3EHJA

Crystal structure of deskc-h188v in complex with amp-pcp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
206
structure length
203
Chain Sequence
KLEDANERIAELVKLEERQRMARDLVDTLGQKLSLMGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSSMKGIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQAKTCRVDIQQLWKEVVITVSDDGTFKGEENSFHGLLGMRERLEFANGSLHIDTENGTKLTMAIPNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor kinase (YocF protein)
publication title Structural plasticity and catalysis regulation of a thermosensor histidine kinase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 60
structure length 203
sequence length 206
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07730 HisKA_3 Histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 3ehjA02
3ZKBA 1UYEA 4MBCA 2YEFA 3U2KA 3U2DA 4XKKA 3GIGA 5FWKA 2C2AA 1AM1A 1ZW9A 4NH9A 2Q2EB 5J71A 4R3MA 4FCQA 2AKPA 3HYYA 2BSMA 2BZ5A 4CWNA 4R3AA 4HXWA 3EKRA 4MPCA 3A0TA 4O0BA 5D6PA 4V25A 4YKTA 2WI7A 3HYZA 4WUBA 3RKZA 2FWZA 2YE3A 3DGEA 2XDKA 2O1UA 2YGEA 3WQ9A 2BU2A 2QG2A 2Q8HA 5IN9A 2YKJA 4XITA 3QDDA 3H4LA 4BXIA 1AH6A 2YE6A 3Q5LA 3EHJA 2CH4A 1UY8A 2WERA 3TZ0A 3CGYA 2XCMA 3B26A 4HYMA 1YC3A 2YJWA 3KE6A 3TZ2A 3ZXOA 4AS9A 1Y8NA 1YERA 3GIFA 2JKIA 2YECA 4HY6A 4I5SA 2XHTA 4V26A 2XX4A 1NHIA 4EMVA 2BYHA 2QG0A 5J6AA 1BGQA 4EFUA 4H81A 3B27A 2VCIA 4MP7A 4NH8A 4EGKA 2BTZA 1YC1A 4LP0A 4URNA 3B24A 2IWSA 1UYHA 2YEIA 3RLPA 3INWA 3IEDA 1YT0A 3T2SA 4YKYA 2GQPA 4DZYA 1UYDA 1YS3A 3GIGB 2CCUA 1OSFA 1ZXMA 2XJXA 4LPBA 4O09A 2BU6A 5D7DA 5D7CA 1NHHA 4XTJA 4GQTA 1UYLA 2XHRA 2O1WA 2CCTA 3K99A 3ZKDA 4K4OA 4XD8A 5D6QA 1QY8A 1UYKA 3R92A 3A0ZA 2HKJA 4KTNA 4GT8A 5CTXA 1US7A 3OWBA 3O2FA 3VHAA 1YT1A 1B62A 1TIDA 3TTZA 4P8OA 2BT0A 2E0AA 2XJGA 3A0YA 2VWCA 1EA6A 1S16A 4JAUA 3PEHA 4LWHA 4CE1A 3G7EA 2BU5A 4B6CA 2YEGA 1S14A 2ZBKB 4MPNA 5M4MA 3ZM7A 2YI6A 5CTUA 2YEAA 3EHHA 4PRVA 4ASAA 3A0WA 1Z5CA 4HY1A 1Z59A 2WEPA 4CE2A 3Q5JA 4L91A 4E02A 1Y8OA 5D7RA 3LNUA 5FNDA 4HYPA 1BYQA 1AJ6A 3QTFA 4JAVA 2CG9A 1YSRA 1TBWA 4B7PA 1Y4SA 4GFNA 4L8ZA 4XCJA 4FPPA 