3EHDA

Crystal structure of conserved protein from enterococcus faecalis v583
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MTKIYFAGPLFSQADLRYNAYLVEQIRQLDKTIDLYLPQENAAINDKSAYADSKMIALADTENVLASDLLVALLDGPTIDAGVASEIGVAYAKGIPVVALYTDSRQQGADNHQKLDALNEIAENQFHYLNLYTVGLIKLNGRVVSSEEDLLEEIKQRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved protein (PF05014) Enterococcus faecalis V583
rcsb
molecule keywords uncharacterized conserved protein
molecule tags Structural genomics, unknown function
source organism Enterococcus faecalis
total genus 50
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ehdA00
1S2IA 1F8XA 2KHZA 1S2LA 3EHDA 4P5DA 4KXNA 2F48A 3GH1A 2NX2A 3U39A 4LJRA 4I4IA 3OPYB 4MEJA 1YDHA 4FYIA 3K2QA 1T35A 2A0KA 4FYKA 4WL0A 4LJKA 2F64A 2F2TA 4OHRA 1WEHA 1WEKA 4KXMA 4U1RA 4JENA 6PFKA 2PFKA 4HX9A 2Q4DA 4PFKA 1PFKA 4JEMA 1KZHA 4I36A 3PFKA 3IMKA 1F8YA 2A33A 2IZ7A 3O8OA 1ZXXA 4KXLA 3SBXA 4NPAA 1S3FA 3O8NA 5ITSA 1RCUA 4P5EA 2KLHA 2PMBA 4LJLA 2HIGA 4A3SA 4I7EA 4RH3A 5AJUA 3O8LA 4JELA 3OPYA 3HNOA 3O8OB 4FYHA 3MAJA 2Q4OA 1S2GA 2F67A 2IZ6A 3QUAA 3F5MA 4MCJA 3UQZA 1S2DA 5AJTA 4OHBA 1MTOA 3BQ9A 2IZ5A 2F62A
chains in the Genus database with same CATH superfamily
5HKOA 4HNTA 4GLOA 3OQPA 4DRXB 2JA1A 4NBRA 2F8LA 5AW6A 3A26A 3LPAA 3FHJA 4QBIA 5C5DA 5KYNA 2DE0X 2QVBA 4ZYTA 2HOQA 2P77A 4OEHA 4AJ4A 4B46A 5L8VA 1GXSA 1WB9A 3NM4A 4LJRA 3DYIA 4XWYA 2RK4A 4HAYA 4DDUA 1NG1A 1ORRA 1K8ZB 4I9HA 5EKTA 3I9MA 1BDMA 3ZVNA 2VEDA 3O4VA 4HRAA 3B2QA 3H6GA 1ST3A 2OC4A 2UVDA 4YQEA 3UJCA 5BSUA 5KYTA 1U63A 4KQCA 3THWA 4COKA 3NVAA 5F5NA 2RHTA 4BMCA 1GLGA 2D5LA 3BAFA 1GIAA 1E6LA 3IO3A 4IG4A 5A04A 4JN6B 1YUBA 4AJEA 1HNZB 3DDHA 3VX4A 4LJ8A 1LSJA 4DLPA 1RQLA 3M6UA 2I1VB 1YR3A 3LQ1A 4AAYA 3QXHA 3B1KA 3KR1A 5G1PA 5KYUA 5GADl 2V7EA 4KYIB 2JFFA 1FUYB 1A8SA 4RDHA 5C53B 2WYUA 1C0EA 2NV6A 2XA2A 3MGKA 4AQDA 2YWBA 1C3OB 3K16A 4JYPA 4EL0A 4YCMA 5FFNA 5HQTA 5CR9A 3BTOA 2NUAA 1UMDB 2VG8A 4HLUA 2JFPA 2X13A 5HJ5A 3A6EA 1Y4SA 2F1JA 4PZDA 3UKOA 4DV7B 4KR3A 3ANYB 4G63A 1JLLB 1FS4A 1LDMA 2AZXA 4EY6A 5EWLA 3D7LA 3T15A 2HA6A 3M4YA 4M38A 5F3WB 1W2WB 1EXVA 2VLBA 1Z36A 5H80A 1UODA 5TQVA 2E55A 4W1SA 3BGSA 1CF2O 3RREA 1P5ZB 1E98A 1ZBDA 1BE0A 2F9MA 2TMGA 4N8DA 4BZXA 5JXGA 4FZRA 2J33A 2OCLA 5G0TA 3SBOA 4F56A 4GFDA 3LFUA 1E1DA 1P8AA 1J9GA 1MT0A 2PEYA 2VTBB 4KSCA 1EFPB 5EIWA 1SNYA 3IPXA 3MYRA 1K3FA 1XCMA 2GK7A 3RVMA 4E1VA 3EF0A 3N2YA 4DUPA 3QBJA 5MFZA 4WK0B 2C07A 4CMEC 5CA1F 5IJ9B 2ZZNA 1XZQA 2AJCA 3H04A 4EGJA 2EW1A 1UDRA 3EH1A 4YQFA 4FVTA 1JDZA 2QRLA 5I9LA 2O3TA 3H2SA 3TFOA 3BIXA 5SYNA 1JX6A 2VHEA 3BMCA 3NTQA 4HATA 3KAQA 3ZWBA 2I2AA 1UEJA 2HLDD 1AXEA 3U4DA 5U4QA 4Z5XA 5IK2A 4X1KB 3D8SA 3OCYA 1W87A 1ZIXA 1ZGCA 1PD0A 2I34A 3DOJA 3FOZA 1I24A 2I78A 3T3IA 1MOPA 2RHMA 3GBSA 3Q72A 2JFQA 1DAGA 4E08A 2B4TO 3WSWA 4F6RB 2PX0A 1W48A 1XRNA 2BSAA 2WSBA 3D4LA 1MW9X 4ON9A 3LT1A 1CF9A 1DQZA 5K0LA 3OKAA 4EDHA 1QZUA 3FHTA 1CQIB 4YCLA 4DYHA 1NVTA 3DMYA 4I2NA 1NIJA 1TK2A 3DTTA 2PA3A 1Z75A 3L6EA 4G0MA 4RDCA 1WXGA 2IPAB 3PEWA 2V8BA 4ZRNA 2ISQA 3ZWPA 3N70A 4INAA 2W6IA 2YFHA 2IA5A 3EAGA 2ZDHA 2B9EA 1T5BA 1DDGA 2BMAA 1O6ZA 1WSAA 4X65B 4NQZA 2IUUA 3SYLA 3HCBA 3TQSA 4CQLB 2ZJ2A 3CLRD 3N87A 5CFPA 2IYOA 2J9FB 3CZAA 2X9LA 3CVOA 3HU3A 4HK4A 4IJ6A 5AI9A 3WS7A 1JIJA 4F85A 2F2TA 2IFTA 4AX8A 3C3EA 5E6RB 5EJMA 5FWYB 3UWKA 2YIDA 3W6UA 4C43A 4WH0A 3OZCA 5A5EA 3LCVB 3IEKA 1UM9B 4N03A 2QNBA 4CLOA 1X0VA 1FQJA 3D43A 2TMDA 2ZIFA 1YOVB 4KXMA 1GPNA 3JW8A 5GONA 5KNDD 2FJPA 5AHXA 4QXOA 3GLFA 3BE5A 5DNCA 1QVZA 6PFKA 3R24A 4W7HA 3KT0A 3BWEA 5IJ0A 3ZXIA 1M74A 1V25A 4QASA 3T34A 2H8KA 2PO5A 4GOND 3E2PA 3G0CA 1WUJS 5JPIA 3G5TA 5JC1A 3M9XA 1DKQA 3CIFA 4AYTA 2YWCA 1L7RA 1U2RA 4K9KA 2WU3A 4LTDA 3SQDA 1QZTA 1Y7LA 1WW2A 2X77A 3BWVA 4GR5A 4PZ0A 4U7TB 1JKJA 4YO7A 2MSDB 5A0VA 4NC9A 4GI2A 2O48X 1ZGZA 1XMIA 1U2TA 2EKPA 2JI8A 2NSJA 4P8RA 4RPIA 1ECGA 3DL2A 1KRXA 1QYVA 1DT3A 3RQSA 2HRRA 3WLJA 3BG5A 5TPZA 1CBUA 1TPYA 3V4SA 4YJ2B 2WC1A 3HJRA 1E2PA 3GJYA 2FHSA 4RXMA 5LMZA 4MR9A 5ALHA 1CPYA 3O4FA 4CKCA 4DR5B 1V3VA 5BWCA 3L8CA 5BR8B 4MR7A 3IT2A 4JXXA 3QBEA 3WAKA 5CFNA 4ZJYA 5D7BA 3DAFA 1LLQA 2ONJA 2YWRA 3N8HA 1P4SA 5ALOA 4QUBA 1L4HA 5HDBB 2E48A 3ZWAA 1Z0UA 2AD5A 4BEWA 1HX7A 4ABTA 3UJ8A 1CJVC 2QTTA 4MUGA 4NDAA 4B8ZA 1ELOA 1Y1LA 2MSCB 3AUSA 5CA0B 3GHYA 2XMRA 3I0NA 4WOJA 1D8AA 2ZRFA 2CDBA 1U3CA 4EI9A 1NNLA 2VT3A 1XQYA 1IZ9A 1OXVA 1PBNA 4LBYA 4MO2A 5C80A 4O25A 5HHTA 3TEJA 3RNOA 2OG1A 1UMBB 5L7YA 1VE3A 3BSFA 1QZXA 2H4JA 4LHVA 4TMFA 1L4NA 5TNXA 4Y7DA 4RA6B 1RQXA 2NZUG 3V4FA 3KKKA 3CLTD 4BQPA 1ZA2A 2OE2A 3UCEA 2WHXA 3WNDA 4AX4A 4DSTA 4RM3A 4L6AA 4PRLA 4MWSA 3BSWA 1NPTO 2C9YA 4L08A 4CM3A 1WZNA 1G3UA 1X7XA 1L3CA 1ZH6A 2ZROA 2XKAA 3A4TA 3TSZA 1XNGA 2VJPA 2D7CA 3EASA 3T9BA 3VUFA 4Z53A 1ENOA 3GY0A 4DZZA 4AKIA 1W5SA 3NGLA 2CYBA 5AJHA 3IOEA 3NAGA 4KFTA 3OC0A 3T9AA 3TW8B 4LGVA 3DTYA 5H68A 1CQWA 3K0BA 1H8EA 1PJAA 4P83A 1ZZEA 1TF5A 5LC1A 3NT2A 2XUZA 2W2MA 1G4UR 3H5LA 2VXBA 5GOZA 3L84A 1ODIA 4YEDA 3VHRA 3R8FA 1T9BA 4EMUA 1P0QA 3CVYA 4RSHA 4P4SA 3SQLA 2QYOA 4JI0B 4TMTA 2Q3MA 4B80A 1E62A 