3EHDA

Crystal structure of conserved protein from enterococcus faecalis v583
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
b'MTKIYFAGPLFSQADLRYNAYLVEQIRQLDKTIDLYLPQENAAINDKSAYADSKMIALADTENVLASDLLVALLDGPTIDAGVASEIGVAYAKGIPVVALYTDSRQQGADNHQKLDALNEIAENQFHYLNLYTVGLIKLNGRVVSSEEDLLEEIKQRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized conserved protein
publication title Crystal structure of conserved protein (PF05014) Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 50
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ehdA00
3HNOA 2A33A 2NX2A 4OHRA 2PFKA 1F8YA 4U1RA 3K2QA 4I4IA 4FYHA 2F2TA 3IMKA 4JENA 2F64A 4A3SA 1MTOA 4FYKA 4JEMA 2Q4OA 4WL0A 2KHZA 4MCJA 5AJUA 2F67A 3QUAA 6PFKA 3OPYB 1S2GA 3O8OA 1S2IA 2IZ7A 4FYIA 4HX9A 1YDHA 4KXLA 3O8NA 2KLHA 4I36A 2IZ6A 5AJTA 4KXNA 4LJRA 4I7EA 1PFKA 2Q4DA 3EHDA 2IZ5A 4NPAA 4KXMA 4RH3A 1ZXXA 1WEKA 2F62A 3O8OB 1KZHA 2A0KA 4LJLA 1RCUA 4P5DA 4JELA 3MAJA 5ITSA 1S2DA 3UQZA 3U39A 1S2LA 1T35A 2PMBA 3PFKA 3OPYA 3F5MA 3GH1A 1F8XA 4MEJA 4LJKA 3O8LA 2HIGA 2F48A 4OHBA 4P5EA 1S3FA 1WEHA 3SBXA 4PFKA 3BQ9A
chains in the Genus database with same CATH superfamily
3L8ZA 1OSNA 1FXUA 1ZONA 2WA1A 3CLRD 1Y7HA 4A1FA 4B81A 3TFOA 2B36A 1E2IA 3RYCA 4EVSA 4O33A 3QMPA 5L3QA 3REOA 4IUBS 1IWOA 1A2KC 2XBLA 3EMDA 4R3NA 3KVOA 3NHPA 4F4FA 3I0MA 1RU3A 4V03A 1RPNA 1SO8A 3FTQA 5IC6A 1EFHA 1VPEA 2I22A 3FKQA 4R01A 1EJ2A 3BMCB 4WL0A 1YOVA 3H2ZA 4HDMB 4MQEA 4OKNA 1KJ8A 2J9FB 4IICA 4ZKDA 1WTCA 4PAWA 4B7ZA 4YHBA 4YDSA 5J4VA 4TMTA 4BO0A 4YC7A 2A92A 5LR6A 1KR5A 1NI3A 2EHDA 2OC9A 1G6OA 3GOHA 5DLDA 4G4SO 4B17A 3QOYA 3QVSA 5C80A 2AFIE 3UMBA 5HRAA 4BO3A 4IG4A 2J59A 4YJ2F 5IAKA 4BFUA 4AQYB 4RTRA 4MKHA 3LLVA 3MT0A 4HX9A 4QDXA 1U2GC 2HDNB 3BD8A 5A0TA 1FFYA 2B4QA 3CUUA 1U2ZA 3W5SA 2WJPA 1XTZA 2ZQYA 4QECA 4Q48A 1OBOA 2OTCA 3BMOA 3Q7PA 1T9DA 1M2KA 2BI4A 3D6NB 4F3TA 1JLKA 3T3IA 3DC2A 4HQ0A 2PDAA 5DTIA 5EP4A 1J8MF 4NH0A 4D98A 1UPXA 3ZGVA 1NULA 1U9JA 2DHDA 2GD2A 4WXMA 1DKPA 1UBUS 1LDNA 3GLFB 2C99A 2CXSA 4KJXA 3EDMA 2QZSA 3BJIC 3IPLA 2ZLBA 1E79A 4US0R 1YZGA 1GGFA 2NV6A 4LE2A 1HDOA 1SOUA 2HV9A 1J1UA 3CR8A 5EWJA 3WL7A 3P9PA 5JD4A 5BR8B 2JIZD 2YBEA 3H5NA 5C53B 4NBWA 4XJSA 3RR2A 2G1PA 1V43A 1RHMA 4JT4A 4XFDA 4UMVA 5HSGA 2A59A 4CTOA 1CY7A 1H2ZA 5LB2A 1YGPA 3ZHXA 2P2NA 1JIXA 2Z9DA 2YBDA 1Z38A 3REFA 2GN6A 1VG8A 2IHZA 4FQ8A 1JEEA 2OECA 1YZYA 4R54A 2FWJA 4O0LA 1A2QA 1LVGA 1J24A 2BZ0A 3ONNA 3KKQA 3IQHX 3VDQA 1QGUA 5AOVA 2OL4A 4I1VA 4HDNA 1CJBA 1XRRA 1E4YA 3M3HA 4OMCA 3CUSA 5EIFA 5J5VA 1OYVA 2F00A 2O8CA 4R83A 4KR9A 4KYVA 4WNAB 4TL6A 1RBQA 4UVDA 1GNPA 1M5TA 2WJYA 2ESRA 2A9KA 3MYYA 1G3UA 1O6GA 4OH7A 2Q3MA 1TT5B 1I8TA 1PVDA 4YRCA 1EFVA 3WBKA 2EGGA 3QKRA 1H4VB 2P7IA 4IKOA 3INTA 4V2IA 2QVBA 2ZIXB 2ZVDA 3E5MA 5TQVA 1V1MA 4MV0A 4AZ0B 4R2WA 4DRXB 4KH0A 1M1YA 3CW8X 2VRCD 1P72A 3GFVA 3PQ7A 3UF0A 4C1NA 2JI9A 1PTKA 2GK7A 4GKAA 4L5BA 4RPGA 1T0BA 3DXXA 2W9XA 3DNPA 4XW2A 4TWIA 5C35A 3O8RA 1CB0A 4IHJB 2BR4A 3OFNA 1KC3A 4EZBA 6AT1A 2XA9A 3AY0A 3BFVA 4BXOA 3HH8A 3LXXA 2SNIE 3JVEA 2XF2A 4J0DA 4BIMA 3QSGA 4NR0A 1TM2A 5C31A 3UJ3X 3RS7A 4P6VF 1PFWA 2ZE7A 4DGSA 4K6HA 1EB9A 1NJFA 2B8TA 5AI4A 3ACBA 3ONVA 4IJUA 2OQRA 4UZSA 3DM9B 1PEDA 1SPXA 1DRVA 1EZZA 1O7JA 5HMMA 1RS0A 3KJIA 2VHJA 3AUYA 3OZRA 5IN5A 3ETCA 1ZMBA 3RTAA 3RPEA 2YZ7A 2R65A 3OX3A 4PYNA 4C5CA 2PH7A 2VSOA 5EE5B 1ANKA 1YJ8A 2D1QA 2QVYX 2WJJA 5AHRA 3OLWA 3LLCA 1P3JA 1ORTA 4DZRA 1KR2A 3AERA 4B6PA 1KZYC 1QQ5A 1ISMA 3JPWA 5EJEA 2FQWA 1L9XA 4I2VA 1J22A 2AJLI 2WWYA 1ZU4A 4MIEA 3BWXA 1SKBA 1B6GA 1P33A 3ZGXA 3ZV4A 4UKDA 2XA1A 2D1TA 3R8XA 5CM2Z 3RIYA 2ZUWA 3T9EA 2P91A 3TCNA 2DE0X 2C8VA 2QZ4A 4J0QA 1B2RA 1W4AA 1SU4A 1XRLA 5TB5A 3SD7A 2CLFB 2DKOA 2W2LD 4IQ0A 1E2GA 4OBXA 5H70A 3HLTA 4TSKA 3K6RA 4ZQEA 2ZJ2A 1PR6A 3DOIA 5EWLA 3VUEA 4J4BA 2PWZA 2WWFA 2I1WA 3A9CA 4XCVA 1QBKC 1TVMA 3HRKA 3IJ5A 1AO3A 3EQ6A 4M83A 3PIIA 1I7QB 3TMYA 2OHXA 2RBKA 1K6MA 1W30A 3UFXA 2GPYA 1EYZA 2OILA 4Q1EA 4OLFA 1MTZA 5L45A 3IH5A 3KFXA 4DLSA 1JQLB 4N6GA 5C32A 1T0UA 3VSCA 2VLBA 3GP8A 4PLVA 3T95A 4KAXA 5JCJD 4YCBA 2FZGA 4GSYA 3D6JA 3QVMA 4MQ4A 1Z2EA 4A8PA 2Y3IA 1NOIA 4RZQA 4UOQA 3ZQJA 5A9SA 1EXNA 3ETJA 2C07A 1HSOA 1T15A 2NYVA 3JAKA 4HEQA 2NUTB 3HO1A 1XQXA 1PCXA 2AX3A 3FAZA 1SOWA 5U4QA 4RORA 1SURA 1CRQA 5GGXA 3HY3A 1HZZC 4BPRA 3U61B 4UBMA 1UWVA 5IN4A 3GRPA 2DLNA 1G41A 1MLDA 5SY6A 2GO1A 2BKVA 3RIMA 2ISQA 1GNTA 3E27A 2XZOA 3UMVA 2X42A 1SQ6A 3K5IA 1U8TA 2BBSA 3AC0A 2CLMB 1JQ3A 3MAJA 1C8VB 1JFFB 4ND8B 2TYSB 1XA0A 2FPGB 1NZJA 3EEYA 3FB1A 3IT3A 3W05A 2WSYB 4ZI7F 2XVMA 5LN1A 2C7OA 3OCUA 3QFHA 4LK3A 1WLSA 1HDXA 1NF8A 3JQRA 4O4LA 2C58A 2N1BA 2Q4TA 4YPOA 4YRBA 3ND9A 4X62B 2C3YA 4M9XA 3QFFA 4YAOA 4HATA 2V3CC 1IK4A 1VJTA 3FF1A 3G5MA 1VSTA 1WZCA 1K8ZB 3DEKA 2REQA 1VB5A 1XYVA 1F5NA 5AI0A 2ENUA 1L5HA 4YRNA 3OECA 3EF1A 5AIAA 1UDAA 4ZWNA 2XMRA 4DJEC 1HEIA 1FSSA 2EW8A 4Y0VA 2BYTA 2I6XA 4EQZA 3UTCA 3EOZA 3M2TA 3I0NA 3BX1A 1WXGA 4CFZA 3GWGA 3DXZA 4FXPA 4FYVA 4IY1A 1IDOA 2E4XA 3DUFB 2J0QA 3FTEA 2R8RA 4QRHA 3VJKA 1OLXA 1DPGA 1DNPA 3NDPA 4J1TA 4Q7QA 4KPEC 2FDCA 3K70D 1GUAA 1V3TA 2MDTA 