3EHHA

Crystal structure of deskc-h188v in complex with adp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
200
structure length
192
Chain Sequence
b'NERIAELVKLEERQRMARDLVDTLGQKLSLMGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSSMKGIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQAKTCRVDIQQLWKEVVITVSDDGTFKGHGLLGMRERLEFANGSLHIDTENGTKLTMAIPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor kinase (YocF protein)
publication title Structural plasticity and catalysis regulation of a thermosensor histidine kinase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 59
structure length 192
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07730 HisKA_3 Histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3ehhA02
2YGEA 3TUHA 2XDLA 5F5RA 1U2OA 1YC1A 3B28A 3Q5KA 2QF6A 1AMWA 1H7UA 1UY9A 1UYMA 3B27A 1AJ6A 1Y8OA 2E0AA 1TBWA 3O2FA 2Q2EB 2WI2A 2AKPA 2WI4A 1Z5CA 4HYPA 1TC6A 1I5AA 5CPHA 4HZ5A 1AH6A 2QG0A 3INWA 4FMTA 1U0ZA 1Y4UA 1YT1A 4V25A 4BXIA 4PRXA 4GEEA 4KSHA 1YC4A 4NH9A 2XX2A 1UYDA 5BOCA 5FNCA 2CCSA 2IWXA 2IORA 4V26A 1B3QA 3R4NA 3T10A 4EGIA 3K98A 2YK9A 2JJCA 4O04A 1QZRA 1EI1A 4GGLA 3T0ZA 4MOTA 4LP0A 2XHRA 1ID0A 3VHDA 4GQTA 5CF0A 4YKTA 3EKRA 3R4MA 4L90A 4R3MA 4JAVA 4PU9A 2XCMA 2FYPA 4XITA 3PEHA 3HHUA 4AWPA 1QYEA 2QFOA 2IWUA 4E00A 2XDXA 4WUCA 2BSMA 2BU8A 4XCLA 1YT0A 2XK2A 1BXDA 3TZ5A 3GIGA 1BGQA 4JQLA 3PEJA 5FWKA 3G7BA 4LWHA 1UYIA 5D7DA 5M4HA 2UWDA 2HG1A 4XDMA 3ZKDA 3FT8A 4R3AA 2YE9A 2HCHA 2YGFA 2YGAA 3U2KA 3A0XA 4YKYA 2H8MA 1THNA 4HY6A 4YKZA 4O07A 4U7OA 2H55A 2BREA 1YS3A 4X9LA 5J71A 4BAEA 3TTZA 5C93A 1TIDA 2BU7A 1UYKA 2FWZA 3R4PA 4URLA 3SL2A 2K5BA 1I58A 3CGYA 2FXSA 2VCJA 4L8ZA 4CWTA 1B62A 1UY6A 1TH8A 3A0YA 4EFUA 5M4KA 2IOPA 4XTJA 1UYGA 3A0RA 2VW5A 1I5DA 2YEGA 1MU5A 2CGFA 4KFGA 5M4MA 2C2AA 4LPBA 5BODA 2YE6A 1GKXA 2YEIA 1ZW9A 3K99A 2XDSA 4YKXA 4YKUA 4XIPA 2WEPA 3R91A 3K97A 3HZ1A 4CWPA 1ZWHA 2FWYA 2YECA 1S16A 1QY8A 3R4OA 3RKZA 3HZ5A 2XJXA 2YI5A 3EHGA 3Q5LA 2WI3A 3O0IA 5CTXA 4MBCA 4CE2A 4LWIA 4CE3A 1YC3A 3OWBA 2YEEA 3U67A 4CWRA 4XKKA 3WHAA 2Q8IA 1US7A 3A0ZA 1I5CA 4Q20A 3ZXQA 3GIEA 4U93A 4QPKA 2YE2A 2XD6A 4B7PA 4ASAA 1R62A 4W7TA 4E01A 2WI7A 4EM7A 5L3JA 4EGHA 1TILA 4L93A 4URNA 2BYHA 1YSZA 3INXA 2ESAA 3R92A 3O6OA 2BYIA 1Y4SA 5F3KA 1YERA 4ZKIA 1UYCA 2YE8A 1NHJA 2WERA 2YI7A 1YESA 2XJGA 2WI1A 2YE5A 5M4NA 2ZDYA 1YETA 1Z5AA 5IDMA 3TZ2A 2YI6A 4XKAA 4FPPA 4NH8A 2YE7A 4ZVIA 2BRCA 4HXZA 4CWOA 3GIGB 4YKQA 3D2RA 4HZ0A 3D0BA 4GCZA 4CWFA 1GJVA 5D6PA 2Q8FA 4URMA 2XHTA 3GIFA 3OPDA 2YEBA 4AWQA 4EMVA 4LWGA 1KZNA 4CWSA 1Y8NA 4UROA 2PNRA 2YEHA 2YEJA 4PL9A 1UYLA 2ZKJA 4YKWA 4H7QA 1MX0A 4YKRA 1B63A 4ASBA 2VWCA 4JASA 5M4PA 4XE2A 3G7EA 3H80A 5FNFA 2YJXA 1A4HA 3FT5A 2WEQA 4WUDA 1OSFA 1BYQA 2XX5A 2GQPA 1ZXMA 4O09A 4I3HA 5CTYA 2XHXA 4R1FA 3ZXOA 2WI5A 4L91A 1TC0A 2YEAA 2BU6A 3G75A 3C11A 3TZ0A 2YKJA 2O1VA 4ASFA 1I5BA 1KIJA 4I5SA 1NHIA 2YKEA 4PRVA 5CTWA 2O1UA 4P8OA 2Q8GA 3D36A 3T0HA 4AS9A 3HEKA 4MP2A 3VHCA 4ASGA 4QPJA 2CG9A 3B26A 4BIZA 2BT0A 4CE1A 2YKBA 3A0WA 2BU5A 2ZBKB 3RLPA 4MPCA 4HY1A 4H81A 4WUBA 3KE6A 2YKIA 4KSGA 5D7CA 2ZDXA 3EHFA 1JM6A 4GT8A 4U7NA 1UY7A 2YEDA 3C0EA 2XJJA 3EHJA 2EXLA 4KTNA 3BM9A 3JZ3A 1YT2A 5IDJA 1PVGA 4HXWA 4O0BA 