3EHGA

Crystal structure of the atp-binding domain of desk in complex with atp
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
125
Chain Sequence
GIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQAKTCRVDIQQLWKEVVITVSDDGTFKGEENSFSKGHGLLGMRERLEFANGSLHIDTENGTKLTMAIPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and enzymatic insights into the ATP binding and autophosphorylation mechanism of a sensor histidine kinase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Sensor kinase (YocF protein)
total genus 38
structure length 125
sequence length 125
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3ehgA00
2YE4A 2XX5A 2IOQA 2XDUA 5J71A 4UROA 4XKKA 1Y4SA 2H8MA 1UY7A 5M4KA 1BGQA 4JQLA 4I5SA 4L94A 2XDXA 4KSGA 1UYGA 1Y8NA 3R4OA 4GQTA 4AS9A 4PRVA 3RKZA 2VWCA 4URLA 5M4NA 1I5CA 3VHCA 5L3JA 1AH6A 2O1UA 4BQJA 1MX0A 1S16A 2XK2A 2CCTA 4XC0A 3CGZA 2FYPA 3K60A 3LNUA 3GIGA 4FPPA 2Q8FA 4WUCA 5D6PA 2YE8A 2YGFA 3HEKA 4BIZA 4PU9A 3BMYA 2YEAA 1QZRA 1Z5BA 3EHGA 3NMQA 2YEIA 3HYYA 1UYCA 4V25A 2XJGA 2WI6A 4WUDA 2ZBKB 2FWYA 3IEDA 5CPHA 2YKJA 2YGAA 4CWRA 1YT2A 4XCLA 4LWFA 4YKWA 4ZVIA 3VADA 3VHDA 3Q5JA 4MP2A 1MU5A 4XITA 4GEEA 3B26A 3GIGB 2FXSA 3A0XA 5F3KA 2XX2A 1YERA 3ZXOA 3A0WA 2XJXA 4YKUA 5BOCA 5M4MA 3FT5A 4B6CA 3SL2A 3T1KA 1UYMA 3T10A 2YEBA 3R4NA 1H7SA 2CGFA 4MPCA 3H4LA 4O07A 3U2KA 3TTZA 4KQVA 3EKOA 2BTZA 4FMTA 3G7BA 1YSZA 1AM1A 1H7UA 1BXDA 1YC4A 3U67A 2C2AA 1YSRA 4ZKIA 3EHHA 1YESA 4R3AA 1NHJA 1BKNA 1KZNA 1BYQA 2YE9A 1YT1A 1TBWA 3FT8A 4HYMA 4EFTA 4XD8A 4EMVA 2YJWA 3ZKDA 1I58A 1UY6A 4H7QA 4E02A 1EI1A 3GIFA 1AJ6A 3A0RA 4ASBA 4JASA 1JM6A 3C0EA 3TZ2A 1TC0A 4L8ZA 4MPNA 4P7AA 4AWQA 2YE3A 4EEHA 1PVGA 3CRKA 4LWGA 5FNDA 2YE2A 3INXA 1TILA 4MP7A 2JKIA 4H85A 2ZDXA 2WI3A 4O04A 4QPJA 4NH8A 3A0TA 2YGEA 3D36A 2IWSA 4XCJA 4CE2A 2CCUA 5CTXA 3BM9A 3QDDA 4L90A 3B27A 3K97A 4HZ0A 5M4PA 2BU7A 4AWOA 4O09A 1YT0A 4HXWA 2CG9A 2YEDA 2UWDA 2YEJA 4URNA 4CWNA 3EHFA 3O0IA 1ZXMA 2YKBA 2XJJA 1UYIA 4GFNA 4EGKA 2Q8IA 4EFUA 5FNFA 2WI5A 4HY1A 1U0ZA 2BZ5A 2IWUA 4CWPA 3U2DA 3O6OA 4XKAA 5D7DA 3R91A 1NHIA 4URMA 4ASAA 1B63A 4U93A 3RLPA 4YKXA 1US7A 1S14A 1UYHA 1AH8A 2XHTA 3T2SA 3D0BA 2BU5A 2YKEA 3GIEA 1TIDA 4PL9A 2IOPA 2QG0A 3OPDA 1UYLA 2QG2A 2YE6A 4KSHA 3HZ5A 2ESAA 2E0AA 4YKQA 1UYFA 3TZ4A 4L91A 1I5AA 3K99A 3B28A 2AKPA 2WEPA 2BU8A 2BU2A 3R4PA 3R92A 4XIQA 4U7NA 4CWTA 5CTUA 3HYZA 3B24A 1NHHA 2YJXA 4XTJA 3HZ1A 4YKTA 5IDJA 2YEFA 5BODA 3TZ5A 2YEEA 4E00A 3ZXQA 1Z5AA 4MB9A 5IN9A 4R1FA 1AMWA 2VW5A 2VCJA 4E01A 4EGHA 1R62A 5GGZA 1KIJA 3ZKBA 4FCQA 4ASGA 4XDMA 3MNRP 2QF6A 1THNA 3INWA 3TZ0A 4EGIA 1UY8A 4W7TA 4CWQA 1Z5CA 1A4HA 4NH9A 2QFOA 1GKXA 3OWDA 1TC6A 4Q20A 1UY9A 3KE6A 3R4MA 1YC1A 4XKOA 1I5DA 2WI4A 3G7EA 4JAVA 4QPKA 4CE1A 2BSMA 3H80A 1L0OA 4WUBA 4CWSA 1GKZA 3WHAA 4XIRA 4U7OA 4O0BA 2WI2A 4V26A 4AWPA 2XHXA 2YEHA 4I3HA 1ZXNA 3PEJA 1EA6A 4KFGA 4XIPA 2FWZA 2BT0A 4NH7A 3HHUA 3Q5KA 4FCPA 4CWFA 4ASFA 1Y8PA 4LPBA 4R3MA 3EHJA 1I5BA 4MBCA 2WI7A 4FCRA 2O1WA 4L93A 4B7PA 2VCIA 4H81A 1ZW9A 4GCZA 2PNRA 4LWEA 1I59A 3DGEA 1TH8A 1QY8A 5CTWA 3Q5LA 4MOTA 4JAUA 2XHRA 2ZKJA 1YS3A 2BREA 2XDKA 2Q8HA 3T0ZA 4KP4A 2CCSA 5D6QA 4KTNA 5M4EA 2XDLA 2K5BA 5J6AA 4BQGA 2CH4A 3PEHA 2Q2EB 2ZDYA 