3LUJA 4AI6A 3R8CA 2AT1A 1E5TA 2P4HX 2JKVA 2X1VA 4CLXA 2IW3A 3NP7A 1SVKA 2WKSA 3T7KA 3UWKA 4YCCA 5IH7A 5B1DA 3AHIA 2QMHA 3DMDA 5KVAA 4N5IX 1NXWA 5AO9A 1DC6A 3ESQA 2IC5A 1CR0A 1VJ0A 2LWIA 2ZYSA 4J16A 4YCDA 1VL1A 1Z4JA 5IDVA 4FCWA 5KYYB 1K06A 2C2BA 1W6RA 2JLQA 2BGLA 2H7YA 2LTAA 5I9IA 3KYJB 1W8IA 4OH1A 2YWGA 1V2HE 1Z5GA 4NV1A 3G13A 1XZPA 1NE7A 2WR8A 3BSYA 3KQOA 5CT4A 4RTMA 4WBSA 3O8NA 5BPHA 3PHCA 1JLRA 1FDRA 1GRRA 1NW3A 4BHTA 1JJAA 4LECA 3DLBA 3M4YA 3ZE6A 5A3QA 2PRZA 4LDPA 1JHYA 1SA0B 1XWFA 2W2OA 4KK4A 3LFUA 5AUNB 2O8EA 1UDCA 1ZD8A 3KJNA 4MP6A 4UXHA 3UH0A 1VGRA 3SCZA 3SQNA 3F8TA 5MN5A 1CQXA 1OZAA 2WT4A 1NY6A 4HWOA 3HO6A 4XFKA 2XKKA 3E9QA 4ZVMA 4MVJM 1RYMA 1I2DA 1BRMA 4RKEA 2C5LA 2ZVPX 3RS8A 2OR3A 3TLZA 1IG0A 2FPIB 2P2GA 1J9ZA 1X0XA 1XZMA 2QE7D 3R6GA 2BIFA 1JRLA 1LSUA 1VIAA 5DGCA 4CJXA 1PV4A 4MV9A 2VZEA 2FWMX 5DLEA 4RJIA 3WNQA 2C97A 4HFRA 2W8BB 2JI4A 3ROTA 4IXNA 4J7CA 3TPZA 5BV2P 2NYRA 2MTBA 4IIJA 1KERA 1Y9AA 3H9JA 2ANCA 1SWVA 4HPWA 3CZMA 4RULA 1Z62A 1DBWA 1RP7A 3M2PA 2N0SA 4AXXA 8LDHA 4TL7A 5DNEA 3IQIX 4OJYA 1OVMA 1L7QA 2Q28A 1GY8A 1SD1A 3I2JA 2HUNA 4R2LA 3U7QB 5D86A 2H4JA 1GZVA 1T5IA 2Z1MA 4L4ZA 5CJPA 4OKSA 1EAMA 2P6UA 4JJIA 2YWJA 4Z2YA 5TV2A 3HYNA 4PTZA 2ZK7A 3UW3A 1PGQA 3BRCA 1JH9A 4OJNA 3IHKA 1O97D 3H0CA 2Q5OA 1YVDA 2ORIA 2QMQA 3MMXA 4FJ0A 3CZ4A 3MA0A 2EARA 4G09A 1IVYA 4Y1GA 1O9BA 1KHHA 2CLLB 3PIDA 4CIVA 4ZDJA 5K4HA 2AI1A 2QL7A 4I1PA 4PRLA 1E18A 3NCTA 1TLLA 2QE6A 4RM2A 4PC1A 1NVAA 1BKYA 2R6AA 3IEPA 1Y1QA 1L5WA 1O95A 3K8ZA 1LLDA 1F2UA 1F9EA 2JZOA 1KSHA 4PHCA 3QXHA 1VSQA 1P7ZA 2GN2A 1U3UA 2WINI 2DTDA 3L93A 1KKMA 3KUUA 3S7TA 4N41A 3OD5A 4I99A 4AJPA 3E2IA 16PKA 1CY8A 4UW9A 2WSSA 1FTWA 1U7TA 2HH9A 2J87A 3I73A 5L40A 4RQUA 1QF6A 2YY5A 3ACCA 3LHIA 3ZK7A 4AS1A 1IMJA 1BXGA 2IZ1A 3TDMA 4DBZA 4ZVUA 3LPMA 3KSRA 1Y5MA 1Z8FA 3FYSA 4MDYA 2PH5A 4EFNA 2QNIA 1Z0UA 2WNSA 4KPUA 1C50A 4RSRA 4INPA 1FTNA 4U2GA 1K3TA 1WB9A 4L4SA 4XCXA 4FFLA 3SVTA 1WSWA 1P62B 4FVTA 5SZKB 4RMNA 2G1UA 3VBEA 1JSCA 1NM5A 2BZ1A 5HJ7A 4RPLA 2YHIA 2VA9A 5AHXA 5CAEB 5JCPA 5JLJA 4LOAA 2I8CA 3TS1A 4C4ZA 5DWVA 2I3GA 4ZU6X 4DADA 1N32B 2AFHE 2O8DA 1RM3A 4OUDB 4BS9A 4EY4A 3L1IA 5I7OA 1WPRA 2Q41A 2QT1A 4ZEWA 4ARZB 5T7BA 5TJHA 5FUXA 2GGSA 5JZBA 5JPCA 1Y4AE 1GV0A 2XUIA 2NXWA 3D7NA 1NA5A 3BH6A 1TU3A 2PQMA 3ETLA 1NC3A 4JBWA 2BCGY 4PYRA 2GPWA 1ENYA 2GJSA 2R79A 3U16A 5LZ5A 3PB3A 4N3AA 3NI2A 2NNLD 4RNCA 5EJFA 1YBVA 1Z37A 1P2UA 4G0OA 4CTMA 1A2BA 1LBHA 3VR5D 1LS1A 2I65A 1C29B 3NM6B 4H7HA 3H65A 2BMWA 3I09A 4QATA 4C0WA 1ZC4A 2W48A 2QXTA 4JU8A 2BFEA 2RIPA 3VJMA 3J81A 4IZIA 4PIVA 1TQ2A 4LYDA 3GOQA 2BM1A 5B6IA 2P3LA 5AESA 2BRUC 4J7AA 2JRCA 4W5WA 3UA4A 3RVJA 3M3PA 3C16C 5E1MA 5AXCA 2CJFA 4PSVA 1LVHA 2ZYRA 3RAPR 4DIOA 3FDFA 1L5VA 1WUKS 2YV3A 2FKNA 3HBAA 2MMCA 4KDCA 2EL9A 4WY8A 4YCAA 5E7JA 1KYYA 2GI4A 1I10A 3GX1A 2X41A 2Z2XA 4HH4A 1UC8A 1ISPA 1W5BA 1FQWA 2GBLA 2C2XA 4H17A 4QULA 1JFTA 1TIPA 1U4OA 1A5ZA 3A6KA 1R27A 1L7OA 3G02A 4PF1A 1QP4A 1P5HA 3HKEB 3OLYA 4QRIA 5ESRA 2HIMA 3AL0C 4NL4H 1UXHA 4GRDA 4IIHA 4W8OA 2WG2A 2Y05A 1BXRA 1EP1B 2FPUA 3VR3A 1NL3A 1ODSA 1LSSA 5I48A 2JIBA 1OFGA 1EFRA 3OT5A 1YI1A 2EFGA 3ZTTA 4HUTA 4B3MB 4OQYA 2GUGA 2NG1A 3AV0B 1ZRNA 4UM9D 5CA0A 1M2EA 1SU6A 3RVDA 1LWOA 2C5FA 4OIMA 1L7BA 5EYPA 1Z6QA 1JHZA 1UPAA 2O3RA 4JIMA 3ZXUB 3IUJA 4DSUA 4E09A 5LD2B 5JADA 5F5XA 3EPRA 3UXYA 5LQUA 2FG6C 1RYEA 5J1SB 2JFNA 3JQQA 3MQ4A 4LNAA 5D5QA 3FWZA 4ETIA 5C46F 1ONSA 4JY7A 3OOHA 3G9ZA 5B53A 3OQIB 1DEAA 1X15A 2VI5A 1GRCA 1K92A 2C95A 3H19A 3TQCA 3O7WA 3V6LA 1JEJA 3FNEA 1XYYA 4AF7A 3CJQA 1SKYE 3ETHA 3ZQUA 2XXAA 3CT4A 2G5TA 4MKFA 5HWSA 3OQNA 4G1UC 1SQ0A 1W9MA 4KUEA 1O89A 5AJWA 4D0RA 1QPGA 2JFHA 4HB2A 4I4NA 4F04A 1V8FA 1OWPA 5WRFA 3ZD6A 4Y2QA 1DFGA 2GWHA 3ABRB 2FR1A 1ZXBA 1JG3A 1TXGA 1REQB 1M2FA 1SQFA 3P9XA 2VZ9A 4EP1A 1ZZGA 2Q8PA 3CSSA 2B7CA 4LZLA 1VGVA 2X0KA 1FOEB 1T8UA 3OLQA 1P0PA 3PDUA 2IS1A 2G1JA 4DIDA 7REQA 1JTEA 3LUBA 5GTDA 3FM9A 1R00A 4LWOA 2FHPA 2O2ZA 3P0HA 3PFWO 4JUAA 4TXMA 2KBEA 3FZGA 5FOXA 2OPBA 4D8WA 3HK2A 3F7NA 2ZS8A 4K5QA 3RWBA 2J4CA 1V39A 4WK4B 4AULA 2GJ8A 3NQ41 3UK1A 4C2TA 4YRFA 1D8AA 2C3PA 1CY6A 5DBFA 1BQ3A 4XQGA 3DW3X 3PD0A 2XE4A 3I2GA 4NXNB 1YRBA 1ZK2A 1PL6A 2JHFA 4TX1A 5G53C 3FHTA 5DNCA 1ZOOA 3UIEA 3K16A 4BVFA 1JFVA 4AYXA 5I9MA 1M1NB 2Z43A 5JMPA 3X3HA 1RM5A 4EW2A 1C9JA 2CLHB 1FVHA 4B8YA 1W36B 2J3LA 4O4IA 4AIIA 1G42A 3IUBA 2NU6A 5I9NA 1EI9A 1SIOA 2IELA 1NPTO 1EIZA 1ONPA 2B6NA 2PL3A 3NJRA 1UDBA 1UCFA 3KAPA 2IWRA 4OVKA 4AY6A 1RHQA 1M3SA 4CM3A 5E7IA 4TYQA 3WKEA 1M1YE 5M34A 4K46A 5CTJA 3X44A 2VNAA 5IBRA 5HUQA 4QSMA 2KPOA 4DWVA 1MJFA 1OC4A 3BHIA 4NBNA 4TTSA 1F06A 2PBZA 4ENUA 4TTVA 1C9DB 2JGKA 4MQLA 3K8OE 5EGSA 4OBEA 4KVFA 9ATCA 1OXMA 4PLTA 4BKPA 5H82A 4ID9A 4HI0E 2G4VA 1Z35A 4ROTA 3DOCA 3VPSA 2GF9A 3PNYA 1NKVA 4HDQB 4L1KA 1EFTA 3TLGB 4A92A 721PA 2BJWA 5CYFA 2JLSA 3T35A 2EZUA 1IJBA 4F2HA 1AH2A 1K1EA 1MH1A 1XTVA 2BCJQ 5KHLB 1NVVR 5LCXA 3GRVA 1DIGA 3NU1A 2HLDD 1H6CA 1DXQA 1EGAA 5D5HA 2QU8A 4TVSA 2QRMA 4FT2A 2XNDA 3ER9A 3EQZA 1XDBA 5JXJA 4DZZA 1ADFA 3TZKA 3RYIA 2W00A 3MAGA 3RC9A 3VPXA 1GPWB 4M6WB 