3EHJA

Crystal structure of deskc-h188v in complex with amp-pcp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
206
structure length
203
Chain Sequence
b'KLEDANERIAELVKLEERQRMARDLVDTLGQKLSLMGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSSMKGIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQAKTCRVDIQQLWKEVVITVSDDGTFKGEENSFHGLLGMRERLEFANGSLHIDTENGTKLTMAIPNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor kinase (YocF protein)
publication title Structural plasticity and catalysis regulation of a thermosensor histidine kinase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 60
structure length 203
sequence length 206
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07730 HisKA_3 Histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3ehjA02
2XK2A 1L0OA 1YSRA 1I5CA 1YC3A 2XDKA 2XHRA 2YKCA 4MOTA 1I5AA 2XJGA 3RLRA 3OWBA 1GJVA 4AWOA 2XX5A 4R3AA 2PNRA 4YKYA 1QY8A 3QDDA 4FPPA 1QYEA 1A4HA 4O0BA 4EMVA 1YESA 2BTZA 3D36A 1MU5A 5CTWA 1NHJA 1QZRA 4XIRA 2YI6A 4O05A 2XHTA 2WEPA 2HKJA 4XIQA 4XC0A 4AWPA 4MPNA 4CWOA 2YK2A 1Z5AA 1BXDA 1UYIA 3EHJA 4KSHA 3VHCA 4ZVIA 1YC1A 3VADA 2WI5A 4R1FA 4XDMA 2Q8FA 2YJXA 4XKKA 4CWSA 4V26A 3LPSA 4PL9A 2YEBA 3NMQA 4WUCA 3CRKA 2HG1A 2FWZA 1UY6A 3ZKBA 4YKQA 1B3QA 1YS3A 4YKWA 2WI1A 4KQVA 2Q2EB 4XCJA 2YEAA 2BREA 2BU7A 4JAVA 4BXIA 3LNUA 2O1VA 4YKUA 3HHUA 1Z59A 1BYQA 3FV5A 2XJXA 2CH4A 4URNA 3K99A 3DGEA 3U2DA 2WI6A 5M4EA 1Z5CA 1US7A 1UYLA 4LWHA 1NHIA 4CWPA 1YT2A 3CGYA 4WUBA 4HXZA 4KP4A 4EGHA 3GIEA 4XTJA 2VW5A 2E0AA 1I59A 3C11A 4GFNA 5M4NA 2XX2A 2CGFA 4NH7A 4GEEA 2YEEA 4EFUA 4YKXA 2VWCA 3B26A 2YEDA 4GGLA 2BT0A 2BSMA 2YE6A 2YGEA 5CTUA 5IDMA 1TBWA 4JASA 4BIUA 5M4PA 3B27A 3TTZA 1Y4SA 2JKIA 1UYEA 2AKPA 2ESAA 4EM7A 2YEIA 2YEJA 2CCUA 5D7RA 3HYYA 1GKXA 3B24A 4O04A 5J6AA 1U2OA 3A0XA 2YE8A 4NH9A 3A0YA 5FWKA 2QG0A 2K5BA 3EHHA 3ZXOA 2FXSA 3RLPA 3O0IA 2JJCA 4CWNA 1UY9A 3G7BA 1Y4UA 4CE1A 1YSZA 1JM6A 4H81A 2YEFA 2BU2A 1KZNA 3WQ9A 2YEGA 1Y8NA 1EI1A 4L93A 4QPJA 3QTFA 5BOCA 1TH8A 4XITA 3MNRP 2XDXA 4BQGA 4ASFA 2BRCA 1UYHA 4CE2A 2XX4A 3B28A 2Q8IA 2YE7A 3A0TA 3SL2A 3TZ0A 2IWXA 3WHAA 1Y8PA 2YI7A 4HY6A 2XDLA 4ASGA 3T10A 3CGZA 3Q5KA 3EHGA 4JQLA 2Q8HA 4B7PA 1YT0A 3JZ3A 3U67A 3TZ2A 4WUDA 3FT5A 4XKAA 3CRLA 4L8ZA 2YJWA 5D6QA 4AS9A 3O2FA 3O6OA 2BU8A 4HY1A 4PRXA 4H85A 4KFGA 3K60A 3R4NA 4B6CA 2YEHA 3K97A 2YE9A 4R3MA 2Q8GA 4PU9A 1Z5BA 4L91A 4P7AA 2C2AA 3GIGB 1KIJA 1ID0A 1B63A 1UYDA 4MPCA 2O1UA 2YK9A 3GIGA 1YERA 3KE6A 4YKRA 2VCIA 1YT1A 1BGQA 4GQTA 2YE3A 3G75A 3PEJA 3H80A 3FT8A 2YE5A 1UYMA 2BZ5A 4XD8A 2XD6A 3D0BA 4XIPA 2CCTA 3T0HA 5L3JA 2HCHA 3T2SA 2WERA 5CPHA 1UY8A 1H7UA 3ZKDA 2IWUA 3D2RA 2ZDYA 3Q5LA 5C93A 3R4OA 4LWEA 4P8OA 2QG2A 3VHDA 2XCMA 4DUHA 3B25A 2IOPA 2ZBKB 4MPEA 2BU6A 1MX0A 1AMWA 4XKOA 3INXA 3T1KA 4I3HA 4MB9A 4EFTA 4CE3A 3ZXQA 5IDJA 1EA6A 3HZ1A 1S14A 5J71A 1TC6A 4EEHA 1B62A 1ZXNA 4GT8A 5M4HA 4L90A 5CTXA 5D6PA 1I5BA 2IWSA 3Q5JA 4PRVA 3T0ZA 3EHFA 1YC4A 4XCLA 4I5SA 3HEKA 4HXWA 2GFDA 4HYPA 4CWQA 5FNDA 3CWVA 4XE2A 1S16A 4URLA 4LWFA 4LWIA 5M4KA 1UYCA 2YGAA 3R92A 5FNFA 2YKIA 4O07A 4KSGA 1H7SA 2YECA 4X9LA 2YGFA 4ASBA 2CCSA 5D7CA 5M4MA 4L94A 3K98A 1THNA 4Q20A 4NH8A 1UY7A 4LWGA 2CG9A 2YKEA 2YKBA 4MP2A 5CTYA 4U7OA 3A0RA 