5CVVA 2XUJA 1G6KA 3AQIA 5DTIA 1HF3A 4UW9A 3MOGA 4JR2A 4QSMA 1G0NA 1ND5A 3O03A 3HCAA 5CYPA 3KJZA 4ZT2A 1V3UA 3BZWA 1SQ5A 3H11B 1MAVA 3B2NA 2J5RA 3IDFA 1AA6A 1FIUA 2PUEA 1WP4A 3FIJA 1BXZA 1KH1A 1WXXA 2KX7A 1ZM4A 3HJAA 4K9SA 1VPDA 4RJJA 1QP8A 2L19A 1M2VB 2F59A 1HDEA 4D96A 6REQA 1EK2A 1FF9A 4E5UA 2XXJA 5AW4A 3ZY3A 1ISMA 4AJ1A 4QICA 4N49A 5K6AA 4ZARA 2DWUA 2X8JB 4JITA 2WUEA 3DW1X 5IAEA 5CNKA 2VDLB 3ND7A 5KTNA 5BV1A 1T0IA 2J46A 4LYEA 3KZXA 2ATVA 1TUIA 4PX3A 5I7HA 4PFQA 2VHQA 3WISA 3BN3A 4O3MA 1QK5A 4MJLA 5KYYA 2UYYA 1KK2A 1ZCBA 2QWXA 5IF3A 3UUWA 4XX0B 4ZEXA 1T1EA 2WWHA 2SKEA 1EK0A 2I22A 4PQRA 3U4CA 2EBHX 1LA2A 1MENA 3GGSA 3AF0A 1G6OA 3OA0A 4AUMA 2G76A 3K9FC 2BLNA 3EEYA 3SSMA 4KODA 3C7AA 3ADCA 3IAM1 3SX2A 1RCUA 3C98A 4HJXA 3TRIA 3VR4H 2G1JA 1PE0A 4BKPA 1U0LA 1S1MA 1OGIA 1NRWA 4ERNA 3DH0A 3GW8A 2SCUA 3C70A 3IE2A 5FL7A 5B5SA 5G3YA 5BYKA 1QIGA 2ZJZA 5BOSA 3TLAA 5EJEA 2DWOA 3INYA 1DUVG 4LHEA 5AOAA 1RHKA 2BFDA 4RCYA 2C4VA 4G8DA 4N3AA 1D0SA 5IBCA 3P32A 2A6PA 2P4HX 4QUJA 2Y1OA 4X63A 5IJZA 4YMSA 4MSUA 1NMSA 5T4BA 1H5QA 1BKDR 3DDZX 1Y34E 1WLSA 5GP1A 1BXRB 3GJ3A 3RARA 1OXKB 2YVAA 4ZQBA 4BB6A 1HBJA 2NW6A 4JKOA 5LOVA 4WZAE 2WWWA 4OD0A 1OIVA 1ESNA 1GKUB 1QHHA 1MOSA 2HWKA 2WUWE 3IA2A 1C3VA 4HHEA 5H3HA 4IKPA 3FNRA 1AS3A 2RCYA 3HRIA 4U0JA 3F6SA 1HNXB 2VTEA 1H4VB 2GHTA 3T7KA 1DO8A 2QX9A 3KPWA 1OC4A 3MK31 2PKYX 3OTHA 1I3NA 1N9ZA 1I8TA 2ZULA 3OVMA 2PNJA 4G3XA 4ITVA 3S2UA 1A77A 5B3KA 3HWSA 1M2HA 1T2UA 2PDAA 1XT6A 1S7CA 2PS9A 4ZZ1A 1CTQA 5SV2A 1UJ5A 4HNSA 4TL8A 2YJZA 3O9ZA 4AZSA 1M5RA 2CLKB 1U8YA 1W4BA 3CXRA 2PZGA 3O8BA 4RHTA 3ROPA 1T3GA 4ZANA 2B36A 1XZBA 3LUDA 4QIHA 1ZK2A 2OCGA 5A6SA 5KTSA 1Z3IX 5ITZA 2PSSA 3I6BA 2ACKA 2VPQA 2SKCA 5D84A 1NQVA 1P4GA 1GG2A 4K6KA 5HZMA 1QFSA 4FK8A 4FYIA 1ZHHA 4PLWA 4OI1A 3W8NA 3ZOKA 4DSZA 4KPEC 1G21E 5JH7B 4M9SA 5JRZA 1E2GA 1GDTA 3HGMA 4LJKA 3RYIA 3NCTA 4YDRA 1R0BA 2EATA 5EIBC 2FE4A 1PR0A 2XQKA 1ZRHA 2YYYA 3A1TA 4MROA 3SCZA 1DQPA 4RZHA 4BO6A 1BMFA 3AFNA 4YUYA 3MCWA 3D6AA 5AKKA 1A5BB 2W2LD 5BURA 2IC5A 3BWBA 8MHTA 2ZRDA 5TPZD 1DBRA 5BVGA 2XMBA 5CT9A 1GDHA 3FNEA 3NASA 1ZD1A 3H4VA 3SPXA 3H3JA 5AJWA 1EWTA 2A35A 2W4MA 3URMA 5A9SB 3M5WA 1SBQA 2HRQA 2GJ4A 2OUIA 4LECA 3OKPA 3W5IA 2P35A 4G1CA 1NN3A 2VJQA 3OY2A 4QYSA 3UAOA 4QJ5A 1IOZA 1XJCA 2CB0A 1Z73A 3B52X 5AXDA 2BHSA 5SY6A 3ZNNA 3NYIA 4JVMA 3C3CA 4UDXX 3O0TA 2QORA 1G8YA 4KN8A 2GPYA 3UWMA 1RQRA 3C16C 1DJLA 4ZI5A 2BUBA 2WNIA 1QP4A 1TW3A 1NN0A 1IHOA 2V97A 3WZMA 4N40A 2HQ1A 5LZ9A 4NOKA 1OLUB 4NENA 3WWPA 2IEYA 4F97A 1DIOB 4CG1A 1JAXA 4UBMA 1SVMA 2ZJ1A 5JD6A 1KMHA 1X87A 2HCJB 4HFNA 1ZP6A 3A1CA 3LPDA 2C2YA 4JLMA 1UJ6A 3L7LA 1K06A 2BF4A 3WGLA 5L6MB 1QNFA 3V5NA 1RXIA 3U7QB 3ZV3A 1G4AE 1P1HA 3BE8A 2MYPA 3QH4A 2DETA 2X58A 3M9WA 5EKDA 4C4TA 3TOVA 3KQNA 4N5DA 1F60A 4IGFA 2A5DA 4Q4DA 3GOHA 4QDUA 1J0XO 1F1BA 3HUUA 3P2KA 3T3EA 4Q1EA 3LPCA 1A0OA 2VVTA 4PSUA 2LIPA 5E9JA 4UHJA 1EDEA 2I4LA 2EFCB 2VUHB 2O2YA 3ZLTA 1N6HA 3H5IA 3L46A 5T41A 1Z28A 3IULA 4ILKA 1E59A 4YIKA 1M7BA 2GAOA 1BRTA 2GLXA 4LCJA 4LVCA 4A6DA 3ZQ4A 1HYEA 2HHLA 4BB5A 4WVLA 4CMGA 3PQ8A 2HA3A 1CJTC 1UZMA 1IUPA 2JF0A 1NMEA 2WSLA 3G17A 5LZ5A 5SY9A 2QBYB 1UBTS 2GGSA 1CUDA 1YRBA 5EN4A 2Z6VA 1VG9B 1P72A 3WB2A 3EE6A 1OZFA 4OUKX 3ZTYA 2AMYA 2IUTA 4UMFA 3H6HA 2XWPA 1OV4A 3VC3A 4Q7LA 2CW5A 5FA8A 1AGXA 4FYXA 2NO0A 3ROEA 2FX3A 3ZZ0A 5K9ZA 5FB3A 1HXHA 4Y6SA 3OETA 1JZTA 4RF2A 1QKKA 4HFRA 2C84A 3OM9A 1LH0A 2EYQA 4U0KA 3TAHA 3TGLA 2PGOA 4KXNA 4TVKA 5A4DA 2ZI9A 1RZVA 3MCVA 3VR4A 5IVKA 3MINB 3DD5A 3DYBA 5C8DA 4GU5A 3EVCA 1WMFA 2AH5A 4P53A 3FMPB 3GLHB 3D3QA 5H5JA 4E94A 2ZWVA 2QAJA 1OA1A 3OQ6A 1Z4OA 5JARA 5A4FS 1M2WA 2LKDA 1V7CA 2W2NA 3EGVA 4DDKA 2RAUA 3HVRA 4NI5A 1EXNA 1NV8A 2OD2A 3OU6A 2J3HA 5LNK6 1VHJA 1Z26A 4GI5A 4LEIA 4BP1A 4ZIRB 4K9MA 2F55A 1RXWA 3D6NB 3ITKA 4PRKA 4UUPA 5B4UA 1EESA 4TQGA 2CDNA 5B7PA 3K0HA 2PVPA 1Z88A 4F2GA 1U8FO 2FFBA 1QYDA 1E0DA 1HKHA 4ZO7A 4G5HA 5FR1A 4US2R 5I7SA 2OWEA 4YR9A 4UBLA 2CLIB 4PS1A 1THTA 4DBVO 4PC2A 2GBFA 4RAQA 3U7JA 5EXTA 2XMGA 2CJPA 4M1EA 1A7KA 4L4UA 2NNWB 3JQEA 4F2HA 3MTAA 1E8MA 4GX2A 3LVFO 3CLSC 4BQRA 1NOKA 2YYSA 3HCRA 2SHKA 2R85A 2IBTA 2RK3A 2YW9A 1HGXA 1RYYA 1G16A 3CZ5A 1NFQA 2YUIA 4F0JA 5C1IA 5HPYB 2DAPA 2V1XA 1AGNA 4PPFA 1GZDA 1U9IC 2EAUA 3AR8A 5JO9A 1PR9A 3QKUA 3ZIAA 2XYGA 2VA8A 5K8IA 4U6NA 5DM2A 3HHEA 3TW4A 3LVBA 2PZBA 3DCYA 3IYLW 3I58A 1F8FA 1E89A 1N5KA 4EYQA 5HQ3B 1HTWA 4LY9A 4Q4JA 3UAVA 3TFQA 2OG2A 3TNDA 3KAPA 1FXWF 1JQ5A 3EXAA 1RDFA 3U2QA 4DREA 5F9FA 2R9VA 1M8FA 4MHOA 2HKIA 2P8SA 3UICA 4HPXB 2VWPA 4DA8A 3G89A 1M1ZA 4RD0A 4C7KA 2F9LA 1ZLYA 1ZONA 3I0ZA 4UAGA 2FMIA 1P60A 4JCOA 4F4DA 1PNQA 2B7LA 3OCXA 1DZIA 1PDWA 2WJIA 5DVZA 4AICA 5AJUA 2G0AA 1UBOS 3QI7A 5CPBA 3VDMA 1ZISA 1CK4A 1B8OA 2NXCA 2JGDA 4OV6B 1R8JA 2WV9A 3KQSA 3L3BA 4KH0A 1MO4A 4NCKA 1WU8A 3QOXA 1D2EA 3WIBA 3WAJA 4G0UA 3AVYA 1GEGA 5BUQA 3WZ2A 3EFHA 3MTDA 4R0MA 2BFBB 4QTTB 3OQNA 3ILVA 1WSWA 5DI3B 4AJLA 1R7RA 4IOKA 4NCJA 4ZVQA 4ZU1X 2VTVA 4H08A 5T4EA 4U7GA 3FR8A 1XZMA 3UZUA 4PZAA 3CBQA 3E9DA 4FSHA 2C4NA 2JJ1A 4B8WA 1A4UA 1P0PA 2RH4A 3KLNA 2OV3A 1XPOA 4K6OA 1PWEA 1JHZA 