2EOAA 4DW8A 2R6GA 1J20A 4CW7A 2XVZA 3MINB 4EMBA 5ADWA 3WAJA 3Q3CA 2PL9A 4CCAA 4TVOA 5DRYA 4GU5A 5BOSA 4OEHA 1BQ4A 3O03A 1U0NA 2D0IA 2PZMA 1KAQA 3FRIA 3HEBA 3EE6A 4JVLA 2QT9A 4TMWA 3JQDA 2IYPA 2F9LA 3RJZA 1XZQA 2X9GA 4UTPA 1YONA 1MOPA 4Y67A 5DNYB 5C5IA 4UREA 5DTJA 3BQMB 1V45E 1RLMA 3DAOA 4KXYA 1TIBA 4F0JA 4B3GA 2OB2A 2Y8EA 4OPMA 3PFGA 1ZKMA 2DJ5A 2ZEJA 4IIVA 1ICEA 4WN9B 1ISGA 1Y82A 3RF6A 1B8VA 3KJXA 1U1DA 1E6UA 1SVMA 1HQKA 2QTVA 3C3XA 3OWOA 3V8EA 4Y1EA 1DTSA 2XT9A 1S3GA 3DFMA 3DOFA 2P65A 5KNLA 3GHYA 3HPRA 2AG8A 3NKVA 5BV7A 2VP5A 1G60A 1TF5A 1NBEA 2E55A 3GRCA 3I2HA 4G63A 4B1FA 4C7BA 4LCEA 2JF0A 4FMPA 4QQNA 4CDMA 1AV6A 2HA0A 1EQUA 1JR3D 4C0JA 3T54A 4F06A 4OCZA 5G0SA 4E4TA 3O4RA 2O8NA 1YZLA 1JF8A 4JEUA 4I4TA 1KFKB 1GDHA 1XFDA 2G25A 3B1YA 1GTMA 2OO7A 3CZAA 3F4KA 3QKTA 3R0QA 2FSVC 4HTFA 4OXQA 5L3ZA 5JZOA 3ZC3A 2XOEA 3PC3A 1DDOA 1HE2A 2LR0A 4WE3A 1W88B 2I54A 3F2VA 3JASB 3GUCA 1AXRA 1DRUA 4IH4A 1L4MA 1TCCA 5CURA 3MAAC 3IMCA 1AY0A 4M60A 3A1WA 4KX5A 2Q6LA 3VSDA 3WFIA 4E3ZA 5EMLA 3WL3A 3Q7IA 5EQJB 3NTOA 4X63A 4HQRA 2BHSA 3EXHA 2XH8A 3VSBA 1I5RA 4G0NA 1G16A 1DO0A 3QNUA 1OHHA 1Q95A 1EHYA 3AU9A 3BILA 2GVNA 1S6YA 1N5JA 1CJVC 1Q20A 3AX6A 4E08A 2XWSA 1D03A 2VDMB 1SCUB 1Y34E 1MQ9A 3BXGA 4OGFA 4HZIA 3ZNQA 1ZQ9A 1Q44A 3ASYA 4QBGB 3R6TA 2D62A 2HF9A 4QC2A 3F6BX 1RHKA 1IFXA 3HCWA 2YN2A 3C97A 1J8DA 1ICIA 4E13A 3BD7A 2QUZA 5JH7F 3UKJA 4NC9A 3NC4A 3AO0B 3PA6A 1CNFA 4N12A 3ZHUA 3S1AB 4Q12A 4W1PA 1JJIA 4MQFB 4X90A 3IUSA 1UFQA 3ERCA 3DQQA 3N8NA 3ZZUA 4B4OA 1WDTA 5BQXA 2UUPA 1EX6A 3AR8A 5CPFA 1H1LB 1DXYA 3OHMA 3KXLA 5CB0A 4LMAA 3KYCA 4Z86A 5BVHB 1NJ6A 2DWCA 3AH8A 1FP1D 8ABPA 3HKDA 1P9WA 5ALWA 3RV3A 1DWQA 3ZXIA 2VAPA 1DJOA 4K9OA 4WCFC 4N0MA 4XVQA 5B3KA 1JWLA 2X4LA 2QM7A 2IW1A 1W47A 2AHOA 1GL9B 3FKSA 1NE2A 3JYQA 4EY8A 1X80B 2YFHA 1X1EA 1XZNA 2VEDA 1BXKA 3NHWA 4GSKA 4P9NA 1FMFA 2X5XA 2C5SA 1HO3A 2FX2A 3D31A 1OD6A 3E48A 4V3CA 1MX1A 4UNNA 3OMXA 2ZG6A 3JWIA 3SC2A 3DLPX 3RFCA 3WYGA 1CYEA 2D1FA 5K2MA 1ZN9A 5TGDA 4RUKA 4Z51A 4K9PA 4EI9A 4IV8A 5K0FA 2WFLB 2M1XA 2J3MA 3BK2A 3IJRA 3PFIA 1WMDA 2ZBPA 4IS3A 3X1XA 3D1JA 5JI3E 1WDKA 1ZW1A 2AR7A 4KSCA 2NT3A 4RVUA 3BXPA 1GVNB 3HCDA 4YX9A 4DN6A 3SIPA 2G8NA 1YUNA 4QBFA 1GAQA 1XKXA 1E2MA 1RI4A 5TS2A 5A6SA 4M3NA 4XQ0A 4BASA 3ADBA 5DMXA 5BWMA 3FYHA 1UF9A 2BMAA 4L5IA 2YDYA 1C3JA 1E69A 1IONA 2Z4TA 3A58B 3FJOA 5KWJA 1CDOA 5IUKC 4CLHA 3R0XA 5AI5A 1SEVA 2C54A 4MOWA 1LC3A 2X5OA 3NOQA 1RXCA 5CVJA 1DAMA 3MM4A 4WZBB 1IWPB 1HK7A 3G9UA 4J2HA 5AYVA 5IYZA 5U9CA 3CX7A 4AKGA 3GFSA 4S1NA 3GZNA 4UPEA 3HR7A 1CUCA 3OKCA 1HYGA 1RXWA 5JNLA 3PQ3A 4YDHB 3TLJA 4IRMA 2R8PA 3S99A 4FZ3A 1THGA 3TRHA 3V7YA 2AOTB 1ZO8A 4C14A 5IK2A 3PJEA 1KQFA 3T3DA 3BMNB 2NQ2C 4J0IA 4QEKA 1SBIA 3G0HA 2YWHA 4A2CA 4BP3A 1XDSA 3R41A 2KJQA 1P3Y1 3GIDA 4AJHA 1M72A 1T9HA 5J43A 1PWHA 1M34A 2NTYC 1PR5A 4GDMA 1LLQA 3LWNA 1ZIYA 1TF2A 4QDZA 3IBCA 4HXYA 2IDMA 2E1PA 2V5AA 2X2OA 3BMQB 3E5HA 1GZ7A 2HSDA 4RXTA 3QU9A 3JZFA 1O54A 2ZWOA 1Q1GA 4Y6RA 5BSHA 1P1BA 1FUEA 4MGIR 4B7XA 3PQ8A 1KPIA 4R0MA 2PLAA 1BA2A 4HSEA 1DQYA 2G76A 3RSQA 2RI1A 4LOLA 5IMSA 3DHVA 5I7WA 4YR9A 2EF1A 3EULA 1UJ4A 1KZ6A 1CFJA 1XKQA 1XQ1A 4MW5A 1VKOA 1S8NA 1BN6A 4HJRA 4V3BA 4A8JC 2BHLA 3H2KA 1FFHA 4WKGA 5CP8A 3VR6A 2GEVA 2O2CA 4AJOA 3HG7A 2EBUA 2C42A 2DFLA 1XPUA 3A2MA 1MVNA 5DX0A 3PNKA 1WG8A 3BH7A 4ZMRA 1CIPA 1T0JB 2AOUA 2IU3A 4TYPA 1G2PA 4C08A 1DIBA 3IVXA 2HIAA 1QXSA 4F3CA 3KL4A 4S0XA 1GCGA 4XGNA 4EGSA 3WR5A 3WJ7A 1F4VA 4N40A 5JQGB 4GPBA 5EXDA 4HBZA 4KQWA 1TM7E 3IULA 4GQBA 2IDJA 3CLUC 2GM4A 2VCHA 1EP9A 2FE4A 3Q9UA 4KH1A 4REOA 1TCBA 3RIEA 4TLMB 3MMSA 4PQEA 1ADBA 1U1CA 5PNTA 4RGQA 5AK0A 2PMFA 3ZWKA 2OZKA 2YXLA 3CG0A 3VDNB 4GM0A 1J21A 2C2KA 2OUIA 1Y9EA 3GJ0A 2A4KA 2GNAA 2G07A 2MR6A 3KRTA 4LTDA 1JHAA 5LZ8A 2FUG1 4XUCA 3IXLA 4HNAB 4XGRA 3FPBA 4PIMA 1AKWA 4A6XA 3SS7X 4ARCA 1G2QA 1CUBA 1H1DA 5H7XA 1E3WA 4I1YA 1L5RA 1TW2A 3JQ8A 3FVQA 3LAWA 3SC3A 1K66A 4F2DA 5IULC 3WJ2A 1SOVA 3HVUA 1P7VA 3BXOA 3KOUA 4JB8A 3C5EA 3WS7A 3E03A 4OBWA 3AR9A 4ES6A 2OO3A 5BVGA 1LSOA 1WUJS 4A3SA 1V7ZA 4CR6A 1PZGA 3TMKA 2XQJA 3KOOA 3WGGA 2Q0HA 2Z3VA 3A6JA 4GXQA 2X1LA 3MCWA 4CFYA 4DMLA 5CA1A 1NVTA 2IH5A 4O2AF 4WX2B 4NJMA 5DEOA 1GD1O 4OV6B 1JEYA 3E1SA 3BKXA 2PRSA 5GJCA 2VN8A 5CFNA 3S2EA 5BUZA 4QGBA 1FNMA 2GUWA 2RGBA 3G2HA 1UZLA 2FWNA 1F1JA 3P19A 2DR3A 4P3YA 2F3UA 4EEKA 1KYZA 1E6CA 2QW8A 3AETB 2GPJA 3H11B 2ES4A 1GSAA 2EKBA 2QSYA 5TF4A 4CKYA 3SQDA 1XDDA 2QAGB 3OETA 1VBMA 2NO7A 1G64A 2PUWA 4G8CA 5D3MB 1OH7A 4BO1A 4TUYB 2EEZA 3CNLA 3I32A 2PX8A 4PPNA 3FXAA 4W1SA 2KB0A 5JH7B 1AUXA 2NZUG 1ZCZA 2K87A 3R5HA 4RX1A 1XZCA 2PX4A 5J5CA 2B5WA 4DMMA 3GK3A 2WFZA 2ZRIA 3DBLA 3QF4B 5GGYA 4N03A 1ZK1A 1H3FA 4JBYA 1RKQA 1E4EA 1GAWA 3BGOS 3K0FB 4LJ7A 5IBQA 4AWBA 3A1NA 2CY0A 3N70A 4LRWA 4AWXA 5TEVA 1IHYA 2I76A 4D02A 1LRJA 4J2TA 3T99A 4TSFD 2AR9A 2L69A 1IUNA 2RH9B 3MBOA 3EA4A 1NT4A 2G67A 4KFRA 3GUZA 3W8FA 1RZRD 5JWHA 4P80A 5GM2A 2Z8YM 3PHIA 3FPFA 3G49A 5DXJA 4BBAA 3CEPB 5DOZA 3G68A 1MG0A 1C0LA 2G83A 3HSSA 3FOAA 1I1HA 2C0PA 5HF9A 2PEZA 3ND6A 1N2SA 4A91A 3NVMB 1Y1RA 4EFLA 1JR4A 1K98A 1FVFA 1XCBA 