2YKCA 2BU6A 3A0YA 2HG1A 2YEGA 4BIUA 1Y8OA 2WEQA 4O05A 5D7CA 4CWOA 4DZYA 1Z59A 1Y4UA 2BRCA 2YK2A 3A0ZA 4MPEA 3CWVA 1OSFA 3FV5A 2XX4A 2WI1A 3CRLA 2IWXA 3B25A 2HCHA 5FNCA 3TUHA 2EXLA 4HZ5A 5F5RA 4CE3A 2YI5A 3CGYA 3D2RA 1ZWHA 5CTYA 3ZM7A 2YI6A 5CF0A 3C11A 2XCMA 2YE5A 4HY6A 4LWHA 3JZ3A 3G75A 3K98A 2HKJA 2BYHA 2XABA 3O2FA 4GGLA 3RLQA 3OW6A 4GT8A 3OMUA 4BAEA 1GJVA 1ID0A 3T0HA 4YKYA 2H55A 2YE7A 3EKRA 2O1VA 2XDSA 3LPSA 1U2OA 5C93A 2YECA 2GQPA 1QYEA 4YKZA 2BYIA 4LWIA 2Q8GA 4PRXA 1YC3A 2YI7A 5IDMA 5M4HA 1B62A 5FWKA 4LP0A 4P8OA 4EM7A 3QTFA 4BXIA 2IORA 4XE2A 1UYDA 4YKRA 3VHAA 2YK9A 1UYEA 3RLRA 1UYKA 3OWBA 2WERA 4K4OA 4HXZA 4DUHA 2GFDA 2YKIA 1YETA 4HYPA 4X9LA 1B3QA 2YI0A 3WQ9A 2XD6A 2JJCA 5D7RA
chains in the Genus database with same CATH superfamily
2YE4A 2XX5A 2IOQA 2XDUA 5J71A 4UROA 4XKKA 1Y4SA 2H8MA 1UY7A 5M4KA 1BGQA 4JQLA 4I5SA 4L94A 2XDXA 4KSGA 1UYGA 1Y8NA 3R4OA 4GQTA 4AS9A 4PRVA 3RKZA 2VWCA 1IXMA 4URLA 3LMMA 5M4NA 1I5CA 3VHCA 5L3JA 1AH6A 2O1UA 4BQJA 1MX0A 1S16A 2XK2A 2CCTA 4XC0A 3CGZA 2FYPA 3K60A 3LNUA 3GIGA 4FPPA 2Q8FA 4WUCA 5D6PA 2YE8A 2YGFA 3HEKA 4BIZA 4PU9A 3BMYA 2YEAA 1QZRA 1Z5BA 3EHGA 3NMQA 2YEIA 3HYYA 1UYCA 4V25A 2XJGA 2WI6A 4WUDA 2ZBKB 2FWYA 3IEDA 5CPHA 2YKJA 2YGAA 4CWRA 1YT2A 4XCLA 4LWFA 4YKWA 4ZVIA 3VADA 3VHDA 3Q5JA 4MP2A 1MU5A 4XITA 4GEEA 3B26A 3GIGB 2FXSA 3A0XA 5F3KA 2XX2A 1YERA 3ZXOA 3A0WA 2XJXA 4YKUA 5BOCA 5M4MA 3FT5A 4B6CA 3SL2A 3T1KA 1UYMA 3T10A 2YEBA 3R4NA 1H7SA 2CGFA 4MPCA 3H4LA 4O07A 3U2KA 3TTZA 4KQVA 3EKOA 2BTZA 4FMTA 3G7BA 1YSZA 1AM1A 1H7UA 1BXDA 1YC4A 3U67A 2C2AA 1YSRA 4ZKIA 4E72A 3EHHA 1YESA 4R3AA 1NHJA 1BKNA 1KZNA 3CYGA 1BYQA 2YE9A 1YT1A 1TBWA 3FT8A 4HYMA 4EFTA 4XD8A 4EMVA 2YJWA 3ZKDA 1I58A 1UY6A 4H7QA 4E02A 1EI1A 3GIFA 1AJ6A 3A0RA 4ASBA 4JASA 1JM6A 3C0EA 3TZ2A 1TC0A 4L8ZA 4MPNA 4P7AA 4AWQA 2YE3A 4EEHA 1PVGA 3CRKA 4LWGA 5FNDA 5JENA 2YE2A 3INXA 1TILA 4MP7A 2JKIA 4H85A 2ZDXA 2WI3A 4O04A 4QPJA 4NH8A 3A0TA 2YGEA 3D36A 2IWSA 4XCJA 4CE2A 2CCUA 5CTXA 3BM9A 3QDDA 4L90A 3B27A 3K97A 4HZ0A 5M4PA 2BU7A 4AWOA 4O09A 1YT0A 4HXWA 2CG9A 2YEDA 2UWDA 2YEJA 4URNA 4CWNA 3EHFA 3O0IA 1ZXMA 2YKBA 2XJJA 1UYIA 4GFNA 4EGKA 2Q8IA 4EFUA 2HHIA 5FNFA 2WI5A 4HY1A 1U0ZA 2BZ5A 2IWUA 4CWPA 3U2DA 3O6OA 4XKAA 5D7DA 3R91A 1NHIA 4URMA 4ASAA 1B63A 4U93A 3RLPA 4YKXA 1US7A 1S14A 1UYHA 1AH8A 2C1GA 2XHTA 3T2SA 3D0BA 2BU5A 2YKEA 3GIEA 1TIDA 4PL9A 2IOPA 2QG0A 3OPDA 1UYLA 2QG2A 2YE6A 4KSHA 3HZ5A 2ESAA 2E0AA 4YKQA 1UYFA 3TZ4A 4L91A 1I5AA 3K99A 3B28A 2AKPA 2WEPA 2BU8A 2BU2A 3R4PA 3R92A 4XIQA 4U7NA 4CWTA 5CTUA 3HYZA 3B24A 1NHHA 2YJXA 4XTJA 3HZ1A 4YKTA 5IDJA 2YEFA 5BODA 3TZ5A 2YEEA 4E00A 3ZXQA 1Z5AA 4MB9A 5IN9A 4R1FA 1AMWA 2VW5A 2VCJA 4E01A 4EGHA 1R62A 5GGZA 1KIJA 3ZKBA 4FCQA 4ASGA 4XDMA 3MNRP 2QF6A 1THNA 3INWA 3TZ0A 4EGIA 1UY8A 4W7TA 4CWQA 1Z5CA 1A4HA 4NH9A 2QFOA 1GKXA 3OWDA 1TC6A 4Q20A 1UY9A 3KE6A 3R4MA 1YC1A 4XKOA 1I5DA 2WI4A 3G7EA 4JAVA 4QPKA 4CE1A 2BSMA 1F51A 3H80A 1L0OA 4WUBA 4CWSA 1GKZA 3WHAA 4XIRA 4U7OA 4O0BA 2WI2A 4V26A 4AWPA 2XHXA 2YEHA 4I3HA 1ZXNA 3PEJA 1EA6A 4KFGA 4XIPA 2FWZA 2BT0A 4NH7A 3HHUA 3Q5KA 4FCPA 4CWFA 4ASFA 1Y8PA 4LPBA 4R3MA 3EHJA 1I5BA 4MBCA 2WI7A 4FCRA 2O1WA 4L93A 4B7PA 2VCIA 4H81A 1ZW9A 4GCZA 2PNRA 4LWEA 1I59A 3DGEA 