2FEOA 2W2PA 3BXFA 2W0MA 3BMNA 2AJ8A 3RYCB 2KLBA 4HWPA 2NOAA 3JQPA 4BNYA 2CF6A 1A5TA 2JGKA 5EP4A 2EKQA 3UJ9A 1ZH8A 2OPBA 2IITA 2YJ6A 4Z3KA 1BMFD 2P5YA 4RGYA 1W25A 4O2AA 1EQAA 2FWMX 3KNZA 3WLPA 5I9NA 1XVVA 3GPIA 3WWEA 4DA7A 4ZQIA 4MLPA 1CRQA 4B34A 4DR7B 2ZXUA 3I9LA 3K8OE 3T7AA 1HSOA 5K4AA 5EHGA 2HBRA 3C8DA 4Z4FA 1OB5A 4O33A 3JU3A 1KP3A 1QS0B 5FOVA 2HHCA 3HQ4O 3K5HA 2J08A 4HF7A 1U9IA 3ZVMA 1NZDA 2ST1A 1N5OX 1V9LA 1OT5A 3TCKA 3RTGA 3LI2A 4BVJA 1W581 2IH2A 2EDAA 2QRKA 3FCUB 3TAXA 2F6RA 3QPWA 2AFIA 1SIOA 1YAJA 3LQ4A 2XTAA 4PLCA 1R16A 1YMUA 2ODBA 1MFZA 1Q3KA 1JLHA 2YHSA 3DULA 1MORA 4NICA 5FOSA 5CB6A 2Z5GA 1ODCA 3GAMA 3TW0A 3Q3VA 3QPCA 3GEEA 5D51S 1VI5A 4P6VF 3GFTA 1XTRA 1R66A 3EHEA 3JR3A 1I4EB 4W6QA 2BMWA 4FWBA 4M8LA 3I37X 3JPWA 2ADMA 3BX1A 1L7XA 1W49A 3NVKI 5H0IA 2QRUA 4HDKB 1BFUA 3HBJA 1VRCA 3ISJA 1HK7A 3PJGA 2V0NA 4UAUA 5EJ2A 4ZVKA 3SICE 5HUQA 3M4JA 1AKYA 4G37A 1PT9A 2WE7A 4YPFA 3OCZA 4RIFA 3DZHA 3VSCA 3H3FA 1JKXA 2R7NA 3NRJA 1Z4QA 4U9IS 3FR7A 4RFVA 4GNRA 4DS3A 1VL6A 1ZK1A 2GSWA 3QWAA 5DK6A 4HQRA 2PXAA 4AFNA 2FP4B 1ST2A 4ME6A 4RPLA 2KLHA 4GVPA 3A6ZA 3BKWA 1BG6A 2V7BA 1WCIA 1O03A 2AOUA 4ENPA 2ZPUA 4ARAA 1CR2A 2QTMA 2R66A 3WGHA 1YQXA 4Z7OB 5HRAA 3KETA 1S3IA 2GCOB 2OGSA 3K1ZA 3W5SA 4EG7A 5EIBD 2CEAA 2AS0A 4LV8B 3UB3A 1M76A 3RJZA 3GOQA 1I3LA 2B1QA 2NZVG 1JDVA 3T0IA 3ICWA 4C20A 3OLQA 3TKYA 1VMEA 3X1XA 3Q8KA 4QX6A 1QGYA 4OSEA 2CCGA 4FU0A 4BU1A 3CE6A 4RENA 2WTAA 2WYVA 5F4ZA 3QVXA 3MJDA 3VR4D 3AEUB 4D6YA 3TECE 1BIFA 4QOEA 1DEAA 1KTIA 1M3SA 1N5DA 1CDZA 1PZEA 2H17A 4E5MA 5LLTA 1N7HA 1YE8A 4V0NA 3DBOB 2AXPA 4ZTBA 4HSGA 3RJTA 3WYNA 3GL9A 1E2EA 1X1SA 2FFHA 3PYLA 5JMPA 4EX6A 3EXEA 3EIWA 1LZLA 2ZJYA 2AUTA 3NC4A 3IODA 4R2LA 3F2VA 1SKUA 1N2CE 1W88A 1SOAA 1XA3A 4NS1A 2AE1A 2WKPA 2VJAA 3OJXA 1QMPA 2O4UX 4Z1MA 3M5CA 1J8DA 5C0OE 5B3LA 1KQPA 2KHZA 4RPGA 2ONZA 2ZTSA 4J0GA 5G02A 3SE0A 1VLLA 1ULSA 4AXBA 4G2NA 3N2KA 4A0RA 4S1WA 3UMYA 2DZDA 1ATIA 5M34A 5DM1A 3KQWA 3DTVA 1G19A 1D3AA 1QO0A 2FOIA 3OPYB 4NJMA 3B36A 4O4LF 4P4TA 1E3MA 1P9RA 2O8DB 1Z34A 1BWRA 4ZVLA 3T5BA 1R50A 5L95A 2ZUEA 1L5WA 4UE2A 3LDGA 1V7ZA 4Q1CA 1ZD8A 3NBQA 1DAOA 3LF2A 3P0EA 3KQKA 4DV2B 2A4MA 2X0JA 1JSCA 2Q5JA 4LXQA 1XZ8A 1AC5A 1FDIA 2JGFA 2QL6A 1Q6YA 3JVDA 4MRAA 4F91B 4GSKA 4EFDA 4NYMQ 2GCEA 3AHGA 1QV6A 3IP9A 3ZWDA 1RRCA 1PZNA 3NP7A 4IW3B 2X2PA 3ZHZA 2XNSA 1CJSA 2OSVA 4BVKA 3SGLA 3A1WA 1CEQA 1JG4A 4HV4A 1WXFA 4CEJA 2IVFA 2CBZA 3HDYA 3OO1A 2MR5A 4HNVA 1LJ8A 1H3NA 2HEIA 2YZGA 3DT6A 3OH8A 3KE9A 3RV3A 2G0TA 1REQA 4HDSA 5AKIA 3O8RA 3SEFA 1KJNA 4QGBA 3WFIA 1E3QA 3PP8A 5CIQA 3I05A 2C94A 1KDZA 1T13A 2VSNA 5ALZA 4BLSA 5JG7A 1PFVA 2XD9A 3D2CA 1VIAA 3IRVA 2VHCA 4J9VA 3N1UA 2A67A 4G1MB 4MPPA 2GETA 5LB4A 3D3WB 3F0TA 4YV0A 1F1JA 2OD9A 2DU8A 2VATA 2YS7A 3LFHA 3QPDA 3A6GA 3TJRA 3WK8A 4BLTA 3ME5A 5KVSA 3KYIB 5IWCA 4M2LA 1LLDA 2ACWA 2XGOA 3EQ8A 4NEGA 1VRWA 5EOVA 2FTKE 3EJWA 4R83A 2CT8A 5CH5A 2QZZA 3P4YA 1GCOA 3OEWA 1QTQA 3LUBA 1E9EA 3UWSA 1ISHA 4DHEA 4V1CA 3MB8A 5HMMA 2HR1A 1P4AA 1KY2A 4HFJA 4BNHA 2Q41A 4GEGA 4UE6A 3UMSA 4QHYA 4DIFA 3CW2A 2J9ZB 4W8OA 2Z1NA 4FSXA 1XEXA 5BN3B 5JYDA 5BWOA 3I61A 1VXRA 3IVGA 2WSYB 1K2VN 521PA 3QEKA 5TARA 5AIAA 4M36A 2J3MA 4BX0A 1VKHA 5IAJA 3GC6A 3F90A 5EL0A 4A03A 3PR1A 4P0PB 2Z6UA 4OHUA 4EPWA 4Q4AA 3K2IA 1LBTA 1UFOA 1E5XA 1QKIA 1WHSB 3O8DA 1PSWA 2O2CA 3TTYA 2V7QA 2KE5A 4ZAXA 1U5BB 1B2RA 3BXZA 1QYCA 3HDHA 1E7WA 3SYMA 4S2UA 1MF7A 2OB1A 4JEHA 2BTOA 2CCJA 3KCQA 1KYWA 2QVLA 4L51A 4DXDA 3RIHA 1NZJA 3JZMA 3CLSD 1NW9B 1OXUA 4X8MA 2XWSA 4XCXA 1BHQ1 2VRCD 2MSKA 3QVJA 1RLOA 4ND8B 3H4IA 4IDFA 5AJTA 4RDXA 2VAPA 4MARA 4DLLA 2UV8A 1KYVA 2WJPA 4F3NA 3WQRA 3KBBA 1RC1A 1YQGA 3H9GA 2D2EA 3C1UA 4YT8A 4FHDA 4HWSA 4DSAA 3ZHBA 1Y1KE 2GH1A 2WKWA 5I8PA 4JX9A 4WKNA 1U2QA 4MQFA 3ETLA 2MDTA 2IH4A 5K3OA 1XU9A 4NBLA 1TQ4A 1XJQA 5KQLA 3HO1A 3D4BA 1ANKA 3QEMB 2PANA 3IOYA 4L27A 4YIHA 4JB3A 4QOFA 5C37A 1JIUA 3LWZA 3M2PA 4TUYA 2Z58A 5IJAA 2CSXA 4PC1A 2KMLA 3CW8X 3Q1LA 4OX9B 2VQ6A 4CM4A 3ICVA 5BPHA 4PCUA 1E2UA 4GBED 5DPMA 1HETA 3AF6A 5LVAA 1KQ3A 2AOWA 1JDPA 3SQNA 4C03A 4LDNA 5JY1A 4JZYA 1OPRA 4GX1A 1BDIA 3PHLA 5GV8A 1FU7A 4HQLA 5A2QA 4EPTA 2VBGA 1EUQA 3HJCA 3W4IA 3EA0A 3ORSA 1IHXA 4EY5A 1G20A 4ISBA 5BN4A 3H3XA 4ITRC 3OPVA 3KDAA 3PKJA 3TR6A 3ZDYB 3EX7C 3N8NA 3S2FA 3IDZA 1A8IA 4LG1A 1T3ZA 1P2FA 2C31A 4MGYR 1Z2OX 1W9HA 3ZHUA 1JFVA 4EGSA 1GTMA 1RLTA 3FWYA 5KQPA 1ML4A 2ZJ6A 2IX3A 3KV3O 3X3HA 2OORC 1MAWA 3C85A 1IN5A 2IXBA 1E6WA 1JYEA 4TV9B 3ANSA 4IS2A 2RKWA 3PFKA 3DZBA 1IN6A 2XUGA 2D5AA 1JTVA 2CFRA 1NXWA 1U9ZA 2BOVA 1JMYA 3AI3A 4N3CA 3L92A 2PE5A 2GTPA 3RWOA 1MZPA 4LF9B 4X6UA 1NQOA 3G8AA 2QKYA 3OZ7A 4HB4A 4NPAA 2MIIA 2OQRA 3E58A 5FTKA 1UZAA 1V48A 3SR4A 1Q11A 3NJRA 4GM0A 3PCTA 5FPYA 1G2PA 4Z8YA 1RZRA 3KKPA 4XR9A 3G49A 2DBRA 5CDYA 4J2TA 4JL5A 1DCMA 1GPWB 2XUFA 4WBSA 3BD6A 4JT2A 5GTDA 3H2IA 4OMFG 5E3JA 3O4RA 1EVZA 4O4IA 2OPHA 1UBFA 5K8TA 3WGQA 4DLSA 2GUWA 1G5RA 2NO7A 3C1TA 3I72A 5HF8A 3UCXA 1GKIA 3LQYA 3V4RA 1GKYA 1M0EA 4EO9A 3OI7A 2FFAA 3MSXA 3PLNA 3OJOA 3ZJYA 4BO0A 4AY6A 1V2GA 4ONEA 3BJIC 5EXPA 4DW8A 13PKA 2O8EB 3MWDB 4YCNA 3C6KA 4YJGB 