5BMVA 4BNXA 5IXYA 1OC2A 1CYDA 1YFJA 1IB6A 2IEBA 2TMYA 1QHEA 4W82A 3S70A 3CNOA 4CT0A 3LC2O 2ECKA 4XWAA 2CL5A 4WJLA 1JWAB 4Q3BA 1ULHA 2BMJA 2E4YA 4XSVA 4R51A 5IP5A 5LXTB 1JIIA 1F17A 2NZWA 3M70A 5FWYA 1CU1A 2W6ID 2FHSA 3K9QO 1I6WA 4IFTA 1VIYA 1WD5A 2QF7A 3RSHA 3O6VA 4DAEA 2F3RA 3STWA 1Y4SA 2PWAA 3BFJA 1N5LA 2VTVA 3KR1A 3P4XA 4EJMA 1NNI1 2CD7A 2P35A 3KQKA 4CLRA 1X87A 3FUWA 1TPZA 2WYVA 4QYIA 3ZE2B 2CF5A 1ILWA 2B21A 2JJ1A 3IBGA 2P6NA 4FDLA 4D6PA 1F6DA 1AXGA 5FTNA 3W2TA 4DNOA 1DV1A 5JRJA 2AN3A 3NNNA 1XD8A 3C3KA 1E2FA 3MHPA 4GBMA 1CQWA 1E59A 1SK9A 2V1XA 1IN5A 2Z4RA 3KYBA 3GFOA 3A6GA 1E5DA 1K97A 4BWGA 3KVNA 3NAQA 4JP2A 5GOTA 1G21B 4WA7A 3CRMA 3TQHA 3CZQA 1AX9A 1DBIA 5B6PA 2AQ8A 3PUJA 4X1KB 3U4GA 5IC4A 5K99A 3C98A 2BPOA 1ZH4A 2H06A 4L8YA 1F7UA 1FZQA 4ZOLA 1Z2CA 5JMOA 1VL0A 3FG9A 2PBFA 2EBFX 4M76B 4F1KA 4ICIA 1FP2A 1H9BA 4Z8YA 5B3LA 5FV4A 5BW5A 4Z4FA 5CFOA 1W0JA 2XQIA 3CA8A 2XCUA 4HLNA 1JDSA 1XZFA 3U3OA 1TJPB 4M1WA 4LN1A 4C4RA 4F84A 2HRBA 5AKJA 3DV0B 4LYGA 2O0HA 3W5BA 4M9ZA 1QDLB 1RYNA 3FNQA 2A0XA 4UNPA 3SY8A 3N2YA 4EBFA 4ZDIA 4PO8A 3ICPA 621PA 2EZTA 3FPKA 3FYUA 4MIOA 3GGGA 2BW0A 2IZ0A 1Y9JA 2FRXA 1EEXB 4JSRA 3EWSA 2I3BA 2G4CA 2FEWB 3CEJA 1KJJA 5ETJA 3VKHA 1USGA 1CERA 1ZI8A 2A57A 3K2BA 3PNPA 4JK3A 3ZIDA 4JDPA 3QQ5A 3IQDB 3ZJTA 3A1VA 1HQYE 3QA3E 4FIZA 1SEPA 4Q4JA 3IQFA 4JC4A 4E12A 3PC2A 3MTBA 1S0UA 4CMEA 5TGTA 3DCNA 5I7HA 5LVAA 2QTBA 3WJ1A 1MFPA 1US8A 1EQAA 2GK6A 3L8MA 4M9QA 1Y0BA 5EMNA 2M1ZA 3C5HA 5GZ1A 5EIBD 5EZSA 1PG5A 4URWR 2BMDA 2DP4E 4P1ZA 3ENWA 1W46A 3G0CA 1T34A 2QGZA 4NY1A 4OP1A 3SHVA 4R68A 3PFBA 3RK0A 2DB3A 1EKXA 4I6EA 3Q8XB 1IY1A 1OAOC 2G09A 2IPNA 1XKLA 3F1LA 4RCYA 2B8JA 4ZAYA 4S04A 4L8WB 1BIFA 4Z7OB 2VHCA 2HRQA 3GN1A 3A9VA 4L9RA 5GIOE 2BEJA 4E0BA 1FLAA 1SKMA 3TXYA 3G2IA 3LHFA 1UOEA 2Q45A 5C18A 3U3DA 2AUNA 4EW3A 3HCOA 4F38A 1XVVA 1KVTA 1U2RA 3SEAA 1TQ8A 4F56A 4TXJA 4HDRA 3ACDA 4QA9A 2Z0MA 3T6KA 4F4CA 1GGVA 1PKXA 3BIOA 3JU3A 3O0DA 1Z4LA 4BRWA 3O82A 2CNKA 2LNDA 1T36A 2HA5A 2QD1A 4PTLA 5I8PA 2PUDA 1EVIA 1PEAA 2ZRGA 3K0CA 1L5ZA 1Y3AA 1SRQA 1N5DA 2QMEA 3ENZA 3THWA 4D8YA 2E85A 4JWTA 3PQDA 3BZWA 3DYVA 1HOTA 2ID8A 1JYSA 1ZINA 2GTHA 5ALSA 5DRTA 1U9IC 4LK2A 1DJPA 2QK4A 2WTXA 4RGYA 4REMA 2H0RA 3DMRA 4XGIA 2I34A 2XE6A 3GELA 3KQPA 4JYCA 5BT9A 3TTXA 3OE7A 1E2JA 4ER7A 3Q7EA 1G4HA 3NKLA 2BDTA 3IS3A 2HYIC 2OQ2A 4H0FA 1C30A 1A96A 3HXOA 1QR6A 1G8GA 5AVYA 2VSQA 4D41A 3KQUA 4IQGA 5KTMA 3L9XA 5BP7A 1TMKA 3HNOA 2XYGA 5CIWA 1PRYA 5REQA 1EJBA 3OF2A 1RBYA 3N8DA 4LSWA 1WB4A 1IXRC 2RHJA 1YDFA 1UIMA 3LY9A 3FKJA 5CUQA 1SBCA 4EB6A 2I3DA 5GAJA 5EAIA 2BFBA 2QXUA 5AKEA 2BV3A 1YB7A 2DQKA 4DOMA 3FPJA 2XUJA 1XTTA 2RK6A 2I2DA 2V54A 4QASA 4QDUA 5F7ZA 3CWZA 2NVBA 5AVKA 3KQQA 4JVSB 5F7OA 3TNFA 3LHSA 1OH8A 4GS5A 4EY5A 3TBKA 4FDMA 1VG1A 3GA5A 1Z0IA 13PKA 1J39A 2A14A 2BEWB 4D4HA 4OXRA 5HZGA 3O8OA 2DLDA 3GJ5A 2AQKA 3DH0A 4JKYA 4WAUA 5AHKA 4YP1A 3NMUF 3L92A 3UXHA 1Y1SA 3EF0A 1JHVA 1DOAA 1E3JA 5DISB 4GP9A 3I9V1 2ZRPA 4AAYA 1FIUA 3EOAI 4RANA 5JXIA 2PZ8A 3FF4A 2AQIA 2Y9PB 1XPRA 1G5QA 2YFYA 3BFXA 5JCOA 3TLEA 1W19A 1EM8A 3SJUA 3NBMA 4GZ5A 2ZS7A 5F2EA 1FCJA 4W9NC 5AJTA 1V8OA 4J7XA 4JP5A 1FF9A 2HCTA 4IJMA 1S8FA 4BLQA 4QBKA 3ODPA 5U4XA 5M29A 4OLAA 3HS3A 1BOFA 5E3IA 3OQ1A 4IX1A 3HJAA 3GAFA 5CW2A 3ZY6A 3VNAA 3EXG1 4QVGA 4MUMA 4IWXA 4PYLA 1P39A 4NCJA 1B0PA 4ZCQA 1YHYA 2RCYA 1V3QE 1QRDA 4I55A 2ZIFA 3RJ9A 3ZDAA 2IODA 3M8KA 3DXFA 1HT0A 3OFSA 1DWPA 4MKRA 4BLOA 4F7WA 5M7EA 4W5QA 1CUAA 3NWPA 4HB0A 3H6HA 2D1YA 5KO2A 2ZUEA 1D5CA 4JR2A 2WJ3A 3B85A 2NUAB 4CG3A 4G0YA 1SQSA 4YT5A 3G8BA 5GINE 4JGGA 3NAGA 3PEUA 2HCBA 4FHDA 2FSUA 3TEMA 4D4LA 5L7TA 1E7SA 3WRYA 2BFCB 4KG7A 2XUDA 4UHEA 1HLPA 2NO9A 2AWOA 3ZIAD 4AF6A 3IOYA 4YMWA 1KSGA 5AUOB 5B2EA 3CSDA 3CY6A 4V0KA 1ZGCA 2GFIA 4QIHA 1HDEA 3LV8A 1DFIA 3EVZA 2NSDA 3W7BA 3FPHA 1U8FO 2Y0DA 3AKCA 4Q15A 1UQUA 3ZLVA 2WWTA 1KAMA 4KITB 5GY7A 3GFBA 2WU0A 5BNIA 5JSZB 4ZRDA 5DJ5A 1S9DA 2AR0A 1WM1A 4G0MA 4TMKA 4AF8A 4D4MA 3QX7A 2F9FA 3KX2A 2CE2X 4QTXA 2J07A 3I2YX 1E60A 4QQ8A 5T67A 3KHSA 1KQNA 5HDBB 3K1YA 4EGQA 4ABTA 1VCMA 3AHEA 3V2GA 2XYPA 5C34B 4DLYA 5EINA 3ROKA 2QUKA 3FR7A 3CUKA 5EOVA 5EERA 3K71B 1ULUA 3ZWWA 3K72B 5JPIA 1K2VN 5KNBH 1ETUA 4AK9A 5TT0A 4L5CA 4JASB 3I34X 1NVDA 4TS9A 3MMZA 2VF7A 2EGUA 1Y4DE 5DW3A 1ZA2A 2DC1A 2NVWA 4AS2A 1TX4B 4Z0TA 1CRLA 4WLNA 4H1UA 2XXBA 3DTVD 4RS4A 4U9HS 2QX4A 4GL4A 5AJYA 3AHDA 3O83A 3IELA 2QN2A 3GB9A 4B0PA 5K0GA 3LTNC 3N3AC 1M34E 1KYTA 3BDVA 2POQX 3SFVA 1U0HC 4Q3KA 5E9WA 3AL3A 3U13A 4D81A 1WXQA 2IYSA 1EVYA 1XDZA 3L7AA 3NYQA 3O1HB 4PBRA 2NVUA 5JYDA 3ONDA 1AXEA 2F9MA 3AUXA 1L6RA 3GGDA 5BSWA 1XZJA 3R8FA 2PMCA 2P4SA 4LNUB 5LP6A 4FFDA 1SB9A 1BKSB 4K9SA 2I2AA 1X77A 4P7FA 4B2LA 2HAEA 1KNXA 3DEFA 3IP3A 4YRIA 2ZRKA 1QMGA 3UY4A 3TN7A 3C3WA 2FEAA 1KFCB 2Z58A 3BIFA 4KFSA 4TQAA 5HKBA 5IBCA 1G4UR 1TRKA 3A1DA 5JZSA 1ZM2A 3HB9A 3UT6A 2XUOA 3SQMA 3T1HB 2OAP1 2Z6QA 3TOCA 1JP7A 5L4SA 1K27A 3B9BA 4JB2A 1B16A 4QUBA 4TKVB 1EP2B 1ENOA 4WPGA 5KDLA 3R9WA 5J2TA 3N2EA 1PQUA 3DKVA 4MI9A 3B78A 4AB1A 2HLPA 3H04A 5L4LA 3QEOA 1DB3A 1SPBS 3PFHA 4LSZA 4M9SA 4TXLA 1KMCA 