3NMQA 4XIRA 3K97A 2ESAA 5CF0A 5M4EA 3B25A 4NH7A 3C11A 1QYEA 4FCPA 2WI6A 3VHCA 2QFOA 1EI1A 5FNFA 5M4KA 1GKXA 4CWFA 4LWFA 2YKIA 2YEBA 4XCLA 1PVGA 3G7BA 4BIUA 2WI3A 3HEKA 4E00A 4PRXA 3JZ3A 4WUCA 1B3QA 4YKQA 4BIZA 3TZ4A 1TC0A 2IWXA 2YEEA 4MPEA 1AH8A 4YKWA 4YKXA 1NHJA 5M4HA 3RLRA 2VW5A 4KSGA 2YE9A 1UY7A 1I5BA 1L0OA 2BU7A 3T10A 4MP2A 1AMWA 4HXZA 2IOPA 4CWOA 2FYPA 3Q5KA 3T0HA 3O6OA 2YEHA 4U7OA 4FMTA 3FT8A 4XC0A 5FNCA 2XD6A 3D36A 5IDMA 5CPHA 4EM7A 4CWSA 3OPDA 3RLQA 2Q8IA 3A0RA 5F5RA 3A0XA 2XX2A 4KQVA 3PEJA 2YEDA 3D0BA 4L90A 4LWIA 4URLA 1UYCA 3G75A 1YC4A 2XDXA 2ZDYA 4X9LA 4URMA 2BU8A 4CE3A 2Q8GA 3WHAA 4EGIA 4I3HA 1YETA 3O0IA 2PNRA 2XX5A 4XE2A 3CGZA 3OWDA 2YK2A 1Z5AA 4O07A 4GCZA 2K5BA 4EFTA 2HG1A 3T1KA 4KP4A 4FCRA 2BYIA 1Y8PA 4AWOA 2YE5A 4EEHA 1GKZA 4EGHA 1U0ZA 1ZXNA 3FV5A 4O04A 5BODA 4YKZA 3SL2A 4YKRA 4ASFA 3T0ZA 2XDSA 1UY9A 1H7UA 5L3JA 5M4NA 5F3KA 3CRLA 4JQLA 3ZXQA 3MNRP 4XKAA 4AWQA 3BM9A 3TZ5A 1BXDA 4ASBA 1THNA 1UYMA 2EXLA 4XDMA 2H8MA 1KIJA 4HZ0A 4H7QA 2O1VA 3K98A 3FT5A 2VCJA 3U67A 2XHXA 2YKEA 2H55A 5IDJA 1MU5A 4KFGA 4BQGA 2BREA 4QPKA 2YI0A 4PU9A 1UYFA 4MB9A 2YKCA 2YGAA 1YESA 4KSHA 1I5AA 1I5DA 3HZ1A 4LWEA 1UY6A 4JASA 4HZ5A 3R91A 5M4PA 2FWYA 3VADA 4GGLA 4PL9A 2YE7A 1KZNA 4XIQA 2XJJA 1ID0A 2BRCA 4XKOA 4ZKIA 1Z5BA 2WI2A 4Q20A 2IOQA 4ASGA 4WUDA 2FXSA 4U93A 1I5CA 3INXA 3K60A 4L94A 4LWGA 4CWTA 1QZRA 2CGFA 4GEEA 2HCHA 5CTYA 2XDLA 3R4PA 3D2RA 2WI1A 2YGFA 2WI5A 4QPJA 3EKOA 3CWVA 3BMYA 1B63A 3TUHA 2JJCA 5CTWA 1YSZA 5BOCA 4YKUA 3VHDA 1A4HA 2CCSA 3OW6A 4DUHA 3HZ5A 2XK2A 1UYIA 4L93A 3C0EA 3R4OA 2YI7A 1ZWHA 2ZDXA 4W7TA 2WEQA 2YI5A 2IORA 4R1FA 3EHGA 3H80A 1I59A 3CRKA 4UROA 2QF6A 2XABA 3HHUA 3B28A 4CWQA 4O05A 1Y4UA 1R62A 3OMUA 4U7NA 4XIPA 3R4NA 1I58A 3R4MA 2XDUA 1MX0A 1TILA 2ZKJA 1TC6A 2GFDA 4BAEA 4H85A 4CWPA 5C93A 2YE4A 2YK9A 4ZVIA 1BKNA 1TH8A 3LPSA 4CWRA 4AWPA 2IWUA 2Q8FA 1U2OA 1JM6A 5GGZA 1YT2A 1UYGA 2YE8A 4P7AA 1GJVA 2UWDA 3GIEA 2YJXA 2YEJA 2YE2A 2WI4A 4BQJA 1H7SA 4MOTA 4E01A 2YKBA 3EHFA
chains in the Genus database with same CATH superfamily