1TH8A 1QY8A 5CTWA 2C1IA 3Q5LA 4MOTA 4JAUA 2XHRA 2ZKJA 1YS3A 2BREA 2XDKA 2Q8HA 3T0ZA 4KP4A 2CCSA 5D6QA 4KTNA 5M4EA 2XDLA 2K5BA 5J6AA 4BQGA 2CH4A 3PEHA 2Q2EB 2ZDYA 2YKCA 2BU6A 3A0YA 2HG1A 2YEGA 4BIUA 1Y8OA 2WEQA 4O05A 5D7CA 4CWOA 4DZYA 1Z59A 1Y4UA 2BRCA 2YK2A 3A0ZA 4MPEA 3CWVA 1OSFA 3FV5A 2XX4A 2WI1A 3CRLA 2IWXA 3B25A 2HCHA 5FNCA 3TUHA 2EXLA 4HZ5A 5F5RA 4CE3A 2YI5A 3CGYA 3D2RA 1ZWHA 5CTYA 3ZM7A 2YI6A 3S5TA 5CF0A 3C11A 2XCMA 2YE5A 4HY6A 4LWHA 3JZ3A 3G75A 3K98A 2HKJA 2BYHA 2XABA 3O2FA 4GGLA 3RLQA 3OW6A 4GT8A 3OMUA 4BAEA 1GJVA 1ID0A 3T0HA 4YKYA 2H55A 2YE7A 2FTKA 2O1VA 3EKRA 2XDSA 3LPSA 1U2OA 5C93A 2YECA 2GQPA 1QYEA 4YKZA 2BYIA 4LWIA 2Q8GA 4PRXA 1YC3A 2YI7A 5IDMA 5M4HA 1B62A 5FWKA 4LP0A 4P8OA 4EM7A 3QTFA 4BXIA 2IORA 4XE2A 1UYDA 4YKRA 3VHAA 2YK9A 1UYEA 3RLRA 1UYKA 3OWBA 2WERA 4K4OA 4HXZA 4DUHA 2GFDA 2YKIA 1YETA 4HYPA 4X9LA 1B3QA 2YI0A 3WQ9A 2XD6A 2JJCA 5D7RA
chains in the Genus database with same CATH topology
2YE4A 2XX5A 2IOQA 2XDUA 5J71A 4UROA 4XKKA 1Y4SA 2H8MA 1UY7A 5M4KA 1BGQA 4JQLA 4I5SA 4L94A 2XDXA 4KSGA 1UYGA 1Y8NA 3R4OA 4GQTA 4AS9A 4PRVA 3RKZA 2VWCA 4URLA 5M4NA 1I5CA 3VHCA 5L3JA 1AH6A 2O1UA 4BQJA 1MX0A 1S16A 2XK2A 2CCTA 4XC0A 3CGZA 2FYPA 3K60A 3LNUA 3GIGA 4FPPA 2Q8FA 4WUCA 5D6PA 2YE8A 2YGFA 3HEKA 4BIZA 4PU9A 3BMYA 2YEAA 1QZRA 1Z5BA 3EHGA 3NMQA 2YEIA 3HYYA 1UYCA 4V25A 2XJGA 2WI6A 4WUDA 2ZBKB 2FWYA 3IEDA 5CPHA 2YKJA 2YGAA 4CWRA 1YT2A 4XCLA 4LWFA 4YKWA 4ZVIA 3VADA 3VHDA 3Q5JA 4MP2A 1MU5A 4XITA 4GEEA 3B26A 3GIGB 2FXSA 3A0XA 5F3KA 2XX2A 1YERA 3ZXOA 3A0WA 2XJXA 4YKUA 5BOCA 5M4MA 3FT5A 4B6CA 3SL2A 3T1KA 1UYMA 3T10A 2YEBA 3R4NA 1H7SA 2CGFA 4MPCA 3H4LA 4O07A 3U2KA 3TTZA 4KQVA 3EKOA 2BTZA 4FMTA 3G7BA 1YSZA 1AM1A 1H7UA 1BXDA 1YC4A 3U67A 2C2AA 1YSRA 4ZKIA 3EHHA 1YESA 4R3AA 1NHJA 1BKNA 1KZNA 1BYQA 2YE9A 1YT1A 1TBWA 3FT8A 4HYMA 4EFTA 4XD8A 4EMVA 2YJWA 3ZKDA 1I58A 1UY6A 4H7QA 4E02A 1EI1A 3GIFA 1AJ6A 3A0RA 4ASBA 4JASA 1JM6A 3C0EA 3TZ2A 1TC0A 4L8ZA 4MPNA 4P7AA 4AWQA 2YE3A 4EEHA 1PVGA 3CRKA 4LWGA 5FNDA 2YE2A 3INXA 1TILA 4MP7A 2JKIA 4H85A 2ZDXA 2WI3A 4O04A 4QPJA 4NH8A 3A0TA 2YGEA 3D36A 2IWSA 4XCJA 4CE2A 2CCUA 5CTXA 3BM9A 3QDDA 4L90A 3B27A 3K97A 4HZ0A 5M4PA 2BU7A 4AWOA 4O09A 1YT0A 4HXWA 2CG9A 2YEDA 2UWDA 2YEJA 4URNA 4CWNA 3EHFA 3O0IA 1ZXMA 2YKBA 2XJJA 1UYIA 4GFNA 4EGKA 2Q8IA 4EFUA 5FNFA 2WI5A 4HY1A 1U0ZA 2BZ5A 2IWUA 4CWPA 3U2DA 3O6OA 4XKAA 5D7DA 3R91A 1NHIA 4URMA 4ASAA 1B63A 4U93A 3RLPA 4YKXA 1US7A 1S14A 1UYHA 1AH8A 2XHTA 3T2SA 3D0BA 2BU5A 2YKEA 3GIEA 1TIDA 4PL9A 2IOPA 2QG0A 3OPDA 1UYLA 2QG2A 2YE6A 4KSHA 3HZ5A 2ESAA 2E0AA 4YKQA 1UYFA 3TZ4A 4L91A 1I5AA 3K99A 3B28A 2AKPA 2WEPA 2BU8A 2BU2A 3R4PA 3R92A 4XIQA 4U7NA 4CWTA 5CTUA 3HYZA 3B24A 1NHHA 2YJXA 4XTJA 3HZ1A 4YKTA 5IDJA 2YEFA 5BODA 3TZ5A 2YEEA 4E00A 3ZXQA 1Z5AA 4MB9A 5IN9A 4R1FA 1AMWA 2VW5A 2VCJA 4E01A 4EGHA 1R62A 5GGZA 1KIJA 3ZKBA 4FCQA 4ASGA 4XDMA 3MNRP 2QF6A 1THNA 3INWA 3TZ0A 4EGIA 1UY8A 4W7TA 4CWQA 1Z5CA 1A4HA 4NH9A 2QFOA 1GKXA 3OWDA 1TC6A 4Q20A 1UY9A 3KE6A 3R4MA 1YC1A 4XKOA 1I5DA 2WI4A 3G7EA 4JAVA 4QPKA 4CE1A 2BSMA 3H80A 1L0OA 4WUBA 4CWSA 1GKZA 3WHAA 4XIRA 4U7OA 4O0BA 2WI2A 4V26A 4AWPA 2XHXA 2YEHA 4I3HA 1ZXNA 3PEJA 1EA6A 4KFGA 4XIPA 2FWZA 2BT0A 4NH7A 3HHUA 3Q5KA 4FCPA 