2GFDA 3HYZA 4KP4A 2O1WA 4LWFA 2YKCA 1AH8A 3QDDA 2XX4A 3FV5A 4EGKA 2CH4A 4MB9A 4FCPA 4L94A 4EFTA 4MP7A 1S14A 3Q5JA 4O05A 3BMYA 1AM1A 3MNRP 5CTUA 3LPSA 5FNDA 1UYHA 3OWDA 2Q8HA 2VCIA 3QTFA 5GGZA 3CGZA 1ZXNA 4GFNA 5D7RA 3TZ4A 3ZKBA 4XIQA 5J6AA 3IEDA 3NMQA 3CWVA 2IOQA 4KQVA 2YJWA 4P7AA 2YE4A 3A0TA 4DUHA 3OMUA 4B6CA 4XC0A 2XDUA 1UY8A 4BQJA 2BU2A 3K60A 1EA6A 1I59A 4XKOA 3RLQA 2YE3A 2JKIA 4MPNA 2YI0A 3H4LA 5IN9A 3T2SA 2BTZA 1UYEA 4XD8A 3CRLA 3CRKA 4CWNA 4AWOA 1NHHA 3VADA 4CWQA 1UYFA 4H85A 2XABA 2YK2A 4HYMA 3B25A 3HYYA 2CCUA 4FCRA 3RLRA 4E02A 4FCQA 4LWEA 1H7SA 3VHAA 3WQ9A 3B24A 2BZ5A 2WI6A 2XDKA 4NH7A 4XIRA 1Z59A 2QG2A 1L0OA 4XCJA 3ZM7A 2IWSA 3EHHA 3OW6A 1YSRA 2HKJA 4MPEA 1Y8PA 5D6QA 3LNUA 4JAUA 5M4EA 3DGEA 3U2DA 1Z5BA 4K4OA 4DZYA 3EKOA 2CCTA 4BQGA 1BKNA 3T1KA 2YEFA 4EEHA 1GKZA 4BIUA
chains in the Genus database with same CATH superfamily
2YGEA 3TUHA 2XDLA 5F5RA 1U2OA 1YC1A 3B28A 3Q5KA 2QF6A 1AMWA 1H7UA 1UY9A 1UYMA 3B27A 2FTKA 1AJ6A 1Y8OA 2E0AA 1TBWA 3O2FA 2Q2EB 2WI2A 2AKPA 2WI4A 1Z5CA 4HYPA 1TC6A 1IXMA 1I5AA 5CPHA 4HZ5A 1AH6A 2QG0A 3INWA 4FMTA 1U0ZA 1Y4UA 1YT1A 4V25A 4BXIA 4PRXA 4GEEA 4KSHA 1YC4A 4NH9A 2XX2A 1UYDA 5BOCA 5FNCA 2CCSA 2IWXA 2IORA 4V26A 1B3QA 3R4NA 3T10A 4EGIA 3K98A 2YK9A 2JJCA 4O04A 1QZRA 1EI1A 4GGLA 3T0ZA 4MOTA 4LP0A 2XHRA 4E72A 1ID0A 3VHDA 4GQTA 5CF0A 4YKTA 3EKRA 3R4MA 4L90A 4R3MA 4JAVA 4PU9A 5JENA 2XCMA 2FYPA 4XITA 3CYGA 3PEHA 3HHUA 4AWPA 1QYEA 2QFOA 2IWUA 4E00A 2XDXA 4WUCA 2BSMA 2BU8A 4XCLA 1YT0A 2XK2A 1BXDA 3TZ5A 3GIGA 1BGQA 4JQLA 3PEJA 5FWKA 3G7BA 4LWHA 2HHIA 1UYIA 5D7DA 5M4HA 2UWDA 2HG1A 4XDMA 3ZKDA 3FT8A 4R3AA 2YE9A 2HCHA 2YGFA 2YGAA 3U2KA 3S5TA 3A0XA 4YKYA 2H8MA 1THNA 4HY6A 4YKZA 4O07A 4U7OA 2H55A 2BREA 1YS3A 4X9LA 5J71A 4BAEA 3TTZA 5C93A 1TIDA 2BU7A 1UYKA 2FWZA 3R4PA 4URLA 3SL2A 2K5BA 1I58A 3CGYA 2FXSA 2VCJA 4L8ZA 4CWTA 1B62A 1UY6A 1TH8A 3A0YA 4EFUA 5M4KA 2IOPA 4XTJA 1UYGA 3A0RA 2VW5A 1I5DA 2YEGA 1MU5A 2CGFA 4KFGA 5M4MA 2C2AA 4LPBA 5BODA 2YE6A 1GKXA 2YEIA 1ZW9A 3K99A 2XDSA 4YKXA 4YKUA 4XIPA 2WEPA 3R91A 3K97A 3HZ1A 4CWPA 1ZWHA 2FWYA 2YECA 1S16A 1QY8A 3R4OA 3RKZA 3HZ5A 2XJXA 2YI5A 3EHGA 3Q5LA 2WI3A 3O0IA 5CTXA 4MBCA 4CE2A 4LWIA 4CE3A 1YC3A 3OWBA 2YEEA 3U67A 4CWRA 4XKKA 3WHAA 2Q8IA 1US7A 3A0ZA 1I5CA 4Q20A 3ZXQA 3GIEA 4U93A 4QPKA 2YE2A 2XD6A 4B7PA 4ASAA 1R62A 4W7TA 4E01A 2WI7A 4EM7A 5L3JA 4EGHA 1TILA 4L93A 4URNA 2BYHA 1YSZA 3INXA 2ESAA 3R92A 3O6OA 2BYIA 1Y4SA 5F3KA 1YERA 4ZKIA 1UYCA 2YE8A 1NHJA 2WERA 2YI7A 1YESA 2XJGA 2WI1A 2YE5A 5M4NA 2ZDYA 1YETA 1Z5AA 5IDMA 3TZ2A 2YI6A 4XKAA 4FPPA 4NH8A 2YE7A 4ZVIA 2C1GA 2BRCA 4HXZA 4CWOA 3GIGB 4YKQA 3D2RA 4HZ0A 3D0BA 4GCZA 4CWFA 1GJVA 5D6PA 2Q8FA 3LMMA 4URMA 2XHTA 3GIFA 3OPDA 2YEBA 4AWQA 4EMVA 4LWGA 1KZNA 4CWSA 1Y8NA 4UROA 2PNRA 2YEHA 2YEJA 4PL9A 1UYLA 2ZKJA 4YKWA 4H7QA 1MX0A 4YKRA 1B63A 4ASBA 2VWCA 4JASA 5M4PA 4XE2A 3G7EA 3H80A 5FNFA 2YJXA 1A4HA 3FT5A 2WEQA 4WUDA 1OSFA 1BYQA 2XX5A 2GQPA 1ZXMA 4O09A 4I3HA 5CTYA 2XHXA 4R1FA 3ZXOA 2WI5A 4L91A 1TC0A 2YEAA 2BU6A 3G75A 3C11A 3TZ0A 2YKJA 2O1VA 4ASFA 1I5BA 1KIJA 4I5SA 1NHIA 2YKEA 4PRVA 5CTWA 2O1UA 4P8OA 2Q8GA 3D36A 3T0HA 4AS9A 3HEKA 4MP2A 3VHCA 4ASGA 4QPJA 2CG9A 3B26A 4BIZA 2BT0A 4CE1A 2YKBA 3A0WA 2BU5A 2ZBKB 3RLPA 4MPCA 4HY1A 