 5DK3A 2JK5A 4FXTA 1BZ9B 2F68X 2UZYA 1MFAL 3BDBA 3O2DL 4HCIA 3HAEA 2CBTA 1F4YL 4LCYA 2PN5A 3EJUA 2FAUA 4MQXD 1BD2D 3OAZK 2J4WH 3GHEH 1J8HD 3AGWA 1E65A 5D1QE 2VH5H 4HWNA 3H55A 5K33A 4WY7H 4GMTL 2WLZA 3DTXA 3GF8A 4GIOA 1USZA 1RZGA 3V7AG 1NBVL 1GRWA 3KPMA 5EBMB 1U3JA 5SX5K 5C86A 1IUZA 4OT1H 3B6SB 1NCGA 3INUL 5AZEH 2JE8A 4I1RA 4JAMB 1GOFA 1HL8A 1LHZA 4V1DE 3TYGH 3FU0A 4LCCC 4NQQA 5GSRB 4P5TD 4ABWA 3O3EA 4J8RA 4P2OC 1FL3B 4GO8A 4XT1C 1CQYA 1IGFH 4QAMB 2CMRL 4OCWH 1FE8L 1YEDA 4LSTL 5D2LA 2QPDB 1S6NA 2BS8A 3MROA 4JRXB 4PJFF 3VFOA 1KBBA 4BK5C 3RPKA 2YPKA 4APQD 3QJVB 2FJFA 3NIDB 6FABL 3S4SG 3GJEA 5GISH 4G5ZH 4LSQH 3EDJA 2F7PA 1BQUA 2QPEB 3FXIC 1KIQA 5JW3L 3CG8A 4LK4A 1G7MA 3PUUA 3GZQA 3RY6C 3CODA 3F00A 4RZCA 1DJGA 3HG5A 1KGYE 4UT6A 3BQUC 2VR5A 3IE9A 3TBVB 2WCGA 3RFZC 4KI5F 5A3IC 3A4EA 3HS9A 5H35A 1IVTA 1P1ZB 5DR5L 1GPOL 3Q6GH 4YL4A 5EN2A 2BSCA 4U1LA 3ZT6A 2E0PA 3GSVA 3VYPA 1WICA 1KIPB 2R2EB 4U2ZA 2HRHA 4Z95L 4F1SA 4GSUA 5LDSA 4PSPA 2XG4B 3QAKA 5GJTL 1EZUA 3Q2WA 1FZKA 5DVNA 1NDMA 1GC1H 1OE3A 2JJUA 4QF1A 1OP4A 4QHNB 5BS0A 5DYOB 3KMDA 4D0CA 3NCJL 1SLXA 2ZP9A 2YCWA 2F53E 2AK4A 1AP2A 1G9NC 4FEMA 4U1SB 1I1CA 2JJWA 5FHBH 4P3DB 3LZRA 1DFXA 1HIMH 1A1MA 3P3YA 5E51A 3VFGH 1KEMH 2NPLX 4AH2A 5ETZA 2ZYSA 4U1HA 1K9TA 4Z7OB 3QS3A 3I75A 2QTEA 5FHAL 5ECGA 2N0MA 5C7XL 4NQXA 4RDQF 4KUZL 5CBAA 3QR0A 3RB7A 3VWJC 1SYSB 2Y7MA 3TIEA 2EUZA 5F7MC 2A9BA 3ZIYA 3N1MC 2IWGA 4HJ0D 1OSEA 2Y1YA 3RURA 3QDJA 1GS6X 1JWSA 1QSFA 4JO1H 3VFTA 2Y00A 1I8KB 2L04A 1N5YL 1RUQL 1U36A 5LAPA 4ETQB 1RJCA 2VRKA 4PRPA 4WWPA 3RAJH 5CD5D 4FQCH 1YYLL 1E4JA 1UH4A 5IGXH 1IC7L 5DWPA 5EA0L 1TMQA 1PNCA 3IWVA 3QEUA 1DCLA 3OKOB 2KPNA 1CWQA 1E7UA 3R19A 3QAZB 3G5VB 3T2PA 1QR4A 3E2HB 5FGCB 1NC2D 4FI6A 3M17A 4ZX5A 1N2RA 1JVLA 2EIZB 2FX7H 1T4WA 4UM9D 2CKBH 4GS7B 3ZTNL 3IXTB 1XB8A 3EADA 4KQ4H 2OX5B 1AZNA 4IKKA 3HZYA 5DXWA 4PGJA 3D85D 3IDIB 4F24A 2BOBA 5I6XB 3CLFL 3HZKB 4PY8I 4S1QL 1EO5A 2QBWA 4KLYA 4POUB 3CX5J 3GGWB 2H9GA 4OFDA 4PAZA 5D7LD 4JKKA 3J2PA 1A7QL 3EO1B 5JHDA 4DJHA 3ILPB 5KYWB 2J43A 5T8IA 1GOHA 4WKZA 4Y7MA 3CLWA 4Z3JA 5IMMA 4XE5B 4Z7WE 2BWDA 3N40F 4S1SL 4HKJB 4DGVL 5BQ7A 3UPCA 5BW7A 1CLOL 4NPYA 3VD4A 4K9EC 3EOYG 2G2NA 1SF3A 5HY9A 