4CWFA 4ASFA 1Y8PA 4LPBA 4R3MA 3EHJA 1I5BA 4MBCA 2WI7A 4FCRA 2O1WA 4L93A 4B7PA 2VCIA 4H81A 1ZW9A 4GCZA 2PNRA 4LWEA 1I59A 3DGEA 1TH8A 1QY8A 5CTWA 3Q5LA 4MOTA 4JAUA 2XHRA 2ZKJA 1YS3A 2BREA 2XDKA 2Q8HA 3T0ZA 4KP4A 2CCSA 5D6QA 4KTNA 5M4EA 2XDLA 2K5BA 5J6AA 4BQGA 2CH4A 3PEHA 2Q2EB 2ZDYA 2YKCA 2BU6A 3A0YA 2HG1A 2YEGA 4BIUA 1Y8OA 2WEQA 4O05A 5D7CA 4CWOA 4DZYA 1Z59A 1Y4UA 2BRCA 2YK2A 3A0ZA 4MPEA 3CWVA 1OSFA 3FV5A 2XX4A 2WI1A 3CRLA 2IWXA 3B25A 2HCHA 5FNCA 3TUHA 2EXLA 4HZ5A 5F5RA 4CE3A 2YI5A 3CGYA 3D2RA 1ZWHA 5CTYA 3ZM7A 2YI6A 5CF0A 3C11A 2XCMA 2YE5A 4HY6A 4LWHA 3JZ3A 3G75A 3K98A 2HKJA 2BYHA 2XABA 3O2FA 4GGLA 3RLQA 3OW6A 4GT8A 3OMUA 4BAEA 1GJVA 1ID0A 3T0HA 4YKYA 2H55A 2YE7A 3EKRA 2O1VA 2XDSA 3LPSA 1U2OA 5C93A 2YECA 2GQPA 1QYEA 4YKZA 2BYIA 4LWIA 2Q8GA 4PRXA 1YC3A 2YI7A 5IDMA 5M4HA 1B62A 5FWKA 4LP0A 4P8OA 4EM7A 3QTFA 4BXIA 2IORA 4XE2A 1UYDA 4YKRA 3VHAA 2YK9A 1UYEA 3RLRA 1UYKA 3OWBA 2WERA 4K4OA 4HXZA 4DUHA 2GFDA 2YKIA 1YETA 4HYPA 4X9LA 1B3QA 2YI0A 3WQ9A 2XD6A 2JJCA 5D7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YE4 A;  2XX5 A;  2IOQ A;  2XDU A;  5J71 A;  4URO A;  4XKK A;  1Y4S A;  2H8M A;  1UY7 A;  5M4K A;  1BGQ A;  4JQL A;  4I5S A;  4L94 A;  2XDX A;  4KSG A;  1UYG A;  1Y8N A;  3R4O A;  4GQT A;  4AS9 A;  4PRV A;  3RKZ A;  2VWC A;  4URL A;  5M4N A;  1I5C A;  3VHC A;  5L3J A;  1AH6 A;  2O1U A;  4BQJ A;  1MX0 A;  1S16 A;  2XK2 A;  2CCT A;  4XC0 A;  3CGZ A;  2FYP A;  3K60 A;  3LNU A;  3GIG A;  4FPP A;  2Q8F A;  4WUC A;  5D6P A;  2YE8 A;  2YGF A;  3HEK A;  4BIZ A;  4PU9 A;  3BMY A;  2YEA A;  1QZR A;  1Z5B A;  3EHG A;  3NMQ A;  2YEI A;  3HYY A;  1UYC A;  4V25 A;  2XJG A;  2WI6 A;  4WUD A;  2ZBK B;  2FWY A;  3IED A;  5CPH A;  2YKJ A;  2YGA A;  4CWR A;  1YT2 A;  4XCL A;  4LWF A;  4YKW A;  4ZVI A;  3VAD A;  3VHD A;  3Q5J A;  4MP2 A;  1MU5 A;  4XIT A;  4GEE A;  3B26 A;  3GIG B;  2FXS A;  3A0X A;  5F3K A;  2XX2 A;  1YER A;  3ZXO A;  3A0W A;  2XJX A;  4YKU A;  5BOC A;  5M4M A;  3FT5 A;  4B6C A;  3SL2 A;  3T1K A;  1UYM A;  3T10 A;  2YEB A;  3R4N A;  1H7S A;  2CGF A;  4MPC A;  3H4L A;  4O07 A;  3U2K A;  3TTZ A;  4KQV A;  3EKO A;  2BTZ A;  4FMT A;  3G7B A;  1YSZ A;  1AM1 A;  1H7U A;  1BXD A;  1YC4 A;  3U67 A;  2C2A A;  1YSR A;  4ZKI A;  3EHH A;  1YES A;  4R3A A;  1NHJ A;  1BKN A;  1KZN A;  1BYQ A;  2YE9 A;  1YT1 A;  1TBW A;  3FT8 A;  4HYM A;  4EFT A;  4XD8 A;  4EMV A;  2YJW A;  3ZKD A;  1I58 A;  1UY6 A;  4H7Q A;  4E02 A;  1EI1 A;  3GIF A;  1AJ6 A;  3A0R A;  4ASB A;  4JAS A;  1JM6 A;  3C0E A;  3TZ2 A;  1TC0 A;  4L8Z A;  4MPN A;  4P7A A;  4AWQ A;  2YE3 A;  4EEH A;  1PVG A;  3CRK A;  4LWG A;  5FND A;  2YE2 A;  3INX A;  1TIL A;  4MP7 A;  2JKI A;  4H85 A;  2ZDX A;  2WI3 A;  4O04 A;  4QPJ A;  4NH8 A;  3A0T A;  2YGE A;  3D36 A;  2IWS A;  4XCJ A;  4CE2 A;  2CCU A;  5CTX A;  3BM9 A;  3QDD A;  4L90 A;  3B27 A;  3K97 A;  4HZ0 A;  5M4P A;  2BU7 A;  4AWO A;  4O09 A;  1YT0 A;  4HXW A;  2CG9 A;  2YED A;  2UWD A;  2YEJ A;  4URN A;  4CWN A;  3EHF A;  3O0I A;  1ZXM A;  2YKB A;  2XJJ A;  1UYI A;  4GFN A;  4EGK A;  2Q8I A;  4EFU A;  5FNF A;  2WI5 A;  4HY1 A;  1U0Z A;  2BZ5 A;  2IWU A;  4CWP A;  3U2D A;  3O6O A;  4XKA A;  5D7D A;  3R91 A;  