4H81A 4WUBA 3KE6A 2YKIA 4KSGA 5D7CA 2ZDXA 3EHFA 1JM6A 4GT8A 4U7NA 1UY7A 2YEDA 3C0EA 2XJJA 3EHJA 2EXLA 4KTNA 3BM9A 3JZ3A 1YT2A 5IDJA 1PVGA 4HXWA 1F51A 4O0BA 2GFDA 3HYZA 4KP4A 2O1WA 4LWFA 2YKCA 1AH8A 3QDDA 2XX4A 3FV5A 4EGKA 2CH4A 4MB9A 4FCPA 4L94A 4EFTA 4MP7A 1S14A 3Q5JA 4O05A 3BMYA 1AM1A 3MNRP 5CTUA 3LPSA 5FNDA 1UYHA 3OWDA 2Q8HA 2VCIA 3QTFA 5GGZA 3CGZA 1ZXNA 4GFNA 5D7RA 3TZ4A 3ZKBA 4XIQA 5J6AA 3IEDA 3NMQA 3CWVA 2IOQA 4KQVA 2YJWA 4P7AA 2YE4A 3A0TA 4DUHA 3OMUA 4B6CA 4XC0A 2XDUA 1UY8A 4BQJA 2BU2A 3K60A 1EA6A 1I59A 4XKOA 3RLQA 2YE3A 2JKIA 4MPNA 2YI0A 3H4LA 5IN9A 3T2SA 2BTZA 1UYEA 4XD8A 3CRLA 3CRKA 4CWNA 4AWOA 1NHHA 3VADA 4CWQA 1UYFA 4H85A 2XABA 2YK2A 4HYMA 3B25A 3HYYA 2CCUA 4FCRA 3RLRA 4E02A 4FCQA 4LWEA 1H7SA 3VHAA 3WQ9A 3B24A 2BZ5A 2WI6A 2XDKA 4NH7A 4XIRA 1Z59A 2QG2A 1L0OA 4XCJA 3ZM7A 2IWSA 3EHHA 3OW6A 1YSRA 2HKJA 4MPEA 1Y8PA 5D6QA 3LNUA 4JAUA 5M4EA 3DGEA 3U2DA 1Z5BA 4K4OA 2C1IA 4DZYA 3EKOA 2CCTA 4BQGA 1BKNA 3T1KA 2YEFA 4EEHA 1GKZA 4BIUA
chains in the Genus database with same CATH topology
2YGEA 3TUHA 2XDLA 5F5RA 1U2OA 1YC1A 3B28A 3Q5KA 2QF6A 1AMWA 1H7UA 1UY9A 1UYMA 3B27A 1AJ6A 1Y8OA 2E0AA 1TBWA 3O2FA 2Q2EB 2WI2A 2AKPA 2WI4A 1Z5CA 4HYPA 1TC6A 1I5AA 5CPHA 4HZ5A 1AH6A 2QG0A 3INWA 4FMTA 1U0ZA 1Y4UA 1YT1A 4V25A 4BXIA 4PRXA 4GEEA 4KSHA 1YC4A 4NH9A 2XX2A 1UYDA 5BOCA 5FNCA 2CCSA 2IWXA 2IORA 4V26A 1B3QA 3R4NA 3T10A 4EGIA 3K98A 2YK9A 2JJCA 4O04A 1QZRA 1EI1A 4GGLA 3T0ZA 4MOTA 4LP0A 2XHRA 1ID0A 3VHDA 4GQTA 5CF0A 4YKTA 3EKRA 3R4MA 4L90A 4R3MA 4JAVA 4PU9A 2XCMA 2FYPA 4XITA 3PEHA 3HHUA 4AWPA 1QYEA 2QFOA 2IWUA 4E00A 2XDXA 4WUCA 2BSMA 2BU8A 4XCLA 1YT0A 2XK2A 1BXDA 3TZ5A 3GIGA 1BGQA 4JQLA 3PEJA 5FWKA 3G7BA 4LWHA 1UYIA 5D7DA 5M4HA 2UWDA 2HG1A 4XDMA 3ZKDA 3FT8A 4R3AA 2YE9A 2HCHA 2YGFA 2YGAA 3U2KA 3A0XA 4YKYA 2H8MA 1THNA 4HY6A 4YKZA 4O07A 4U7OA 2H55A 2BREA 1YS3A 4X9LA 5J71A 4BAEA 3TTZA 5C93A 1TIDA 2BU7A 1UYKA 2FWZA 3R4PA 4URLA 3SL2A 2K5BA 1I58A 3CGYA 2FXSA 2VCJA 4L8ZA 4CWTA 1B62A 1UY6A 1TH8A 3A0YA 4EFUA 5M4KA 2IOPA 4XTJA 1UYGA 3A0RA 2VW5A 1I5DA 2YEGA 1MU5A 2CGFA 4KFGA 5M4MA 2C2AA 4LPBA 5BODA 2YE6A 1GKXA 2YEIA 1ZW9A 3K99A 2XDSA 4YKXA 4YKUA 4XIPA 2WEPA 3R91A 3K97A 3HZ1A 4CWPA 1ZWHA 2FWYA 2YECA 1S16A 1QY8A 3R4OA 3RKZA 3HZ5A 2XJXA 2YI5A 3EHGA 3Q5LA 2WI3A 3O0IA 5CTXA 4MBCA 4CE2A 4LWIA 4CE3A 1YC3A 3OWBA 2YEEA 3U67A 4CWRA 4XKKA 3WHAA 2Q8IA 1US7A 3A0ZA 1I5CA 4Q20A 3ZXQA 3GIEA 4U93A 4QPKA 2YE2A 2XD6A 4B7PA 4ASAA 1R62A 4W7TA 4E01A 2WI7A 4EM7A 5L3JA 4EGHA 1TILA 4L93A 4URNA 2BYHA 1YSZA 3INXA 2ESAA 3R92A 3O6OA 2BYIA 1Y4SA 5F3KA 1YERA 4ZKIA 1UYCA 2YE8A 1NHJA 2WERA 2YI7A 1YESA 2XJGA 2WI1A 2YE5A 5M4NA 2ZDYA 1YETA 1Z5AA 5IDMA 3TZ2A 2YI6A 4XKAA 4FPPA 4NH8A 2YE7A 4ZVIA 2BRCA 4HXZA 4CWOA 3GIGB 4YKQA 3D2RA 4HZ0A 3D0BA 4GCZA 4CWFA 1GJVA 5D6PA 2Q8FA 4URMA 2XHTA 3GIFA 3OPDA 2YEBA 4AWQA 4EMVA 4LWGA 1KZNA 4CWSA 1Y8NA 4UROA 2PNRA 2YEHA 2YEJA 4PL9A 1UYLA 2ZKJA 4YKWA 4H7QA 1MX0A 4YKRA 1B63A 4ASBA 2VWCA 4JASA 5M4PA 4XE2A 3G7EA 3H80A 5FNFA 2YJXA 1A4HA 3FT5A 2WEQA 4WUDA 1OSFA 1BYQA 2XX5A 2GQPA 1ZXMA 4O09A 4I3HA 5CTYA 2XHXA 4R1FA 3ZXOA 2WI5A 4L91A 1TC0A 2YEAA 2BU6A 3G75A 3C11A 3TZ0A 2YKJA 2O1VA 4ASFA 1I5BA 1KIJA 4I5SA 1NHIA 2YKEA 4PRVA 5CTWA 2O1UA 4P8OA 2Q8GA 3D36A 3T0HA 