1YJXA 2ZJAA 4GXQA 2O8BB 2FZCA 5ALMA 3VVBA 1VLJA 2HMVA 3PKIA 3WWYA 2J9YB 1CUIA 1NMQA 2IPMA 2WV7A 2PNFA 4Y2HA 3Q41A 1GCAA 3A04A 1L5GB 1E9CA 2GPNA 3DDSA 1U0JA 5TC4A 2ZT5A 3JATA 2EQAA 1U5AA 1NFRA 1IEWA 1Y3BE 2WJVA 2OESA 3LA6A 4DKXA 2X22A 2CXTA 3BWCA 1XFAA 3K9NA 3KWMA 4MCJA 1AF4A 1J9ZA 1F2TA 2BFMA 3EOAI 4A91A 1NASA 2ADFA 5IT5A 1R8SA 4GM1A 4DQ0A 2DOKA 4ZMBA 2PLAA 3PJRA 3H1PA 5J47A 1CZOA 1YGPA 1LDNA 2EIXA 5AMXA 2SBTA 3N5KA 1PJTA 3DDCA 2RGAA 3EXHB 4QXMA 1SEVA 1ZIDA 4B4VA 4C06A 3UMMA 3DG9A 4AY2A 3T1OA 4B32A 3RHZA 3VU1A 2BI8A 2JB9A 3IV7A 3QU5A 4AP6A 3QUCA 1JJAA 5DGTA 2GAFA 4LV5B 3NOVA 4BO3A 4IAOA 1DLIA 4PGHA 1TCUA 2XB6A 1D7OA 2EARA 4CM7A 4D3ZA 2QPOA 5EI5A 1RW4A 2QF7A 1NW3A 5JBIA 3QSYA 1L1QA 2P8JA 3DMRA 4LOHA 4YXFA 4ZT7A 2ZJFA 3UAYA 3FW1A 1UJCA 2AEFA 4CQJA 1NUHA 1BS2A 1DHRA 1VECA 5A3VA 2E5LB 1WAMA 1KU0A 1JS1X 2WAYA 1E1CB 3Q9LA 4JSTA 3A1VA 4EX7A 1KH2A 3JD1A 4AMBA 4X1IA 4W4TA 5FWXB 5KSPA 2JGMA 3KSDO 3NDPA 2J30A 1RQ2A 2PPVA 1IB6A 2PV0A 1MIOB 3QK7A 1PLJA 3WQHA 3F67A 1FYFA 4QYIB 2IV2X 5TF0A 3T9EA 3PQ7A 1VFNA 1JU4A 3KPUA 3P9RA 4RORA 3OX1A 4RVDA 1SVIA 2P2ZA 2FVYA 3SVZA 3O84A 2G04A 4HWTA 3KSUA 5AUPB 4PY2A 4CMHA 2HUPA 2CWWA 3WMFA 1JDSA 2R8OA 4FOTA 3IMCA 4NZMA 2FOXA 4U2FA 2QL7A 2WOJA 4O4LB 2YVQA 2CVQA 4IDQA 2P62A 5H81A 3V8VA 5KAPA 3DUFB 3G8BA 3GUCA 4HEJA 1EE9A 4MTCA 1W1UA 3Q98A 2C1EA 2IZ7A 4N4AA 5H70A 4DANA 2BDUA 2FSSA 5CGQB 3H0KA 5FPPA 4A0FA 2RIRA 4H60A 2RAFA 1UBCA 4Y2VA 3RRXA 4AO7A 4I1PA 2WEKA 2GVDC 1LBQA 2R97A 3JRXA 5IDVA 3P8ZA 3BBLA 1SHKA 3NHBA 3QPVA 1UK9A 1R0RE 1E1QD 2WUVA 1YB2A 3FMVA 1M6HA 1BX1A 2QTBA 1P3DA 1WWKA 3C7KA 5FV4A 5T4FA 4JBLA 3VRHA 4MWGA 3CF4A 2HRZA 3L0ZA 4N0PA 4QYWA 7REQA 3LUKA 3SSNA 2IDZA 2P5UA 1AO3A 2I9PA 4XSHA 3FTDA 2N47A 3OWHA 1J1ZA 3ORYA 4X7RA 5ESRA 2ZBVA 2WJWA 3AEZA 1LTQA 4A5SA 3ZJTA 2W83A 1NVAA 2H1IA 1JB1A 2E4VA 1KSJA 3C3BA 1RRGA 2OV1A 1ZVMA 3LL7A 3BRCA 2OK8A 4KN6A 2GTIA 3JAWB 2MR6A 4PZ9A 1LCIA 4DSOA 1V37A 1GZ6A 1C8VB 1JVBA 1ZUNA 3CISA 3KAJA 3RKUA 4ZEVA 5JYBA 1KIMA 1KAQA 1GNQA 2X7HA 3NW9A 2HSGA 3R9KA 4IDEA 4ABYA 2PD4A 3NUGA 2EBWA 1GA1A 3KR2A 2A7QA 2ORED 1A9OA 3L4KA 3U09A 5H3CA 3PFFA 4EKDA 2QRVA 8ATCA 4BVFA 1OR8A 2FZKA 4IDNA 1C1DA 1K88A 2IQIA 2XRZA 3IPAA 3ZZ1A 5T6MA 1YE5A 4IDHA 3VZCA 4AJKA 4UNRA 1MC5A 5B6IA 2HL6A 2EXXA 4Q3EA 3TLMA 1LY1A 4IEFB 4CVNA 1NDQA 3NBFA 4K7JA 3IQDB 5M5BA 4C0KA 2QRPA 3CRRA 1TQ2A 3IVXA 3FMGA 5EQDA 4JLVA 4LJ4A 3VZSA 2PWAA 3OWOA 3V55A 4Q15A 4HAXA 4JL8A 1ZOPA 1P29A 1T2EA 1W1WA 3REQB 4EUNA 3HCCA 1S2NA 1Q7RA 3L2OB 4NBSA 4ENSA 1YASA 1CF4A 2M9MA 3AIOA 1E2NA 1TUBB 3MBKA 2JCBA 3QIAA 5C7IO 4C4XA 5KNLA 4GRAA 5THXA 1XD8A 4R7ZA 2J6BA 4LVUA 1Q50A 2DWQA 4FD3A 1YS7A 3NXKA 3WL4A 3UFXB 1ZJ5A 4FMCB 1EVLA 3T35A 1UXKA 4CI9A 3V6MA 5JVDA 5IP5A 3RG8A 4OI0A 4Y2PA 4ZT6A 3ZV6A 1E4EA 2GXSA 3IDSA 4RQUA 5HQJA 2HA7A 5HF9A 2G1PA 1ODKA 1WUTA 1JR2A 4GRIA 3QX8A 2R00C 3S44A 2R6FA 4LHWA 1G20E 1KI3A 3QTLA 4Q5IA 4AG3A 2AWNA 4N65A 4MRNA 4MVJE 4I55F 2EBFX 4PLTA 1DIHA 3JAKB 2HU5A 1FUIA 1II8A 3QLEA 1N5RA 1X70A 4QGHA 2CNOA 3OZTA 3SQOA 2C3MA 3JWJA 4RHXA 2Q4RA 2F17A 3FNBA 5LZ8A 1SAYA 1CKEA 1T43A 3AHEA 4CF6A 7ADHA 4ZOCA 1XKLA 1ZR4A 4OAOA 3B9BA 1IY9A 3PPYA 4DV4B 4G26A 4BATA 1DEHA 1VBFA 1OWPA 4UHBA 1VCHA 4XUDA 4Y18A 4FB4A 2ASEA 3PQ6A 5AK5A 2PX4A 5DYGA 2EKDA 3HXOA 1JA9A 1EWYA 2B4YA 2WHEA 3D8BA 4GO1A 3H16A 4MI6A 4BO4A 2ATEA 3W2EA 3P20A 5HOQA 1KC3A 3DE5X 3DOHA 1WW8A 3MPOA 2WP0A 2C83A 4M86A 5F7XA 3IB3A 3PLAE 4NX2A 1P2DA 2FUG6 3UOGA 3VKGA 1K08A 1Y7IA 1MXFA 3WKDA 1D07A 1XAJA 3FLBA 2OFFA 2CHUA 1Z8NA 1M6NA 4GVXA 3UTCA 4EJMA 4EGCB 2HV8A 4L4YA 2YTZA 4ZCMA 2Q3LA 3QXXA 4TV8B 4UKDA 2RI0A 3BE4A 3SKXA 3VNVA 1LK0A 1SIWA 1VZ2A 3B6IA 3RIYA 3V1MA 4MW5A 4BV3A 4D5GA 3IBTA 3BMQB 2NAPA 3BSSA 3GLGB 3WGUA 1B73A 2VF5X 4ZAVA 5EXEA 3ELYA 2YZNA 1HNWB 3RS7A 4JEIA 1S7GA 4M22A 2FDXA 3IT0A 5DULA 3JPYA 1I2AA 3NFYA 3DF9A 2B69A 4K81B 1W4RA 1YF3A 4RD1A 3TRHA 3C39A 1CR0A 1S2GA 5FADA 1QIKA 3LL4A 1SXJB 5DP2A 5AVXA 3WMEA 5JANA 4PQGA 1MJGM 1UBNA 2NO1A 3LW7A 4MV9A 2GO1A 1JDUA 1Q84A 1EGVB 2YS6A 1ENZA 3WRXC 2GB4A 2OHXA 1Y9EA 2RGGA 2OYRA 3FKQA 4PAWA 4JYZA 2ZBQA 2IDMA 1LI4A 3GRFA 2QQFA 3KXKA 3TQFA 4C4AA 1J8FA 3HJGA 3W34A 4E4TA 1M8GA 1KI4A 4XE5A 3LX6A 2R00A 2Q6KA 3I2IA 5E9QA 2KS6A 1JHYA 3V3TA 3PTAA 4Q7JB 1T8WA 3QKSB 2QGNA 4IFIA 2H00A 4KH1A 2CZQA 1F0NA 5F3DA 2WB4A 3RTCA 3AEQB 5FTNA 4D2IA 3CVXA 3MFQA 1N6KA 4L15A 3ADDA 4ZN6A 1KSHA 2P3LA 2ZUWA 3A4IA 1GYQA 1MU0A 2HCBA 4IXNA 4L50A 3JQ8B 1AN9A 1HLDA 1KMMA 1P5FA 1WKCA 2XTJA 3F5FA 4OA8A 1STOA 3ZJ4A 4CLDA 3D8UA 3BB1A 3A9WA 4N76A 2QB5A 2Z2IA 1E3EA 1JJFA 1SXIA 2P4UA 2UVPA 2R4TA 1PL6A 3TLYA 1KI6A 2GLTA 1IXRC 4E32A 1C1YA 1EFCA 1VSUA 4MV7A 4PZPA 3G6KA 1W0JA 4XJSA 1IBLB 1Z56C 1EWVA 3LYAA 5ALFA 3CE9A 1G1MA 2V4MA 1YT5A 3DFUA 5B64A 4N6GA 4CLRB 4M1OA 3I9NA 3IUNA 5EC8A 3GJQA 5D3MB 4GIBA 1XQWA 3S27A 4UQLA 4CW7A 4LXTA 2JKVA 3M6WA 5KO2A 1NAHA 1VL8A 2GKGA 2NZYA 3LHSA 4B1FA 4B6EA 2B30A 1U9JA 2W6QA 3FGNA 3P2EA 1QZ3A 4N5NA 2ILVA 4JLDA 3RNLA 4PXSA 3WTCA 1RRMA 4BEBA 5JD4A 3CPJB 2WYHA 4QQFA 4ZOLF 5D2CA 3QVVA 1RQPA 4LPKA 4AF8A 1PFGA 2JLQA 1C81A 3FCYA 3HL0A 4R8VA 2YVUA 2QQ0A 4KNYA 1XU7A 4ID3A 