4RRPA 4AL8L 3GSOA 1YPZF 1ZOXA 5GGVY 3NP3A 3GBMH 3QG7H 1BQKA 1WC7A 2YGQA 3AABA 4HZLB 3T04D 2ZZLA 3L1OL 1DJXA 2R27A 4ZS6D 2VM9A 4J3XA 2B2XL 4MZ3A 4UNTA 5D72L 3ESVF 3FUJA 1UQSA 1TQSA 1MQ8A 4KKZA 1GL4B 1F3JB 4I9WE 1J8SA 2QQKH 3L7EB 4PJ8D 5D5MB 4F7MA 3PNRB 3T6WA 3LKNB 1RZ7L 1RIVH 1XCQB 3WEBA 5BUPA 3CE1A 5D1ZC 1F4HA 4KTDL 4PJCB 1PF3A 3FT4B 2H47C 1EAJA 1EGJL 2F5BL 4GO6B 3E6FB 4L9DA 4ZO7A 2J8UB 3VXRB 1GYCA 1TOXA 1AIFB 4U1JA 4E9TA 3MBXL 1I7TB 1W91A 2C4FU 2VDOL 3L3KB 3QIBD 4HCRL 4N24A 1BLIA 3IETB 4M5TA 3QC5X 2AGJL 3IDJA 4OZGF 1JE6A 2QLYA 4L8BA 1YNLL 3WFZA 2WLHA 5TE7H 4LCUB 4UI2A 4DZ8B 1WT5A 1TZHA 1GY2A 2VR4A 1J05A 4XCCH 3HFFA 4AEHL 3MNWB 4WU5A 5ILTL 4MA7H 4MXWL 2WXIA 3H9HB 2NXYB 1KCLA 1O75A 3WIHA 4MYWB 1DFBL 2DTSA 5DD0H 5EORL 2UXVA 5KSAD 4ZW6A 3NRFA 5I2IA 3ET9F 2J12B 1JMZA 3C5ZB 3C8HA 3QXVA 4FQPA 3GHPA 4GJTB 3LH2H 4WI0B 1WFTA 1NIEA 2XIBA 4WTQA 1M2VB 5JIMA 3MV8B 5HDBE 3RVWD 1SY6A 3GBNH 4C4BA 2B15A 4JZJC 2W9DH 1PY6A 1ZTXL 1BYOA 5AW4B 2Q1EA 3UP1A 2IDUA 3V0VA 5FOBB 4UTAA 1AGCB 4FTVD 3ULUE 3UJJL 3SCMC 4S2SB 4MAUL 1F18A 2Q3ZA 4E9LA 5LGKA 3LSOB 3ARTA 3S36H 4G8GD 2E76C 1WEJH 5DS8B 2OL3L 3UBXG 2HVJB 1AT9A 1QBAA 3SGJC 1NLDL 2QADD 4DNLA 3VFSA 1YVLA 4FNUA 4P2AA 4PBDA 4XP4H 4JM2A 1C7SA 2UX6A 4ZDHA 1P4BL 5CN3A 4K8RH 3DHJA 4IIQC 1WBYB 4LHJB 2GYSA 4UT9L 4F8QA 1G7JA 3IFPB 4PJFB 4XCFL 4L1HA 4UT6H 3P0GA 2CCWA 3L3GA 3RWDA 4KKRA 5T3ZL 1Q90A 4ZAKD 5B38B 4NNYA 3W2DL 1EZVY 3TJHC 3KPPA 3AGVA 5AWNL 5KSVA 5I1DA 4PB9H 4DGYL 1SOQA 3F7VB 2O5XH 3FQXA 1NAKH 1N67A 4W68A 2P5EB 3FN0L 3CQPA 3KM2A 2F74B 3HFMH 1BD2A 2GUOA 3DMMB 1WGVA 5I1AB 1J8HA 5DMKB 1KB5A 5J8OA 4HUUA 4POYA 2AJZB 4IRJC 4Y9GA 1LO5A 5AAMA 3EOBB 1BFTA 2FT6A 1ES0A 2XPGA 3WTVA 1B2WL 2SEBA 1HDMA 3LKPA 4WKXA 2CU9A 3B9KC 3O4OC 4JFFB 1EEQA 1U3HB 3BVNA 1W0WA 1ETZB 2YRLA 1ZLSL 3SKJL 1RIHH 1FBBA 1EQWA 4LZKA 4P5TA 2EIMB 3CQQA 5DD6B 2FBJL 3M6DA 4TNVK 4X6CE 4DP0X 3ROOB 4JHWH 5J13C 2Z64C 4XCYA 5C0ND 1VJMA 4EI6B 4LXFA 4WWKC 1D5MA 3BSZL 2MQ0A 1AGDA 3RHWK 4ELKB 3DBSA 3RVVD 4B9JA 4APQA 4KJWC 4J12A 3B3BA 4HXAH 4NKDA 1YY8A 4HAGA 2E4TA 3OXRA 5E8PB 3MRJA 1JK9A 5F7FA 5D7SL 4OLZL 1W6LA 4TUOA 1IAII 1RZKL 3RVTD 3IB4A 3BMVA 3HI5L 4LRNH 4NENA 5I1KL 3MI6A 3ULVF 4LCWD 