3ZKBA 1UYEA 4MBCA 2YEFA 3U2KA 3U2DA 4XKKA 3GIGA 5FWKA 2C2AA 1AM1A 1ZW9A 4NH9A 2Q2EB 5J71A 4R3MA 4FCQA 2AKPA 3HYYA 2BSMA 2BZ5A 4CWNA 4R3AA 4HXWA 3EKRA 4MPCA 3A0TA 4O0BA 5D6PA 4V25A 4YKTA 2WI7A 3HYZA 4WUBA 3RKZA 2FWZA 2FTKA 2YE3A 3DGEA 2XDKA 2O1UA 2YGEA 3WQ9A 2BU2A 2QG2A 2Q8HA 5IN9A 2YKJA 4XITA 3QDDA 3H4LA 4BXIA 1AH6A 2YE6A 3Q5LA 3EHJA 2CH4A 1UY8A 2WERA 3TZ0A 3CGYA 2XCMA 3B26A 4HYMA 1YC3A 2YJWA 3KE6A 3TZ2A 5JENA 3ZXOA 4AS9A 1Y8NA 1YERA 3GIFA 2JKIA 2YECA 4HY6A 4I5SA 2XHTA 4V26A 2XX4A 1IXMA 1NHIA 4EMVA 2BYHA 2QG0A 5J6AA 1BGQA 4EFUA 4H81A 3B27A 2VCIA 4MP7A 4NH8A 4EGKA 2BTZA 1YC1A 4LP0A 4URNA 3B24A 2IWSA 1UYHA 2YEIA 3CYGA 3RLPA 3INWA 3IEDA 1YT0A 3T2SA 4YKYA 2GQPA 4DZYA 1UYDA 1YS3A 3GIGB 2CCUA 1OSFA 1ZXMA 2XJXA 4LPBA 4O09A 2BU6A 5D7DA 5D7CA 1NHHA 4XTJA 4GQTA 1UYLA 2XHRA 2O1WA 2CCTA 3K99A 3ZKDA 4K4OA 4XD8A 5D6QA 1QY8A 1UYKA 3R92A 3A0ZA 2HKJA 4KTNA 4GT8A 5CTXA 1US7A 3OWBA 3O2FA 3VHAA 1YT1A 1B62A 1TIDA 3TTZA 4P8OA 2BT0A 2E0AA 2XJGA 3A0YA 2VWCA 1EA6A 1S16A 4JAUA 3PEHA 4LWHA 4CE1A 3G7EA 2BU5A 4B6CA 2YEGA 1S14A 2ZBKB 4MPNA 5M4MA 3ZM7A 2YI6A 5CTUA 2YEAA 3EHHA 4PRVA 4ASAA 3A0WA 1Z5CA 4HY1A 1Z59A 2WEPA 4CE2A 3Q5JA 4L91A 4E02A 1Y8OA 5D7RA 3LNUA 5FNDA 4HYPA 1BYQA 1AJ6A 3QTFA 4JAVA 2CG9A 1YSRA 1TBWA 4B7PA 1Y4SA 4GFNA 4L8ZA 4XCJA 4FPPA 3NMQA 4XIRA 3K97A 2ESAA 5CF0A 5M4EA 3B25A 4NH7A 3C11A 1QYEA 4FCPA 2C1IA 2WI6A 3VHCA 2QFOA 1EI1A 5FNFA 5M4KA 1GKXA 4CWFA 4LWFA 2YKIA 2YEBA 4XCLA 1PVGA 3G7BA 4BIUA 2WI3A 3HEKA 4E00A 4PRXA 3JZ3A 4WUCA 1B3QA 4YKQA 4BIZA 3TZ4A 1TC0A 2IWXA 2YEEA 4MPEA 1AH8A 4YKWA 4YKXA 1NHJA 5M4HA 3RLRA 2VW5A 4KSGA 2YE9A 1UY7A 1I5BA 1L0OA 2BU7A 3T10A 4MP2A 1AMWA 4HXZA 2IOPA 4CWOA 2FYPA 2C1GA 3Q5KA 3T0HA 3O6OA 2YEHA 4U7OA 3FT8A 4FMTA 4XC0A 5FNCA 2XD6A 3D36A 5IDMA 5CPHA 4EM7A 4CWSA 3OPDA 3RLQA 2Q8IA 3A0RA 5F5RA 3A0XA 2XX2A 4KQVA 3PEJA 2YEDA 3D0BA 4L90A 4LWIA 4URLA 1UYCA 3G75A 1YC4A 2XDXA 2ZDYA 4X9LA 4URMA 2BU8A 4CE3A 2Q8GA 3LMMA 3WHAA 4EGIA 4I3HA 1YETA 3O0IA 2PNRA 2XX5A 4XE2A 3CGZA 3OWDA 2YK2A 1Z5AA 4O07A 4GCZA 2K5BA 4EFTA 2HG1A 3T1KA 4KP4A 4FCRA 2BYIA 1Y8PA 4AWOA 2YE5A 4EEHA 1GKZA 4EGHA 1U0ZA 1ZXNA 