4AS9A 3HEKA 4MP2A 3VHCA 4ASGA 4QPJA 2CG9A 3B26A 4BIZA 2BT0A 4CE1A 2YKBA 3A0WA 2BU5A 2ZBKB 3RLPA 4MPCA 4HY1A 4H81A 4WUBA 3KE6A 2YKIA 4KSGA 5D7CA 2ZDXA 3EHFA 1JM6A 4GT8A 4U7NA 1UY7A 2YEDA 3C0EA 2XJJA 3EHJA 2EXLA 4KTNA 3BM9A 3JZ3A 1YT2A 5IDJA 1PVGA 4HXWA 4O0BA 2GFDA 3HYZA 4KP4A 2O1WA 4LWFA 2YKCA 1AH8A 3QDDA 2XX4A 3FV5A 4EGKA 2CH4A 4MB9A 4FCPA 4L94A 4EFTA 4MP7A 1S14A 3Q5JA 4O05A 3BMYA 1AM1A 3MNRP 5CTUA 3LPSA 5FNDA 1UYHA 3OWDA 2Q8HA 2VCIA 3QTFA 5GGZA 3CGZA 1ZXNA 4GFNA 5D7RA 3TZ4A 3ZKBA 4XIQA 5J6AA 3IEDA 3NMQA 3CWVA 2IOQA 4KQVA 2YJWA 4P7AA 2YE4A 3A0TA 4DUHA 3OMUA 4B6CA 4XC0A 2XDUA 1UY8A 4BQJA 2BU2A 3K60A 1EA6A 1I59A 4XKOA 3RLQA 2YE3A 2JKIA 4MPNA 2YI0A 3H4LA 5IN9A 3T2SA 2BTZA 1UYEA 4XD8A 3CRLA 3CRKA 4CWNA 4AWOA 1NHHA 3VADA 4CWQA 1UYFA 4H85A 2XABA 2YK2A 4HYMA 3B25A 3HYYA 2CCUA 4FCRA 3RLRA 4E02A 4FCQA 4LWEA 1H7SA 3VHAA 3WQ9A 3B24A 2BZ5A 2WI6A 2XDKA 4NH7A 4XIRA 1Z59A 2QG2A 1L0OA 4XCJA 3ZM7A 2IWSA 3EHHA 3OW6A 1YSRA 2HKJA 4MPEA 1Y8PA 5D6QA 3LNUA 4JAUA 5M4EA 3DGEA 3U2DA 1Z5BA 4K4OA 4DZYA 3EKOA 2CCTA 4BQGA 1BKNA 3T1KA 2YEFA 4EEHA 1GKZA 4BIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YGE A;  3TUH A;  2XDL A;  5F5R A;  1U2O A;  1YC1 A;  3B28 A;  3Q5K A;  2QF6 A;  1AMW A;  1H7U A;  1UY9 A;  1UYM A;  3B27 A;  1AJ6 A;  1Y8O A;  2E0A A;  1TBW A;  3O2F A;  2Q2E B;  2WI2 A;  2AKP A;  2WI4 A;  1Z5C A;  4HYP A;  1TC6 A;  1I5A A;  5CPH A;  4HZ5 A;  1AH6 A;  2QG0 A;  3INW A;  4FMT A;  1U0Z A;  1Y4U A;  1YT1 A;  4V25 A;  4BXI A;  4PRX A;  4GEE A;  4KSH A;  1YC4 A;  4NH9 A;  2XX2 A;  1UYD A;  5BOC A;  5FNC A;  2CCS A;  2IWX A;  2IOR A;  4V26 A;  1B3Q A;  3R4N A;  3T10 A;  4EGI A;  3K98 A;  2YK9 A;  2JJC A;  4O04 A;  1QZR A;  1EI1 A;  4GGL A;  3T0Z A;  4MOT A;  4LP0 A;  2XHR A;  1ID0 A;  3VHD A;  4GQT A;  5CF0 A;  4YKT A;  3EKR A;  3R4M A;  4L90 A;  4R3M A;  4JAV A;  4PU9 A;  2XCM A;  2FYP A;  4XIT A;  3PEH A;  3HHU A;  4AWP A;  1QYE A;  2QFO A;  2IWU A;  4E00 A;  2XDX A;  4WUC A;  2BSM A;  2BU8 A;  4XCL A;  1YT0 A;  2XK2 A;  1BXD A;  3TZ5 A;  3GIG A;  1BGQ A;  4JQL A;  3PEJ A;  5FWK A;  3G7B A;  4LWH A;  1UYI A;  5D7D A;  5M4H A;  2UWD A;  2HG1 A;  4XDM A;  3ZKD A;  3FT8 A;  4R3A A;  2YE9 A;  2HCH A;  2YGF A;  2YGA A;  3U2K A;  3A0X A;  4YKY A;  2H8M A;  1THN A;  4HY6 A;  4YKZ A;  4O07 A;  4U7O A;  2H55 A;  2BRE A;  1YS3 A;  4X9L A;  5J71 A;  4BAE A;  3TTZ A;  5C93 A;  1TID A;  2BU7 A;  1UYK A;  2FWZ A;  3R4P A;  4URL A;  3SL2 A;  2K5B A;  1I58 A;  3CGY A;  2FXS A;  2VCJ A;  4L8Z A;  4CWT A;  1B62 A;  1UY6 A;  1TH8 A;  3A0Y A;  4EFU A;  5M4K A;  2IOP A;  4XTJ A;  1UYG A;  3A0R A;  2VW5 A;  1I5D A;  2YEG A;  1MU5 A;  2CGF A;  4KFG A;  5M4M A;  2C2A A;  4LPB A;  5BOD A;  2YE6 A;  1GKX A;  2YEI A;  1ZW9 A;  3K99 A;  2XDS A;  4YKX A;  4YKU A;  4XIP A;  2WEP A;  3R91 A;  3K97 A;  3HZ1 A;  4CWP A;  1ZWH A;  2FWY A;  2YEC A;  1S16 A;  1QY8 A;  3R4O A;  3RKZ A;  3HZ5 A;  2XJX A;  2YI5 A;  3EHG A;  3Q5L A;  2WI3 A;  3O0I A;  5CTX A;  4MBC A;  4CE2 A;  4LWI A;  4CE3 A;  1YC3 A;  3OWB A;  2YEE A;  3U67 A;  4CWR A;  4XKK A;  3WHA A;  2Q8I A;  1US7 A;  3A0Z A;  1I5C A;  4Q20 A;  3ZXQ A;  3GIE A;  4U93 A;  4QPK A;  2YE2 A;  2XD6 A;  4B7P A;  4ASA A;  