4NHEA 3D31A 1O96B 2P27A 2QJWA 1ZNWA 1WE2A 1P81A 4Z0TA 1ZD9A 5JJBA 3AUAA 1N2EA 3SBDA 4I9GA 2DEUA 3B5EA 1Y6RA 4HQKA 1JL3A 1NI4B 4Y2YA 3PJEA 3N7TA 1LDBA 4JH0A 4DWOA 2DBZA 3ANLA 1EFRD 1V9SA 1U7WA 3JQFC 1L5VA 4KBGA 1YHYA 3T1NA 4DKJA 3KS9A 1QIIA 4CRWB 1T3LA 2AD1A 4YP9A 2ZVPX 3JQ7A 5EPOA 2O3SA 3WRXA 2Q2QA 5HSGA 3DBLA 2ZSAA 4GOMD 3U0VA 3E35A 3UW1A 3DT9A 2C5GA 1ACLA 3FYTA 3HNRA 5D6OA 4BNJA 2C5AA 4D4IA 5JECA 1M2OA 3AM1A 1QFJA 3QELA 3ZD6A 1ZRNA 5LQMA 2C5LA 3ZD9A 1KARA 4WADA 1PVDA 2FEKA 5IJWA 4FI3C 4B6QA 1U1GA 1T6ZA 1TUEA 4F5EA 3ELBA 3R5JA 5FNZA 4EJSB 2FJ0A 4BLQA 3LYUA 3JYQA 3OM1A 3R0JA 4JJGA 1VMKA 1WQ4A 3EGDA 3IILA 5ENVA 3C7DB 4OMDA 2TS1A 5GM2A 5LQRA 2I87A 4Y1RB 2P68A 3WL6A 5B1DA 4OHWA 3C41J 1B74A 1MOZA 5TGZA 1CIJA 1UOQA 1IM8A 1UJBA 3P0IA 1Z5OA 1RHJA 2XUKA 3LC2O 4R8RA 5EZYF 4BO7A 2DFDA 3DAYA 3EPRA 4MS1A 1CVIA 3E18A 3RC3A 1DJQA 2YHIA 1DBIA 4F11A 4J0EA 3PEYA 1A8UA 1ZRSA 2JHCA 3DE0X 3JYNA 3SF8B 2FN9A 2ZRGA 1OT3A 5E2AA 5K8UA 4D74A 3BHJA 4ZHQA 4MJ7A 1QGZA 1KK1A 1AURA 1PYDA 2ID8A 1IOLA 1PZXA 5JPCA 3PKZA 3HLKA 4W5OA 2R0QC 1ZEJA 1JEAA 4FS8A 4GAEA 1GA6A 2VOEA 2QLLA 4PC3A 4F5WA 5CYFA 2PCLA 4EA8A 1QDEA 1F3LA 1CS4C 2JLYA 1YKGA 4NMWA 1KVUA 3WQSB 3S2GA 2IEAA 4DDMA 4EA6A 5HIAA 1UBKS 3NBMA 5BVHA 1Y5MA 3OFJA 2WVJA 1SBZA 3QEJA 2AG0A 5ERYA 2O1WA 5CD1A 1QUEA 4N54A 2HIAA 2LXNA 2VYNA 3JQFA 4YAWA 4ZP1A 1W8IA 1V96A 4N0EA 4L6CA 1D4FA 3AB8A 1PR5A 4L72A 4EKNB 3HXPA 4G07A 1FXSA 1II0A 1ZVJA 2O20A 3GFBA 2EJBA 3HSYA 4CL2A 1EQUA 1IMOA 1E66A 2C8LA 4XDHA 2HLNA 1UQUA 4YRGA 1OTXA 3NC1C 1KOJA 3BJRA 5HA5A 5KVQA 2C1XA 3RR2A 1C7FA 2O3JA 4KR6A 1XQ1A 3THSA 1R4NA 4F8YA 1HOXA 5JHGB 3M4ZA 4E14A 4CM1A 3S3TA 2B94A 3U5ZB 5DCLA 1OHHD 3E7DA 4PLZA 1GAJA 3TR5A 3ZN2A 2GXAA 4QDKA 4DMRA 1PK8A 3W2IA 3RS3A 2C98A 1AMNA 3DTNA 4FC7A 1XHEA 3H1EA 3KKQA 3EG9A 1HEUA 3SN6A 2X2OA 4RVSA 1VQ1A 2F1OA 1LTHR 1NSTA 4I19A 4XLLA 4EHFA 1JQEA 3RB8A 4L74A 2D6FA 1BA2A 4LJ5A 4ENTA 3GFRA 1P77A 1DC8A 1UZUA 4JC5A 4P2BA 2QVCA 4MGEA 1Z0KA 3FVTA 4LTMA 2HDHA 5CLQA 1OAOA 4TZ6A 3P9SA 4L5CA 2HCFA 1QFXA 5JAHA 1AUXA 1UADA 5M29A 3EVNA 3I2YX 2QRHA 1CR6A 2NT4A 1CS0A 1T3SA 4BU0A 1UFVA 1HTTA 3I39X 3OCUA 4I8IA 5LP6F 1SU7A 2NXEA 2W2OA 1DNPA 3IEIA 3MCZA 4GBJA 4U7JA 4M55A 2C03A 2OXTA 3PEFA 2GNPA 3CNQS 4B17A 1LVGA 5B30A 1DDIA 3GVCA 3I2KA 5AT1A 4W5JA 4GX0A 2UZAA 3IAXA 1TLTA 4LUCA 1WDWB 1YIAA 3LDHA 4WPGA 1VCNA 3DCJA 4IMPA 4LGMA 4NV1A 2C2HA 2F1KA 4IDGA 4R0NA 5ITVA 4D8UA 2OQIA 2G4VA 3H9QA 2A9RA 3CH4B 8ADHA 1HKUA 3F1LA 4IIGA 2W6OA 2RHRA 4IQGA 1XEAA 1MRSA 1S2IA 2YFKA 4GI3A 5ALEA 2R96A 4LMAA 4F04A 2JFWA 1N36B 1A9ZA 2Y1EA 3CU5A 1XR3A 5H16A 1GT91 1UANA 4HGYA 4B0OA 4E1AA 3E5RA 1XRRA 2W70A 4I66A 1G7RA 1W0JD 3EW7A 3SKVA 3NG1A 3A9TA 1YCHA 4UEKA 3N75A 3RUEA 2SKDA 2DR0A 2IYFA 2GRJA 4IQ8A 1U7ZA 3WK6A 1LXCA 4LRUA 5IASA 4ZHSA 2WM8A 1ZOLA 3ZWVA 2ZS9A 4EHKA 1T9AA 3HY6A 1IN7A 1SHLA 4PWYA 3RYHA 5BW8A 3K6SA 4Z7JA 4KR7A 5D8DA 3ANXA 3LS2A 3GJ6A 2QOEA 3N3BC 3QJYA 3OZXA 5AHRA 3WLAA 3ZXYA 4A16A 1XHLA 5LUBA 1NWCA 4P9NA 5HZGA 4GDFA 2VPWA 4JWTA 1U2GC 2ZCVA 2NXWA 5DN6A 1RNLA 1KHTA 1QU2A 1GFWA 3NWPA 5FJIA 4D8YA 2G4CA 1FLDA 5GJWC 3H9JA 3QWIA 2EP5A 1I7NA 4GT1A 1GITA 2CBGA 2O6HA 3CCFA 1R0CA 4TMKA 2WBLC 2QRNA 3TBFA 2XNDA 5B57C 2X14A 2OXCA 4K8RB 1TC1A 3KTFA 3N05A 4TVBA 2QUBA 1NMZA 3CO0S 3OMXA 3A37A 4P3PA 4BVGA 4P80A 4FN5A 1RM3A 3A8TA 4ND1A 5DWVA 1Q0UA 4NBNA 3LYLA 2W22A 4ZT5A 4R1TA 3D6VA 2BC9A 2ET6A 2GN4A 1T5TA 2IYPA 2WK1A 4L3WA 1PO7A 6AT1A 2J31A 2AG8A 3HPRA 4J6EA 1PYOA 4DNPA 2FMTA 1UXHA 4B3FX 5AW7A 4LJAA 3QKWA 2YWFA 1U1IA 4RJIA 4LJ9A 1X19A 5DXFA 3RVLA 5LOVF 4JBYA 4RQAA 3ILYA 2IVZA 2RC5A 5IKXA 3R20A 4O3FA 3LLCA 4PVCA 3RO7A 5YASA 3AU8A 5AW3A 3SYRA 2Q29A 2WHQA 2PX2A 1TLFA 4MVJG 1Y9ZA 2CFOA 1Y42X 3DKVA 3RI3A 3KM0A 5ADVA 4TTPA 1E3SA 3SFZA 4HYYA 3FZYA 3W5AA 1ID8A 3SKYA 1O94C 1OREA 2LUOA 2HYDA 3E22B 1MRNA 1QDLB 1EVYA 1OLXA 4AY4A 1RACA 4XVCA 5IDQA 5C31A 1C1HA 1UMCB 2QS9A 4JP2A 1JDTA 2VP9A 3RCBA 1JTFA 3KTOA 3ZUGA 2XUHA 2IOFA 3M1IA 3QNWA 3VR6D 4P7JA 2GEDA 3THXA 2V3CC 3NWOA 4EPXA 2BN4A 3IOCA 3HNOA 2MINB 3LUGA 3MD9A 2I2XB 1UBJS 4M4SA 4ZOLB 3QHPA 3G82C 1CRWG 1LV8A 2RHDA 1G59A 1G5IA 1VJDA 1F9EA 3CLUD 3H42B 3IV6A 2Q27A 1KZYC 3P9QA 3FUCA 1DSSG 3DQZA 4WZAB 1RAHA 1VHQA 4A9AA 2M1ZA 3OCCA 4EY8A 1O9HA 5L9AA 4WOCA 1EU1A 1QH1B 2P0YA 2VYFA 1IY2A 3GFFA 3PQ3A 1H85A 3JWHA 3U7FB 1KY3A 2FE1A 3OCJA 1U2GA 3K0AB 4O2RA 4UM8B 5G3ZA 5F5XA 4F38A 3KVNA 5U9CA 4CEHA 3K4PA 4B5LA 1JHDA 1P4JA 1AGPA 3I73A 1EFVB 5A3JA 1UKZA 4TMZA 4WEOA 2JBAB 3COYA 4JOQA 1SHTX 1B42A 1J7KA 3NXSA 2KBFA 4QG7A 3HM2A 4ZCQA 4LVOA 1H94A 1J6UA 1LFDB 2CWDA 2I7DA 1ORVA 2I7VA 2WVHA 3K5WA 2AI1A 3X1MA 1NFFA 5K8JB 1QHFA 2YV1A 1NYRA 1U65A 3L1JA 2H92A 3EIOA 1ZCFA 1QM5A 3F96A 4P34A 2VWHA 4RD3A 4YP0A 5M04A 3W79A 5JNUA 1O95C 4UZFA 4FT2A 3Q8LA 1CE8B 4WLEA 3UF0A 2Q5HA 4X61A 1UK8A 1SBNE 3HY3A 3QKRA 1EG2A 1E8NA 3D4OA 1N5MA 1FPMA 2VJMA 3NBKA 3KOOA 2VRBA 1YQWA 5DO9A 3I62A 1GZ5A 2C2XA 2HSWA 3U49A 1VJRA 1XMVA 2O05A 3DVAB 1L1EA 4A82A 4UM9B 4ZI2A 2H5LA 4AMZA 1O0BA 1NBIA 4JJIA 4MRRA 1GTSA 3OAAD 3LQKA 3BFXA 4O02B 3PUKA 3VMFA 4JVOA 4BJ3A 1AUQA 4D46A 3RS0A 4OXQA 2BGRA 3ZGLA 1GQQA 