3ZI4A 2XB8A 4WK0B 1HYQA 2I55A 3M49A 1T13A 5LBTA 1F2TB 4YPFA 1PE0A 1NFQA 4WUTA 4DQKA 1LK7A 2JI6A 3T1YB 4EG3A 1QGED 1QNFA 1XE3A 1ZKDA 1T10A 2H3EA 2ZB8A 2WVAA 1U0FA 4D26A 2ZXUA 2HCFA 1O4WA 4RSHA 2A1IA 1T3SA 4ZVSA 3A2LA 2XODA 1HRDA 1L5GB 3WWEA 2LDBA 4BJHB 3FMGA 2IE0A 4N0EA 4PTYA 4GMHA 4NU6A 2IIBA 1HTWA 3U0VA 3NTQA 3LL7A 1LVUA 4DG9A 521PA 2EDAA 2N47A 4OGKA 1QWOA 1IPHA 3PFCA 2BTEA 1AB5A 5DI3B 1BDHA 1F2VA 3GRRA 5I4KA 3KO8A 4WIAA 3U7HB 1IZZA 1GFIA 2NU7B 2GD6A 3LT5A 4LBWA 1YB5A 3OIDA 4CYMA 4N8SA 4ZMSA 5BMOA 4UHFA 4PHGA 1XO1A 2QTHA 2HX1A 3NHYA 3W8NA 5EHIA 2VP4A 1PK9A 1CUFA 3BGVA 3NHSA 4OL0A 2NO0A 4KRXA 1Q92A 1XTIA 3OSUA 4TQUS 4X3OA 1J0AA 3U0BA 1GM5A 2V5UA 3N6XA 1JA9A 3J81k 1ZN7A 3DP9A 1XROA 4FHEA 4O4JF 3QMMA 1D9XA 1QYWA 4BIIA 4CUJA 1A0OA 3I83A 3WQHA 5L53A 2O8VA 4CV3A 3JAWA 1VP9A 4RHEA 2GAJA 2W93A 2C94A 2RB5A 3QPCA 3EOBI 4DEYA 2XMBA 2VRNA 3HFGA 3RE1A 3G9XA 3S68A 3P7MA 4MYSA 2DEUA 2R1TA 1OI2A 2QM0A 3GA0A 4UQOA 3H2JA 3DZHA 3W6PA 5A03A 2WD8A 3PP8A 5NULA 4WOPA 2CUTA 2YRWA 3K9WA 3IPRA 4JT2A 3L1UA 3CRNA 2H9AA 3U3KA 3U4QB 1KETA 1VRVA 4G4JA 4BO4A 5BQ3A 1W4RA 3RT7A 1XMOB 4FEAA 1N6LA 3DFKA 3GMIA 4LV6A 4J3NA 9MHTA 1CE8A 2V7EA 2JG3A 1BX3A 2X19A 5A5VA 1J2JA 2DMRA 2JGNA 3NOXA 2B4AA 3S8EA 2DBZA 3SN6A 1FSGA 4OKIA 4JQSA 1Y3FE 4YGYA 4HLUC 1TUBB 3KJGA 2ONKA 3SF8B 1GU0A 2IHBA 2X0FA 2CHGA 1JFLA 1Z08A 2BWJA 4TT3D 3TR5A 1XD2B 1P5ZB 2COUA 1Z83A 2FSGA 5G40A 3P2KA 5I4BA 1NDHA 2G9ZA 3MPOA 1SUPA 1W4ZA 1BQEA 4CVNA 1J2YA 4MRAA 1NPYA 1NKTA 2HREA 3RRZA 4I5FA 4HNRA 3LK6A 2XE8A 1PJSA 2QBYB 3BB3A 9ABPA 3CLSC 5IKPA 3C7AA 4ZO9A 3D3QA 1NLYA 1NF2A 4AJIA 2MIIA 5KINB 3ED1A 1MZPA 3MUNA 1NF3A 2OHJA 3GHHA 2BI7A 5KQPA 3F5SA 1RTKA 2GTIA 1M7GA 3AB7A 4CMIB 5EHQA 4DILA 3JR3A 1Y98A 4PQGA 3K0AB 5J9FA 2I9KA 2RJ3A 1VL8A 1ADCA 1ZGBA 4YRSA 5IT4A 1VP3A 4D0LB 4UDOA 4DE5A 1TTPB 2GAIA 2NW6A 1SJ9A 2ORWA 1GPAA 4E6EA 3N74A 4BVLA 1R6TA 3V7UA 3FI0A 1SN7A 1XMXA 2J7PA 1KO1A 2GCIA 2XYVA 4F5DA 1QO0A 5HKOA 1YL6A 5C1PA 3AXSA 3OP1A 1ZN2A 1GZHB 1JLLA 3E3NA 2DSNA 3NHLA 5FTMA 2W6CX 4G25A 1FUKA 5FNVA 4IL5A 2EQ5A 4P8RA 4H77A 4ARBA 2C57A 5D51S 2NP6A 4LJLA 2HWUA 1NW9B 3O3OB 4U6NA 3T3HA 3QU2A 5LQNA 2D6FA 1Y3HA 1IQRA 3C6KA 5B36A 1G4AE 1OFUX 4KGVA 4Y2TA 5COBA 1GTJ1 1EE9A 5DTEA 2VDOB 2B99A 3DBRA 3ROEA 1KMMA 1U90A 2H85A 3BS4A 3EC2A 1DQPA 1PHRA 1R9GA 2GHIA 2RGAA 4HEHA 4NFSA 5GWXA 3VDMA 4E51A 3QM1A 4K8OA 1FMTA 3PCTA 1GPJA 4CKWA 2YFKA 2W2QA 4CKBA 5CFMA 3HA3A 2B92A 3GT4A 3V4RA 3JZDA 3OZDA 3B1VA 4GLFA 3LYAA 3PNSA 3JQCA 1ENZA 1NKSA 1ZHFA 1R4AA 1T3GA 2X6QA 3ILXA 3JQAA 3L6DA 4NDNE 3PBKA 3TKYA 1SC4A 3VZRA 2IOQA 3HBJA 4IJQA 4ND6A 4WKBA 2EVWX 1NVBA 3ROMA 4AO7A 1PL7A 4MI6A 1QPBA 3IKVA 3RROA 1MB0A 1Q6YA 3ES9A 1WCIB 1STOA 2AFIB 2PS3A 2Z4SA 4HS4A 1WBDA 2AMVA 2HSWA 1RACA 2B2NA 4BU1A 2GZ2A 3FCCA 4RBNA 1KBOA 3RHFA 1FX1A 1L5SA 1FJ2A 2AHRA 2QN3A 5EMJA 5INTA 4Z53A 2JFPA 1PGOA 3PXXA 5GPBA 4US2R 3B6IA 1M6WA 3UEOA 1F0KA 3DMNA 5L3SA 3LWZA 1M2VA 2GZRA 3DHWC 4NYJR 5BPFA 3QEAZ 5ARCA 4URZR 3TCKA 3DWGA 3NHFA 3DBIA 4RDCA 4PYQA 4J49A 3TGLA 4BVHA 4R1UA 3FOEC 5TE9A 3V9PA 1VKNA 1SBHA 2F55A 4LZAA 3KOWA 2MMGA 4P86A 2JASA 3CGWA 1OGYA 4LA4A 4MV4A 4QGSA 2YXDA 1WXHA 4WTOA 1KAGA 4A0QA 1XQ6A 1QX3A 3L8YA 2XX3A 3I5AA 3AVTA 1G20A 2JD0A 3CISA 2DHEA 4DB4A 5C7IO 4P31A 5JVDB 5C51B 4KW7A 2HJRA 4N0PA 1D1QA 3QLVA 1DQSA 4CBVA 4EH1A 1KQGA 5G02A 4BO7A 2VJMB 5HW0A 1NJGA 3WGHA 5BNZA 2ZT7A 3V1UA 4Y9UA 1L7PA 4XH9B 3B6JA 3KJQA 3KP1A 5EUBA 3RB8A 5C2JB 4EG6A 4DIMA 3ANXA 4AROA 4RDXA 5HIAA 4GC5A 5IG2A 4MQMA 1HEYA 2G08A 1CVRA 1OUMA 2OZEA 4MCIA 4WBXC 4XYLA 4PXAA 4F1WA 4RXUA 4YY3B 1W5TA 1FC0A 1KL7A 1P9LA 1UMBA 3R77A 1TA0A 2VSYA 3QVTA 3JXEA 4H7FA 4YJ3A 1ESZA 2FW9A 3BDAA 3LKBA 4Y6QA 3ZDQA 2P2ZA 2V8BA 1XRJA 5COAA 1TVKB 2REOA 4BFTA 4HB3A 1JIKA 2UYQA 1GRVA 3M1YA 1YZ3A 2KE5A 1K9SA 2YWDA 4EDHA 3NG1A 4DTIA 4KREA 1IBRA 3HU3A 3LQQA 4GX0A 5EXXA 3K30A 4KBGA 1PZXA 2JANA 3IAM1 4PZYA 5LD2C 1VYTA 5JAMA 2NPOA 1F2DA 1PLLA 3R24A 2BKLA 3Q8WA 1X7YA 1O0SA 3KPJA 3Q1LA 4RQBA 5DNVA 1W0KA 5AVTA 3VR0A 3H6KA 3TEFA 3EYAA 3LXMA 2FZ4A 3X2FA 4OXKA 3VC2A 2JVKA 2H52A 5HJ2A 4E3WA 2QL9A 2FSHA 2CMDA 2WMYA 3CO0S 3G0BA 1P8JA 1OR8A 1U2PA 2BD0A 4ONEA 1T6BY 1PR9A 4KSYA 2JFXA 3L84A 4Z4QA 1F8UA 5ILGA 1E61A 3MJEA 4JA2A 4L57A 1MG5A 1A04A 3CZ5A 3OD1A 1Y6ZA 3P94A 2Q1TA 3N9IA 1JXAA 4HGYA 4ZRNA 2WF6A 1CVIA 4ZJYA 1PR2A 4LHSA 3COYA 1AUOA 4Y98A 4FR2A 4HX5A 4TWZA 4DYDA 3W9BA 2VUHB 4F60A 1P1FA 4MR9A 3RUIA 3HBLA 3ZCRA 5ALVA 1E63A 1W2GA 1I94B 1NQ5A 2IPLA 3CRRA 5F5NA 3EW9A 3IIIA 3DVAB 3IURA 4N3NA 4GYJA 2O59A 1T4CA 4EARA 3VKVA 1YFKA 5DHFA 1BVUA 1YDEA 5P8WA 3U44A 3OE5A 2ETVA 1H0KA 5IAEA 4B0OA 2GLTA 3D8TA 5BNTA 3WLTA 3K32A 1UXKA 4XVCA 1KEPA 1PFVA 1SCDA 3FCYA 1XFAA 3L49A 1WCXA 2LIVA 1VM6A 1ZH6A 4ALJA 1ZISA 4BE7B 1G6KA 2VA8A 1DTEA 1ZIXA 2FG5A 1JIQA 1NY5A 4NIMA 4FFBA 4UJ3A 1UXJA 1Z82A 2C2ZA 3U9SA 5IT9A 2HCRA 3GLHA 2AXNA 2CVQA 1NR1A 1FMJA 1MX9A 1RWPA 2GEDA 2FX5A 1VZ3A 4UJ5A 4Z3KA 1J5EB 1MMFB 3WL6A 1QK3A 3R0VA 4OHWA 2PLRA 5K3FA 3F7OA 1U3GA 1XAJA 4ZOEA 3INNA 3GROA 1UXGA 2RIRA 3JWGA 4MS1B 3L82B 5ALUA 3RQIA 4MR7A 4AMZA 1W36C 2V03A 1JQDA 2C2YA 4LRSB 4CM9A 3A70A 