3FV5A 4O04A 5BODA 4YKZA 3SL2A 4YKRA 4ASFA 3T0ZA 2XDSA 1UY9A 1H7UA 5L3JA 5M4NA 5F3KA 3CRLA 4JQLA 3ZXQA 3MNRP 4XKAA 4AWQA 3BM9A 3TZ5A 1BXDA 4ASBA 1THNA 1UYMA 2EXLA 4XDMA 2H8MA 1KIJA 4HZ0A 4H7QA 2O1VA 3K98A 3FT5A 2VCJA 3U67A 2XHXA 2YKEA 2H55A 5IDJA 1MU5A 4KFGA 4BQGA 2BREA 4QPKA 2YI0A 4PU9A 1UYFA 4MB9A 2YKCA 2HHIA 2YGAA 1YESA 4KSHA 1I5AA 1I5DA 3HZ1A 4E72A 4LWEA 1UY6A 4JASA 4HZ5A 3R91A 5M4PA 2FWYA 3VADA 4GGLA 4PL9A 2YE7A 1KZNA 4XIQA 2XJJA 1ID0A 2BRCA 4XKOA 4ZKIA 1Z5BA 2WI2A 4Q20A 2IOQA 4ASGA 4WUDA 2FXSA 4U93A 1I5CA 3INXA 3K60A 4L94A 4LWGA 4CWTA 1QZRA 2CGFA 4GEEA 2HCHA 5CTYA 2XDLA 3R4PA 3D2RA 2WI1A 2YGFA 2WI5A 4QPJA 3EKOA 3CWVA 3BMYA 1B63A 3TUHA 2JJCA 5CTWA 1YSZA 5BOCA 4YKUA 3VHDA 1A4HA 2CCSA 3OW6A 4DUHA 3HZ5A 2XK2A 1UYIA 4L93A 3C0EA 3R4OA 2YI7A 1ZWHA 2ZDXA 4W7TA 2WEQA 2YI5A 2IORA 4R1FA 3EHGA 3H80A 1I59A 3CRKA 4UROA 1F51A 2QF6A 2XABA 3HHUA 3B28A 4CWQA 4O05A 1Y4UA 1R62A 3OMUA 4U7NA 4XIPA 3R4NA 1I58A 3R4MA 2XDUA 1MX0A 1TILA 2ZKJA 1TC6A 2GFDA 4BAEA 4H85A 4CWPA 3S5TA 5C93A 2YE4A 2YK9A 4ZVIA 1BKNA 1TH8A 3LPSA 4CWRA 4AWPA 2IWUA 2Q8FA 1U2OA 1JM6A 5GGZA 1YT2A 1UYGA 2YE8A 4P7AA 1GJVA 2UWDA 3GIEA 2YJXA 2YEJA 2YE2A 2WI4A 4BQJA 1H7SA 4MOTA 4E01A 2YKBA 3EHFA
chains in the Genus database with same CATH topology
3ZKBA 1UYEA 4MBCA 2YEFA 3U2KA 3U2DA 4XKKA 3GIGA 5FWKA 2C2AA 1AM1A 1ZW9A 4NH9A 2Q2EB 5J71A 4R3MA 4FCQA 2AKPA 3HYYA 2BSMA 2BZ5A 4CWNA 4R3AA 4HXWA 3EKRA 4MPCA 3A0TA 4O0BA 5D6PA 4V25A 4YKTA 2WI7A 3HYZA 4WUBA 3RKZA 2FWZA 2YE3A 3DGEA 2XDKA 2O1UA 2YGEA 3WQ9A 2BU2A 2QG2A 2Q8HA 5IN9A 2YKJA 4XITA 3QDDA 3H4LA 4BXIA 1AH6A 2YE6A 3Q5LA 3EHJA 2CH4A 1UY8A 2WERA 3TZ0A 3CGYA 2XCMA 3B26A 4HYMA 1YC3A 2YJWA 3KE6A 3TZ2A 3ZXOA 4AS9A 1Y8NA 1YERA 3GIFA 2JKIA 2YECA 4HY6A 4I5SA 2XHTA 4V26A 2XX4A 1NHIA 4EMVA 2BYHA 2QG0A 5J6AA 1BGQA 4EFUA 4H81A 3B27A 2VCIA 4MP7A 4NH8A 4EGKA 2BTZA 1YC1A 4LP0A 4URNA 3B24A 2IWSA 1UYHA 2YEIA 3RLPA 3INWA 3IEDA 1YT0A 3T2SA 4YKYA 2GQPA 4DZYA 1UYDA 1YS3A 3GIGB 2CCUA 1OSFA 1ZXMA 2XJXA 4LPBA 4O09A 2BU6A 5D7DA 5D7CA 1NHHA 4XTJA 4GQTA 1UYLA 2XHRA 2O1WA 2CCTA 3K99A 3ZKDA 4K4OA 