4GCZA 3OWDA 4W7TA 4FCRA 5CF0A 4URMA 1AJ6A 1AH6A 3C0EA 2XDUA 1UYFA 1AM1A 1TILA 2QFOA 4YKTA 1GKZA 3R4PA 2WI3A 2YE2A 5GGZA 4ASAA 1Y8OA 3RKZA 2IORA 3IEDA 3RLQA 3OMUA 1R62A 4AWQA 5F5RA 4E02A 3EKOA 1ZW9A 3R4MA 1I5DA 4EGKA 2GQPA 4ZKIA 3OW6A 2UWDA 2BU5A 1ZWHA 4HYMA 3PEHA 1UYKA 2QF6A 2XABA 1NHHA 4CWFA 3TUHA 2BYIA 2ZKJA 3BM9A 5IN9A 1AH8A 1TC0A 2XDSA 4EGIA 3OPDA 2H8MA 4LPBA 2WI7A 3HYZA 4HZ5A 3A0ZA 3U2KA 4LP0A 2ZDXA 4U93A 2FYPA 3BMYA 3ZM7A 2IOQA 3HZ5A 2VCJA 1YETA 2O1WA 4HZ0A 2EXLA 2WI4A 4U7NA 3TZ5A 4QPKA 1TIDA 4FCQA 3VHAA 5BODA 2H55A 2WEQA 4MBCA 5F3KA 4O09A 4E00A 1I58A 4FMTA 1BKNA 3INWA 1OSFA 4CWRA 2XJJA 3GIFA 4BAEA 3R91A 2XHXA 1PVGA 2WI2A 2BYHA 2FWYA 1ZXMA 4H7QA 4BIZA 1U0ZA 2YI5A 2YI0A 3TZ4A 3H4LA 3A0WA 2YKJA 3G7EA 5D7DA 3EKRA 4UROA 4MP7A 4YKZA 4E01A 1UYGA 4K4OA 2YE4A 4DZYA 4KTNA 4FCPA 4V25A 4CWTA 4JAUA 4BQJA 5FNCA
chains in the Genus database with same CATH superfamily
2XK2A 5JENA 1L0OA 1YSRA 1I5CA 1YC3A 2XDKA 2XHRA 2YKCA 4MOTA 1I5AA 2XJGA 3RLRA 3OWBA 1GJVA 4AWOA 2XX5A 4R3AA 2PNRA 4YKYA 1QY8A 3QDDA 4FPPA 1QYEA 3LMMA 1A4HA 4O0BA 4EMVA 1YESA 2BTZA 3D36A 1MU5A 5CTWA 1NHJA 1QZRA 4XIRA 2YI6A 4O05A 2XHTA 2WEPA 2HKJA 4XIQA 4XC0A 4AWPA 4MPNA 4CWOA 2YK2A 1Z5AA 1BXDA 1UYIA 3EHJA 4KSHA 3VHCA 4ZVIA 1YC1A 3VADA 2WI5A 4R1FA 4XDMA 2Q8FA 2YJXA 4XKKA 4CWSA 4V26A 3LPSA 2HHIA 4PL9A 2YEBA 3NMQA 4WUCA 3CRKA 2HG1A 2FWZA 1UY6A 3ZKBA 4YKQA 1B3QA 1YS3A 4YKWA 2WI1A 4KQVA 2Q2EB 4XCJA 2YEAA 2BREA 2BU7A 4JAVA 4BXIA 3LNUA 2O1VA 4YKUA 3HHUA 1Z59A 1BYQA 3FV5A 2XJXA 2CH4A 4URNA 3K99A 3DGEA 3U2DA 2WI6A 5M4EA 1Z5CA 1US7A 1UYLA 4LWHA 1NHIA 4CWPA 1YT2A 3CGYA 4WUBA 4HXZA 4KP4A 4EGHA 3GIEA 4XTJA 2VW5A 2E0AA 1I59A 3C11A 4GFNA 5M4NA 2XX2A 2CGFA 4NH7A 4GEEA 2YEEA 4EFUA 4YKXA 2VWCA 3B26A 2YEDA 4GGLA 2BT0A 2BSMA 2YE6A 2YGEA 5CTUA 5IDMA 1TBWA 4JASA 4BIUA 2C1GA 5M4PA 3B27A 3TTZA 1Y4SA 2JKIA 1UYEA 2AKPA 2ESAA 4EM7A 2YEIA 2YEJA 2CCUA 5D7RA 3HYYA 1GKXA 3B24A 4O04A 5J6AA 1U2OA 3A0XA 2YE8A 4NH9A 3A0YA 5FWKA 2QG0A 2K5BA 3EHHA 3ZXOA 2FXSA 3RLPA 3O0IA 2JJCA 4CWNA 1UY9A 2FTKA 3G7BA 1Y4UA 4CE1A 1YSZA 1JM6A 4H81A 2YEFA 2BU2A 1KZNA 3WQ9A 2YEGA 1Y8NA 1EI1A 4L93A 4QPJA 3QTFA 5BOCA 1TH8A 4XITA 3MNRP 2XDXA 4BQGA 4ASFA 2BRCA 1UYHA 4CE2A 2XX4A 3B28A 2Q8IA 2YE7A 3A0TA 3SL2A 3TZ0A 2IWXA 3WHAA 1Y8PA 2YI7A 4HY6A 2XDLA 4ASGA 3T10A 3CGZA 3Q5KA 3EHGA 4JQLA 2Q8HA 4B7PA 1YT0A 3JZ3A 3U67A 3TZ2A 4WUDA 3FT5A 4XKAA 3CRLA 4L8ZA 2YJWA 5D6QA 4AS9A 3O2FA 3O6OA 2BU8A 4HY1A 4PRXA 4H85A 4KFGA 3K60A 3R4NA 4B6CA 2YEHA 3K97A 2YE9A 4R3MA 2Q8GA 4PU9A 1Z5BA 4L91A 4P7AA 2C2AA 3GIGB 1KIJA 1ID0A 1B63A 1UYDA 4MPCA 2O1UA 2YK9A 3GIGA 1YERA 3KE6A 4YKRA 2VCIA 1YT1A 1BGQA 4GQTA 2YE3A 3G75A 3PEJA 3H80A 3FT8A 2YE5A 1UYMA 2BZ5A 4XD8A 2XD6A 3D0BA 4XIPA 2CCTA 3T0HA 5L3JA 2HCHA 3T2SA 2WERA 5CPHA 1UY8A 1H7UA 3ZKDA 2IWUA 3D2RA 2ZDYA 3Q5LA 5C93A 3R4OA 4LWEA 4P8OA 2QG2A 3VHDA 2XCMA 4DUHA 3B25A 2IOPA 2ZBKB 4MPEA 2BU6A 1MX0A 1AMWA 4XKOA 3INXA 3T1KA 4I3HA 4MB9A 4EFTA 4CE3A 3ZXQA 5IDJA 1EA6A 3HZ1A 1S14A 5J71A 1TC6A 4EEHA 1B62A 1ZXNA 4GT8A 5M4HA 4L90A 5CTXA 5D6PA 1I5BA 2IWSA 3Q5JA 4PRVA 3T0ZA 3EHFA 1YC4A 4XCLA 4I5SA 3HEKA 4HXWA 2GFDA 4HYPA 4CWQA 5FNDA 3CWVA 4XE2A 1S16A 4URLA 4LWFA 4LWIA 5M4KA 1UYCA 2YGAA 3R92A 5FNFA 2YKIA 4O07A 4KSGA 4E72A 