1R62 A;  4W7T A;  4E01 A;  2WI7 A;  4EM7 A;  5L3J A;  4EGH A;  1TIL A;  4L93 A;  4URN A;  2BYH A;  1YSZ A;  3INX A;  2ESA A;  3R92 A;  3O6O A;  2BYI A;  1Y4S A;  5F3K A;  1YER A;  4ZKI A;  1UYC A;  2YE8 A;  1NHJ A;  2WER A;  2YI7 A;  1YES A;  2XJG A;  2WI1 A;  2YE5 A;  5M4N A;  2ZDY A;  1YET A;  1Z5A A;  5IDM A;  3TZ2 A;  2YI6 A;  4XKA A;  4FPP A;  4NH8 A;  2YE7 A;  4ZVI A;  2BRC A;  4HXZ A;  4CWO A;  3GIG B;  4YKQ A;  3D2R A;  4HZ0 A;  3D0B A;  4GCZ A;  4CWF A;  1GJV A;  5D6P A;  2Q8F A;  4URM A;  2XHT A;  3GIF A;  3OPD A;  2YEB A;  4AWQ A;  4EMV A;  4LWG A;  1KZN A;  4CWS A;  1Y8N A;  4URO A;  2PNR A;  2YEH A;  2YEJ A;  4PL9 A;  1UYL A;  2ZKJ A;  4YKW A;  4H7Q A;  1MX0 A;  4YKR A;  1B63 A;  4ASB A;  2VWC A;  4JAS A;  5M4P A;  4XE2 A;  3G7E A;  3H80 A;  5FNF A;  2YJX A;  1A4H A;  3FT5 A;  2WEQ A;  4WUD A;  1OSF A;  1BYQ A;  2XX5 A;  2GQP A;  1ZXM A;  4O09 A;  4I3H A;  5CTY A;  2XHX A;  4R1F A;  3ZXO A;  2WI5 A;  4L91 A;  1TC0 A;  2YEA A;  2BU6 A;  3G75 A;  3C11 A;  3TZ0 A;  2YKJ A;  2O1V A;  4ASF A;  1I5B A;  1KIJ A;  4I5S A;  1NHI A;  2YKE A;  4PRV A;  5CTW A;  2O1U A;  4P8O A;  2Q8G A;  3D36 A;  3T0H A;  4AS9 A;  3HEK A;  4MP2 A;  3VHC A;  4ASG A;  4QPJ A;  2CG9 A;  3B26 A;  4BIZ A;  2BT0 A;  4CE1 A;  2YKB A;  3A0W A;  2BU5 A;  2ZBK B;  3RLP A;  4MPC A;  4HY1 A;  4H81 A;  4WUB A;  3KE6 A;  2YKI A;  4KSG A;  5D7C A;  2ZDX A;  3EHF A;  1JM6 A;  4GT8 A;  4U7N A;  1UY7 A;  2YED A;  3C0E A;  2XJJ A;  3EHJ A;  2EXL A;  4KTN A;  3BM9 A;  3JZ3 A;  1YT2 A;  5IDJ A;  1PVG A;  4HXW A;  4O0B A;  2GFD A;  3HYZ A;  4KP4 A;  2O1W A;  4LWF A;  2YKC A;  1AH8 A;  3QDD A;  2XX4 A;  3FV5 A;  4EGK A;  2CH4 A;  4MB9 A;  4FCP A;  4L94 A;  4EFT A;  4MP7 A;  1S14 A;  3Q5J A;  4O05 A;  3BMY A;  1AM1 A;  3MNR P;  5CTU A;  3LPS A;  5FND A;  1UYH A;  3OWD A;  2Q8H A;  2VCI A;  3QTF A;  5GGZ A;  3CGZ A;  1ZXN A;  4GFN A;  5D7R A;  3TZ4 A;  3ZKB A;  4XIQ A;  5J6A A;  3IED A;  3NMQ A;  3CWV A;  2IOQ A;  4KQV A;  2YJW A;  4P7A A;  2YE4 A;  3A0T A;  4DUH A;  3OMU A;  4B6C A;  4XC0 A;  2XDU A;  1UY8 A;  4BQJ A;  2BU2 A;  3K60 A;  1EA6 A;  1I59 A;  4XKO A;  3RLQ A;  2YE3 A;  2JKI A;  4MPN A;  2YI0 A;  3H4L A;  5IN9 A;  3T2S A;  2BTZ A;  1UYE A;  4XD8 A;  3CRL A;  3CRK A;  4CWN A;  4AWO A;  1NHH A;  3VAD A;  4CWQ A;  1UYF A;  4H85 A;  2XAB A;  2YK2 A;  4HYM A;  3B25 A;  3HYY A;  2CCU A;  4FCR A;  3RLR A;  4E02 A;  4FCQ A;  4LWE A;  1H7S A;  3VHA A;  3WQ9 A;  3B24 A;  2BZ5 A;  2WI6 A;  2XDK A;  4NH7 A;  4XIR A;  1Z59 A;  2QG2 A;  1L0O A;  4XCJ A;  3ZM7 A;  2IWS A;  3EHH A;  3OW6 A;  1YSR A;  2HKJ A;  4MPE A;  1Y8P A;  5D6Q A;  3LNU A;  4JAU A;  5M4E A;  3DGE A;  3U2D A;  1Z5B A;  4K4O A;  4DZY A;  3EKO A;  2CCT A;  4BQG A;  1BKN A;  3T1K A;  2YEF A;  4EEH A;  1GKZ A;  4BIU A; 
#chains in the Genus database with same CATH topology