4X0NA 1XGQA 1OALA 5GRVK 4X31A 1NIBA 5E2JA 5H4YA 4I3RH 1WQVT 3OKMB 3OKNA 4JFTA 4U7KA 3U0TB 2I1XA 43CAA 4XMPH 3ESMA 3KGSA 3QNFA 2VN6A 3JV6B 3EYVB 3FKUS 1GVIA 4BRJA 2V7NA 4XC3H 4JGNA 4BV1A 5IB3A 5JOPE 2GC4C 2YIHA 1J0IA 1JCKA 3EGDB 5JQIB 3KLSA 2VR6A 4H8PA 3VGEA 4I8DA 2NY1D 4XMXA 3EZJB 1S8LA 4M61A 5AVVB 4MDRA 1A3QA 1FHGA 1EJOL 1WFJA 5C8JB 4FQIH 4L3CB 1WK0A 4FTDA 3S34H 1AZRA 1MCPL 1FFOA 3VI0A 2COVD 4C56D 2B4CC 3AQZA 3IN2A 2HRLA 1BZOA 2EO1A 3KYOB 3MRFA 5DS1A 3ZT7A 1QRKA 3FU5A 1X5GA 2K70A 3QAZC 3QUMH 5DJCB 1CFVH 3E2HC 1NFDA 4O00A 1MLBA 1PGRB 3DX7B 4OZ4B 4BQBA 1DQLH 3FU8A 4G1MA 4H8WL 2GQHA 4EUPG 1DSYA 5GPRA 4GS7C 1FSKB 3CVIL 1QYGL 5I6XC 1WO2A 2XPYA 2NY3C 3FB6B 4HWZB 4JY4A 5LGYA 4A7TA 2GJ6A 2IGTA 2P7TA 3WGUB 3S97C 1KN4L 3PXLA 1MHHB 3QO0B 4HIXH 2BIQA 1QHOA 2GK2A 4LAJH 1YPZB 3CXDH 2OTWA 2DYPD 4AX3A 5IB1A 1T4KA 4WO4B 5HI3D 3EUUA 4V11A 5IMKA 5FO8B 1RLWA 1OF2B 1DN2A 2DS4A 2G75B 3F04A 2B0SH 2ZPKL 5CINH 5GRUL 1NGZB 3RWHA 1CC3A 1GMEA 2KSBA 1NC2A 1XXFC 2EDTA 4UAOB 1KXVC 4TQPA 2C9RA 3OJMB 2V3DA 1F00I 1FV1A 3FUFA 3UO1L 1DN0A 4Z77B 4XRCA 5C0RH 1K4CB 5JDJA 1PNDA 1M0KA 2P49B 1ZVYA 5FKAA 2X9ZA 1MAML 4OZGB 2FWLB 5B7FA 2QQLH 4X4YB 5D7LA 1P4IL 2C7UB 5IF0A 2I69A 3WIHH 4PRHB 4WFED 4PP1C 4Z1PA 2LV4A 3VX1A 3MA9L 1XSKA 1SY6H 3N0PB 4HCFA 4F37F 3IT8D 2GEEA 2HSIA 4OSUL 1R3IH 4M4PA 1NDGB 2JCWA 5ECJE 5IQNA 4AQZA 4EZJA 2XX1A 1KCSL 2VLKB 1SBBA 1VERA 4FPDA 4EQ2A 3BRFA 1QI5A 1HXKA 3WTSA 1ZXQA 2PCFB 2XZQH 1NA8A 4R3SB 2H8PB 1E3XA 3D69B 3WMSA 3HMXA 1MCJA 3HARA 3P02A 4UQ3B 4KKQA 4PJ8A 2NXYC 1DCEA 2VLLA 3QHTC 1E9QA 3D25B 1F11A 3C5ZC 2RIKA 3S37L 1XZWA 3SDDD 1PPIA 2EH7H 5LG6A 2VJ0A 4NIYE 3U6XA 3WIIH 3O4LE 1PCSA 5F7HA 1WCBA 3JWOL 3VFMB 1CK0L 1G6RL 5GJSL 3QIBA 1Z9SB 2DWEA 1MCDA 4X6BB 2IEPA 5HYJE 2JJSA 4KO6A 5EEWA 4LU5H 3B56A 1SLUA 2XQYA 1XAUA 2IMNA 3KXFB 3PS6A 5FA3B 1M1XB 5AX0A 4MS6A 4NUGH 2FEEI 2BSED 5DO2C 1UCBH 2A6KB 1TZIA 5D4JA 5IB4B 4P2RD 4PLKC 3UBGA 4BH8B 4G7RB 5KSAA 5A40E 3VO0A 2K9FB 3K81A 1CGSH 4HVBA 1YMMD 3X17A 1JMXA 1HHHB 3IJHA 2QKIB 4KZDL 2JV6A 1A6AA 4HX1B 3N04A 5FJGA 3VGAA 1AR2A 1T0NB 2K3HA 1AKJA 3DOSA 1UD5A 3PWUB 4H20H 4LSPL 3K5SA 1XGYH 5KVFE 4AYBA 4C83A 4HOZA 1I8MA 4FTVA 2YQGA 5F1NB 1GIGH 2HFTA 3BIKA 