5DBEX 1CQJA 2G80A 4BTVA 5AKZA 4Y1EA 3SC2A 1Y9JA 2I6SA 5BQXA 4WMLA 2DLCX 2VCHA 2XY4A 1JXAA 2GZ1A 4FJ0A 2G5CA 4FW8A 4M8NE 2B4AA 2BCJQ 2XECA 4Q05A 2TMYA 1O94A 3HZRA 2ZRAA 3TMKA 3BILA 2FWRA 3C3XA 3H5RA 1JQBA 4GL2A 4PVDA 2EGUA 3BBPA 3MWEA 1LV7A 1NYTA 4XEUA 4HTFB 3P9PA 1VBNA 1HT0A 4OU5A 4YUWA 3S5UA 2V7UA 1P2TA 1AK1A 1Y6ZA 4EAQA 1FFXB 1SM4A 2OCPA 3EZ7A 1FFCA 1P2GA 2GQ0A 1NQTA 2WJ4A 3BQNB 5IVDA 4BAUA 4ZJZA 4RV9A 1KA9H 4TSFA 1Y8RA 2VDMB 4REQB 1M8KA 2Y27A 4B3MB 5EE9A 3H65A 3L8DA 1Z0JA 3IEXA 5ALJA 4GW3A 3FOEC 1TYAE 1XN1A 3TD2A 1C2TA 2IZZA 5T3UA 3BB3A 1E6CA 3PVZA 2WFZA 4M9ZA 5BMVA 3RADC 3MWLA 4X7BA 2XW6A 1GAXA 5IAOA 1TFUA 2C4WA 3VTKA 2Y0DA 3QF7A 4KWEA 3VSBA 4BCDA 1P19A 3W2FA 1HYHA 2GCNA 3QTBA 1EGAA 1Z4MA 1EBUA 4YRKA 5HBRA 4DCOA 2I67A 3NKVA 1MVLA 2PL9A 1BZYA 2DULA 1TAQA 4OB6A 1PHPA 4RXTA 2QPTA 5KTOA 1ZM9A 2Z6AA 3VR5D 5KSWB 3IX7A 3EZYA 2E4AA 4UXIA 2ZUUA 1UR5A 3AJ8A 4W5WA 3R0ZA 1TTPB 1TL7C 4B8YA 4CMIA 1WV1A 4GPEA 4OK3A 1O95A 1N4DA 1Y7PA 1GKLA 2OZLB 4OUDB 4PO8A 4M9XA 5B1IA 1SC1A 4YALA 1ZM2A 2BGKA 2RGXA 3R6TA 2M6KA 4MRMA 1ADYA 4GOJA 3WLKX 3K1YA 2H57A 2ID9A 3MCAA 4XJTA 2HW8A 1C30A 2R7AA 4C4YA 4ZDKA 1K8RA 4ZI7F 2J5BA 3CKLA 4DC9A 1AKNA 2A9OA 4L9AA 3VPCA 2HK8A 2JFHA 2JCSA 2R87A 2RGUA 3A36A 3EC7A 3OZIA 5LYJA 3RDPA 3AJRA 2W0SA 2QTVA 5LDGA 1DBSA 3THRA 5CFMA 4JP5A 1JGTA 1WD5A 3K6RA 2GVZC 3PHCA 4EG3A 4B81A 2QVXX 1U2SA 1YBVA 2XQVA 1ATZA 1NVVQ 1SCBA 1ZKDA 3EULA 4NFSA 2BFFB 2HXYA 3QLVC 4JR0A 4B83A 2XNDD 1YQUA 4LN1A 4UTOA 5EJIA 2AYZA 5LQAA 2ONCA 2I33A 3E7FA 4DVJA 1ZH4A 1Y8QA 2XNCA 4NBKA 4ZT3A 1GWNA 3HKEB 3AB7A 2CKDA 2ZRIA 4FCCA 3K2QA 2OV8A 5J4YA 4GMXA 3GMTA 4XGQA 5F2EA 3WLSA 5C4IA 4OMUA 2PN1A 1F2DA 4HWGA 1FBTA 5FBKA 2P6OA 2FLVA 2N46A 4C04A 5DYYA 3BFVA 4IJQA 1MJNA 2FKAA 2G25A 2XB9A 3ETGA 2HO4A 2P2NA 3K30A 3F4LA 2EIHA 1W7AA 2HPVA 4EEZA 1DO2A 2HWXA 1YH3A 3DZJA 2V98A 3SC4A 2GXQA 2Q2OA 5BW5A 1BU5A 2BKVA 2WYWA 1EI9A 4W82A 1O9GA 2PRIA 3PSAA 2NU6A 4FTWA 3CLKA 4N8EA 4MB0A 3LLVA 1CX9B 3KVVA 5ENZA 4PU0A 3E48A 3I42A 3MMSA 1O5IA 4LSWA 3EBPA 1Y33E 3TKAA 1JQ3A 1BVUA 3QLUA 4FONA 1FMCA 3EWSA 3CH5A 1SU4A 3L6RA 3RFFA 1YAHA 2HUNA 3JCZA 3LP5A 2QZPA 4JT9A 4UUNA 3IURA 4ZYLA 2F90A 1DJNA 3S4YA 1M54A 2WFAA 621PA 5ICCA 5ALTA 2B25A 1NMYA 3M0EA 4EK9A 2CNWD 3CF2A 2DUNA 5JCOC 2VDRB 5B2EA 2GWRA 3TGWA 1JIXA 2YWEA 1HE3A 3OIWA 1XTZA 5CXQA 2JJQA 2IHYA 1R00A 1XRPA 2LE0A 3I9OA 1V16B 4OL9A 3UK1A 4EQ6B 3L01A 2OC9A 1ENYA 1RT9A 3BL6A 5G4KB 3DXYA 4DARA 1PLLA 2X1HA 3KR9A 3VR0A 4QG3A 4KGVA 1TM1E 2WHPA 1Q14A 3DAPA 4JV5B 3KL4A 4X62B 1CUYA 1P8JA 1ZD5A 3FXAA 3VGPA 4F93B 3TF5A 1G9XA 2NU7B 4CUZA 2VN8A 2WAMA 4PX2A 5F1PA 2QI9C 3PGJA 4OJNA 4WOBA 5HKKD 3IXMA 3BH6A 4J0CA 3DHEA 5AJYA 1HEIA 1FS6A 4BPRA 3KZVA 1M73E 2ISCA 3IAUA 2B82A 2POCA 3QLVA 2ZATA 2ZWPA 1SC9A 2G5PA 3ZI4A 1FRFS 3ZKWB 3CFYA 3AI1A 2HWWA 5KB3A 4JYCA 4G0YA 3PFHA 3VYUB 4RH0A 2P79A 1VE5A 1KPIA 1ZUIA 2AXNA 1USIA 2LKCA 3MVEA 4JI1B 3HBNA 4KK3A 4R7GA 3IP6A 3UPTA 4GGMX 4ODIA 3HDJA 3KEOA 2QE7A 3IP7A 2NPIA 4MZXA 4GWLA 3TI7A 1A98A 3UC9A 4F2WA 1K92A 1WTCA 3Q0IA 3ZVKA 4OB8A 3ZWWA 1KWKA 3UT6A 2AA3A 2HU2A 1G5FA 3W90A 2K4MA 2WWRA 3GT7A 4MUMA 3RVBA 4RYDA 1M7HA 2N42A 1MRZA 2VK2A 2ZE7A 1C3OA 3DBHB 3DWEX 3EY9A 2H4ZA 4C5CA 4K28A 4H31A 4UTPA 3GLIE 3MJVA 2OA0A 5BP7A 4Y2QA 1QOQB 4BFSA 3LUCA 4L6IA 3LJKA 2YASA 1YDHA 4FD2A 5K3EA 2VJLA 3TX2A 4XOUA 1GZ7A 4B7UA 2P3SA 1FCJA 5JSQA 5K6RA 2B4QA 4HH4A 1KI8A 1B8UA 1E77A 3BWMA 4LYYA 2JFBA 5J23A 2NSDA 5IW8A 4IXTA 1Q7EA 1A7UA 1PW5A 1Q7GA 4BMXA 4CKEA 5HF6A 1DB3A 2A9FA 4B47A 5JCOA 3Q2OA 4GS5A 1XXLA 2V6JA 4RTNA 1F4LA 2C0CA 2CNDA 4TYPA 1WVMA 1ZA1A 1ZSYA 3IAS6 2UUPA 1A2OA 1E7SA 3GLKA 3Q9NA 4XX1A 4DC1A 4TSFD 4KP7A 2IYRA 2W6ZA 4RL4A 3NC0C 4HT3B 3ID6C 4IUCS 1KJYA 2H0RA 1DLJA 3Q11A 2QMOA 3GG2A 3STUA 2VTBA 1EFPA 4IIFA 5CM9C 2KPOA 1T1GA 1JR3A 1DRWA 2G28A 3PIDA 1SOVA 2W8BB 3MJSA 2EC5A 4UFOA 5IDWA 4EUFA 2Y1XA 3EQZA 4RK6A 4UVGA 5IJ9A 3B70A 3KQHA 1WOYA 2AOXA 5KAMA 4MVYA 3K9BA 1N2BA 4Y2XA 2FZLA 2GZ3A 3IBSA 4O2BA 4OHOA 3RF7A 3VXKA 1N6NA 2AZ4A 1E79A 5JD3A 2WUGA 2P0AA 4KOAA 2LP4Y 5BW6B 1VG0B 3PWTA 2Y0PA 1J07A 1DHTA 2ZJBA 3FKSD 1Q0HA 4RJKA 1T5OA 4R2HA 3L8HA 4WECA 4UM7A 2XQJA 3HS3A 4X1KA 2GM5A 4KLNA 3W0LB 1H6DA 1NAIA 2H1CA 4IVQA 3LKBA 4OH1A 5CAEA 1DCTA 2I8CA 4UEOA 2V6BA 3B5IA 2I91A 3IXLA 4G0WA 1NHWA 2I4NA 1B6SA 1RI3A 4IH9A 5CCBA 1PCXA 5IC5A 1NPYA 1R6BX 3G79A 1OAAA 2OR3A 5G2OA 3G2MA 2GRUA 4NCXA 1CUBA 2LBPA 4KGXA 1NBMA 3KP1A 3EY4A 1N2HA 1URPA 1X7DA 5FBZA 5K0JA 1CQIA 2FOLA 4V2UA 4CL0A 4KR2A 2WIAA 4QGAA 3ZS9A 3V4OA 1V11B 3OSZA 3ABSB 3ZE8A 1FRVA 5CDSA 4JA2A 4B6JA 4J29A 1G8HA 1E99A 7AT1A 3RC7A 1CNMA 3N2IA 4ZYZA 3CTPA 3EPPA 3O8OB 3PGXA 4J3JA 5HM8A 4D57A 3MAJA 1Z9BA 4YJDA 4RVOA 2BD0A 3UEOA 4L3OA 4AD8A 5ALKA 2Q7DA 1KMNA 3TQIA 1YBHA 1G8PA 1B0PA 4QBFA 4ENQA 4K26A 4F72A 5E6RA 1AMOA 2H7VA 1BH2A 4IV0A 3VKUA 4OFBA 3WO0A 2APJA 4LRTB 2AK2A 2WG0A 3REOA 4P58A 4OHBA 1BX3A 1C0PA 3EGXB 3MCTA 4JXZA 2DFNA 1WSBA 2BV3A 2R2AA 4M89A 3HP4A 4M98A 3OOHA 4K6MA 5DE3A 3U1TA 4CV3A 2ETXA 5KVCA 2YY5A 4YN3A 3ZWCA 5AI5A 1NI5A 5IM5A 4WINA 1H42A 1TVKA 1TM7E 2FNAA 2R79A 3IPCA 4GMDA 1E6EA 5THQA 5JASA 2EP7A 