4XD8A 5D6QA 1QY8A 1UYKA 3R92A 3A0ZA 2HKJA 4KTNA 4GT8A 5CTXA 1US7A 3OWBA 3O2FA 3VHAA 1YT1A 1B62A 1TIDA 3TTZA 4P8OA 2BT0A 2E0AA 2XJGA 3A0YA 2VWCA 1EA6A 1S16A 4JAUA 3PEHA 4LWHA 4CE1A 3G7EA 2BU5A 4B6CA 2YEGA 1S14A 2ZBKB 4MPNA 5M4MA 3ZM7A 2YI6A 5CTUA 2YEAA 3EHHA 4PRVA 4ASAA 3A0WA 1Z5CA 4HY1A 1Z59A 2WEPA 4CE2A 3Q5JA 4L91A 4E02A 1Y8OA 5D7RA 3LNUA 5FNDA 4HYPA 1BYQA 1AJ6A 3QTFA 4JAVA 2CG9A 1YSRA 1TBWA 4B7PA 1Y4SA 4GFNA 4L8ZA 4XCJA 4FPPA 3NMQA 4XIRA 3K97A 2ESAA 5CF0A 5M4EA 3B25A 4NH7A 3C11A 1QYEA 4FCPA 2WI6A 3VHCA 2QFOA 1EI1A 5FNFA 5M4KA 1GKXA 4CWFA 4LWFA 2YKIA 2YEBA 4XCLA 1PVGA 3G7BA 4BIUA 2WI3A 3HEKA 4E00A 4PRXA 3JZ3A 4WUCA 1B3QA 4YKQA 4BIZA 3TZ4A 1TC0A 2IWXA 2YEEA 4MPEA 1AH8A 4YKWA 4YKXA 1NHJA 5M4HA 3RLRA 2VW5A 4KSGA 2YE9A 1UY7A 1I5BA 1L0OA 2BU7A 3T10A 4MP2A 1AMWA 4HXZA 2IOPA 4CWOA 2FYPA 3Q5KA 3T0HA 3O6OA 2YEHA 4U7OA 4FMTA 3FT8A 4XC0A 5FNCA 2XD6A 3D36A 5IDMA 5CPHA 4EM7A 4CWSA 3OPDA 3RLQA 2Q8IA 3A0RA 5F5RA 3A0XA 2XX2A 4KQVA 3PEJA 2YEDA 3D0BA 4L90A 4LWIA 4URLA 1UYCA 3G75A 1YC4A 2XDXA 2ZDYA 4X9LA 4URMA 2BU8A 4CE3A 2Q8GA 3WHAA 4EGIA 4I3HA 1YETA 3O0IA 2PNRA 2XX5A 4XE2A 3CGZA 3OWDA 2YK2A 1Z5AA 4O07A 4GCZA 2K5BA 4EFTA 2HG1A 3T1KA 4KP4A 4FCRA 2BYIA 1Y8PA 4AWOA 2YE5A 4EEHA 1GKZA 4EGHA 1U0ZA 1ZXNA 3FV5A 4O04A 5BODA 4YKZA 3SL2A 4YKRA 4ASFA 3T0ZA 2XDSA 1UY9A 1H7UA 5L3JA 5M4NA 5F3KA 3CRLA 4JQLA 3ZXQA 3MNRP 4XKAA 4AWQA 3BM9A 3TZ5A 1BXDA 4ASBA 1THNA 1UYMA 2EXLA 4XDMA 2H8MA 1KIJA 4HZ0A 4H7QA 2O1VA 3K98A 3FT5A 2VCJA 3U67A 2XHXA 2YKEA 2H55A 5IDJA 1MU5A 4KFGA 4BQGA 2BREA 4QPKA 2YI0A 4PU9A 1UYFA 4MB9A 2YKCA 2YGAA 1YESA 4KSHA 1I5AA 1I5DA 3HZ1A 4LWEA 1UY6A 4JASA 4HZ5A 3R91A 5M4PA 2FWYA 3VADA 4GGLA 4PL9A 2YE7A 1KZNA 4XIQA 2XJJA 1ID0A 2BRCA 4XKOA 4ZKIA 1Z5BA 2WI2A 4Q20A 2IOQA 4ASGA 4WUDA 2FXSA 4U93A 1I5CA 3INXA 3K60A 4L94A 4LWGA 4CWTA 1QZRA 2CGFA 4GEEA 2HCHA 5CTYA 2XDLA 3R4PA 3D2RA 2WI1A 2YGFA 2WI5A 4QPJA 3EKOA 3CWVA 3BMYA 1B63A 3TUHA 2JJCA 5CTWA 1YSZA 5BOCA 4YKUA 3VHDA 1A4HA 2CCSA 3OW6A 4DUHA 3HZ5A 2XK2A 1UYIA 4L93A 3C0EA 3R4OA 2YI7A 1ZWHA 2ZDXA 4W7TA 2WEQA 2YI5A 2IORA 4R1FA 3EHGA 3H80A 