 2YGE A;  3TUH A;  2XDL A;  5F5R A;  1U2O A;  1YC1 A;  3B28 A;  3Q5K A;  2QF6 A;  1AMW A;  1H7U A;  1UY9 A;  1UYM A;  3B27 A;  2FTK A;  1AJ6 A;  1Y8O A;  2E0A A;  1TBW A;  3O2F A;  2Q2E B;  2WI2 A;  2AKP A;  2WI4 A;  1Z5C A;  4HYP A;  1TC6 A;  1IXM A;  1I5A A;  5CPH A;  4HZ5 A;  1AH6 A;  2QG0 A;  3INW A;  4FMT A;  1U0Z A;  1Y4U A;  1YT1 A;  4V25 A;  4BXI A;  4PRX A;  4GEE A;  4KSH A;  1YC4 A;  4NH9 A;  2XX2 A;  1UYD A;  5BOC A;  5FNC A;  2CCS A;  2IWX A;  2IOR A;  4V26 A;  1B3Q A;  3R4N A;  3T10 A;  4EGI A;  3K98 A;  2YK9 A;  2JJC A;  4O04 A;  1QZR A;  1EI1 A;  4GGL A;  3T0Z A;  4MOT A;  4LP0 A;  2XHR A;  4E72 A;  1ID0 A;  3VHD A;  4GQT A;  5CF0 A;  4YKT A;  3EKR A;  3R4M A;  4L90 A;  4R3M A;  4JAV A;  4PU9 A;  5JEN A;  2XCM A;  2FYP A;  4XIT A;  3CYG A;  3PEH A;  3HHU A;  4AWP A;  1QYE A;  2QFO A;  2IWU A;  4E00 A;  2XDX A;  4WUC A;  2BSM A;  2BU8 A;  4XCL A;  1YT0 A;  2XK2 A;  1BXD A;  3TZ5 A;  3GIG A;  1BGQ A;  4JQL A;  3PEJ A;  5FWK A;  3G7B A;  4LWH A;  2HHI A;  1UYI A;  5D7D A;  5M4H A;  2UWD A;  2HG1 A;  4XDM A;  3ZKD A;  3FT8 A;  4R3A A;  2YE9 A;  2HCH A;  2YGF A;  2YGA A;  3U2K A;  3S5T A;  3A0X A;  4YKY A;  2H8M A;  1THN A;  4HY6 A;  4YKZ A;  4O07 A;  4U7O A;  2H55 A;  2BRE A;  1YS3 A;  4X9L A;  5J71 A;  4BAE A;  3TTZ A;  5C93 A;  1TID A;  2BU7 A;  1UYK A;  2FWZ A;  3R4P A;  4URL A;  3SL2 A;  2K5B A;  1I58 A;  3CGY A;  2FXS A;  2VCJ A;  4L8Z A;  4CWT A;  1B62 A;  1UY6 A;  1TH8 A;  3A0Y A;  4EFU A;  5M4K A;  2IOP A;  4XTJ A;  1UYG A;  3A0R A;  2VW5 A;  1I5D A;  2YEG A;  1MU5 A;  2CGF A;  4KFG A;  5M4M A;  2C2A A;  4LPB A;  5BOD A;  2YE6 A;  1GKX A;  2YEI A;  1ZW9 A;  3K99 A;  2XDS A;  4YKX A;  4YKU A;  4XIP A;  2WEP A;  3R91 A;  3K97 A;  3HZ1 A;  4CWP A;  1ZWH A;  2FWY A;  2YEC A;  1S16 A;  1QY8 A;  3R4O A;  3RKZ A;  3HZ5 A;  2XJX A;  2YI5 A;  3EHG A;  3Q5L A;  2WI3 A;  3O0I A;  5CTX A;  4MBC A;  4CE2 A;  4LWI A;  4CE3 A;  1YC3 A;  3OWB A;  2YEE A;  3U67 A;  4CWR A;  4XKK A;  3WHA A;  2Q8I A;  1US7 A;  3A0Z A;  1I5C A;  4Q20 A;  3ZXQ A;  3GIE A;  4U93 A;  4QPK A;  2YE2 A;  2XD6 A;  4B7P A;  4ASA A;  1R62 A;  4W7T A;  4E01 A;  2WI7 A;  4EM7 A;  5L3J A;  4EGH A;  1TIL A;  4L93 A;  4URN A;  2BYH A;  1YSZ A;  3INX A;  2ESA A;  3R92 A;  3O6O A;  2BYI A;  1Y4S A;  5F3K A;  1YER A;  4ZKI A;  1UYC A;  2YE8 A;  1NHJ A;  2WER A;  2YI7 A;  1YES A;  2XJG A;  2WI1 A;  2YE5 A;  5M4N A;  2ZDY A;  1YET A;  1Z5A A;  5IDM A;  3TZ2 A;  2YI6 A;  4XKA A;  4FPP A;  4NH8 A;  2YE7 A;  4ZVI A;  2C1G A;  2BRC A;  4HXZ A;  4CWO A;  3GIG B;  4YKQ A;  3D2R A;  4HZ0 A;  3D0B A;  4GCZ A;  4CWF A;  1GJV A;  5D6P A;  2Q8F A;  3LMM A;  4URM A;  2XHT A;  3GIF A;  3OPD A;  2YEB A;  4AWQ A;  4EMV A;  4LWG A;  1KZN A;  4CWS A;  1Y8N A;  4URO A;  2PNR A;  2YEH A;  2YEJ A;  4PL9 A;  1UYL A;  2ZKJ A;  4YKW A;  4H7Q A;  1MX0 A;  4YKR A;  1B63 A;  4ASB A;  2VWC A;  4JAS A;  5M4P A;  4XE2 A;  3G7E A;  3H80 A;  5FNF A;  2YJX A;  1A4H A;  3FT5 A;  2WEQ A;  4WUD A;  1OSF A;  1BYQ A;  2XX5 A;  2GQP A;  1ZXM A;  4O09 A;  4I3H A;  5CTY A;  2XHX A;  4R1F A;  3ZXO A;  2WI5 A;  4L91 A;  1TC0 A;  2YEA A;  2BU6 A;  3G75 A;  3C11 A;  3TZ0 A;  2YKJ A;  2O1V A;  4ASF A;  1I5B A;  1KIJ A;  4I5S A;  1NHI A;  2YKE A;  4PRV A;  5CTW A;  2O1U A;  4P8O A;  2Q8G A;  3D36 A;  3T0H A;  4AS9 A;  3HEK A;  4MP2 A;  3VHC A;  4ASG A;  4QPJ A;  2CG9 A;  3B26 A;  4BIZ A;  2BT0 A;  4CE1 A;  2YKB A;  3A0W A;  2BU5 A;  2ZBK B;  3RLP A;  4MPC A;  4HY1 A;  4H81 A;  4WUB A;  3KE6 A;  2YKI A;  4KSG A;  5D7C