1H7SA 2YECA 4X9LA 2YGFA 4ASBA 2CCSA 5D7CA 5M4MA 4L94A 3K98A 1THNA 4Q20A 4NH8A 1UY7A 4LWGA 2CG9A 2YKEA 2YKBA 4MP2A 5CTYA 4U7OA 3A0RA 4GCZA 3OWDA 4W7TA 4FCRA 3S5TA 5CF0A 4URMA 1IXMA 1AJ6A 1AH6A 3C0EA 2XDUA 1UYFA 1AM1A 1TILA 2QFOA 4YKTA 1GKZA 3R4PA 2WI3A 2YE2A 5GGZA 4ASAA 1Y8OA 3RKZA 2IORA 3IEDA 3RLQA 3OMUA 1R62A 4AWQA 5F5RA 4E02A 3EKOA 1ZW9A 3R4MA 1I5DA 4EGKA 2GQPA 4ZKIA 3CYGA 3OW6A 2UWDA 2BU5A 1ZWHA 4HYMA 3PEHA 1UYKA 2QF6A 2XABA 1NHHA 4CWFA 3TUHA 2BYIA 2ZKJA 3BM9A 5IN9A 1AH8A 1TC0A 2XDSA 4EGIA 3OPDA 2H8MA 4LPBA 2WI7A 3HYZA 4HZ5A 3A0ZA 3U2KA 4LP0A 2ZDXA 4U93A 2FYPA 3BMYA 3ZM7A 2IOQA 3HZ5A 2VCJA 1F51A 1YETA 2O1WA 4HZ0A 2EXLA 2WI4A 4U7NA 3TZ5A 2C1IA 4QPKA 1TIDA 4FCQA 3VHAA 5BODA 2H55A 2WEQA 4MBCA 5F3KA 4O09A 4E00A 1I58A 4FMTA 1BKNA 3INWA 1OSFA 4CWRA 2XJJA 3GIFA 4BAEA 3R91A 2XHXA 1PVGA 2WI2A 2BYHA 2FWYA 1ZXMA 4H7QA 4BIZA 1U0ZA 2YI5A 2YI0A 3TZ4A 3H4LA 3A0WA 2YKJA 3G7EA 5D7DA 3EKRA 4UROA 4MP7A 4YKZA 4E01A 1UYGA 4K4OA 2YE4A 4DZYA 4KTNA 4FCPA 4V25A 4CWTA 4JAUA 4BQJA 5FNCA
chains in the Genus database with same CATH topology
2XK2A 1L0OA 1YSRA 1I5CA 1YC3A 2XDKA 2XHRA 2YKCA 4MOTA 1I5AA 2XJGA 3RLRA 3OWBA 1GJVA 4AWOA 2XX5A 4R3AA 2PNRA 4YKYA 1QY8A 3QDDA 4FPPA 1QYEA 1A4HA 4O0BA 4EMVA 1YESA 2BTZA 3D36A 1MU5A 5CTWA 1NHJA 1QZRA 4XIRA 2YI6A 4O05A 2XHTA 2WEPA 2HKJA 4XIQA 4XC0A 4AWPA 4MPNA 4CWOA 2YK2A 1Z5AA 1BXDA 1UYIA 3EHJA 4KSHA 3VHCA 4ZVIA 1YC1A 3VADA 2WI5A 4R1FA 4XDMA 2Q8FA 2YJXA 4XKKA 4CWSA 4V26A 3LPSA 4PL9A 2YEBA 3NMQA 4WUCA 3CRKA 2HG1A 2FWZA 1UY6A 3ZKBA 4YKQA 1B3QA 1YS3A 4YKWA 2WI1A 4KQVA 2Q2EB 4XCJA 2YEAA 2BREA 2BU7A 4JAVA 4BXIA 3LNUA 2O1VA 4YKUA 3HHUA 1Z59A 1BYQA 3FV5A 2XJXA 2CH4A 4URNA 3K99A 3DGEA 3U2DA 2WI6A 5M4EA 1Z5CA 1US7A 1UYLA 4LWHA 1NHIA 4CWPA 1YT2A 3CGYA 4WUBA 4HXZA 4KP4A 4EGHA 3GIEA 4XTJA 2VW5A 2E0AA 1I59A 3C11A 4GFNA 5M4NA 2XX2A 2CGFA 4NH7A 4GEEA 2YEEA 4EFUA 4YKXA 2VWCA 3B26A 2YEDA 4GGLA 2BT0A 2BSMA 2YE6A 2YGEA 5CTUA 5IDMA 1TBWA 4JASA 4BIUA 5M4PA 3B27A 3TTZA 1Y4SA 2JKIA 1UYEA 2AKPA 2ESAA 4EM7A 2YEIA 2YEJA 2CCUA 5D7RA 3HYYA 1GKXA 3B24A 4O04A 5J6AA 1U2OA 3A0XA 2YE8A 4NH9A 3A0YA 5FWKA 2QG0A 2K5BA 3EHHA 3ZXOA 2FXSA 3RLPA 3O0IA 2JJCA 4CWNA 1UY9A 3G7BA 1Y4UA 4CE1A 1YSZA 1JM6A 4H81A 2YEFA 2BU2A 1KZNA 3WQ9A 2YEGA 1Y8NA 1EI1A 4L93A 4QPJA 3QTFA 5BOCA 1TH8A 4XITA 3MNRP 2XDXA 4BQGA 4ASFA 2BRCA 1UYHA 4CE2A 2XX4A 3B28A 2Q8IA 2YE7A 3A0TA 3SL2A 3TZ0A 2IWXA 3WHAA 1Y8PA 2YI7A 4HY6A 2XDLA 4ASGA 3T10A 3CGZA 3Q5KA 3EHGA 4JQLA 2Q8HA 4B7PA 1YT0A 3JZ3A 3U67A 3TZ2A 4WUDA 3FT5A 4XKAA 3CRLA 4L8ZA 2YJWA 5D6QA 4AS9A 3O2FA 3O6OA 2BU8A 4HY1A 4PRXA 4H85A 4KFGA 3K60A 3R4NA 4B6CA 2YEHA 3K97A 2YE9A 4R3MA 2Q8GA 4PU9A 1Z5BA 4L91A 4P7AA 2C2AA 3GIGB 1KIJA 1ID0A 1B63A 1UYDA 4MPCA 2O1UA 2YK9A 3GIGA 1YERA 3KE6A 4YKRA 2VCIA 1YT1A 1BGQA 4GQTA 2YE3A 3G75A 3PEJA 3H80A 3FT8A 2YE5A 1UYMA 2BZ5A 4XD8A 2XD6A 3D0BA 4XIPA 2CCTA 3T0HA 5L3JA 2HCHA 3T2SA 2WERA 5CPHA 1UY8A 1H7UA 3ZKDA 2IWUA 3D2RA 2ZDYA 3Q5LA 5C93A 3R4OA 4LWEA 4P8OA 2QG2A 3VHDA 2XCMA 4DUHA 3B25A 2IOPA 2ZBKB 4MPEA 2BU6A 1MX0A 1AMWA 4XKOA 3INXA 3T1KA 4I3HA 4MB9A 4EFTA 4CE3A 3ZXQA 5IDJA 1EA6A 3HZ1A 1S14A 5J71A 1TC6A 4EEHA 1B62A 1ZXNA 4GT8A 5M4HA 4L90A 5CTXA 5D6PA 1I5BA 2IWSA 3Q5JA 4PRVA 3T0ZA 3EHFA 1YC4A 4XCLA 4I5SA 