4HQOA 2CZGA 4QHYA 2B9VA 4DLNA 4GM1A 4XRGA 1LNSA 4I08A 3C45A 5T41A 4X71A 4B33A 4UM7A 3RRXA 5L7YA 3RI3A 2GZSA 3BTVA 1GUBA 3KG2A 4ZEOA 4DDHA 2BFMA 3FY4A 4XQCA 4Q1FA 4EHFA 1DJQA 4KE9A 5CB4A 3RS3A 1MAWA 3B8HA 1FNNA 1NX9A 1HLDA 5J59A 4EHJA 4QEDA 5FLYA 2OWEA 3D43A 3PQ5A 4GR5A 5BUSA 1U2SA 3D02A 2C7QA 1RJ9A 1CUEA 2IOYA 2X76A 1Y1KE 5TARA 3SLKA 5JAUA 2I4OA 3TVTA 5F9HA 1PL0A 5BSEA 4QKQA 3OOWA 4FOLA 4WJKB 2ZT5A 4MP3A 4IIGA 3VYTB 1ISJA 1YCGA 4EPVA 1GU1A 3ZVLA 1N5KA 1L8QA 2YY6A 1Z9BA 4JHXA 2BMVA 1D0SA 3W9UA 4LZJA 4YAGA 4ETNA 1CEYA 4I4LA 4R2XA 3K0BA 3AFOA 1OGJA 3EGDA 4OG2A 2DCUA 4UD6A 3OM0A 3FCAA 3W5IA 4CLOB 4V1CI 4LVUA 2ZZMA 5J58A 3NT5A 3QUSA 3DKRA 4JD5A 1T2UA 5EZ5A 4O5AA 2OCPA 3GZTB 4JBNA 1WOYA 5EPUA 5B58C 1LB1B 3MBIA 3NUGA 4ENRA 1G98A 2QI9F 3KSZO 2VYQA 2FU5C 2ZR0A 4KK3A 4L4YA 4KQKA 1XPJA 4W63A 4U7WA 1ZHOA 4ND5A 4DUPA 3OOSA 2J9GA 4PLYA 4EB3A 3F47A 2C82A 3OZAA 1UZUA 2PLNA 5FPTA 3JYHA 4MLCA 1HWYA 2AKAB 4TKLA 2ZIGA 1NMEA 1JL3A 1YRYE 1BEZA 3R0IA 1A9ZA 1XZHA 2SHKA 3MS7A 2P9YA 3PR3A 5FR1A 3DWFA 1T8PA 5G0UA 3JQFA 5HF8A 4A8TA 2PCJA 3I1FA 4AG5A 1UOOA 2G82A 3ZY5A 4LF9B 2EZ9A 4RWEA 3KIPA 3RT9A 4BZQA 2H1IA 1Y7LA 5C4MA 4IGFA 1DWOA 1BS9A 1YRWA 1FTQA 2WYUA 4JBXA 4BFVA 3OTOB 2ZCJA 1LDGA 1PNVA 2QGNA 3DS8A 2KMLA 3F97A 3PE3A 4NBTA 2IYQA 4IH9A 1NIPA 4QUKA 5TR9A 3SYNA 1V4BA 4C01A 2J85A 1YVEI 4PWZA 5FA5A 2C5GA 4AJEA 3DYBA 2XUGA 4B7CA 4K9DA 1Z07A 3AF4A 4DQ0A 2FP3A 4A15A 2IV2X 3TUJC 2CXOA 4GPAA 5AQ1A 3HYSA 3USCS 4OSOA 2II6A 3H9GA 2EJBA 3QBVA 4U8GA 1IMOA 1SELA 3OLXA 3NV9A 3N53A 5DBGA 1BO6A 1HG0A 4BLUA 4C4XA 1QFSA 1BS2A 5E8JA 4PGHA 1GUFA 4TZ0A 3OHPA 4MWSA 4CIYA 1Y48E 3PNQA 1ZESA 4R1SA 1KDYA 3LO8A 3FX2A 2IHYA 2PZFA 3UXMA 3J7AC 1A9QA 2PX5A 1NF9A 3K0KA 4MGZR 3ZH9B 1LLUA 3NYIA 4K26A 1VPDA 1P1CA 4ZV7A 2GEUA 4K6MA 3P9IA 3UXEA 2E49A 4IWYA 2BM0A 4JAVC 9LDTA 5JVDA 3ZDDA 1WMFA 1HZJA 2WUDA 3BXFA 3GU3A 4J07A 4GSLA 4RV9A 3HUFA 4EENA 3QYFA 3WO0A 4F8EA 2IUSA 4HQFA 4LJ5A 5DYTA 1MV8A 1G0OA 1GLNA 3CW2A 1I7NA 1ONBA 1WU8A 1G9SA 2Y4NA 3EGCA 1JHXA 1JZTA 4MVJI 5E6UA 1R15A 3U49A 3ZX5A 4A0HA 4KDRA 5T57A 4AP5A 3NDIA 1J0CA 2HK7A 2GSWA 5JRZA 2XIQA 1T3HA 4U2BA 4ZHQF 2C03A 1OBCA 2RKWA 1ZVQA 2YJGA 4E5SA 4PICA 2W2KB 4UFOA 5HM8A 2R1VA 1GTL1 3N2GB 3EF3A 2YXEA 1ORWA 4KQGA 3WC4A 1X7ZB 3EPHA 2GSDA 2YCBA 4MAFA 3EGXB 5ESXA 2ZRDA 2IVZA 1NG1A 3CUVA 2NU9B 5TEWA 2CGEA 1E2LA 3A1EA 4ZQIA 4ZYWA 3LC7O 2CZQA 5B55A 4G67A 3DMTA 3TINA 3WDMA 4WKCA 3CUEF 2WVJA 1XEWX 3F8WA 4CQMB 2PGDA 2IEAA 4MUNA 4PFSA 4Q4AB 3PQ4A 1I7LA 4WBNB 2QTLA 2ZRLA 1L8AA 3BD6A 3QJGA 2FN4A 2O0MA 3N7TA 4I14A 3GXOA 1E32A 1Z0SA 1XCLA 2FK7A 4JCCA 3WYAA 4IF4A 4DM7A 3OT1A 2H1HA 2QV7A 2NN3C 2OHHA 4BFYA 2CCKA 4D5GA 5LNK6 4JIGA 3L41A 3Q8MA 1JFRA 3EZ9A 1EESA 2NTEA 3I1JA 1R5OA 3JX9A 4PYKA 3RVKA 1RHJA 4RFSB 3QE4A 4ZTZB 3H5TA 4DCVA 2V74B 3DTVB 2CV1A 4KTVE 4DSOA 5H4GA 5HIKA 5FPQA 3A9WA 5C8YF 4G0PA 3DHNA 1X8KA 1NBOA 4JNCA 4LZNA 1XD9A 1TTQB 5ES3A 1TFRA 3HU1A 2JAOA 3ANMA 2VQ3A 4QXQA 1EVQA 2CUNA 2INGX 3Q0TA 2A0WA 4CIDA 2E1RA 2OFPA 4F6RA 2VAWA 1VE6A 3BQNB 4TTQA 4HPXB 1IJKA 2IX9A 3SHTA 2A9QA 2DFKB 4DQVA 4YRTA 1LUAA 2D1RA 3WJAA 3OZGA 1JHRA 2PRKA 3ANYB 3JY6A 1WXEA 3V2HA 1EUCA 1B3BA 3PT5A 1NVGA 2ZTVA 4RC9A 1IIRA 1WEHA 1XQVA 4Q4DA 4YR7A 3LCMA 1XEAA 3HXLA 4FOSA 4XUGB 1Z12A 2PYIA 4UD2A 5CT5A 5IAJA 1UBTS 1XMIA 2PGAA 5LYJF 1R6UA 4QYWA 1KA9H 2IZZA 2AFHB 4D9JA 3EXIB 3L05A 1Q15A 3IA2A 5T6BA 4RPCA 2IU0A 2ZRMA 1EXVA 8MHTA 1C5KA 3WOVA 4MJXA 1E89A 2XQGA 4C7JA 3P0IA 3HZZA 1UBRS 3NBXX 3SJZA 4Q5IA 5A04A 1Q0RA 4LGYA 3MMNA 3WV5A 3E2PA 1R6AA 4K28A 2QRQA 1DRWA 1I80A 1N3YA 3UMMA 1U8CB 2F64A 2CL6X 2DECA 4IDPA 3GDHA 3QMWA 4CMBA 2IFTA 1UBMS 2J5KA 2WE7A 1NU8A 5FUWA 1CNMA 2A58A 2IYFA 2XUAA 3BA6A 1GADO 2I5PO 5CG1A 2A4MA 5DDIP 4UBKA 4CR7A 3DG9A 2WTAA 1OFHA 1WHTA 1WKVA 4PEVA 1WW3A 4WFIA 1E3TA 4HH1A 5KMGA 4G1MB 2R4UA 4PG5A 3KETA 2FP4B 3U1BA 1ZVJA 3TTUA 4MX8A 2MSLA 3EQ2A 2Q1SA 2WJ4A 4LF7B 1LSJA 4ERNA 1GNQA 1Z56C 3EAGA 3N2NA 2I67A 1QLWA 4ZCIA 1OFIA 2VSFA 1QOZA 3JR7A 4O4LF 5JXGA 1PJ4A 2FQYA 1CIJA 1I0IA 3QU7A 3HDQA 4R9VA 1C3EA 4EPTA 4YUWA 2RHMA 1U3DA 3RYCB 4GBED 4Z49A 5BRJA 4GEGA 5E9JA 1ZNZA 1SZPA 3FWKA 1CR1A 4ND7A 1H5UA 1J9EA 4QDOA 3URKA 1S2NA 5FD8A 5A5EA 3I8SA 5B12A 5L3QB 1CRWG 2ODBA 2WAYA 1QVWA 2EQAA 2R6R1 1WF3A 2HUPA 3R76A 1EG2A 5JS7A 1OILA 2XAUA 2XNDD 1ZNYA 3IBSA 1MA3A 1HT3A 1RCFA 1YOVB 5E0KB 4IG9A 4D1YA 1JG7A 3GFRA 2B1QA 4HAIA 1ODIA 4LJ9A 4MQEB 1OXXK 3T15A 1AO0A 3QI7A 3GLIA 3AG6A 3GVCA 1QQBA 4HDSA 5CEFA 3VNSA 1MR3F 3QFRA 4ML3A 4RV4A 4EUNA 4HVCA 5HCUA 2X8BA 4MYDA 1EPUA 4C3OB 5E4JA 4KIGA 1QZ3A 3N28A 1YBMA 5SYAA 3E3OA 4QTZA 4ZYLA 3H7IA 1SZCA 4QOHA 4BLPA 1SH7A 2O4CA 1PWYE 2RONA 3DOOA 1X9GA 1NQWA 1P4AA 1T2EA 2QN7A 3CH6A 1PG2A 2RAPA 3C8UA 2YJ3A 4BECA 3BMOB 3CVXA 3ILVA 4XM2A 3HEMA 2B82A 4X54A 3S0JA 1BCRA 5K0ZA 1NI4A 1SKYB 2D5CA 2RGCA 1DEOA 4JLDA 3GJXC 5DHSA 2XTZA 4OQMA 1OXVA 3D81A 3G7NA 1NHGA 2YZMA 3GNQA 3I4CA 1UBEA 3IAEA 4MVCA 4NULA 4QU9A 1K6IA 1HL3A 2O2XA 5ITWA 3PF9A 2P9TA 2R47A 1C0PA 4DIBA 1A4RA 4MPTA 1H8ED 5EWJB 3LC0A 1OKKA 1G20E 3G5LA 2IL1A 3RRMA 5KOIA 9LDBA 2J6HA 4EG7A 3AEKA 2Q0QA 2H63A 4MV8A 1GPYA 