3DRTB 5G55A 2YD7A 4OCRH 5HI4D 3JV4B 3QJFA 5TQ2H 4UOZA 1UM6L 3HAQA 5DC9B 3MR9B 1E4WL 4G8GA 1EHKB 4HUMB 4TM9A 4MA3A 3RL1B 2NQCA 5A2KH 4KI5C 4D9LL 4H5SA 3KR3L 5JW4N 4DP8X 3DMMC 2AVGA 4ZFOA 2Q86B 2YSTA 4KVCH 4D3CL 1ZANL 2QSCL 2WOYA 3PWLB 2B1HL 4GKNA 4OB5L 2CJUH 5B8CA 2IH1A 5F3HB 4X2UA 2GK0A 3OQRA 3Q8CA 4KTGA 2TRHA 2YFNA 2XV3A 2ZKXA 2BHFA 1J1PL 1C1EL 3HHSA 3NACL 4P4RA 3ETBF 1QSVA 2NDFA 2W07A 3L4TA 1U3HC 4YL9A 3MQIA 4F20A 1DVYA 1I85C 2ATKA 1QR1B 4U7SA 1Z9PA 4R0LB 5ESVA 4ANKA 4X6DA 2UWEA 2TSBA 5L6YH 2V2XB 1OT1A 3S4SA 5IOPA 3VFPB 2Y2WA 1C16B 3F58H 4DKDC 4QEGA 3QIWA 4D7PA 4GRWE 1J0HA 4AJ0A 5LG1A 4XO4A 2FJGA 3WBDA 3CX5K 2BOCA 4AENA 1FNAA 4LDLA 1YLBB 2V8LA 4JHVA 5DJ2B 5C09E 1IAIH 3SDAB 1H9DA 2ICEA 1UG9A 5KOMC 3UGEA 1IGJA 4HOWA 2WQUA 3UTZA 1NFKA 4JK0D 1UH3A 3EJQA 4AIOA 2JH2A 4RAUB 1QRNA 4NUMA 4P2QA 2FZ3B 3CMOH 1TENA 4CMHB 5ADPH 5CIPB 3D12B 3GK8L 2DM7A 2HKHH 3NTCL 3FDWA 1N6VA 3CFJA 2EDOA 3ZUNC 4JB9L 4LHUB 1AD0B 2FT8A 4JY5L 3SE9H 3RGVB 3HMWH 3C2SA 3R18A 3O6FD 3MZGB 1FPTH 4TNWK 2QDWA 3I9PA 5GGVL 1I7UA 3TU6A 1T0MA 2UZXA 2CDFB 3DJ9A 4OM0H 4EN3D 3CXHK 1XR9B 2HLAB 4NQCD 3IJSA 3PQYE 4NQDB 4LSVH 1QLEL 2H32B 1BBDL 4HV8A 4NQVB 3ZKXC 4HS3B 4GW4B 4WI4A 3QJSB 4XC1L 4FFVC 5D2NB 1JNJA 1ACXA 2MSPA 2OP4H 2J88L 3C9NA 3CFBA 4M7KL 4CADA 2X4PB 3I9IA 1AC0A 4RGND 4FG0A 2JLPA 3MLPA 4FFYL 4XB3A 3WELA 4A2EA 3TBBA 5JPNC 1INDH 3F12A 2IBZY 5GGSB 1BJ1H 3ILEA 2GY5A 5ICYB 4PI2A 2FGWL 4XTNA 1NC4D 4JRYB 5D71L 3QUHA 3UAEA 2NT0A 4Y7OC 4UNVA 3AYNA 3WJMA 3L3IA 1SUHA 4OCXH 3BZFB 3RVUC 5KS9E 3ARFC 1J10A 3N6YA 4HK3J 2GY7B 2R23B 1ZLWK 1UA7A 2AXWA 3FT1A 4WO4C 3LRLA 4LLQB 1GGBL 1XT5A 3FK3A 2VDMB 5AOZA 5IEHB 3WFBH 4S0HA 4M5YH 3ES6A 4NWTL 4Q2ZB 2UXFA 1PYWB 2IAAC 3LNFA 5DURD 4AZUA 3EGXA 5I1JL 5EU6D 2W80C 1RPQA 2XWTB 1A6TB 3LKQB 3OR7B 3L3DA 1SHWA 5DZOA 3NIFE 1I53A 5DJAA 5EC2B 4U0RB 5B22A 4MASA 2XXFA 3TP4A 4KK6C 5IBUB 3L4UA 1X6NA 4MCNA 3KPSB 3T0BA 3V8OA 1U9KA 4PVMA 4RFEA 4UOJA 1CR9L 5CEZL 4OFYD 5HHOE 5AOJA 2HVKB 1K85A 4XPAH 1OHQA 3BVXA 4ZUSB 5K9KB 4LBEA 3VWKB 2FIRT 2ZKMX 1XDTT 1L6PA 3H4FA 2G2RA 2J25A 1FGVH 4XP9L 4XP6L 4XO8A 2CK2A 5DVLA 3PV6A 4K3DH 4BUGA 4XMWA 3KM1A 3GTVA 1IW9A 5J9PB 2CLRB 2D0HA 3MKKA 4E0RA 1BIIA 3ZKSD 4R5VA 