3HEKA 4HXWA 2GFDA 4HYPA 4CWQA 5FNDA 3CWVA 4XE2A 1S16A 4URLA 4LWFA 4LWIA 5M4KA 1UYCA 2YGAA 3R92A 5FNFA 2YKIA 4O07A 4KSGA 1H7SA 2YECA 4X9LA 2YGFA 4ASBA 2CCSA 5D7CA 5M4MA 4L94A 3K98A 1THNA 4Q20A 4NH8A 1UY7A 4LWGA 2CG9A 2YKEA 2YKBA 4MP2A 5CTYA 4U7OA 3A0RA 4GCZA 3OWDA 4W7TA 4FCRA 5CF0A 4URMA 1AJ6A 1AH6A 3C0EA 2XDUA 1UYFA 1AM1A 1TILA 2QFOA 4YKTA 1GKZA 3R4PA 2WI3A 2YE2A 5GGZA 4ASAA 1Y8OA 3RKZA 2IORA 3IEDA 3RLQA 3OMUA 1R62A 4AWQA 5F5RA 4E02A 3EKOA 1ZW9A 3R4MA 1I5DA 4EGKA 2GQPA 4ZKIA 3OW6A 2UWDA 2BU5A 1ZWHA 4HYMA 3PEHA 1UYKA 2QF6A 2XABA 1NHHA 4CWFA 3TUHA 2BYIA 2ZKJA 3BM9A 5IN9A 1AH8A 1TC0A 2XDSA 4EGIA 3OPDA 2H8MA 4LPBA 2WI7A 3HYZA 4HZ5A 3A0ZA 3U2KA 4LP0A 2ZDXA 4U93A 2FYPA 3BMYA 3ZM7A 2IOQA 3HZ5A 2VCJA 1YETA 2O1WA 4HZ0A 2EXLA 2WI4A 4U7NA 3TZ5A 4QPKA 1TIDA 4FCQA 3VHAA 5BODA 2H55A 2WEQA 4MBCA 5F3KA 4O09A 4E00A 1I58A 4FMTA 1BKNA 3INWA 1OSFA 4CWRA 2XJJA 3GIFA 4BAEA 3R91A 2XHXA 1PVGA 2WI2A 2BYHA 2FWYA 1ZXMA 4H7QA 4BIZA 1U0ZA 2YI5A 2YI0A 3TZ4A 3H4LA 3A0WA 2YKJA 3G7EA 5D7DA 3EKRA 4UROA 4MP7A 4YKZA 4E01A 1UYGA 4K4OA 2YE4A 4DZYA 4KTNA 4FCPA 4V25A 4CWTA 4JAUA 4BQJA 5FNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XK2 A;  1L0O A;  1YSR A;  1I5C A;  1YC3 A;  2XDK A;  2XHR A;  2YKC A;  4MOT A;  1I5A A;  2XJG A;  3RLR A;  3OWB A;  1GJV A;  4AWO A;  2XX5 A;  4R3A A;  2PNR A;  4YKY A;  1QY8 A;  3QDD A;  4FPP A;  1QYE A;  1A4H A;  4O0B A;  4EMV A;  1YES A;  2BTZ A;  3D36 A;  1MU5 A;  5CTW A;  1NHJ A;  1QZR A;  4XIR A;  2YI6 A;  4O05 A;  2XHT A;  2WEP A;  2HKJ A;  4XIQ A;  4XC0 A;  4AWP A;  4MPN A;  4CWO A;  2YK2 A;  1Z5A A;  1BXD A;  1UYI A;  3EHJ A;  4KSH A;  3VHC A;  4ZVI A;  1YC1 A;  3VAD A;  2WI5 A;  4R1F A;  4XDM A;  2Q8F A;  2YJX A;  4XKK A;  4CWS A;  4V26 A;  3LPS A;  4PL9 A;  2YEB A;  3NMQ A;  4WUC A;  3CRK A;  2HG1 A;  2FWZ A;  1UY6 A;  3ZKB A;  4YKQ A;  1B3Q A;  1YS3 A;  4YKW A;  2WI1 A;  4KQV A;  2Q2E B;  4XCJ A;  2YEA A;  2BRE A;  2BU7 A;  4JAV A;  4BXI A;  3LNU A;  2O1V A;  4YKU A;  3HHU A;  1Z59 A;  1BYQ A;  3FV5 A;  2XJX A;  2CH4 A;  4URN A;  3K99 A;  3DGE A;  3U2D A;  2WI6 A;  5M4E A;  1Z5C A;  1US7 A;  1UYL A;  4LWH A;  1NHI A;  4CWP A;  1YT2 A;  3CGY A;  4WUB A;  4HXZ A;  4KP4 A;  4EGH A;  3GIE A;  4XTJ A;  2VW5 A;  2E0A A;  1I59 A;  3C11 A;  4GFN A;  5M4N A;  2XX2 A;  2CGF A;  4NH7 A;  4GEE A;  2YEE A;  4EFU A;  4YKX A;  2VWC A;  3B26 A;  2YED A;  4GGL A;  2BT0 A;  2BSM A;  2YE6 A;  2YGE A;  5CTU A;  5IDM A;  1TBW A;  4JAS A;  4BIU A;  5M4P A;  3B27 A;  3TTZ A;  1Y4S A;  2JKI A;  1UYE A;  2AKP A;  2ESA A;  4EM7 A;  2YEI A;  2YEJ A;  2CCU A;  5D7R A;  3HYY A;  1GKX A;  3B24 A;  4O04 A;  5J6A A;  1U2O A;  3A0X A;  2YE8 A;  4NH9 A;  3A0Y A;  5FWK A;  2QG0 A;  2K5B A;  3EHH A;  3ZXO A;  2FXS A;  3RLP A;  3O0I A;  2JJC A;  4CWN A;  1UY9 A;  3G7B A;  1Y4U A;  4CE1 A;  1YSZ A;  1JM6 A;  4H81 A;  2YEF A;  2BU2 A;  1KZN A;  3WQ9 A;  2YEG A;  1Y8N A;  1EI1 A;  4L93 A;  4QPJ A;  3QTF A;  5BOC A;  1TH8 A;  4XIT A;  3MNR P;  2XDX A;  4BQG A;  4ASF A;  2BRC A;  1UYH A;  4CE2 A;  2XX4 A;  3B28 A;  2Q8I A;  2YE7 A;  3A0T A;  3SL2 A;  3TZ0 A;  2IWX A;  3WHA A;  1Y8P A;  2YI7 A;  4HY6 A;  2XDL A;  4ASG A;  3T10 A;  3CGZ A;  3Q5K A;  3EHG A;  