1I59A 3CRKA 4UROA 2QF6A 2XABA 3HHUA 3B28A 4CWQA 4O05A 1Y4UA 1R62A 3OMUA 4U7NA 4XIPA 3R4NA 1I58A 3R4MA 2XDUA 1MX0A 1TILA 2ZKJA 1TC6A 2GFDA 4BAEA 4H85A 4CWPA 5C93A 2YE4A 2YK9A 4ZVIA 1BKNA 1TH8A 3LPSA 4CWRA 4AWPA 2IWUA 2Q8FA 1U2OA 1JM6A 5GGZA 1YT2A 1UYGA 2YE8A 4P7AA 1GJVA 2UWDA 3GIEA 2YJXA 2YEJA 2YE2A 2WI4A 4BQJA 1H7SA 4MOTA 4E01A 2YKBA 3EHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZKB A;  1UYE A;  4MBC A;  2YEF A;  3U2K A;  3U2D A;  4XKK A;  3GIG A;  5FWK A;  2C2A A;  1AM1 A;  1ZW9 A;  4NH9 A;  2Q2E B;  5J71 A;  4R3M A;  4FCQ A;  2AKP A;  3HYY A;  2BSM A;  2BZ5 A;  4CWN A;  4R3A A;  4HXW A;  3EKR A;  4MPC A;  3A0T A;  4O0B A;  5D6P A;  4V25 A;  4YKT A;  2WI7 A;  3HYZ A;  4WUB A;  3RKZ A;  2FWZ A;  2YE3 A;  3DGE A;  2XDK A;  2O1U A;  2YGE A;  3WQ9 A;  2BU2 A;  2QG2 A;  2Q8H A;  5IN9 A;  2YKJ A;  4XIT A;  3QDD A;  3H4L A;  4BXI A;  1AH6 A;  2YE6 A;  3Q5L A;  3EHJ A;  2CH4 A;  1UY8 A;  2WER A;  3TZ0 A;  3CGY A;  2XCM A;  3B26 A;  4HYM A;  1YC3 A;  2YJW A;  3KE6 A;  3TZ2 A;  3ZXO A;  4AS9 A;  1Y8N A;  1YER A;  3GIF A;  2JKI A;  2YEC A;  4HY6 A;  4I5S A;  2XHT A;  4V26 A;  2XX4 A;  1NHI A;  4EMV A;  2BYH A;  2QG0 A;  5J6A A;  1BGQ A;  4EFU A;  4H81 A;  3B27 A;  2VCI A;  4MP7 A;  4NH8 A;  4EGK A;  2BTZ A;  1YC1 A;  4LP0 A;  4URN A;  3B24 A;  2IWS A;  1UYH A;  2YEI A;  3RLP A;  3INW A;  3IED A;  1YT0 A;  3T2S A;  4YKY A;  2GQP A;  4DZY A;  1UYD A;  1YS3 A;  3GIG B;  2CCU A;  1OSF A;  1ZXM A;  2XJX A;  4LPB A;  4O09 A;  2BU6 A;  5D7D A;  5D7C A;  1NHH A;  4XTJ A;  4GQT A;  1UYL A;  2XHR A;  2O1W A;  2CCT A;  3K99 A;  3ZKD A;  4K4O A;  4XD8 A;  5D6Q A;  1QY8 A;  1UYK A;  3R92 A;  3A0Z A;  2HKJ A;  4KTN A;  4GT8 A;  5CTX A;  1US7 A;  3OWB A;  3O2F A;  3VHA A;  1YT1 A;  1B62 A;  1TID A;  3TTZ A;  4P8O A;  2BT0 A;  2E0A A;  2XJG A;  3A0Y A;  2VWC A;  1EA6 A;  1S16 A;  4JAU A;  3PEH A;  4LWH A;  4CE1 A;  3G7E A;  2BU5 A;  4B6C A;  2YEG A;  1S14 A;  2ZBK B;  4MPN A;  5M4M A;  3ZM7 A;  2YI6 A;  5CTU A;  2YEA A;  3EHH A;  4PRV A;  4ASA A;  3A0W A;  1Z5C A;  4HY1 