4YGXB 2AXQA 2PR2A 2REXB 2O3UA 2YXBA 3D54D 3GJ4A 1DG1G 4J7UA 3TGPA 1EZ1A 4DR2B 1JH8A 5FI5A 3ZBTA 1EK6A 5JZBA 1GUBA 1CZKA 4AJ2A 4IHJA 2LR0A 3T9FA 5IVHA 3NIWA 4YJ2A 1QX4A 3QFTA 4D80A 1Y6GA 3H7AA 1E9FA 5CNJA 2OZKA 2OTCA 3RJMA 2IK8A 4WCVA 3CEJA 3OQVA 2XT6A 3K32A 3OESA 2CXRA 4PSAA 3TPCA 3ETCA 4ZI7B 5KINB 4BKOA 2I66A 4G41A 2GWHA 3CPHA 4XUEA 4UFPA 4KBFA 1DRJA 4MQEB 3V7YA 1CJUC 4H15A 3UVEA 1ODFA 3W05A 4F2PA 5LWQA 5TIIA 1E3DA 2XZTA 2ZSIA 3CSDA 4W7SA 5EEHA 1KGDA 1TK9A 4I3FA 1UJMA 1D2NA 2NSHA 3K0SA 4M9UA 1SQ6A 3AMVA 1OVMA 2CVZA 3HWWA 3L7DA 4JKIA 2PVCA 5CPFA 4B6GA 5CXXA 1KU6A 2OHOA 2IXTA 4CTNA 2MSNA 2V74B 4Z4CA 1C7JA 3NLLA 5BT8A 1PNRA 3VA7A 4GP6A 1I2ZA 2ZRKA 3CJRA 1Z62A 3W3AH 4HAIA 3ZU5A 3VPSA 3GH3A 2A78A 1SVSA 1SG9A 4LBWA 3O4HA 4YONB 5A2GA 5U4XA 2XE8A 4UEQA 2BEVB 4UXHA 1XA0A 1IQUA 3KJXA 4B2IA 3VJLA 3ELUA 4H3SA 3WNBA 1BKYA 1DVRA 4N3GA 3DBVO 4AIIA 1U3FA 1KZ1A 5DMHA 2ZWMA 1CB0A 4HQOA 3U3XA 3HDQA 4OO3A 2K6GA 1BWQA 4Z2YA 1V1RA 3UJAA 1CUWA 3NPMA 3KZMA 1T8SA 3AR6A 2UU9B 2G4LA 2POQX 3AVXA 4OXXA 5TS3A 5KC8A 5CBKA 1GZSA 4M87A 2RFLA 2AOTB 3G3EA 3S2SA 3TW8A 3ZDRA 3MUFA 1HMPA 1GUZA 4F46A 4ZQCB 3F73A 4NPCA 4RCZA 2O07A 1AS0A 3E9NA 3SC3A 4M46A 5CIYA 2JH8A 1G5TA 5T64A 1XVIA 5J2UF 1R9NA 2X0DA 3FBTA 3L6OO 5FHRA 1QJCA 2G9UA 4RW0A 1DO0A 1L3IA 3MTJA 4I5FA 5T7BA 2NZJA 2XYHA 1YNOA 5J2TF 5T3YA 4KR9A 4PCVA 3EXG2 3AB3A 2YXPX 4XVUA 2BEJA 8ABPA 1XIVA 5AVSA 4OQ4A 1A76A 1EX9A 5LD2B 4DA6A 2J6CA 3UENA 5IMSA 3NBYC 1FY2A 3B48A 1Z6ZA 5EMKA 4OQPA 3B6ZA 4C88A 1AXGA 3BEDA 1RMTA 3CZ4A 3B82A 3IVCA 5FQOA 3HVJA 1NG9A 2NZ2A 1C1XB 4GYYA 3TM4A 4YRPA 1Q16A 3K9HA 1R6XA 3JQCA 2I54A 5B7NA 2IYZA 3QF4A 3JQ6A 5KKNB 1AN0A 3C4VA 3LXXA 4X1OA 2GN1A 1E1RA 3FUTA 3NJ8A 5AOVA 3DW3X 1T8PA 3NIBA 5C34B 1DUIA 3GRZA 5EQJB 2PH7A 2B61A 2XV1A 3LGAA 4KLAA 1IQRA 2VF4X 2X8JA 5LMUB 4L5BA 2MSWA 4IWXA 4MVJF 4UDOA 9LDBA 3E05A 1S01A 4POOA 2AMVA 1TC2A 2LDBA 1LB1B 1WDKA 2DTDA 3C0KA 3IQIX 4F6CA 4XQ0A 3V80A 3M6XA 2GN9A 1IRIA 4XYLA 2PXXA 3CB4A 1HPLA 5K3SA 3TLGB 1HWYA 1EAMA 1P61B 3WJ1A 1JR3D 3OX3A 3TTSA 1A4RA 1V5IA 4DPKA 1JAZA 4G1UC 4IEEA 1RRFA 4Y2TA 4V0SA 4LZLA 5E7JA 3PUXA 5A0FA 5TRTA 1V7PC 4YRAA 2BKUA 2RIPA 3PQCA 2PUDA 4Y2GA 1PEAA 1I3MA 2J1LA 5J40A 4D9BA 1I3KA 1R0XA 1SXHA 3IR7A 1NW5A 3HB9A 1ZEMA 1L1FA 3ZKAA 1QC5B 1UZNA 3MJTA 1U2DC 1ESEA 2Z8XA 2BFPA 3PWSA 1TTTA 1HLFA 3OU7A 1JLKA 4NNPA 2E5FA 2YHAA 2Z1DA 5TVKA 3GA5A 1YZVA 1K3UB 2CUNA 1QRSA 1Y4DE 3EMBA 3HV2A 3JY6A 3A1SA 2CLOB 3E61A 3IH5A 5EJ8A 4II7A 1JR3E 3RVNA 1GGVA 1F4PA 4L8FA 3AT1A 4O4JF 1Z68A 2CK3A 4KZKA 1XZAA 2WJ3A 3V4ZA 1NBMD 4OQLA 1BXRA 1P0IA 2W6JA 2XXBA 3FYSA 4QOJA 5KQMA 5LL6P 3CCCA 4M9QA 4DR6B 3VAAA 4Y9TA 4PYIA 1YSCA 5SY4A 3R8XA 3DDWA 4OP3A 1PVVA 1RKQA 2PS1A 2ZUCA 1J97A 4L0MA 2V7GA 1EM8B 2FLKA 3F4BA 4IJKA 1LI7A 4IIJB 4DGQA 3O1JC 1SUFA 1E18A 1I3CA 1Z18A 4MUHA 1P1CA 3DL4A 4M7OA 2BBSA 4OF4A 3K0KA 2X0FA 4XI9A 1T9KA 5C1PA 2PAAA 3GR6A 2ZRMA 3PC3A 5E95A 3V32A 2HRDA 3R4VA 2A1TR 4U7HA 2WTBA 3W6OA 3O2SB 1OVGA 5JD5A 4LJLA 3R7SA 5KPDA 2P1ZA 4EF5A 1TJYA 3FDFA 3JARB 3FTNA 3HA2A 3O4JA 4UVIA 4XQCA 3UT5B 2OMKA 3GMIA 3ASVA 5JQWA 4WBNB 4MYUA 1K0UA 1L4KA 3F9IA 3QXSA 3SHFA 3UJ7A 2A2ZA 4S35A 1MN6A 3EARA 4V02A 3BERA 3SHWA 2HMAA 5CA1A 4RPJA 5CGZA 2PJDA 2FV8A 3QKTA 4FCTA 4OGFA 1N5LA 3RT7A 2QTLA 4IFTA 4UATA 1DC4A 4E5YA 5DFAA 4FHZA 2OK7A 2BFOA 1KE1A 3PNYA 4IV5A 5CX1B 1SOUA 2GN6A 5JH7A 3EVBA 2WAAA 4RLFA 4E11A 4RHYA 2IP4A 2GBPA 3NTXA 3ORHA 3EJ6A 5JSUA 4RFLA 2OD7A 2DT5A 4I4LA 4OXRA 2G09A 5A06A 1T9GR 2EWVA 4PYQA 2IIQA 5AVQA 1FMFA 4H27A 3ZGXA 2DECA 5DCUA 1DKRA 2ZKIA 3W3AA 3ZY2A 3I04A 1PR4A 4IHKA 4I9UA 1F0PA 4KRYA 2BMVA 3U60B 1BU8A 2C7PA 1YJBA 1UBUS 3WYEA 1OMOA 5H4HA 1QQ7A 3RKSA 4U8GA 3UKDA 2JJ2D 1LF5A 5HMLA 4YROA 4EAAA 4HN2A 1U2DA 4EB8A 4RTJA 3DLHA 4YDHB 5FTWA 4LF5B 3U0BA 1QYWA 2PYDA 1T9DA 3VH2A 3AV3A 4TWJA 5BSGA 1CUXA 2DHRA 2Z5VA 1YR6A 3FRJA 2BH9A 1GNRA 3DOOA 3GZTB 1ADJA 2PRJA 4LC0A 4MIYA 1N8KA 2Q4EA 2ZSDA 3PBKA 4JQOA 1WDLA 3P0FA 4WZBB 5KWEA 3V8RA 4I50B 1UJ2A 1USVA 2ROQA 4OG2A 5FV7A 1XL1A 5MGBA 1KIFA 4RELA 4PLGA 1ZC3A 2R8BA 3R3JA 4E3ZA 1RHQA 1UDCA 2EFDB 1V35A 3HBLA 3L8MA 4NEHB 4XVQA 1AA9A 3JRWA 3OA2A 1OBCA 4UHKA 2OO3A 2RGBA 2Z2XA 4AP5A 2AKEA 1OIXA 1QZZA 1P9NA 4I9FA 1U0NA 3WP0A 3AUJB 4V3BA 4QGGA 1ULHA 3C2QA 5HKLA 4TXJA 2BFEB 1GPBA 2M32A 4N5MA 2H2WA 2QZSA 2HV9A 4OM8A 4RS3A 5HS6A 3ZE0B 3C8ZA 1LFAA 3V9AA 4BEVA 4Q4HA 4E5DA 5A4KA 1FA9A 2FZVA 3WL5A 3L7AA 1AQYA 5HK8A 4YXWA 3EVDA 4TLDA 2Q0SA 1YQDA 4GX5A 3ZEIA 5B4VA 5EXDA 2J0UA 3KQYA 1XD2B 3TSWA 3JASA 4E2FA 2CLHB 1CR1A 3ISTA 4Q00A 3G2LA 1KSFX 1T2NA 3D4IA 3DB2A 1N0UA 1XVUA 3FHCB 3PC8C 3DWGA 4IDDA 4NVRA 4R9NA 2QR3A 4EKEA 5B3JC 2QBYA 2JAOA 1T6YA 3IOMA 1XTUA 3G13A 1A3CA 1VM6A 3GO4A 4HYQA 4DM3A 3E23A 2RHBA 3ER6A 3I8SA 5E0KB 4BBAA 3W1EA 5JIBA 2YZ2A 3PQ4A 4ZK6A 2H3HA 3RFXA 1WTAA 3WK9A 4DEXA 4I1OA 4YQZA 2D06A 3M3HA 5COBA 3UCFA 5JFGA 2ODTX 1IC6A 2WU1A 3PFBA 1P6UA 3FB4A 3FBWA 3IKTA 1M75A 4HO1X 2H54A 5AVKA 3PD0A 4U8HA 2M6SA 4R5MA 4WK2B 2C4KA 1LPSA 3T1VA 2BDEA 4L95C 2CJXA 2EFYA 3VGJA 4N41A 2CY0A 3OKCA 3I6MA 4F6LA 2YHUA 2QLTA 2P4QA 4A0HA 5LDDC 5LU8A 3D0OA 1U7XA 2RJ3A 4HZIA 1Q0PA 