3FTSA 5CO1A 4QGTA 5ICXB 1E9OA 1AZVA 1U93B 5TF1H 1CF8H 1JHTB 3TA3C 1I31A 3EDFA 4YVNA 1NTDA 3U25A 5AOMA 3SBPA 4TNGA 4X80L 1OCCB 1E27B 2NR6D 4HDIB 1SHMA 3QI9B 4N20A 4U6HA 1JAEA 2R0LL 4OIFA 2DLEA 3BWUF 3QA3B 2WKOF 3BP4B 3GSWB 4QT5B 3II2A 4H88L 3LHPH 3RJOA 4JY6A 8FABA 3A67L 4DZBB 1T80A 3IDUA 3CU7A 4MHHI 4GKOA 2DLFL 3Q2LA 4KKPA 5F6HI 5GGSY 1RUPH 4MVBD 5I19H 1JWUB 2CGRH 4UTCA 4FC3E 5DZ9A 2RCSL 2HWZH 2ARJA 3F84A 2CGYA 3WSQH 1CICD 3QEGL 2C1PA 1SEQH 3CC5B 3C5JA 1V10A 2NRDA 2Q7YA 4ZPTB 1CTMA 1VFUA 3MREA 3FO1A 3OKKB 2VQ1A 3N42F 4LLAA 4A55A 3B2DC 4IAQA 4I2XE 3IDGB 1U3YA 9CGTA 1OGSA 3O3BB 2E9IA 4G7VH 4X8JA 3W9EB 5JHMA 5E8DH 3VYNA 1TPXB 1UVQA 1QD0A 2ODHA 3HR6A 3WNLA 5D7JA 3PDOA 1DQKA 2F54E 5TQ0L 4KGJA 4M48L 4PR5B 1NANI 1ZHLB 4YGVA 3VYOA 2XVBA 4YPGB 4G9FB 4PVNA 4TSAH 1QSED 4FP8H 2ICWJ 2QKIC 3Q1EA 4ZW8A 4ZQTA 3DETD 3U1SH 1MCNA 4NNXB 2DI7A 3RU8H 3SDDA 4N86A 1UGKA 2NTFA 2O5NA 3FNKA 1G7QB 4YXHH 1V5JA 3BP6B 3WY2A 1CE6A 1UOVA 3QRGH 2ZFEA 1ORSA 3DX3A 5KVGL 2OMYB 4YDZA 1AXSB 2NNAA 3UBXA 4FA7B 4JX0A 5HHXH 3NCEB 4QJ5B 2P8MB 4FFWD 3HLAB 2VDLH 1U6AH 2EH8H 2YAFA 1NEZA 2B1AL 4PW3A 2JKNA 2ZKHH 1T03L 2R83A 4N0FB 4ODTL 2BSEA 1HS6A 2A9ML 4PVBA 2IPKA 4HSCX 1DZBA 3WAJA 2AT9A 4UZGA 3FO0L 3BZEA 1GGIH 4P2RA 4P9HC 3BUQA 1Q72L 3NY8A 1CURA 3KYKH 3BX7C 2OZNA 4QRAA 4XR8C 1YMMA 1G6VK 3NVQA 1WGOA 4MCYB 5FV2A 5IM7A 3EG9A 1BM7A 3WL9A 2NY0C 1MJ8L 1UOLA 4LLVB 1A9BA 5CMAA 1OP3H 3PHQB 5D2LF 2YBRB 5J1AB 4GQ9L 5H2JA 1FAIH 4P3WA 1G7HA 2D7TL 1OE1A 1QZ1A 2OMZA 4R0LC 2VIRB 3HJ0A 1FYTD 3NJJA 1R0AH 3FUEA 1M0LA 3GSUB 5KVEL 5TD4A 2X4UA 4JQIL 1DBMH 1AOHA 3VUAA 1VFBB 3LPFA 5DHXB 3SO3B 4TTDC 3ZMEA 4AYFB 4D8PA 1PJ9A 1DBBL 4PH8A 5DRXA 3REWA 4K94H 4G7SB 4FRWA 2VJXA 3RHWF 1AHWC 1Z2KA 2EEBA 3DX2A 4FKEA 3N91A 4RGOH 1MLCB 3SDAC 1NKGA 4QRPB 3RL2A 5C0AB 1I1FB 1NOLA 2PYED 3S36X 1JOIA 1U30A 5DT1H 2Z31D 2BFVH 3I50H 3NFNA 4JFWA 1EAPB 3CFEA 1F90L 4N2FA 5KSUB 3LQAC 4XPHH 5I1CL 3ZMNA 1B3JA 5DD5L 3D2TA 2XDHA 2W9EH 5BV7B 3IJYB 2Y1ZA 1Y0LB 3EHBB 4TS6A 3B7UX 5FB8B 5B4MC 4XVSL 3KYAA 4OZHE 1YN6B 2CIIA 1BDYA 4PRBA 2JF1A 3TBWA 4MCZA 2Z92A 5IK3A 1SEBA 3QCTL 2AAAA 3K4ZA 2Z65C 4KY1L 3HRZC 3PGDA 5C0CB 1KY6A 4JRXE 4ONHB 1ZV9A 3QYMA 4OGZA 1B88A 5EBWB 4K3JL 