1NHI A;  4URM A;  4ASA A;  1B63 A;  4U93 A;  3RLP A;  4YKX A;  1US7 A;  1S14 A;  1UYH A;  1AH8 A;  2XHT A;  3T2S A;  3D0B A;  2BU5 A;  2YKE A;  3GIE A;  1TID A;  4PL9 A;  2IOP A;  2QG0 A;  3OPD A;  1UYL A;  2QG2 A;  2YE6 A;  4KSH A;  3HZ5 A;  2ESA A;  2E0A A;  4YKQ A;  1UYF A;  3TZ4 A;  4L91 A;  1I5A A;  3K99 A;  3B28 A;  2AKP A;  2WEP A;  2BU8 A;  2BU2 A;  3R4P A;  3R92 A;  4XIQ A;  4U7N A;  4CWT A;  5CTU A;  3HYZ A;  3B24 A;  1NHH A;  2YJX A;  4XTJ A;  3HZ1 A;  4YKT A;  5IDJ A;  2YEF A;  5BOD A;  3TZ5 A;  2YEE A;  4E00 A;  3ZXQ A;  1Z5A A;  4MB9 A;  5IN9 A;  4R1F A;  1AMW A;  2VW5 A;  2VCJ A;  4E01 A;  4EGH A;  1R62 A;  5GGZ A;  1KIJ A;  3ZKB A;  4FCQ A;  4ASG A;  4XDM A;  3MNR P;  2QF6 A;  1THN A;  3INW A;  3TZ0 A;  4EGI A;  1UY8 A;  4W7T A;  4CWQ A;  1Z5C A;  1A4H A;  4NH9 A;  2QFO A;  1GKX A;  3OWD A;  1TC6 A;  4Q20 A;  1UY9 A;  3KE6 A;  3R4M A;  1YC1 A;  4XKO A;  1I5D A;  2WI4 A;  3G7E A;  4JAV A;  4QPK A;  4CE1 A;  2BSM A;  3H80 A;  1L0O A;  4WUB A;  4CWS A;  1GKZ A;  3WHA A;  4XIR A;  4U7O A;  4O0B A;  2WI2 A;  4V26 A;  4AWP A;  2XHX A;  2YEH A;  4I3H A;  1ZXN A;  3PEJ A;  1EA6 A;  4KFG A;  4XIP A;  2FWZ A;  2BT0 A;  4NH7 A;  3HHU A;  3Q5K A;  4FCP A;  4CWF A;  4ASF A;  1Y8P A;  4LPB A;  4R3M A;  3EHJ A;  1I5B A;  4MBC A;  2WI7 A;  4FCR A;  2O1W A;  4L93 A;  4B7P A;  2VCI A;  4H81 A;  1ZW9 A;  4GCZ A;  2PNR A;  4LWE A;  1I59 A;  3DGE A;  1TH8 A;  1QY8 A;  5CTW A;  3Q5L A;  4MOT A;  4JAU A;  2XHR A;  2ZKJ A;  1YS3 A;  2BRE A;  2XDK A;  2Q8H A;  3T0Z A;  4KP4 A;  2CCS A;  5D6Q A;  4KTN A;  5M4E A;  2XDL A;  2K5B A;  5J6A A;  4BQG A;  2CH4 A;  3PEH A;  2Q2E B;  2ZDY A;  2YKC A;  2BU6 A;  3A0Y A;  2HG1 A;  2YEG A;  4BIU A;  1Y8O A;  2WEQ A;  4O05 A;  5D7C A;  4CWO A;  4DZY A;  1Z59 A;  1Y4U A;  2BRC A;  2YK2 A;  3A0Z A;  4MPE A;  3CWV A;  1OSF A;  3FV5 A;  2XX4 A;  2WI1 A;  3CRL A;  2IWX A;  3B25 A;  2HCH A;  5FNC A;  3TUH A;  2EXL A;  4HZ5 A;  5F5R A;  4CE3 A;  2YI5 A;  3CGY A;  3D2R A;  1ZWH A;  5CTY A;  3ZM7 A;  2YI6 A;  5CF0 A;  3C11 A;  2XCM A;  2YE5 A;  4HY6 A;  4LWH A;  3JZ3 A;  3G75 A;  3K98 A;  2HKJ A;  2BYH A;  2XAB A;  3O2F A;  4GGL A;  3RLQ A;  3OW6 A;  4GT8 A;  3OMU A;  4BAE A;  1GJV A;  1ID0 A;  3T0H A;  4YKY A;  2H55 A;  2YE7 A;  3EKR A;  2O1V A;  2XDS A;  3LPS A;  1U2O A;  5C93 A;  2YEC A;  2GQP A;  1QYE A;  4YKZ A;  2BYI A;  4LWI A;  2Q8G A;  4PRX A;  1YC3 A;  2YI7 A;  5IDM A;  5M4H A;  1B62 A;  5FWK A;  4LP0 A;  4P8O A;  4EM7 A;  3QTF A;  4BXI A;  2IOR A;  4XE2 A;  1UYD A;  4YKR A;  3VHA A;  2YK9 A;  1UYE A;  3RLR A;  1UYK A;  3OWB A;  2WER A;  4K4O A;  4HXZ A;  4DUH A;  2GFD A;  2YKI A;  1YET A;  4HYP A;  4X9L A;  1B3Q A;  2YI0 A;  3WQ9 A;  2XD6 A;  2JJC A;  5D7R A; 
#chains in the Genus database with same CATH topology