4JQL A;  2Q8H A;  4B7P A;  1YT0 A;  3JZ3 A;  3U67 A;  3TZ2 A;  4WUD A;  3FT5 A;  4XKA A;  3CRL A;  4L8Z A;  2YJW A;  5D6Q A;  4AS9 A;  3O2F A;  3O6O A;  2BU8 A;  4HY1 A;  4PRX A;  4H85 A;  4KFG A;  3K60 A;  3R4N A;  4B6C A;  2YEH A;  3K97 A;  2YE9 A;  4R3M A;  2Q8G A;  4PU9 A;  1Z5B A;  4L91 A;  4P7A A;  2C2A A;  3GIG B;  1KIJ A;  1ID0 A;  1B63 A;  1UYD A;  4MPC A;  2O1U A;  2YK9 A;  3GIG A;  1YER A;  3KE6 A;  4YKR A;  2VCI A;  1YT1 A;  1BGQ A;  4GQT A;  2YE3 A;  3G75 A;  3PEJ A;  3H80 A;  3FT8 A;  2YE5 A;  1UYM A;  2BZ5 A;  4XD8 A;  2XD6 A;  3D0B A;  4XIP A;  2CCT A;  3T0H A;  5L3J A;  2HCH A;  3T2S A;  2WER A;  5CPH A;  1UY8 A;  1H7U A;  3ZKD A;  2IWU A;  3D2R A;  2ZDY A;  3Q5L A;  5C93 A;  3R4O A;  4LWE A;  4P8O A;  2QG2 A;  3VHD A;  2XCM A;  4DUH A;  3B25 A;  2IOP A;  2ZBK B;  4MPE A;  2BU6 A;  1MX0 A;  1AMW A;  4XKO A;  3INX A;  3T1K A;  4I3H A;  4MB9 A;  4EFT A;  4CE3 A;  3ZXQ A;  5IDJ A;  1EA6 A;  3HZ1 A;  1S14 A;  5J71 A;  1TC6 A;  4EEH A;  1B62 A;  1ZXN A;  4GT8 A;  5M4H A;  4L90 A;  5CTX A;  5D6P A;  1I5B A;  2IWS A;  3Q5J A;  4PRV A;  3T0Z A;  3EHF A;  1YC4 A;  4XCL A;  4I5S A;  3HEK A;  4HXW A;  2GFD A;  4HYP A;  4CWQ A;  5FND A;  3CWV A;  4XE2 A;  1S16 A;  4URL A;  4LWF A;  4LWI A;  5M4K A;  1UYC A;  2YGA A;  3R92 A;  5FNF A;  2YKI A;  4O07 A;  4KSG A;  1H7S A;  2YEC A;  4X9L A;  2YGF A;  4ASB A;  2CCS A;  5D7C A;  5M4M A;  4L94 A;  3K98 A;  1THN A;  4Q20 A;  4NH8 A;  1UY7 A;  4LWG A;  2CG9 A;  2YKE A;  2YKB A;  4MP2 A;  5CTY A;  4U7O A;  3A0R A;  4GCZ A;  3OWD A;  4W7T A;  4FCR A;  5CF0 A;  4URM A;  1AJ6 A;  1AH6 A;  3C0E A;  2XDU A;  1UYF A;  1AM1 A;  1TIL A;  2QFO A;  4YKT A;  1GKZ A;  3R4P A;  2WI3 A;  2YE2 A;  5GGZ A;  4ASA A;  1Y8O A;  3RKZ A;  2IOR A;  3IED A;  3RLQ A;  3OMU A;  1R62 A;  4AWQ A;  5F5R A;  4E02 A;  3EKO A;  1ZW9 A;  3R4M A;  1I5D A;  4EGK A;  2GQP A;  4ZKI A;  3OW6 A;  2UWD A;  2BU5 A;  1ZWH A;  4HYM A;  3PEH A;  1UYK A;  2QF6 A;  2XAB A;  1NHH A;  4CWF A;  3TUH A;  2BYI A;  2ZKJ A;  3BM9 A;  5IN9 A;  1AH8 A;  1TC0 A;  2XDS A;  4EGI A;  3OPD A;  2H8M A;  4LPB A;  2WI7 A;  3HYZ A;  4HZ5 A;  3A0Z A;  3U2K A;  4LP0 A;  2ZDX A;  4U93 A;  2FYP A;  3BMY A;  3ZM7 A;  2IOQ A;  3HZ5 A;  2VCJ A;  1YET A;  2O1W A;  4HZ0 A;  2EXL A;  2WI4 A;  4U7N A;  3TZ5 A;  4QPK A;  1TID A;  4FCQ A;  3VHA A;  5BOD A;  2H55 A;  2WEQ A;  4MBC A;  5F3K A;  4O09 A;  4E00 A;  1I58 A;  4FMT A;  1BKN A;  3INW A;  1OSF A;  4CWR A;  2XJJ A;  3GIF A;  4BAE A;  3R91 A;  2XHX A;  1PVG A;  2WI2 A;  2BYH A;  2FWY A;  1ZXM A;  4H7Q A;  4BIZ A;  1U0Z A;  2YI5 A;  2YI0 A;  3TZ4 A;  3H4L A;  3A0W A;  2YKJ A;  3G7E A;  5D7D A;  3EKR A;  4URO A;  4MP7 A;  4YKZ A;  4E01 A;  1UYG A;  4K4O A;  2YE4 A;  4DZY A;  4KTN A;  4FCP A;  4V25 A;  4CWT A;  4JAU A;  4BQJ A;  5FNC A; 
#chains in the Genus database with same CATH topology