A;  1Z59 A;  2WEP A;  4CE2 A;  3Q5J A;  4L91 A;  4E02 A;  1Y8O A;  5D7R A;  3LNU A;  5FND A;  4HYP A;  1BYQ A;  1AJ6 A;  3QTF A;  4JAV A;  2CG9 A;  1YSR A;  1TBW A;  4B7P A;  1Y4S A;  4GFN A;  4L8Z A;  4XCJ A;  4FPP A;  3NMQ A;  4XIR A;  3K97 A;  2ESA A;  5CF0 A;  5M4E A;  3B25 A;  4NH7 A;  3C11 A;  1QYE A;  4FCP A;  2WI6 A;  3VHC A;  2QFO A;  1EI1 A;  5FNF A;  5M4K A;  1GKX A;  4CWF A;  4LWF A;  2YKI A;  2YEB A;  4XCL A;  1PVG A;  3G7B A;  4BIU A;  2WI3 A;  3HEK A;  4E00 A;  4PRX A;  3JZ3 A;  4WUC A;  1B3Q A;  4YKQ A;  4BIZ A;  3TZ4 A;  1TC0 A;  2IWX A;  2YEE A;  4MPE A;  1AH8 A;  4YKW A;  4YKX A;  1NHJ A;  5M4H A;  3RLR A;  2VW5 A;  4KSG A;  2YE9 A;  1UY7 A;  1I5B A;  1L0O A;  2BU7 A;  3T10 A;  4MP2 A;  1AMW A;  4HXZ A;  2IOP A;  4CWO A;  2FYP A;  3Q5K A;  3T0H A;  3O6O A;  2YEH A;  4U7O A;  4FMT A;  3FT8 A;  4XC0 A;  5FNC A;  2XD6 A;  3D36 A;  5IDM A;  5CPH A;  4EM7 A;  4CWS A;  3OPD A;  3RLQ A;  2Q8I A;  3A0R A;  5F5R A;  3A0X A;  2XX2 A;  4KQV A;  3PEJ A;  2YED A;  3D0B A;  4L90 A;  4LWI A;  4URL A;  1UYC A;  3G75 A;  1YC4 A;  2XDX A;  2ZDY A;  4X9L A;  4URM A;  2BU8 A;  4CE3 A;  2Q8G A;  3WHA A;  4EGI A;  4I3H A;  1YET A;  3O0I A;  2PNR A;  2XX5 A;  4XE2 A;  3CGZ A;  3OWD A;  2YK2 A;  1Z5A A;  4O07 A;  4GCZ A;  2K5B A;  4EFT A;  2HG1 A;  3T1K A;  4KP4 A;  4FCR A;  2BYI A;  1Y8P A;  4AWO A;  2YE5 A;  4EEH A;  1GKZ A;  4EGH A;  1U0Z A;  1ZXN A;  3FV5 A;  4O04 A;  5BOD A;  4YKZ A;  3SL2 A;  4YKR A;  4ASF A;  3T0Z A;  2XDS A;  1UY9 A;  1H7U A;  5L3J A;  5M4N A;  5F3K A;  3CRL A;  4JQL A;  3ZXQ A;  3MNR P;  4XKA A;  4AWQ A;  3BM9 A;  3TZ5 A;  1BXD A;  4ASB A;  1THN A;  1UYM A;  2EXL A;  4XDM A;  2H8M A;  1KIJ A;  4HZ0 A;  4H7Q A;  2O1V A;  3K98 A;  3FT5 A;  2VCJ A;  3U67 A;  2XHX A;  2YKE A;  2H55 A;  5IDJ A;  1MU5 A;  4KFG A;  4BQG A;  2BRE A;  4QPK A;  2YI0 A;  4PU9 A;  1UYF A;  4MB9 A;  2YKC A;  2YGA A;  1YES A;  4KSH A;  1I5A A;  1I5D A;  3HZ1 A;  4LWE A;  1UY6 A;  4JAS A;  4HZ5 A;  3R91 A;  5M4P A;  2FWY A;  3VAD A;  4GGL A;  4PL9 A;  2YE7 A;  1KZN