 2YE4 A;  2XX5 A;  2IOQ A;  2XDU A;  5J71 A;  4URO A;  4XKK A;  1Y4S A;  2H8M A;  1UY7 A;  5M4K A;  1BGQ A;  4JQL A;  4I5S A;  4L94 A;  2XDX A;  4KSG A;  1UYG A;  1Y8N A;  3R4O A;  4GQT A;  4AS9 A;  4PRV A;  3RKZ A;  2VWC A;  1IXM A;  4URL A;  3LMM A;  5M4N A;  1I5C A;  3VHC A;  5L3J A;  1AH6 A;  2O1U A;  4BQJ A;  1MX0 A;  1S16 A;  2XK2 A;  2CCT A;  4XC0 A;  3CGZ A;  2FYP A;  3K60 A;  3LNU A;  3GIG A;  4FPP A;  2Q8F A;  4WUC A;  5D6P A;  2YE8 A;  2YGF A;  3HEK A;  4BIZ A;  4PU9 A;  3BMY A;  2YEA A;  1QZR A;  1Z5B A;  3EHG A;  3NMQ A;  2YEI A;  3HYY A;  1UYC A;  4V25 A;  2XJG A;  2WI6 A;  4WUD A;  2ZBK B;  2FWY A;  3IED A;  5CPH A;  2YKJ A;  2YGA A;  4CWR A;  1YT2 A;  4XCL A;  4LWF A;  4YKW A;  4ZVI A;  3VAD A;  3VHD A;  3Q5J A;  4MP2 A;  1MU5 A;  4XIT A;  4GEE A;  3B26 A;  3GIG B;  2FXS A;  3A0X A;  5F3K A;  2XX2 A;  1YER A;  3ZXO A;  3A0W A;  2XJX A;  4YKU A;  5BOC A;  5M4M A;  3FT5 A;  4B6C A;  3SL2 A;  3T1K A;  1UYM A;  3T10 A;  2YEB A;  3R4N A;  1H7S A;  2CGF A;  4MPC A;  3H4L A;  4O07 A;  3U2K A;  3TTZ A;  4KQV A;  3EKO A;  2BTZ A;  4FMT A;  3G7B A;  1YSZ A;  1AM1 A;  1H7U A;  1BXD A;  1YC4 A;  3U67 A;  2C2A A;  1YSR A;  4ZKI A;  4E72 A;  3EHH A;  1YES A;  4R3A A;  1NHJ A;  1BKN A;  1KZN A;  3CYG A;  1BYQ A;  2YE9 A;  1YT1 A;  1TBW A;  3FT8 A;  4HYM A;  4EFT A;  4XD8 A;  4EMV A;  2YJW A;  3ZKD A;  1I58 A;  1UY6 A;  4H7Q A;  4E02 A;  1EI1 A;  3GIF A;  1AJ6 A;  3A0R A;  4ASB A;  4JAS A;  1JM6 A;  3C0E A;  3TZ2 A;  1TC0 A;  4L8Z A;  4MPN A;  4P7A A;  4AWQ A;  2YE3 A;  4EEH A;  1PVG A;  3CRK A;  4LWG A;  5FND A;  5JEN A;  2YE2 A;  3INX A;  1TIL A;  4MP7 A;  2JKI A;  4H85 A;  2ZDX A;  2WI3 A;  4O04 A;  4QPJ A;  4NH8 A;  3A0T A;  2YGE A;  3D36 A;  2IWS A;  4XCJ A;  4CE2 A;  2CCU A;  5CTX A;  3BM9 A;  3QDD A;  4L90 A;  3B27 A;  3K97 A;  4HZ0 A;  5M4P A;  2BU7 A;  4AWO A;  4O09 A;  1YT0 A;  4HXW A;  2CG9 A;  2YED A;  2UWD A;  2YEJ A;  4URN A;  4CWN A;  3EHF A;  3O0I A;  1ZXM A;  2YKB A;  2XJJ A;  1UYI A;  4GFN A;  4EGK A;  2Q8I A;  4EFU A;  2HHI A;  5FNF A;  2WI5 A;  4HY1 A;  1U0Z A;  2BZ5 A;  2IWU A;  4CWP A;  3U2D A;  3O6O A;  4XKA A;  5D7D A;  3R91 A;  1NHI A;  4URM A;  4ASA A;  1B63 A;  4U93 A;  3RLP A;  4YKX A;  1US7 A;  1S14 A;  1UYH A;  1AH8 A;  2C1G A;  2XHT A;  3T2S A;  3D0B A;  2BU5 A;  2YKE A;  3GIE A;  1TID A;  4PL9 A;  2IOP A;  2QG0 A;  3OPD A;  1UYL A;  2QG2 A;  2YE6 A;  4KSH A;  3HZ5 A;  2ESA A;  2E0A A;  4YKQ A;  1UYF A;  3TZ4 A;  4L91 A;  1I5A A;  3K99 A;  3B28 A;  2AKP A;  2WEP A;  2BU8 A;  2BU2 A;  3R4P A;  3R92 A;  4XIQ A;  4U7N A;  4CWT A;  5CTU A;  3HYZ A;  3B24 A;  1NHH A;  2YJX A;  4XTJ A;  3HZ1 A;  4YKT A;  5IDJ A;  2YEF A;  5BOD A;  3TZ5 A;  2YEE A;  4E00 A;  3ZXQ A;  1Z5A A;  4MB9 A;  5IN9 A;  4R1F A;  1AMW A;  2VW5 A;  2VCJ A;  4E01 A;  4EGH A;  1R62 A;  5GGZ A;  1KIJ A;  3ZKB A;  4FCQ A;  4ASG A;  4XDM A;  3MNR P;  2QF6 A;  1THN A;  3INW A;  3TZ0 A;  4EGI A;  1UY8 A;  4W7T A;  4CWQ A;  1Z5C A;  1A4H A;  4NH9 A;  2QFO A;  1GKX A;  3OWD A;  1TC6 A;  4Q20 A;  1UY9 A;  3KE6 A;  3R4M A;  1YC1 A;  4XKO A;  1I5D A;  2WI4 A;  3G7E A;  4JAV A;  4QPK A;  4CE1 A;  2BSM A;  1F51 A;  3H80 A;  1L0O A;  4WUB A;  4CWS A;  1GKZ A;  3WHA A;  4XIR A;  4U7O A;  4O0B A;  2WI2 A;  4V26 A;  4AWP A;  2XHX A;  2YEH A;  4I3H A;  1ZXN A;  3PEJ A;  1EA6 A;  4KFG A;  4XIP A;  2FWZ A;  2BT0 A;  4NH7 A;  3HHU A;  3Q5K A;  4FCP A;  4CWF A;  4ASF A;  1Y8P A;  4LPB A;  4R3M A;  3EHJ A;  1I5B A;  4MBC A;  2WI7 A;  4FCR A;  2O1W A;  4L93 A;  4B7P A;  2VCI A;  4H81 A;  1ZW9 A;  