 2XK2 A;  5JEN A;  1L0O A;  1YSR A;  1I5C A;  1YC3 A;  2XDK A;  2XHR A;  2YKC A;  4MOT A;  1I5A A;  2XJG A;  3RLR A;  3OWB A;  1GJV A;  4AWO A;  2XX5 A;  4R3A A;  2PNR A;  4YKY A;  1QY8 A;  3QDD A;  4FPP A;  1QYE A;  3LMM A;  1A4H A;  4O0B A;  4EMV A;  1YES A;  2BTZ A;  3D36 A;  1MU5 A;  5CTW A;  1NHJ A;  1QZR A;  4XIR A;  2YI6 A;  4O05 A;  2XHT A;  2WEP A;  2HKJ A;  4XIQ A;  4XC0 A;  4AWP A;  4MPN A;  4CWO A;  2YK2 A;  1Z5A A;  1BXD A;  1UYI A;  3EHJ A;  4KSH A;  3VHC A;  4ZVI A;  1YC1 A;  3VAD A;  2WI5 A;  4R1F A;  4XDM A;  2Q8F A;  2YJX A;  4XKK A;  4CWS A;  4V26 A;  3LPS A;  2HHI A;  4PL9 A;  2YEB A;  3NMQ A;  4WUC A;  3CRK A;  2HG1 A;  2FWZ A;  1UY6 A;  3ZKB A;  4YKQ A;  1B3Q A;  1YS3 A;  4YKW A;  2WI1 A;  4KQV A;  2Q2E B;  4XCJ A;  2YEA A;  2BRE A;  2BU7 A;  4JAV A;  4BXI A;  3LNU A;  2O1V A;  4YKU A;  3HHU A;  1Z59 A;  1BYQ A;  3FV5 A;  2XJX A;  2CH4 A;  4URN A;  3K99 A;  3DGE A;  3U2D A;  2WI6 A;  5M4E A;  1Z5C A;  1US7 A;  1UYL A;  4LWH A;  1NHI A;  4CWP A;  1YT2 A;  3CGY A;  4WUB A;  4HXZ A;  4KP4 A;  4EGH A;  3GIE A;  4XTJ A;  2VW5 A;  2E0A A;  1I59 A;  3C11 A;  4GFN A;  5M4N A;  2XX2 A;  2CGF A;  4NH7 A;  4GEE A;  2YEE A;  4EFU A;  4YKX A;  2VWC A;  3B26 A;  2YED A;  4GGL A;  2BT0 A;  2BSM A;  2YE6 A;  2YGE A;  5CTU A;  5IDM A;  1TBW A;  4JAS A;  4BIU A;  2C1G A;  5M4P A;  3B27 A;  3TTZ A;  1Y4S A;  2JKI A;  1UYE A;  2AKP A;  2ESA A;  4EM7 A;  2YEI A;  2YEJ A;  2CCU A;  5D7R A;  3HYY A;  1GKX A;  3B24 A;  4O04 A;  5J6A A;  1U2O A;  3A0X A;  2YE8 A;  4NH9 A;  3A0Y A;  5FWK A;  2QG0 A;  2K5B A;  3EHH A;  3ZXO A;  2FXS A;  3RLP A;  3O0I A;  2JJC A;  4CWN A;  1UY9 A;  2FTK A;  3G7B A;  1Y4U A;  4CE1 A;  1YSZ A;  1JM6 A;  4H81 A;  2YEF A;  2BU2 A;  1KZN A;  3WQ9 A;  2YEG A;  1Y8N A;  1EI1 A;  4L93 A;  4QPJ A;  3QTF A;  5BOC A;  1TH8 A;  4XIT A;  3MNR P;  2XDX A;  4BQG A;  4ASF A;  2BRC A;  1UYH A;  4CE2 A;  2XX4 A;  3B28 A;  2Q8I A;  2YE7 A;  3A0T A;  3SL2 A;  3TZ0 A;  2IWX A;  3WHA A;  1Y8P A;  2YI7 A;  4HY6 A;  2XDL A;  4ASG A;  3T10 A;  3CGZ A;  3Q5K A;  3EHG A;  4JQL A;  2Q8H A;  4B7P A;  1YT0 A;  3JZ3 A;  3U67 A;  3TZ2 A;  4WUD A;  3FT5 A;  4XKA A;  3CRL A;  4L8Z A;  2YJW A;  5D6Q A;  4AS9 A;  3O2F A;  3O6O A;  2BU8 A;  4HY1 A;  4PRX A;  4H85 A;  4KFG A;  3K60 A;  3R4N A;  4B6C A;  2YEH A;  3K97 A;  2YE9 A;  4R3M A;  2Q8G A;  4PU9 A;  1Z5B A;  4L91 A;  4P7A A;  2C2A A;  3GIG B;  1KIJ A;  1ID0 A;  1B63 A;  1UYD A;  4MPC A;  2O1U A;  2YK9 A;  3GIG A;  1YER A;  3KE6 A;  4YKR A;  2VCI A;  1YT1 A;  1BGQ A;  4GQT A;  2YE3 A;  3G75 A;  3PEJ A;  3H80 A;  3FT8 A;  2YE5 A;  1UYM A;  2BZ5 A;  4XD8 A;  2XD6 A;  3D0B A;  4XIP A;  2CCT A;  3T0H A;  5L3J A;  2HCH A;  3T2S A;  2WER A;  5CPH A;  1UY8 A;  1H7U A;  3ZKD A;  2IWU A;  3D2R A;  2ZDY A;  3Q5L A;  5C93 A;  3R4O A;  4LWE A;  4P8O A;  2QG2 A;  3VHD A;  2XCM A;  4DUH A;  3B25 A;  2IOP A;  2ZBK B;  4MPE A;  2BU6 A;  1MX0 A;  1AMW A;  4XKO A;  3INX A;  3T1K A;  4I3H A;  4MB9 A;  4EFT A;  4CE3 A;  3ZXQ A;  5IDJ A;  1EA6 A;  3HZ1 A;  1S14 A;  5J71 A;  1TC6 A;  4EEH A;  1B62 A;  1ZXN A;  4GT8 A;  5M4H A;  4L90 A;  5CTX A;  5D6P A;  1I5B A;  2IWS A;  3Q5J A;  4PRV A;  3T0Z A;  3EHF A;  1YC4 A;  4XCL A;  4I5S A;  3HEK A;  4HXW A;  2GFD A;  4HYP A;  4CWQ A;  5FND A;  3CWV A;  4XE2 A;  1S16 A;  4URL A;  4LWF A;  4LWI A;  5M4K A;  1UYC A;  2YGA A;  3R92 A;  5FNF A;  2YKI A;  4O07 A;  4KSG A;  4E72 A;  1H7S A;  2YEC A;  4X9L A;  2YGF A;  4ASB A;  2CCS A;  5D7C A;  5M4M A;  4L94 A;  3K98 A;  