1VHLA 2HSEA 1JGTA 4R7GA 1NVKA 1IUPA 4P5PA 2C1ZA 3B53X 4LY0A 3Q11A 1TFUA 2XR1A 2ZB2A 3LCJA 2QAGC 3RADC 1J0EA 3IBFA 3E8XA 1TQDA 4JLVA 3R4VA 1KJWA 5K8TA 2IF0A 2JIOA 4QAQA 3C6XA 4WD3A 1ISIA 3BL6A 1QYVA 5KTSA 4DV4B 1V1JA 4JOSA 5AVWA 3FMOB 3TWOA 1W85A 5AK3A 1QGUB 2YOGA 3BE5A 3R4CA 1AZLA 2BFNA 1DC3A 4HDNB 4BGEA 4BNZA 2JZNA 5F1PA 1PTJA 3U7JA 3PX7A 2R84A 1JXOA 3DZ8A 4NMXB 4PX9A 5KWVA 2O8CB 3N2KA 1QTRA 3N7UA 4JFAA 3RK4A 2O8FA 4ZCPA 5EIXA 4I3FA 3DLTA 3MJFA 4IOKA 1DSSG 1NP6A 3RSZA 4OB7A 4EEZA 1LPBB 1EFVB 3F46A 4ZC1A 1QDEA 3QKRB 5I7RA 3PE4A 1R64A 1E9VA 2ONZA 3X0DA 1V1MB 2Y27A 5TPWA 4S3MA 2R00C 5HILA 2V6JA 4RK5A 1LQTA 1M1YB 1U3CA 3O1JC 2JLAA 1XU9A 2FDXA 4KJZA 3F4BA 4MWDA 5KNBD 2QSUA 4HAVA 1ZD5A 2A0YA 4B75A 4RM3A 4HNQA 3U7IA 2XQKA 5LJLA 3TX2A 4GOJA 2OOKA 3QQPA 4NX2A 4TQGA 1DDGA 2A1UA 4BXOB 2E4VA 1J5XA 1DIAA 4HRVA 1TVEA 3DE0X 2WLSA 5EIHA 3KV3O 1EJ6A 1AS0A 2EL7A 4RHFA 4YYEA 4QDKA 1YZKA 1BGVA 1E0KA 2NMVA 2DWOA 5THQA 4LIPD 2L0XA 2YVQA 1ODTC 1X1QA 5T8KC 3TLBA 4BLTA 2XITA 2SICE 1BMDA 3ECSA 3NXSA 1B1AA 2XD9A 4U2CA 2VDNB 1Y3IA 4YT4A 3ZQ4A 2JIZA 3M89A 2ZS9A 3PV0A 3CR3C 4Y9DA 5B30A 3G1WA 2SCUA 4NG5A 3WGJA 1GN9A 4U8HA 3A4IA 5KTNA 3T7TA 4DR3B 3G8DA 3MTDA 3AERB 5JSKA 1LC0A 1E9DA 3E9CA 4LMRA 1N1GA 3OHSX 1XRMA 3NC1C 3WAGA 2E37A 1N4DA 2G0TA 1M6VA 4L27A 2REXB 1G8FA 1IXSB 1HI9A 3P9NA 4J3JA 2VTEA 2EX4A 1CG6A 2ZR8A 4NMLA 1WNFA 4I9HA 5DPMA 3VC3A 5J2UF 3ANLA 4U7GA 4B6QA 1EMDA 3EPJA 5TMPA 2B98A 2ZYVX 1GQRA 4UCQA 4DWWA 1A9XA 1YV9A 3D5QA 3HDHA 1EWQA 2O8BB 2R8OA 3GLHE 1TT7A 4CKEA 4Q24A 2QIPA 1J2EA 5EWLB 7YASA 4DDVA 3T9DA 3DZKA 5LMUB 3PWSA 1AU9A 4NEGA 1LX6A 3OEED 4ZQBA 3N2IA 4D9KA 2C92A 5DULA 4OB8A 2XF8A 3UFXB 4IOLA 1E5VA 5D85A 1V26A 3NNSA 4YP7A 3MJHA 5F7XA 3STYA 4LXIA 3VHXA 2MSEB 5K8IA 2QVCA 4NBLA 2NU8A 2VRCA 3JTMA 4CLOA 4RK7A 1C2TA 4D99A 4OUKX 1W96A 2JIQA 3OF5A 1OFUA 1JB9A 2P8SA 2DWUA 2VL7A 2WFMA 4LY9A 1LKZA 5A9SB 1JG4A 4KNYA 3GVIA 3JAKB 2O2HA 3FZEA 3I8OA 1ESCA 2QN9A 1QVZA 3KLMX 2XXJA 3BMXA 2O52A 1ZJ6A 2IDZA 2IKSA 3HGMA 3HKCA 2ONCA 2WM2A 4FUTA 4H1HA 3K0SA 3V2UA 2HQBA 2P9BA 5DCYA 1XVAA 2PFKA 3OFJA 3T34A 2Y77A 4YUXA 1Z47A 1NAHA 4LW8A 4LXQA 1VXRA 4R3UC 1U7ZA 3G82C 4UVIA 4FCCA 5E4YA 1JHPA 1OV6A 3MWKA 2O1SA 1YR6A 3HM2A 3DZGA 3EDQA 4FYYA 3RKSA 1TCAA 1NQOA 2A30A 4P4SA 1LFAA 4LISA 4POOA 2Q2WA 4HWPA 6REQA 3E15A 4G5OA 1V9SA 4RE5A 5TQJA 3I5MA 2ZSUA 3KR2A 4MIKA 4O4LB 5MN4A 4ATNA 4IJWA 1SB8A 4O8CA 5DOVA 2QAJA 2P6OA 1UUFA 1Y80A 4PZPA 2GBIA 2GH1A 3GRAA 3S28A 1QRSA 4FW9A 2XUHA 1EWYA 4KYTA 4EHHA 4EPXA 5EZYA 4OX9B 1OWMA 1JQ5A 2DERA 2REQB 2JCVA 1YS1X 2D8MA 4P93A 1N6OA 1L5HB 3UGQA 1ZEJA 3EAQA 3ZCXA 4HEA6 2CHVA 2FWIA 3BDIA 3IDAA 1BW9A 3AR6A 4CEHA 1AKEA 1H2HA 2AN9A 2A1TR 1V5WA 4RY9A 1Z5NA 2W2LA 2WOOA 5DEIA 3EZYA 3W5HA 3N0XA 2QQEA 4Y1FA 3NVAA 3KK0A 1E98A 1UK9A 3I92A 1J7KA 3MJCA 4G56A 4R8VA 4WKNA 1XXHA 1YIAA 3QKIA 2XJ9A 4M0KA 4WXYB 4D42A 5CB8A 2AE1A 2PT5A 5CA0F 4JJAA 5EHNA 2XNKA 2RK4A 1OLXB 6LDHA 1ILEA 2PG3A 5HF6A 4XI9A 4E14A 3U1TA 1PFKA 1ZBDA 5JCJA 3WL8A 1SCJA 3W2HA 5ALHA 4O6VA 4CRWB 3ZGYA 3HCRA 1H5NA 3BJEA 1W49A 3PYMA 2YQ4A 3HUEA 4OD0A 4IR7A 1OXUA 1YQUA 4CL2A 3HYRA 1RZVA 4ER6A 1R0WA 1ZGJA 2YVUA 3BSWA 3ZWXA 4CM5A 1CF9A 2WIJA 4B80A 1WEKA 4B76A 3T3EA 1RQGA 4WLVA 4C7MA 2XMPA 2WQ7A 1Q1QA 3GT0A 1WQ1R 2WU4A 5H80A 1XBTA 2C0CA 2E82A 4NYIR 5A7HA 3TM4A 3D3JA 3RTEA 4GEKA 2QMZA 4FKBA 4R81A 1DQRA 4EJ2A 1LEHA 4CUKA 3FSGD 3L6UA 4G0QA 1XLUA 2OXIA 5M5BA 5IJAA 4XSHA 3UAOA 5TPZD 4JJGA 2IYXA 2Z5LA 1OV4A 2O8EB 5BT8A 1GA6A 1XZEA 3GDFA 5JD6A 1XZBA 4OMDA 5TY0A 5B1EA 4DBVO 2J4DA 3R0ZA 5FO1A 1S2LA 1RI1A 3EIFA 1ZCFA 4GQIA 5EJ6A 2MR5A 1C9NA 4UQPA 1SD2A 2OBYA 4EMTA 2XZLA 3PIRA 5FPSA 2BGTA 4FW8A 4BGIA 5LOVA 2RH5A 5CM9C 3GBVA 2PQ2A 4ENWA 2G63A 5C37A 1T24A 5HGJA 2OB1A 5EE9A 5D84A 2Q5CA 2YNMC 3DYIA 4KCGA 1PHPA 3E8SA 1FW8A 2HN9A 3JWEA 3O2JA 1RKUA 3R5JA 1LTQA 4PVDA 3T0IA 3ZJYA 1M1UA 3TOSA 2AJBA 2QTNA 4NG4A 4W1RA 3ZZNA 1XU7A 1SCBA 3CWQA 3W5CA 821PA 1FQKA 4KZKA 5A3JA 4EMUA 1C1HA 4IIJB 4KAAA 1WU7A 3BKWA 2C9DA 3QPAA 4Y6OA 4Q9KA 2Q7XA 1CHNA 5C4GB 3NTRA 4MV3A 4D3XA 1J5PA 4NP6A 4KO8A 1N3IA 3QOXA 1IQ0A 4GLOA 3OPMA 4AJLA 2I3ZA 4EVIA 1IAVA 1NGSA 5E7MA 3EUWA 2IOHA 3TGWA 1T1IA 2B8WA 1KP2A 4EZEA 1QYRA 3B6MA 1TAHA 1Y8ZA 3VX3A 3EEIA 2HWWA 3PQFA 3SPXA 3SKYA 3TIFA 4WNYA 2HWYA 4ZYYA 2QRVA 4DHEA 1Z45A 5CLGA 4RFLA 1JMVA 1GCAA 1XNJA 1Q2XA 1R6DA 3KEQA 3V8MA 4CHTA 1VCOA 1Y7PA 3TR0A 2Y1GA 3IHLA 4YLYA 2C4UA 1E2NA 5CH8A 2XT6A 1AUPA 3OWHA 2WKPA 1HV8A 2Q07A 1Q0UA 1PNQA 2H3HA 2OV1A 4J0GA 1ECLA 3H5WA 4ZT3A 3TMAA 4X60A 3UK7A 3O2QB 1SULA 1F2UB 3ZDCA 4HLCA 1KTIA 4HEJA 4JITA 3AKDA 5A0VA 3WRXC 4F2WA 5ES4B 3B2EA 4IHKA 4GWLA 1X8JA 1TMGE 1CUHA 3P0JA 3V42A 5LLTA 3PJFA 5DM4A 1LLCA 1P1IA 2V98A 1L1RA 4UQLA 5LMCA 4O1IA 4BEJA 3W2EA 4PC7A 1T2DA 4QXAA 1BXGB 2HT6A 5BNWA 3I2FA 3ZHTA 3I4FA 1FY2A 2ZI7A 3CPJB 2BE9A 4GBJA 1EM6A 4QGAA 3UUWA 1KDZA 2PA3A 4GPEA 4GP7A 2QE7A 4Q37A 4KPUB 1VXOA 1HFWA 4GL2A 4OU4A 2GZAA 1QVVA 1Q0TA 1QUEA 4GECA 5LKAA 1AN9A 5BW6B 5HVNA 1Q7BA 3ND7A 4N6OA 5DGXA 1J33A 5A7FA 3WDLA 4Q93A 5LQJA 1D2HA 3LP8A 4NS1A 2C9BA 2G28A 5LWHA 4HKTA 2A0KA 1XNRB 5KZMB 2YHIB 1CS4C 