A;  2ZDX A;  3EHF A;  1JM6 A;  4GT8 A;  4U7N A;  1UY7 A;  2YED A;  3C0E A;  2XJJ A;  3EHJ A;  2EXL A;  4KTN A;  3BM9 A;  3JZ3 A;  1YT2 A;  5IDJ A;  1PVG A;  4HXW A;  1F51 A;  4O0B A;  2GFD A;  3HYZ A;  4KP4 A;  2O1W A;  4LWF A;  2YKC A;  1AH8 A;  3QDD A;  2XX4 A;  3FV5 A;  4EGK A;  2CH4 A;  4MB9 A;  4FCP A;  4L94 A;  4EFT A;  4MP7 A;  1S14 A;  3Q5J A;  4O05 A;  3BMY A;  1AM1 A;  3MNR P;  5CTU A;  3LPS A;  5FND A;  1UYH A;  3OWD A;  2Q8H A;  2VCI A;  3QTF A;  5GGZ A;  3CGZ A;  1ZXN A;  4GFN A;  5D7R A;  3TZ4 A;  3ZKB A;  4XIQ A;  5J6A A;  3IED A;  3NMQ A;  3CWV A;  2IOQ A;  4KQV A;  2YJW A;  4P7A A;  2YE4 A;  3A0T A;  4DUH A;  3OMU A;  4B6C A;  4XC0 A;  2XDU A;  1UY8 A;  4BQJ A;  2BU2 A;  3K60 A;  1EA6 A;  1I59 A;  4XKO A;  3RLQ A;  2YE3 A;  2JKI A;  4MPN A;  2YI0 A;  3H4L A;  5IN9 A;  3T2S A;  2BTZ A;  1UYE A;  4XD8 A;  3CRL A;  3CRK A;  4CWN A;  4AWO A;  1NHH A;  3VAD A;  4CWQ A;  1UYF A;  4H85 A;  2XAB A;  2YK2 A;  4HYM A;  3B25 A;  3HYY A;  2CCU A;  4FCR A;  3RLR A;  4E02 A;  4FCQ A;  4LWE A;  1H7S A;  3VHA A;  3WQ9 A;  3B24 A;  2BZ5 A;  2WI6 A;  2XDK A;  4NH7 A;  4XIR A;  1Z59 A;  2QG2 A;  1L0O A;  4XCJ A;  3ZM7 A;  2IWS A;  3EHH A;  3OW6 A;  1YSR A;  2HKJ A;  4MPE A;  1Y8P A;  5D6Q A;  3LNU A;  4JAU A;  5M4E A;  3DGE A;  3U2D A;  1Z5B A;  4K4O A;  2C1I A;  4DZY A;  3EKO A;  2CCT A;  4BQG A;  1BKN A;  3T1K A;  2YEF A;  4EEH A;  1GKZ A;  4BIU A; 
#chains in the Genus database with same CATH homology
 2YGE A;  3TUH A;  2XDL A;  5F5R A;  1U2O A;  1YC1 A;  3B28 A;  3Q5K A;  2QF6 A;  1AMW A;  1H7U A;  1UY9 A;  1UYM A;  3B27 A;  1AJ6 A;  1Y8O A;  2E0A A;  1TBW A;  3O2F A;  2Q2E B;  2WI2 A;  2AKP A;  2WI4 A;  1Z5C A;  4HYP A;  1TC6 A;  1I5A A;  5CPH A;  4HZ5 A;  1AH6 A;  2QG0 A;  3INW A;  4FMT A;  1U0Z A;  1Y4U A;  1YT1 A;  4V25 A;  4BXI A;  4PRX A;  4GEE A;  4KSH A;  1YC4 A;  4NH9 A;  2XX2 A;  1UYD A;  5BOC A;  5FNC A;  2CCS A;  2IWX A;  2IOR A;  4V26 A;  1B3Q A;  3R4N A;  3T10 A;  4EGI A;  3K98 A;  2YK9 A;  2JJC A;  4O04 A;  1QZR A;  1EI1 A;  4GGL A;  3T0Z A;  4MOT A;  4LP0 A;  2XHR A;  1ID0 A;  3VHD A;  4GQT A;  5CF0 A;  4YKT A;  3EKR A;  3R4M A;  4L90 A;  4R3M A;  4JAV A;  4PU9 A;  2XCM A;  2FYP A;  4XIT A;  3PEH A;  3HHU A;  4AWP A;  1QYE A;  2QFO A;  2IWU A;  4E00 A;  2XDX A;  4WUC A;  2BSM A;  2BU8 A;  4XCL A;  1YT0 A;  2XK2 A;  1BXD A;  3TZ5 A;  3GIG A;  1BGQ A;  4JQL A;  3PEJ A;  5FWK A;  3G7B A;  4LWH A;  1UYI A;  5D7D A;  5M4H A;  2UWD A;  2HG1 A;  4XDM A;  3ZKD A;  3FT8 A;  4R3A A;  2YE9 A;  2HCH A;  2YGF A;  2YGA A;  3U2K A;  3A0X A;  4YKY A;  2H8M A;  1THN A;  4HY6 A;  4YKZ A;  4O07 A;  4U7O A;  2H55 A;  2BRE A;  1YS3 A;  4X9L A;  5J71 A;  4BAE A;  3TTZ A;  5C93 A;  1TID A;  2BU7 A;  1UYK A;  2FWZ A;  3R4P A;  4URL A;  3SL2 A;  2K5B A;  1I58 A;  3CGY A;  2FXS A;  2VCJ A;  4L8Z A;  4CWT A;  1B62 A;  1UY6 A;  1TH8 A;  3A0Y A;  4EFU A;  5M4K A;  2IOP A;  4XTJ A;  1UYG A;  3A0R A;  2VW5 A;  1I5D A;  2YEG A;  1MU5 A;  2CGF A;  4KFG A;  5M4M A;  2C2A A;  4LPB A;  5BOD A;  2YE6 A;  1GKX A;  2YEI A;  1ZW9 A;  3K99 A;  2XDS A;  4YKX A;  4YKU A;  4XIP A;  2WEP A;  3R91 A;  3K97 A;  3HZ1 A;  4CWP A;  1ZWH A;  2FWY A;  