4GCZ A;  2PNR A;  4LWE A;  1I59 A;  3DGE A;  1TH8 A;  1QY8 A;  5CTW A;  2C1I A;  3Q5L A;  4MOT A;  4JAU A;  2XHR A;  2ZKJ A;  1YS3 A;  2BRE A;  2XDK A;  2Q8H A;  3T0Z A;  4KP4 A;  2CCS A;  5D6Q A;  4KTN A;  5M4E A;  2XDL A;  2K5B A;  5J6A A;  4BQG A;  2CH4 A;  3PEH A;  2Q2E B;  2ZDY A;  2YKC A;  2BU6 A;  3A0Y A;  2HG1 A;  2YEG A;  4BIU A;  1Y8O A;  2WEQ A;  4O05 A;  5D7C A;  4CWO A;  4DZY A;  1Z59 A;  1Y4U A;  2BRC A;  2YK2 A;  3A0Z A;  4MPE A;  3CWV A;  1OSF A;  3FV5 A;  2XX4 A;  2WI1 A;  3CRL A;  2IWX A;  3B25 A;  2HCH A;  5FNC A;  3TUH A;  2EXL A;  4HZ5 A;  5F5R A;  4CE3 A;  2YI5 A;  3CGY A;  3D2R A;  1ZWH A;  5CTY A;  3ZM7 A;  2YI6 A;  3S5T A;  5CF0 A;  3C11 A;  2XCM A;  2YE5 A;  4HY6 A;  4LWH A;  3JZ3 A;  3G75 A;  3K98 A;  2HKJ A;  2BYH A;  2XAB A;  3O2F A;  4GGL A;  3RLQ A;  3OW6 A;  4GT8 A;  3OMU A;  4BAE A;  1GJV A;  1ID0 A;  3T0H A;  4YKY A;  2H55 A;  2YE7 A;  2FTK A;  2O1V A;  3EKR A;  2XDS A;  3LPS A;  1U2O A;  5C93 A;  2YEC A;  2GQP A;  1QYE A;  4YKZ A;  2BYI A;  4LWI A;  2Q8G A;  4PRX A;  1YC3 A;  2YI7 A;  5IDM A;  5M4H A;  1B62 A;  5FWK A;  4LP0 A;  4P8O A;  4EM7 A;  3QTF A;  4BXI A;  2IOR A;  4XE2 A;  1UYD A;  4YKR A;  3VHA A;  2YK9 A;  1UYE A;  3RLR A;  1UYK A;  3OWB A;  2WER A;  4K4O A;  4HXZ A;  4DUH A;  2GFD A;  2YKI A;  1YET A;  4HYP A;  4X9L A;  1B3Q A;  2YI0 A;  3WQ9 A;  2XD6 A;  2JJC A;  5D7R A; 
#chains in the Genus database with same CATH homology
 2YE4 A;  2XX5 A;  2IOQ A;  2XDU A;  5J71 A;  4URO A;  4XKK A;  1Y4S A;  2H8M A;  1UY7 A;  5M4K A;  1BGQ A;  4JQL A;  4I5S A;  4L94 A;  2XDX A;  4KSG A;  1UYG A;  1Y8N A;  3R4O A;  4GQT A;  4AS9 A;  4PRV A;  3RKZ A;  2VWC A;  4URL A;  5M4N A;  1I5C A;  3VHC A;  5L3J A;  1AH6 A;  2O1U A;  4BQJ A;  1MX0 A;  1S16 A;  2XK2 A;  2CCT A;  4XC0 A;  3CGZ A;  2FYP A;  3K60 A;  3LNU A;  3GIG A;  4FPP A;  2Q8F A;  4WUC A;  5D6P A;  2YE8 A;  2YGF A;  3HEK A;  4BIZ A;  4PU9 A;  3BMY A;  2YEA A;  1QZR A;  1Z5B A;  3EHG A;  3NMQ A;  2YEI A;  3HYY A;  1UYC A;  4V25 A;  2XJG A;  2WI6 A;  4WUD A;  2ZBK B;  2FWY A;  3IED A;  5CPH A;  2YKJ A;  2YGA A;  4CWR A;  1YT2 A;  4XCL A;  4LWF A;  4YKW A;  4ZVI A;  3VAD A;  3VHD A;  3Q5J A;  4MP2 A;  1MU5 A;  4XIT A;  4GEE A;  3B26 A;  3GIG B;  2FXS A;  3A0X A;  5F3K A;  2XX2 A;  1YER A;  3ZXO A;  3A0W A;  2XJX A;  4YKU A;  5BOC A;  5M4M A;  3FT5 A;  4B6C A;  3SL2 A;  3T1K A;  1UYM A;  3T10 A;  2YEB A;  3R4N A;  1H7S A;  2CGF A;  4MPC A;  3H4L A;  4O07 A;  3U2K A;  3TTZ A;  4KQV A;  3EKO A;  2BTZ A;  4FMT A;  3G7B A;  1YSZ A;  1AM1 A;  1H7U A;  1BXD A;  1YC4 A;  3U67 A;  2C2A A;  1YSR A;  4ZKI A;  3EHH A;  1YES A;  4R3A A;  1NHJ A;  1BKN A;  1KZN A;  1BYQ A;  2YE9 A;  1YT1 A;  1TBW A;  3FT8 A;  4HYM A;  4EFT A;  4XD8 A;  4EMV A;  2YJW A;  3ZKD A;  1I58 A;  1UY6 A;  4H7Q A;  4E02 A;  1EI1 A;  3GIF A;  1AJ6 A;  3A0R A;  4ASB A;  4JAS A;  1JM6 A;  3C0E A;  3TZ2 A;  1TC0 A;  4L8Z A;  4MPN A;  4P7A A;  4AWQ A;  2YE3 A;  4EEH A;  1PVG A;  3CRK A;  4LWG A;  5FND A;  2YE2 A;  3INX A;  1TIL A;  4MP7 A;  2JKI A;  4H85 A;  2ZDX A;  2WI3 A;  4O04 A;  4QPJ A;  4NH8 A;  3A0T A;  2YGE A;  3D36 A;  2IWS A;  4XCJ A;  4CE2 A;  2CCU