3L6EA 1R1DA 2Y66A 3LQRA 3O90A 4KO3S 1UJBA 2ZJ3A 3B13B 5LA6F 2VATA 1AUQA 1OA1A 2QYSA 3B5IA 4OFZA 3A9TA 4RENA 2EP5A 2YV2A 3W2IA 4RHYA 1Y6QA 4DCMA 2O8DB 4EITA 2H2GA 1P4GA 3AXTA 3QWHA 4N3CA 4QXOA 5T4BA 3VXKA 3WYCA 4BQPA 3KKEA 5A9RA 3IJEB 5DZSA 1MGOA 3DZJA 2FG7C 2YVLA 1WS6A 1E4OA 1I4EB 4R84A 4MYTA 4D8VA 3NVKI 1EGMB 4X1OA 4ILKA 1U1IA 1RP1A 3CRW1 3S3TA 2UUCB 1KH3A 2ZTLA 4MMYB 3ZJUA 5A2QA 3H86A 1V7CA 1RWXA 1AUVA 3LKDA 2XVXA 2BKEA 4BNIA 4B6JA 5L3VA 3M9LA 3ROQA 3WVNA 3OCCA 2BFEB 4KAFA 1WQ3A 5GOZA 3K8YA 2OT3B 3PYXA 5G2OA 3ASVA 2HV8A 3BL8A 3TZBA 4TYYA 4BNWA 4LY3A 5ITZA 3KLNA 3TM5A 4GW3A 4KIWA 5I45A 1WHSA 4J0EA 2Z8ZA 4RD2A 2DX7A 3AIOA 3AP3A 4WCFA 4X61A 1ISHA 3IO5A 3P9KA 4IVPA 4HH3C 4Y6SA 5FA8A 1QH8A 1UR5A 1M66A 4A27A 4QUGA 1OI7A 1YU6A 1AS2A 3U5ZB 2G06A 3HACA 3ZEAA 2N42A 1A8QA 1NT2A 1Q57A 4EF6A 2P3OA 1UT6A 4O2BA 1AMOA 3C2QA 5ERYA 3DDNA 4W5JA 5G1PA 4C0BA 1H93A 1YA6A 4IJ5A 4BVGA 5JALA 1E92A 1GGJA 3PDHA 4YONB 4NDAA 4ZU1X 2XKAA 4LJYA 1BXRB 1Y1PA 2X9QA 2F7SA 2YJ4A 4G85A 1VYHA 1NWCA 1HDCA 4G26A 3DAYA 1VHDA 4KKXB 4II3A 3RYHA 2XZTA 3PXDA 5CT8A 4KIUA 4TTJA 4E94A 1DEKA 3GLIE 5JO0A 3TCXB 4F2PA 1J1IA 1NUHA 2VPPA 3CH7A 3LQFA 5CA0B 4L6CA 4YAIA 4TRJA 5EYPB 1GQOA 5IX8A 3EK2A 2W83A 4YP5A 2QD3A 5AH0A 2BTQA 4RTNA 3FDIA 1Z4KA 2L19A 4RIFA 3CR7A 3TQRA 1WVIA 5LB4A 4ZXPA 4LYHA 1HTBA 1OOEA 5IJ9A 2RGEA 1HF3A 3C6QA 3RUHA 3QVWA 3VISA 3ZW8A 2FRDC 4QTYA 2SKEA 3CEMA 4I4CA 1Q7TA 3O93A 2PAAA 5HOEA 1A9TA 3PHLA 1FW6A 2CNOA 1UPBA 3DLCA 4S2EA 1PI3A 1W44A 4LQDA 3ANNA 4NABA 3IV6A 2C4TA 3I1YA 3SZUA 3LBNA 2XXAB 2WG1A 2XB4A 1E64A 2C2GA 1NNSA 3L4BA 5HPYB 3PGA1 3EHDA 2NSLA 2JGEA 3OTGA 4ENPA 3UC5A 3W5JA 1ATZA 4NI5A 4DLPA 2OHIA 4OQPA 3ZXSA 4F96A 5BW4A 1N7GA 1MJNA 4I9NA 4J9UE 3WLLA 5D2CA 3ER8A 4AQ7A 3C41J 4XLZA 4TGLA 4ZCLA 2BGWA 2PSJA 4ZGWA 5EUMA 1NMSA 1SKQA 3L1JA 3BULA 3CLKA 1AE1A 2R8EA 3EB9A 2X58A 5EXPA 2HLHA 3VJLA 4BYGA 3WFJA 4Q6BA 2PMWB 1AB6A 5DYWA 4ZEMA 2JCBA 5K0EA 3BCSA 2KLBA 4ENVA 2EZ4A 3CF4A 2PR2A 5BV0A 5BV1A 1B6TA 1R8XA 2Q0XA 2GRJA 2VG8A 2QD4A 1IBKB 3OPVA 3T7SA 3L06A 1JSLA 4MMXB 4OXIA 4DQXA 5FDFA 2D5IA 1TM4E 2P6MA 2RI6A 4XDYA 4X92A 1B4DA 3I2KA 5HIMA 3RWOA 3UM9A 3GQVA 4EUSA 3AGPA 5F21A 1LI4A 3CX4A 4H7KA 5DX1A 5F1YA 3ZWYA 1TD1A 3JCZA 1V25A 2QMYA 5IWCA 1I7SB 5K8CA 4BE4A 1FP7A 2CWDA 1J2RA 3RCBA 2GKGA 1E3LA 1R0RE 2J6IA 3A9SA 3CLTC 4LJKA 4O4IB 3QVLA 3AVPA 2OYRA 2NU6B 3KQMA 5L3RA 3AY7A 3CIOA 3ZWDA 3TGPA 5KYWA 3KEMA 5F51A 4W9MC 3U3ZA 3LBIA 3IOMA 2G9RA 3LNCA 1XNHA 2OMEA 4MITA 1U0JA 1KDTA 4LXHA 4FM9A 4U7HA 2L18A 3LPAA 5I9LA 1PG0A 3B48A 5BQ5A 4C6TA 2AC2A 3G8AA 5NLLA 3KTAA 2YXPX 2J3QA 2YMQA 4HX2A 3HJBA 2E6UX 3GCZA 1M8JA 3ZZTA 1VZ2A 2PT9A 2VP0A 3E3MA 3I01A 2CJYA 4GI2A 2Y2VA 3B2NA 4FU0A 4NOJA 5JYCA 2E89A 3LRXA 3M6XA 4IDGA 1EFCA 4IXWA 2P30A 1DAOA 1KK0A 1WP4A 3EXFA 4I46A 5K4GA 3H18A 2Q0SA 4LFBB 4R98A 3IHWA 1K4YA 2R66A 3GARA 3IXQA 2UKDA 3ZWNA 1LJUA 4US1R 1NYRA 1RJWA 1ULSA 1O94C 4NCIA 3SBEA 5HF5A 3RYIB 3A14A 1SIBE 1T0PA 1EK1A 4Q4HA 1HUQA 3T8YA 3NJ8A 2JI8A 1ZWKA 1O9HA 1RFGE 2ACWA 3DOUA 5BOSB 4UXJA 5AI8A 4PQFA 3UMFA 3CLHA 4BAZA 4F9GA 2CLEB 2I9PA 2D74A 2GJ9A 2IS4A 1LH0A 3PUVA 3T4PA 3U5TA 1N5MA 5DV9A 2WQ6A 4KYIB 2UZAA 1M67A 1UZMA 1VJCA 2VXOA 1ISFA 2D1SA 4ZIRA 2YV4A 3NTUA 3VH2A 5HKAA 2Q2QA 5LQDA 3G5TA 3ZV3A 2PWYA 4R71A 1XZ8A 2WKRA 3IEXA 4BO5A 4W5NA 1T5OA 1ADGA 4DMRA 1DRKA 4E5MA 3CF4G 3ZHSA 1T9ZA 1UZNA 2VKTA 2WHPA 3C6ZA 4JH0A 5SY4A 3OMWA 5TVKA 1LK0A 4B44A 4LFAB 2W4IA 4JXJA 3KELA 4HUQA 3WDKA 2R6HA 1JI0A 5BNFA 5BQFA 4EYEA 1H2AS 4JDUA 2YN4A 3M4XA 1K2WA 1RZ3A 2OCXA 3D4PA 3QWAA 4KRGA 3BSSA 4JLPA 1D2AA 2PJZA 1VPVA 4BUJA 1RPTA 5JECA 1MT0A 2DQSA 4M1KA 4IXTA 1TE2A 3DWEX 4YRDA 1E77A 2AUTA 4KQHA 4CF7A 1ID1A 3KQTA 1ULAA 2C7PA 4ASUD 3NOVA 1GZUA 3OCZA 2YW2A 4I4TB 4KU4A 4E5YA 3X1MA 1PJCA 5DXAA 5A71A 4HTFB 4FGSA 1OVGA 3E1KA 4PSCA 3Q3GE 1MW8X 5MGBA 2H17A 1AGNA 2IYOA 1A8HA 3KKPA 3EWNA 3L7NA 3IR7A 4GOXA 1BE6A 2D0OB 2QLLA 1G8JA 1PZMA 3SK0A 3HU2A 3T12A 4QLBA 5JARA 3EG5A 4EQ6A 3MB5A 1TJ4A 3ZPXA 4RH1A 2XWQA 4IEFB 3FMIA 4KGZA 3AFNA 1N2XA 1PR4A 2ODEA 3KE8A 5LLSA 3ZD7A 4AG3A 4JC5A 4MTLA 2C2WA 3K0EA 4N3BA 2HNAA 4HXFB 2CL0X 2XZDA 3ECAA 5ITSA 1Z5VA 2JAPA 3VH1A 2YIJA 4GRIA 2NO4A 3AUAA 3OJOA 4G4GA 1YUMA 2QRJA 1JQAA 2IBMA 3EXHB 3LRTA 4WK6A 4K0KB 4TKUA 4P83A 1RM0A 1KFEB 2OLKA 5D6OA 1M2OA 2QZJA 3PUZA 1PS8A 4YAEA 3U3MA 4DXDA 2XCSB 4IDCA 2LP4Y 1EGQA 3W1WA 2HJWA 3D8UA 3K9LA 4INAA 4CT5A 4HWTA 1DARA 3UJ6A 2BCEA 1GLGA 1XZDA 2Y1DA 4BV9A 4OJMX 3CCFA 1QK5A 2HTFA 3I9NA 4AO6A 5AFSA 5L95A 5AKYA 1HE4A 2QKYA 2WV7A 2E4WA 2X2EA 1XZGA 3FA2A 3MOSA 4YQEA 3QY9A 4WXHA 1JEQA 2JLZA 4DL9A 1R7RA 2V58A 3T9FA 3VZDA 4Z54A 4DR7B 3X1YA 4AUMA 5HP4A 1HNXB 1E7RA 1MX5A 2ZANA 4H7JA 1PSDA 5JZMA 1VRCA 5I4CA 3JD4A 4QQFA 1V16A 3UCXA 4EYGA 3DWIA 2UXCB 4C22A 1JFSA 5ILQA 3GRYA 1NZFA 4BEVA 3KVRA 1OCEA 1VIMA 1XXHE 5IAAA 1UQTA 3KYCB 4X8MA 3WLSA 2XMDA 4KWTA 1TUIA 4QFBA 5TQ0A 2CXRA 3HUTA 3HKDB 3GAMA 4BKUA 3ZWVA 1U9YA 1SZJG 2AN4A 4NPCA 1QPZA 3JZIA 4A6PA 1SXJD 1KHTA 1JR3A 4D0SA 5CX4A 3OI7A 3MGGA 3ZW7A 1W94A 3C3DA 3HDGA 1RXIA 4U9UA 1HGXA 4M1EA 4AKSA 3EXG2 3PDCA 4IO0A 3BM5A 3H1GA 3K5WA <