1THN A;  4Q20 A;  4NH8 A;  1UY7 A;  4LWG A;  2CG9 A;  2YKE A;  2YKB A;  4MP2 A;  5CTY A;  4U7O A;  3A0R A;  4GCZ A;  3OWD A;  4W7T A;  4FCR A;  3S5T A;  5CF0 A;  4URM A;  1IXM A;  1AJ6 A;  1AH6 A;  3C0E A;  2XDU A;  1UYF A;  1AM1 A;  1TIL A;  2QFO A;  4YKT A;  1GKZ A;  3R4P A;  2WI3 A;  2YE2 A;  5GGZ A;  4ASA A;  1Y8O A;  3RKZ A;  2IOR A;  3IED A;  3RLQ A;  3OMU A;  1R62 A;  4AWQ A;  5F5R A;  4E02 A;  3EKO A;  1ZW9 A;  3R4M A;  1I5D A;  4EGK A;  2GQP A;  4ZKI A;  3CYG A;  3OW6 A;  2UWD A;  2BU5 A;  1ZWH A;  4HYM A;  3PEH A;  1UYK A;  2QF6 A;  2XAB A;  1NHH A;  4CWF A;  3TUH A;  2BYI A;  2ZKJ A;  3BM9 A;  5IN9 A;  1AH8 A;  1TC0 A;  2XDS A;  4EGI A;  3OPD A;  2H8M A;  4LPB A;  2WI7 A;  3HYZ A;  4HZ5 A;  3A0Z A;  3U2K A;  4LP0 A;  2ZDX A;  4U93 A;  2FYP A;  3BMY A;  3ZM7 A;  2IOQ A;  3HZ5 A;  2VCJ A;  1F51 A;  1YET A;  2O1W A;  4HZ0 A;  2EXL A;  2WI4 A;  4U7N A;  3TZ5 A;  2C1I A;  4QPK A;  1TID A;  4FCQ A;  3VHA A;  5BOD A;  2H55 A;  2WEQ A;  4MBC A;  5F3K A;  4O09 A;  4E00 A;  1I58 A;  4FMT A;  1BKN A;  3INW A;  1OSF A;  4CWR A;  2XJJ A;  3GIF A;  4BAE A;  3R91 A;  2XHX A;  1PVG A;  2WI2 A;  2BYH A;  2FWY A;  1ZXM A;  4H7Q A;  4BIZ A;  1U0Z A;  2YI5 A;  2YI0 A;  3TZ4 A;  3H4L A;  3A0W A;  2YKJ A;  3G7E A;  5D7D A;  3EKR A;  4URO A;  4MP7 A;  4YKZ A;  4E01 A;  1UYG A;  4K4O A;  2YE4 A;  4DZY A;  4KTN A;  4FCP A;  4V25 A;  4CWT A;  4JAU A;  4BQJ A;  5FNC A; 
#chains in the Genus database with same CATH homology
 2XK2 A;  1L0O A;  1YSR A;  1I5C A;  1YC3 A;  2XDK A;  2XHR A;  2YKC A;  4MOT A;  1I5A A;  2XJG A;  3RLR A;  3OWB A;  1GJV A;  4AWO A;  2XX5 A;  4R3A A;  2PNR A;  4YKY A;  1QY8 A;  3QDD A;  4FPP A;  1QYE A;  1A4H A;  4O0B A;  4EMV A;  1YES A;  2BTZ A;  3D36 A;  1MU5 A;  5CTW A;  1NHJ A;  1QZR A;  4XIR A;  2YI6 A;  4O05 A;  2XHT A;  2WEP A;  2HKJ A;  4XIQ A;  4XC0 A;  4AWP A;  4MPN A;  4CWO A;  2YK2 A;  1Z5A A;  1BXD A;  1UYI A;  3EHJ A;  4KSH A;  3VHC A;  4ZVI A;  1YC1 A;  3VAD A;  2WI5 A;  4R1F A;  4XDM A;  2Q8F A;  2YJX A;  4XKK A;  4CWS A;  4V26 A;  3LPS A;  4PL9 A;  2YEB A;  3NMQ A;  4WUC A;  3CRK A;  2HG1 A;  2FWZ A;  1UY6 A;  3ZKB A;  4YKQ A;  1B3Q A;  1YS3 A;  4YKW A;  2WI1 A;  4KQV A;  2Q2E B;  4XCJ A;  2YEA A;  2BRE A;  2BU7 A;  4JAV A;  4BXI A;  3LNU A;  2O1V A;  4YKU A;  3HHU A;  1Z59 A;  1BYQ A;  3FV5 A;  2XJX A;  2CH4 A;  4URN A;  3K99 A;  3DGE A;  3U2D A;  2WI6 A;  5M4E A;  1Z5C A;  1US7 A;  1UYL A;  4LWH A;  1NHI A;  4CWP A;  1YT2 A;  3CGY A;  4WUB A;  4HXZ A;  4KP4 A;  4EGH A;  3GIE A;  4XTJ A;  2VW5 A;  2E0A A;  1I59 A;  3C11 A;  4GFN A;  5M4N A;  2XX2 A;  2CGF A;  4NH7 A;  4GEE A;  2YEE A;  4EFU A;  4YKX A;  2VWC A;  3B26 A;  2YED A;  4GGL A;  2BT0 A;  2BSM A;  2YE6 A;  2YGE A;  5CTU A;  5IDM A;  1TBW A;  4JAS A;  4BIU A;  5M4P A;  3B27 A;  3TTZ A;  1Y4S A;  2JKI A;  1UYE A;  2AKP A;  2ESA A;  4EM7 A;  2YEI A;  2YEJ A;  2CCU A;  5D7R A;  3HYY A;  1GKX A;  3B24 A;  4O04 A;  5J6A A;  1U2O A;  3A0X A;  2YE8 A;  4NH9 A;  3A0Y A;  5FWK A;  2QG0 A;  2K5B A;  3EHH A;  3ZXO A;  2FXS A;  3RLP A;  3O0I A;  2JJC A;  4CWN A;  1UY9 A;  3G7B A;  1Y4U A;  4CE1 A;  1YSZ A;  1JM6 A;  4H81 A;  2YEF A;  2BU2 A;  1KZN