4R26H 3LD8B 3NIDE 4Z3EA 3A4DA 4LF3B 4Y2OB 5FYKH 1ETJA 1KGCE 2CO7B 2WXHA 4X83A 5I6LA 1C5DB 1DE4A 1MY7A 5JHAA 3EAKA 1XD0A 2XWBA 3BCFA 1AHMA 2VW7A 1SVZA 4QHKJ 4AVHA 2A1WH 1QO3A 3RE0A 4LNRA 4JFED 2NXZB 4LDOB 1I8UA 2VERA 4PMEA 1JF5A 4YJZL 2DLHA 2AQ2A 1QPPA 2WJKA 1OT4A 4ZFQA 5EZJA 4EN3A 2E9BA 4O58H 1DLFL 2B8OT 4TUJB 1CFQB 4NQCA 3D4GA 3JWDL 3EYSL 3QQ4A 3CK0H 1YECL 2ZOKB 4HEMA 3QUKB 4B5ZA 2YGOA 4PCKA 1JTPA 4UOW1 3DV6A 4QTFA 6TAAA 5I1HH 2WLJA 1LL1A 4UQ2B 1HHJA 3BMWA 5D7HA 2CKNA 2BRQA 4AYMC 1PKQB 5HYEA 3ZMRA 4E41D 3LNDA 4HJJH 3TBYA 4GIPD 4BKLA 4P07A 1DHKA 3CBJB 4FG6D 4ZXBB 5TDPB 1JNHB 3DVNB 3HC4H 1I7ZB 3L08A 4UG2A 4XPFL 2KQMA 5DK0B 3PXJA 3VXMD 5INDA 3ZE0F 2EXSA 3ME0B 4P0DA 4QXTA 1TZGL 4DP5X 1A4JA 1PCXA 4PV9A 5C1MA 4Y16A 5BRZB 3S3PA 1NC4A 1ZLEA 2CKBB 3X1FA 2VLJE 1IL1A 3QWOB 1Z3GH 2NSMA 1P1VA 1BAFL 5K39B 4U0RC 4R7XA 4XXWC 4KMQA 4JR9L 5IFHH 1SXCA 2ZNXA 5GHWH 3U0WH 2EECA 2IWKA 1WFIA 1XH0A 4PIBA 1PAMA 4S0SD 1XGZA 3V5HB 2DF3A 3VWKC 2X1PA 5AHYA 4S1RH 3BEWA 4FHKA 2D3LA 1IW6A 2XN2A 3M1BA 1NCDL 1R3JB 2VDPB 1JV6A 3P77A 5AKVA 2YEZA 5IHHA 1OGTA 1ZSHA 4N0CC 3QJOA 4H25B 1MPAH 3T3ME 4FFZA 5EU6A 1I82A 4J3TA 1TTBA 1HEJC 3RDTB 1QI3A 4A4MA 2XVLA 3NA9H 2GITA 1IM3B 2WNXA 4R84A 2H0FA 4WGKA 3UTTB 1OL0A 3QI9C 2YRZA 3NCXA 2V7HA 5FLUA 2GJZA 3N42B 4OFYA 3K71A 2C4FT 2PXYA 4LDEA 2VISA 4UM8A 4PJGA 3T4YB 1F1AA 4XBEL 2IG2H 4R96B 1ADQH 4KNQA 1GGUA 1NSNH 1N70A 2UY6A 3ZRSA 1MI5B 2F18A 3KWTA 1LQSR 2AXFB 1VFAA 5A6LA 5CGMA 1LDPH 1F0LA 1IM9B 2DY2A 1CLYH 1E4XL 2JK5B 3TGXA 4JO8A 4IHOA 4IM8A 1OAXH 5SWSE 4OJAA 2UZYB 3HAEB 4AQ1A 1TPXC 4LCYB 1KMEA 5CFAA 3I6KB 3WV0A 3MGOA 1NANH 2AF2A 3CN4A 3HJEA 3T2OA 3NABH 2G9HA 3UJIH 4N4YB 3CZKA 2IDTA 3EH3B 3DTXB 2L7EA 1RZGB 3UBHA 3KPMB 2RQ8A 2HPTA 3M7OA 1D6VL 4YSAA 3VI4A 4GBRA 1IKFL 2EE6A 3T8XA 3BHBA 4P5KA 4BKTC 3BGMA 4UQAA 3R8BB 4I89A 2H6UA 1CICA 4IBTA 4JPWH 4PJCE 2QVIA 4JKNA 2P8PA 3O3EB 4J8RB 3DROA 2F8XC 4LGSB 5CF3A 3IS0X 2J8UE 3VI3A 4JM2F 4BXVA 1G5GA 3HNSH 2BO0A 5D2LB 3RNQA 4LOUC 3VFOB 2QSQA 3MROB 5I75B 2YPKB 4PMFA 5DO8A 5DYSA 4CAGA 2FJFB 3GJEB 4DPAX 1LDSA 5FYLL 1QSEA 2P43B 1SVCP 4J2QA 4JHAL 4C4KO 2X72A 1KIQB 1A6ZA 3KBHE 5AAWC 1G7MB 3L5JA 3G5YA 1FAKT 4ELMA 4UOW0 1P6WA 5FYJH 