A;  5CTX A;  3BM9 A;  3QDD A;  4L90 A;  3B27 A;  3K97 A;  4HZ0 A;  5M4P A;  2BU7 A;  4AWO A;  4O09 A;  1YT0 A;  4HXW A;  2CG9 A;  2YED A;  2UWD A;  2YEJ A;  4URN A;  4CWN A;  3EHF A;  3O0I A;  1ZXM A;  2YKB A;  2XJJ A;  1UYI A;  4GFN A;  4EGK A;  2Q8I A;  4EFU A;  5FNF A;  2WI5 A;  4HY1 A;  1U0Z A;  2BZ5 A;  2IWU A;  4CWP A;  3U2D A;  3O6O A;  4XKA A;  5D7D A;  3R91 A;  1NHI A;  4URM A;  4ASA A;  1B63 A;  4U93 A;  3RLP A;  4YKX A;  1US7 A;  1S14 A;  1UYH A;  1AH8 A;  2XHT A;  3T2S A;  3D0B A;  2BU5 A;  2YKE A;  3GIE A;  1TID A;  4PL9 A;  2IOP A;  2QG0 A;  3OPD A;  1UYL A;  2QG2 A;  2YE6 A;  4KSH A;  3HZ5 A;  2ESA A;  2E0A A;  4YKQ A;  1UYF A;  3TZ4 A;  4L91 A;  1I5A A;  3K99 A;  3B28 A;  2AKP A;  2WEP A;  2BU8 A;  2BU2 A;  3R4P A;  3R92 A;  4XIQ A;  4U7N A;  4CWT A;  5CTU A;  3HYZ A;  3B24 A;  1NHH A;  2YJX A;  4XTJ A;  3HZ1 A;  4YKT A;  5IDJ A;  2YEF A;  5BOD A;  3TZ5 A;  2YEE A;  4E00 A;  3ZXQ A;  1Z5A A;  4MB9 A;  5IN9 A;  4R1F A;  1AMW A;  2VW5 A;  2VCJ A;  4E01 A;  4EGH A;  1R62 A;  5GGZ A;  1KIJ A;  3ZKB A;  4FCQ A;  4ASG A;  4XDM A;  3MNR P;  2QF6 A;  1THN A;  3INW A;  3TZ0 A;  4EGI A;  1UY8 A;  4W7T A;  4CWQ A;  1Z5C A;  1A4H A;  4NH9 A;  2QFO A;  1GKX A;  3OWD A;  1TC6 A;  4Q20 A;  1UY9 A;  3KE6 A;  3R4M A;  1YC1 A;  4XKO A;  1I5D A;  2WI4 A;  3G7E A;  4JAV A;  4QPK A;  4CE1 A;  2BSM A;  3H80 A;  1L0O A;  4WUB A;  4CWS A;  1GKZ A;  3WHA A;  4XIR A;  4U7O A;  4O0B A;  2WI2 A;  4V26 A;  4AWP A;  2XHX A;  2YEH A;  4I3H A;  1ZXN A;  3PEJ A;  1EA6 A;  4KFG A;  4XIP A;  2FWZ A;  2BT0 A;  4NH7 A;  3HHU A;  3Q5K A;  4FCP A;  4CWF A;  4ASF A;  1Y8P A;  4LPB A;  4R3M A;  3EHJ A;  1I5B A;  4MBC A;  2WI7 A;  4FCR A;  2O1W A;  4L93 A;  4B7P A;  2VCI A;  4H81 A;  1ZW9 A;  4GCZ A;  2PNR A;  4LWE A;  1I59 A;  3DGE A;  1TH8 A;  1QY8 A;  5CTW A;  3Q5L A;  4MOT A;  4JAU A;  2XHR A;  2ZKJ A;  1YS3 A;  2BRE A;  2XDK A;  2Q8H A;  3T0Z A;  4KP4 A;  2CCS A;  5D6Q A;  4KTN A;  5M4E A;  2XDL A;  2K5B A;  5J6A A;  4BQG A;  2CH4 A;  3PEH A;  2Q2E B;  2ZDY A;  2YKC A;  2BU6 A;  3A0Y A;  2HG1 A;  2YEG A;  4BIU A;  1Y8O A;  2WEQ A;  4O05 A;  5D7C A;  4CWO A;  4DZY A;  1Z59 A;  1Y4U A;  2BRC A;  2YK2 A;  3A0Z A;  4MPE A;  3CWV A;  1OSF A;  3FV5 A;  2XX4 A;  2WI1 A;  3CRL A;  2IWX A;  3B25 A;  2HCH A;  5FNC A;  3TUH A;  2EXL A;  4HZ5 A;  5F5R A;  4CE3 A;  2YI5 A;  3CGY A;  3D2R A;  1ZWH A;  5CTY A;  3ZM7 A;  2YI6 A;  5CF0 A;  3C11 A;  2XCM A;  2YE5 A;  4HY6 A;  4LWH A;  3JZ3 A;  3G75 A;  3K98 A;  2HKJ A;  2BYH A;  2XAB A;  3O2F A;  4GGL A;  3RLQ A;  3OW6 A;  4GT8 A;  3OMU A;  4BAE A;  1GJV A;  1ID0 A;  3T0H A;  4YKY A;  2H55 A;  2YE7 A;  3EKR A;  2O1V A;  2XDS A;  3LPS A;  1U2O A;  5C93 A;  2YEC A;  2GQP A;  1QYE A;  4YKZ A;  2BYI A;  4LWI A;  2Q8G A;  4PRX A;  1YC3 A;  2YI7 A;  5IDM A;  5M4H A;  1B62 A;  5FWK A;  4LP0 A;  4P8O A;  4EM7 A;  3QTF A;  4BXI A;  2IOR A;  4XE2 A;  1UYD A;  4YKR A;  3VHA A;  2YK9 A;  1UYE A;  3RLR A;  1UYK A;  3OWB A;  2WER A;  4K4O A;  4HXZ A;  4DUH A;  2GFD A;  2YKI A;  1YET A;  4HYP A;  4X9L A;  1B3Q A;  2YI0 A;  3WQ9 A;  2XD6 A;  2JJC A;  5D7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...