A;  3WQ9 A;  2YEG A;  1Y8N A;  1EI1 A;  4L93 A;  4QPJ A;  3QTF A;  5BOC A;  1TH8 A;  4XIT A;  3MNR P;  2XDX A;  4BQG A;  4ASF A;  2BRC A;  1UYH A;  4CE2 A;  2XX4 A;  3B28 A;  2Q8I A;  2YE7 A;  3A0T A;  3SL2 A;  3TZ0 A;  2IWX A;  3WHA A;  1Y8P A;  2YI7 A;  4HY6 A;  2XDL A;  4ASG A;  3T10 A;  3CGZ A;  3Q5K A;  3EHG A;  4JQL A;  2Q8H A;  4B7P A;  1YT0 A;  3JZ3 A;  3U67 A;  3TZ2 A;  4WUD A;  3FT5 A;  4XKA A;  3CRL A;  4L8Z A;  2YJW A;  5D6Q A;  4AS9 A;  3O2F A;  3O6O A;  2BU8 A;  4HY1 A;  4PRX A;  4H85 A;  4KFG A;  3K60 A;  3R4N A;  4B6C A;  2YEH A;  3K97 A;  2YE9 A;  4R3M A;  2Q8G A;  4PU9 A;  1Z5B A;  4L91 A;  4P7A A;  2C2A A;  3GIG B;  1KIJ A;  1ID0 A;  1B63 A;  1UYD A;  4MPC A;  2O1U A;  2YK9 A;  3GIG A;  1YER A;  3KE6 A;  4YKR A;  2VCI A;  1YT1 A;  1BGQ A;  4GQT A;  2YE3 A;  3G75 A;  3PEJ A;  3H80 A;  3FT8 A;  2YE5 A;  1UYM A;  2BZ5 A;  4XD8 A;  2XD6 A;  3D0B A;  4XIP A;  2CCT A;  3T0H A;  5L3J A;  2HCH A;  3T2S A;  2WER A;  5CPH A;  1UY8 A;  1H7U A;  3ZKD A;  2IWU A;  3D2R A;  2ZDY A;  3Q5L A;  5C93 A;  3R4O A;  4LWE A;  4P8O A;  2QG2 A;  3VHD A;  2XCM A;  4DUH A;  3B25 A;  2IOP A;  2ZBK B;  4MPE A;  2BU6 A;  1MX0 A;  1AMW A;  4XKO A;  3INX A;  3T1K A;  4I3H A;  4MB9 A;  4EFT A;  4CE3 A;  3ZXQ A;  5IDJ A;  1EA6 A;  3HZ1 A;  1S14 A;  5J71 A;  1TC6 A;  4EEH A;  1B62 A;  1ZXN A;  4GT8 A;  5M4H A;  4L90 A;  5CTX A;  5D6P A;  1I5B A;  2IWS A;  3Q5J A;  4PRV A;  3T0Z A;  3EHF A;  1YC4 A;  4XCL A;  4I5S A;  3HEK A;  4HXW A;  2GFD A;  4HYP A;  4CWQ A;  5FND A;  3CWV A;  4XE2 A;  1S16 A;  4URL A;  4LWF A;  4LWI A;  5M4K A;  1UYC A;  2YGA A;  3R92 A;  5FNF A;  2YKI A;  4O07 A;  4KSG A;  1H7S A;  2YEC A;  4X9L A;  2YGF A;  4ASB A;  2CCS A;  5D7C A;  5M4M A;  4L94 A;  3K98 A;  1THN A;  4Q20 A;  4NH8 A;  1UY7 A;  4LWG A;  2CG9 A;  2YKE A;  2YKB A;  4MP2 A;  5CTY A;  4U7O A;  3A0R A;  4GCZ A;  3OWD A;  4W7T A;  4FCR A;  5CF0 A;  4URM A;  1AJ6 A;  1AH6 A;  3C0E A;  2XDU A;  1UYF A;  1AM1 A;  1TIL A;  2QFO A;  4YKT A;  1GKZ A;  3R4P A;  2WI3 A;  2YE2 A;  5GGZ A;  4ASA A;  1Y8O A;  3RKZ A;  2IOR A;  3IED A;  3RLQ A;  3OMU A;  1R62 A;  4AWQ A;  5F5R A;  4E02 A;  3EKO A;  1ZW9 A;  3R4M A;  1I5D A;  4EGK A;  2GQP A;  4ZKI A;  3OW6 A;  2UWD A;  2BU5 A;  1ZWH A;  4HYM A;  3PEH A;  1UYK A;  2QF6 A;  2XAB A;  1NHH A;  4CWF A;  3TUH A;  2BYI A;  2ZKJ A;  3BM9 A;  5IN9 A;  1AH8 A;  1TC0 A;  2XDS A;  4EGI A;  3OPD A;  2H8M A;  4LPB A;  2WI7 A;  3HYZ A;  4HZ5 A;  3A0Z A;  3U2K A;  4LP0 A;  2ZDX A;  4U93 A;  2FYP A;  3BMY A;  3ZM7 A;  2IOQ A;  3HZ5 A;  2VCJ A;  1YET A;  2O1W A;  4HZ0 A;  2EXL A;  2WI4 A;  4U7N A;  3TZ5 A;  4QPK A;  1TID A;  4FCQ A;  3VHA A;  5BOD A;  2H55 A;  2WEQ A;  4MBC A;  5F3K A;  4O09 A;  4E00 A;  1I58 A;  4FMT A;  1BKN A;  3INW A;  1OSF A;  4CWR A;  2XJJ A;  3GIF A;  4BAE A;  3R91 A;  2XHX A;  1PVG A;  2WI2 A;  2BYH A;  2FWY A;  1ZXM A;  4H7Q A;  4BIZ A;  1U0Z A;  2YI5 A;  2YI0 A;  3TZ4 A;  3H4L A;  3A0W A;  2YKJ A;  3G7E A;  5D7D A;  3EKR A;  4URO A;  4MP7 A;  4YKZ A;  4E01 A;  1UYG A;  4K4O A;  2YE4 A;  4DZY A;  4KTN A;  4FCP A;  4V25 A;  4CWT A;  4JAU A;  4BQJ A;  5FNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...