4OCYH 3GLZA 5H35B 3ZLQC 1GTFA 5EN2B 2EYTA 3GSVB 1AQKH 1QUPA 4G8IA 1QFWI 3IFNL 1YQVH 5HJGA 1B0IA 1ODUA 1HKFA 1B0GA 2EDWA 3ISWA 4BD4A 2AHIA 4CC4A 3CHXA 3T2QA 5DZVA 1BMWA 2XWXA 1FZKB 2N1KA 4KKAD 1NDMB 3IFOA 3BCDA 3HVDA 1T83A 4QF1B 4KH2A 5BS0B 1DQJA 4D0CB 1IFHL 1QPXA 1R5WA 1RZJL 3V4VH 2AK4B 2EEDA 1AP2B 5C6WH 5I5IA 1CXEA 4LVOB 4N8VA 1I3GL 4HJUA 5AB1A 1AR1B 3Q3GA 5I23A 4FF9A 3MPCA 1A1MB 3F83A 5DEJA 4AH2B 5MEOA 1Q9LA 2WQAA 3RI5F 4U1HB 3WN6A 3ULVL 4J39A 4EKXA 1FYTA 2IH9A 2XZCH 5B0WA 3I75B 3MUGA 4YFDB 5DUPL 3WNOA 1QAWA 1KZYA 1KGWA 4HC1A 3EHBC 3FAXA 4GIAA 2XYBA 4I3SL 4NQXB 3ULUL 4MJIA 1S46A 1UKQA 4P59L 5CBAB 4QI3A 1KYOJ 1MHPH 2FX8H 4ZPVA 1JHKH 1TJMA 1PIFA 1W8EA 3TIEB 3CD4A 4MFHA 4WFFE 3WXWL 1D2OA 1GC1C 5PCYA 2HKAA 4X6FA 1UWXH 1E0OB 1CZ8L 4EZMA 4GW1A 4HKBA 4LBAA 3VFTB 1JWSB 1QSFB 1GR7A 3MLWL 2DMBA 3QRBA 5DFAA 4E9QA 2G3NA 1S78D 4GW5A 4PRPB 1TJIH 5DZJA 2UXTA 3ARGC 3LD8C 2PYEA 2N56A 2Z31A 4JO4L 5GS0L 4P23A 1IGMH 2JJTC 4PWIA 5AYQA 3QEUB 3T1FA 3DO7A 2DICA 1URZA 4UOQA 3LB6C 4PN6A 4P5RA 3VD7A 2W88A 4JBSA 4MNQE 3H9YA 4GKSA 4K2UL 3M17B 3UG5A 1N2RB 1Q0XH 2XYCA 3CH8A 1PJWA 2WD0A 3HZYB 3K91A 5E6RB 2XZAL 2BOBB 1M7DA 3SBWA 5IROC 3A4AA 5EZIH 3ZE0B 4O2CA 2CR0A 1H8LA 4PWEA 3QZPA 2H9GB 2YGPA 5TFSH 2ENJA 2JMRA 2IH8A 5EWIH 1NFDF 2OCFD 5F3FA 4FXLA 5HP5A 3QZWB 1LO2H 3HPLA 4PTUA 4YHKL 3G9VA 4DT2A 1BQSA 3MLXL 5CAYB 4I13B 5JHDB 3W11C 2ED6A 3UOAB 4WKZB 4M7JH 4JFEA 1OSPL 4KITB 5KSBA 5IMMB 1R3KA 2NX5D 1UA3A 2PW2A 4TVPL 5BQ7B 2DM2A 1OAQH 2X6BA 4NPYB 2NY6D 5HY9B 3ABWA 3GSOB 5AWZA 3GUFA 5HDLA 1OAUL 2QKSA 1WC7B 5HHMB 1NMAH 2OR9L 1DQML 3L1FA 3TYFA 2E7HA 4ERSH 5I17A 2CLZA 2L4OA 4FI8A 3O2VH 4AQ8A 4EBQL 3B2VL 1DR9A 3R4DA 1FDLH 4AT6A 1HINL 2VDML 1UQSB 4LCIH 4E9SA 1ZPLA 3D39D 4E41A 3NFPA 4ODBD 4XMLL 4F7MB 2GTZA 3QIUC 4BCYA 5HGDA 1RZQA 5DMYA 4OZIE 1NCAL 3B4NA 4NO3A 5DMIH 2NQDA 1AO7E 3OF6D 3B34A 3FFDA 2VDRL 1PQZA 4QXUH 3LIUA 2DKMA 3VXMA 1NL0L 1R3LA 3BWUC 4U1JB 4L1BA 4AOFA 4JFQA 3IDJB 3MCYA 5AOLA 2BP8A 2WQSA 4K3HA 5B6ZA 2AKRA 4L8BB 5MERA 3RDTC 3QEQA 2XJKA 1MCLA 4MB3A 2KT6A 5HHPA 2WNWA 2NZ9D 4Z3FA 1PMYA 1TZHB 4DETA 2WGNB 1HK6A 1J05B 3O6LH 1RURH 4J4PD 3S6CA 3BH4A 3RX9A 4WU5B 2XQBL 2RBLA 4EAEA 4XXCC 2Z4QA 3P9WB 3QARA 