2YEC A;  1S16 A;  1QY8 A;  3R4O A;  3RKZ A;  3HZ5 A;  2XJX A;  2YI5 A;  3EHG A;  3Q5L A;  2WI3 A;  3O0I A;  5CTX A;  4MBC A;  4CE2 A;  4LWI A;  4CE3 A;  1YC3 A;  3OWB A;  2YEE A;  3U67 A;  4CWR A;  4XKK A;  3WHA A;  2Q8I A;  1US7 A;  3A0Z A;  1I5C A;  4Q20 A;  3ZXQ A;  3GIE A;  4U93 A;  4QPK A;  2YE2 A;  2XD6 A;  4B7P A;  4ASA A;  1R62 A;  4W7T A;  4E01 A;  2WI7 A;  4EM7 A;  5L3J A;  4EGH A;  1TIL A;  4L93 A;  4URN A;  2BYH A;  1YSZ A;  3INX A;  2ESA A;  3R92 A;  3O6O A;  2BYI A;  1Y4S A;  5F3K A;  1YER A;  4ZKI A;  1UYC A;  2YE8 A;  1NHJ A;  2WER A;  2YI7 A;  1YES A;  2XJG A;  2WI1 A;  2YE5 A;  5M4N A;  2ZDY A;  1YET A;  1Z5A A;  5IDM A;  3TZ2 A;  2YI6 A;  4XKA A;  4FPP A;  4NH8 A;  2YE7 A;  4ZVI A;  2BRC A;  4HXZ A;  4CWO A;  3GIG B;  4YKQ A;  3D2R A;  4HZ0 A;  3D0B A;  4GCZ A;  4CWF A;  1GJV A;  5D6P A;  2Q8F A;  4URM A;  2XHT A;  3GIF A;  3OPD A;  2YEB A;  4AWQ A;  4EMV A;  4LWG A;  1KZN A;  4CWS A;  1Y8N A;  4URO A;  2PNR A;  2YEH A;  2YEJ A;  4PL9 A;  1UYL A;  2ZKJ A;  4YKW A;  4H7Q A;  1MX0 A;  4YKR A;  1B63 A;  4ASB A;  2VWC A;  4JAS A;  5M4P A;  4XE2 A;  3G7E A;  3H80 A;  5FNF A;  2YJX A;  1A4H A;  3FT5 A;  2WEQ A;  4WUD A;  1OSF A;  1BYQ A;  2XX5 A;  2GQP A;  1ZXM A;  4O09 A;  4I3H A;  5CTY A;  2XHX A;  4R1F A;  3ZXO A;  2WI5 A;  4L91 A;  1TC0 A;  2YEA A;  2BU6 A;  3G75 A;  3C11 A;  3TZ0 A;  2YKJ A;  2O1V A;  4ASF A;  1I5B A;  1KIJ A;  4I5S A;  1NHI A;  2YKE A;  4PRV A;  5CTW A;  2O1U A;  4P8O A;  2Q8G A;  3D36 A;  3T0H A;  4AS9 A;  3HEK A;  4MP2 A;  3VHC A;  4ASG A;  4QPJ A;  2CG9 A;  3B26 A;  4BIZ A;  2BT0 A;  4CE1 A;  2YKB A;  3A0W A;  2BU5 A;  2ZBK B;  3RLP A;  4MPC A;  4HY1 A;  4H81 A;  4WUB A;  3KE6 A;  2YKI A;  4KSG A;  5D7C A;  2ZDX A;  3EHF A;  1JM6 A;  4GT8 A;  4U7N A;  1UY7 A;  2YED A;  3C0E A;  2XJJ A;  3EHJ A;  2EXL A;  4KTN A;  3BM9 A;  3JZ3 A;  1YT2 A;  5IDJ A;  1PVG A;  4HXW A;  4O0B A;  2GFD A;  3HYZ A;  4KP4 A;  2O1W A;  4LWF A;  2YKC A;  1AH8 A;  3QDD A;  2XX4 A;  3FV5 A;  4EGK A;  2CH4 A;  4MB9 A;  4FCP A;  4L94 A;  4EFT A;  4MP7 A;  1S14 A;  3Q5J A;  4O05 A;  3BMY A;  1AM1 A;  3MNR P;  5CTU A;  3LPS A;  5FND A;  1UYH A;  3OWD A;  2Q8H A;  2VCI A;  3QTF A;  5GGZ A;  3CGZ A;  1ZXN A;  4GFN A;  5D7R A;  3TZ4 A;  3ZKB A;  4XIQ A;  5J6A A;  3IED A;  3NMQ A;  3CWV A;  2IOQ A;  4KQV A;  2YJW A;  4P7A A;  2YE4 A;  3A0T A;  4DUH A;  3OMU A;  4B6C A;  4XC0 A;  2XDU A;  1UY8 A;  4BQJ A;  2BU2 A;  3K60 A;  1EA6 A;  1I59 A;  4XKO A;  3RLQ A;  2YE3 A;  2JKI A;  4MPN A;  2YI0 A;  3H4L A;  5IN9 A;  3T2S A;  2BTZ A;  1UYE A;  4XD8 A;  3CRL A;  3CRK A;  4CWN A;  4AWO A;  1NHH A;  3VAD A;  4CWQ A;  1UYF A;  4H85 A;  2XAB A;  2YK2 A;  4HYM A;  3B25 A;  3HYY A;  2CCU A;  4FCR A;  3RLR A;  4E02 A;  4FCQ A;  4LWE A;  1H7S A;  3VHA A;  3WQ9 A;  3B24 A;  2BZ5 A;  2WI6 A;  2XDK A;  4NH7 A;  4XIR A;  1Z59 A;  2QG2 A;  1L0O A;  4XCJ A;  3ZM7 A;  2IWS A;  3EHH A;  3OW6 A;  1YSR A;  2HKJ A;  4MPE A;  1Y8P A;  5D6Q A;  3LNU A;  4JAU A;  5M4E A;  3DGE A;  3U2D A;  1Z5B A;  4K4O A;  4DZY A;  3EKO A;  2CCT A;  4BQG A;  1BKN A;  3T1K A;  2YEF A;  4EEH A;  1GKZ A;  4BIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...