3CZMA 3GLHA 3SZMA 1XVAA 2QW8A 4RE6A 4CKBB 5FYDA 1Y6JA 2ZI7A 3GGDA 4TS4A 5ULLA 5CLHA 1BHJA 4FT4A 1U2ZA 3FDZB 3NOXA 4I1YA 5J58A 3MIIA 1H1LB 4G6ZA 1O57A 1CY7A 2G77B 1UP7A 2OCKA 3N2ZB 3LQ2A 1R6DA 4D0GA 2BT4A 3IEPA 1OAKA 1XSEA 3W5HA 1U0RA 5KOIA 1E0AA 4DSUA 2B1RA 3P4UA 2PO7A 4RDIA 1QLJA 4C3UA 2L0XA 4NJOA 1OX5A 1B7GO 2EDCA 4CIAA 3FPLA 4P5PA 2AR9A 4Z4QA 2WF7A 2IYQA 5CK5A 2FW7A 2J7PA 4YC7A 2D1TA 3V1TC 1ACJA 1U6IA 4MUAA 3EMKA 1YB1A 5FNVF 3DDNA 1N1GA 3I9V6 4L22A 3RH0A 3VZQA 1T0UA 3R6LA 4CIYA 4LIPD 2A5GA 4F1WA 2XMQA 1BCRB 1P9LA 1HT3A 2XGMA 2VPXA 1ZK0A 2IEDA 3L7JA 1TCCA 2BEUA 3SU8A 2ECFA 2WYIA 3G2KA 1J09A 1VJ1A 3IUBA 5J2UB 2PZAA 4Q7MB 4Y98A 3GUUA 4WKPA 3RWBA 4NYJR 2QLBA 3G88A 1Y5RA 1DWOA 5FKJA 1MEEA 5J2TB 1EAYA 2HA5A 1Y48E 3GPBA 2C92A 3K71B 1N0HA 4B73A 5BUCA 1KXJA 1L7PA 2GJSA 4K9DA 1LX6A 2OCYC 4MICA 4US0R 3RAFC 3CX6A 2O8NA 2VOJA 3PC2A 5IX8A 4FFBB 5JZ9A 1A9RA 3RFUA 1DIRA 3I5UA 3IFSA 5HQ3A 4LE0A 4LHZA 5B3JA 4KLCA 1U7OA 4J8PA 1I3OA 2HF2A 3CNNA 3K09C 1UPFA 5P8WA 3HLYA 2NU9B 3UA3A 2CVOA 4X85A 2XBUA 4CJXA 4N0MA 5DNDA 2UUBB 2VF8A 2VK1A 4IOMA 2YMMA 2IH5A 3QLJA 3H2KA 2G5GX 3BWDD 4M9RA 5IZCC 3VPBA 2QZJA 3D7MA 3HVIA 4IGEA 1MABB 1N9GA 4M99A 1Z15A 2FPKA 3DV2A 4F12A 1W36C 2BBTA 1K8QA 1X9HA 2VQFB 5BORA 2Y1WA 2ALJA 3FYDA 1QV9A 3DMDA 3ABRB 4LJ6A 1ZD3A 4B4WA 1V1MB 2DPHA 4BE4A 3CV3A 4K1XA 4X6LA 4PCLA 1C29B 2VJYA 4DF3A 1H69A 5FHQA 2ZUVA 1LX7A 2R47A 5FOTA 2OO5C 4G9BA 1W8DA 2VJCA 3QYFA 2HJRA 1Q21A 3BHIA 1G8MA 4UNIA 4CE6A 1HRDA 1IDOA 2BFBA 1I1HA 2BR4A 2QJOA 3BD7A 3I64A 1LD3A 1S3FA 2KW5A 1UQTA 3I3OA 3QBVA 5DHSA 5DI3A 5EVCA 4HS9A 1FJXA 2ZZMA 2AN4A 4EP1A 4QPNA 4UC0A 2I3ZA 1KEUA 1K66A 2VA9A 1VG1A 2R6R1 3GUYA 2EZ9A 5TY0A 2O7SA 4DCUA 4G8BA 3PQ2A 1XXHE 1Z37A 4KVFA 1SVKA 1S3SA 1ZINA 2BKLA 4ZI3A 5DXJA 3ROMA 3GXOA 3KVRA 2D3WA 3RYCA 3S40A 4PTZA 3ZQ6A 5B12A 1NXQA 1PL8A 3W3AD 4BB9A 4DSNA 3AZPA 2V6GA 2J0VA 3ZGVA 4A2CA 1D04A 3FFWA 1HLGA 1NTOA 4Z9XA 2CDAA 5AVWA 4I81A 4B6PA 2NU8B 4YRZA 2FSIA 1LW6E 2VZ9A 3PJDA 3T4PA 4OP1A 4TRJA 4IYRA 1KHHA 1RAIA 3PHBE 1GTRA 1ICIA 1QNLA 1WXEA 2DPMA 1H9BA 2Q1TA 4HNAB 4UREA 1XO1A 3D4PA 5DGCA 2RHOA 1TVMA 1CNEA 4DY4A 3GDFA 2AX3A 4I2VA 2VWQA 2R7LA 3AW8A 1CSEE 5IYZF 3VSDA 2UXCB 4HI0E 5JWRA 5GJBA 2FU5C 3AHFA 1WJGA 4QFDA 4GLBA 2C9DA 4TN5A 2ADOA 1Z3CA 4M1SA 2VQ3A 3TQRA 2VSOA 4NU5A 5B37A 2IP2A 4UARA 4CV0A 2EBUA 3AY6A 3R23A 3VYTB 3K9WA 3OSUA 4FGWA 3K09A 3OUZA 4TYMA 2IYYA 2BUCA 1F2UB 3MGBA 4MVXA 2AHRA 4KIWA 3J7TA 4MYDA 4CKWB 5LQJA 4ZQGA 3P0HA 2A1IA 4BQQA 2PQ6A 1MW8X 3HWRA 5IZCA 1IOVA 1L5NA 4UNPA 4YAIA 3U4GA 4YLYA 4KNVA 3R9IA 3DPIA 3WGNA 3FUVA 3F9RA 4YRFA 2YWDA 1TMKA 1V8PA 1NATA 1H65A 4FDUA 1YXMA 1Z0FA 3DV0A 3HLTA 3KTAA 1P7VA 4HDKA 1IU9A 1E9BA 2CVPA 5LXTF 1D09A 3T99A 1B23P 1P2VA 3KG2A 4J0KA 2PXCA 4PHFA 3RC2A 3TDMA 4KAJA 4WCDA 4QDJA 4NV0A 2OO5A 1AHIA 2BEWB 4E7OA 4EUHA 3PXAA 4XPIB 4IDBA 4YXWD 4GRDA 2VAXA 1W29A 3MAAC 1IN1A 2ODNA 1MQ8B 4GZ3A 1G18A 1YRYE 2AYYA 1NJSA 3A9VA 2FP4A 3KK0A 4U2DA 4BGIA 2HMWA 2F8MA 4JENA 1M2GA 1U3DA 3AFGA 4GR4A 3WB9A 7GPBA 1EM6A 4D25A 1L4MA 3DJFA 3U9LA 4ALMA 2VIIA 3I9FA 1UP6A 1KS9A 4NRDA 2E4UA 4BRSA 3U4QB 2JLVA 2GCOA 2GFHA 4GMKA 4DCMA 2GKSA 5EYPA 3RAJA 1A72A 1NVMB 1R27A 3LBFA 1G8SA 4QQKA 4KJXA 3SR0A 2IBSA 5LR6A 1YS2X 4FKZA 5EJGA 5JQGB 3GV0A 2EFEB 4BNXA 2HDOA 2VXCA 4UU1A 5GZ3A 2JCYA 6GPBA 2PBFA 3OJ0A 4KNWA 4HY3A 4Z7NB 1IBRA 1XL0A 1L7MA 3AEUA 3SVTA 3H8SA 3K8ZA 1T91A 2AI3A 1OX4A 2Y67A 1R0WA 2DKOA 4C6TB 3TL6A 4CFYA 2JD1A 4DCPA 5CFQA 1GPAA 3PDHA 1XG5A 3G59A 3OTIA 1CDEA 3DFIA 4LDRA 4AMGA 1XRMA 5CRIA 2GZDA 4H7JA 1UC4B 2JC3A 3QFFA 4Q34A 4RV5A 4OBWA 5LN1A 5FCDA 1GL7A 1Z2DA 3KFXA 4AZWA 1PSDA 3E1GA 3ESBA 3FCOA 2ZU0C 2ZWOA 3KEQA 8LDHA 3R7WB 1GUDA 3T4XA 1YCGA 1SD1A 2IS1A 3DM5A 3CKKA 4FYYA 2PTGA 2ZXEA 3TRJA 1SVNA 2WSIA 3H4TA 1N5IA 3IKMB 4IJUA 1TU0A 5EZ5A 1NX9A 3HXQA 1ZWKA 3FVWA 2Z3VA 3SBEA 1W5TA 4M0KA 4EEKA 4BQOA 1IZ7A 3CX4A 3PEEA 4RFSA 5EFZA 4LF8B 2JGIA 3RD5A 1FP2A 3GMSA 4Y3UA 1UOOA 3I5YA 1XDDA 3OPYA 1JP7A 1DZ3A 4MEBA 2PMFA 3R3SA 4BL5A 4CHGA 1SVUA 1JFTA 1QB7A 2YYAA 4KIGA 4RD4A 4KVZA 3TLZA 4URYR 4MKGA 5KYVA 2PT7A 1EFDN 2Z98A 3KQPA 3STTA 3QRWA 3FOCA 1GG9A 3ZTWA 4EECA 2VP6A 5AK4A 4ZA2A 4UBKA 2V45A 3A0RB 3ABQB 5FEMA 4A5OA 3FGZA 1OU0A 1PGPA 3KKNA 2H1RA 2PGLA 4RZUA 3NVMB 1VCMA 3EIXA 3QYPA 4F06A 4CTOA 1JYFA 2NN3C 2IUFA 1RBZA 2X0KA 3R9XB 1NF2A 4L75A 3NORA 1J0BA 4JJ7A 5FP0A 1WG8A 1C9EA 3MS4A 4JUAA 4BWVA 4NF2A 4B3GA 3HCFA 1EJ2A 3VZBA 2BFCB 3JQBA 2ZOSA 3BB4A 4P35A 3VPFA 1VLMA 1JH9A 2RKOA 4QHSA 4L0CA 4P92A 4A10A 5L4NA 2XZOA 1L5HA 5KYXB 3UV7A 3ZQKA 2Y2UA 2HZ7A 2O2DA 3DWFA 3NHAA 4N5LA 4CCSA 4IQ4A 2IUSA 1OY1A 3AESB 3EMVA 4AMUA 2WWGA 4H4EA 4MUKA 1TT7A 1VHTA 4FFWA 5CBPA 4OFXA 2NMVA 1D1TA 5CCDA 4GOKA 1XCJA 3PEVA 4Y8VA 4C5AA 4E22A 1BS9A 4HDRB 5FFMA 1P1KA 5GWXA 5JE8A 5I5GA 1W4AA 1L6IA 5EJ4A 5DRYA 2KSQA 2CE2X 1YKFA 3AXSA 4AWBA 3WIVA 1V5FA 3OUUA 2FR0A 2DR3A 4LW8A 4BIIA 4UQPA 4FI3F 1OFGA 4F92B 5IS2A 1J22A 2ZIXB 3OT1A 2H5JA 3UHJA 4YPOA 1Q3HA 1KQNA 2VNAA 2W43A 3FOWA 3IAHA 4HNQA 5C3UA 4CKXA 4C4OA 1E7MA 2ZR0A 4DWVA 4YMHA 1GARA 5EUBA 1HZZC 2QZ9A 3ZE2B 3OZWA 4DIBA 5BN3A 5EE5B 4QDZA 4RM2A 2IHBA