2I24N 3ZYIA 3LXCA 1OGAE 5T1DL 3PAVA 1CDGA 1A7OH 1HKLL 4GFXA 4NOBA 5I2IB 1QWNA 1UZ6E 3NYKA 5AL8A 3MMEA 2QEJA 5E6SB 1Q94A 1VKXA 3VSVA 3X1BA 1VESA 1X5AA 5IVZA 2LW3A 1FJ1A 2YBGA 5IVXA 3V0VB 4NJAH 1UD3A 2R0WH 5TF0A 3US9A 7PAZA 5B39G 3Q9PA 3V0DA 2ADIA 3K2KA 3MODL 1QNIA 5F93C 4ZTOL 4UCFA 1WBZA 4L35A 2MPAH 4R8WH 4QTIL 2VLME 3JVFC 4O2EA 3MXWH 1HCFX 4KRPC 4N0UA 1IGYA 3C5SA 5J11B 5DQ9A 2FNBA 1QMUA 1EO7A 3GS4A 1NUFA 3I6SA 4JM2B 5G2CA 4ZDHB 1C3WA 5MP6H 3RP1A 2X2JA 1E40A 2G5BB 3ZDXE 3OKDA 3DARA 1F8TL 1G7JB 1AACA 4N9OB 4OJFH 4KRMB 1O7VA 3L3GB 3P0GB 4KV5E 3CBRA 3O6KL 3US0A 5TK4A 3SGKA 5BMFL 2LTQB 3VGFA 4KO9A 5IQOA 4NNYB 1NEUA 2OTPA 4WFGD 3KPPB 2WLLA 1FO0H 4F8NA 2IF7A 3N2JA 3P4NA 5I1DB 1PZBA 1HXYB 2WTRA 2NT1A 5EU4A 3A6OA 4ZMQA 1AGEA 2A5UA 3FQXB 3MLZL 3S9DB 5TDOA 4F3FA 1CJYA 1JS4A 2GUOB 5I75C 2LABA 1J8HB 1KB5B 3LPOA 4HUUB 1AAJA 3BGFB 5DRWA 5FUCC 1C5BL 2I60H 4Y1AD 3M8OH 1F02I 5ISZD 4KU1A 4L4TB 3EYUH 5TE4H 3RBGA 1LO5B 4ESKA 3EJZD 4K8RC 2FVNA 2HT4D 3FFCE 1KBPA 4HIPA 4KOBA 2WXFA 4GUOA 1ES0B 2XPGB 2SEBB 1HDMB 3LKPB 4NHCH 3OQ3B 1FC1A 2AJXH 2GTQA 3O8XC 1ASOA 3BVNB 1W0WB 1AZZC 1FQ9C 2VRQA 2ED8A 2DQCH 3MHZA 4LEBA 4P5TB 5CNHA 3MZTA 1G4MA 35C8L 3CZLA 4KROD 4NHUA 1QFWH 3WFEL 1FORH 2MOVA 1DVSA 2J4WL 3MX0A 3TF4A 1A4BA 4FNTA 4HHWA 1D5MB 1EX0A 1T04A 1JXJA 2NQ3A 2Z1KA 1AGDB 1JP5A 4G43A 4JGMA 4YHLH 4M5ZH 1J8RA 4W6WB 4APQB 3MN8A 4C56E 4NKDB 1YY8B 3QXUA 1JFQH 2YD4A 3ARYA 3OXRB 4MQSA 3QFGA 3MRJB 4K3EH 1OM3L 5I1EL 1EERB 2XSKA 4PBVC 3W38A 1YEIH 3KGTA 4TUOB 4BE6A 3TEWA 2XNAB 2PPFA 4LVOC 2EXYC 2UWEF 2HT3D 4X6DF 3KW7A 4HGKC 4BKSC 1PLBA 1AR1C 1NCWL 1ZVHA 2TRYA 1MUJA 1UWYA 3FU6A 4HS8H 4NENB 1XGQB 2HFFB 3K6FA 3K4DA 3OKNB 3EXLA 2I26N 3ROLA 1SMOA 3RIKA 2GJPA 4OCWL 3BT2L 43CAB 4A68A 1WAAA 1O9VA 1SM3H 2G4GA 5KTEL 3K6IA 4YXKL 2Z7YA 5F7UA 2ALAA 1XH2A 2LAAA 4R4FH 2ODIA 2V7NB 1BQHA 2D4FA 3WE6A 1OTTC 2X4QA 2Z7WA 2R9HD 5IB3B 4Q6YA 2X3CA 5E4EB 3DUHA 3V52H 3F64A 4BSVA 2EDMA 5SWZE 5LBGA 2MQGA 4ODVH 4M61B 3QWQB 5H8DA 3QZOA 4TLSA 4PJDA 4ONFL 5LB1A 1K8DA 1J5DA 3HS8A 3Q6GL 4XP1H 1A7PH 3BH8A 3AROA 4F80A 2EE2A 4TULH 3H53A 5BV7L 1FFOB 1ZRUA 2AEIT 3FQNA 5AVXB 5CFHA 4RFNC 1AOZA 1KC5L 3NAAH 3PGFL 1LVEA 4WW3A 1Y6NR 5JHBA 5L8KB 2BNQA