A;  4XIQ A;  2XJJ A;  1ID0 A;  2BRC A;  4XKO A;  4ZKI A;  1Z5B A;  2WI2 A;  4Q20 A;  2IOQ A;  4ASG A;  4WUD A;  2FXS A;  4U93 A;  1I5C A;  3INX A;  3K60 A;  4L94 A;  4LWG A;  4CWT A;  1QZR A;  2CGF A;  4GEE A;  2HCH A;  5CTY A;  2XDL A;  3R4P A;  3D2R A;  2WI1 A;  2YGF A;  2WI5 A;  4QPJ A;  3EKO A;  3CWV A;  3BMY A;  1B63 A;  3TUH A;  2JJC A;  5CTW A;  1YSZ A;  5BOC A;  4YKU A;  3VHD A;  1A4H A;  2CCS A;  3OW6 A;  4DUH A;  3HZ5 A;  2XK2 A;  1UYI A;  4L93 A;  3C0E A;  3R4O A;  2YI7 A;  1ZWH A;  2ZDX A;  4W7T A;  2WEQ A;  2YI5 A;  2IOR A;  4R1F A;  3EHG A;  3H80 A;  1I59 A;  3CRK A;  4URO A;  2QF6 A;  2XAB A;  3HHU A;  3B28 A;  4CWQ A;  4O05 A;  1Y4U A;  1R62 A;  3OMU A;  4U7N A;  4XIP A;  3R4N A;  1I58 A;  3R4M A;  2XDU A;  1MX0 A;  1TIL A;  2ZKJ A;  1TC6 A;  2GFD A;  4BAE A;  4H85 A;  4CWP A;  5C93 A;  2YE4 A;  2YK9 A;  4ZVI A;  1BKN A;  1TH8 A;  3LPS A;  4CWR A;  4AWP A;  2IWU A;  2Q8F A;  1U2O A;  1JM6 A;  5GGZ A;  1YT2 A;  1UYG A;  2YE8 A;  4P7A A;  1GJV A;  2UWD A;  3GIE A;  2YJX A;  2YEJ A;  2YE2 A;  2WI4 A;  4BQJ A;  1H7S A;  4MOT A;  4E01 A;  2YKB A;  3EHF A; 
#chains in the Genus database with same CATH topology
 3ZKB A;  1UYE A;  4MBC A;  2YEF A;  3U2K A;  3U2D A;  4XKK A;  3GIG A;  5FWK A;  2C2A A;  1AM1 A;  1ZW9 A;  4NH9 A;  2Q2E B;  5J71 A;  4R3M A;  4FCQ A;  2AKP A;  3HYY A;  2BSM A;  2BZ5 A;  4CWN A;  4R3A A;  4HXW A;  3EKR A;  4MPC A;  3A0T A;  4O0B A;  5D6P A;  4V25 A;  4YKT A;  2WI7 A;  3HYZ A;  4WUB A;  3RKZ A;  2FWZ A;  2FTK A;  2YE3 A;  3DGE A;  2XDK A;  2O1U A;  2YGE A;  3WQ9 A;  2BU2 A;  2QG2 A;  2Q8H A;  5IN9 A;  2YKJ A;  4XIT A;  3QDD A;  3H4L A;  4BXI A;  1AH6 A;  2YE6 A;  3Q5L A;  3EHJ A;  2CH4 A;  1UY8 A;  2WER A;  3TZ0 A;  3CGY A;  2XCM A;  3B26 A;  4HYM A;  1YC3 A;  2YJW A;  3KE6 A;  3TZ2 A;  5JEN A;  3ZXO A;  4AS9 A;  1Y8N A;  1YER A;  3GIF A;  2JKI A;  2YEC A;  4HY6 A;  4I5S A;  2XHT A;  4V26 A;  2XX4 A;  1IXM A;  1NHI A;  4EMV A;  2BYH A;  2QG0 A;  5J6A A;  1BGQ A;  4EFU A;  4H81 A;  3B27 A;  2VCI A;  4MP7 A;  4NH8 A;  4EGK A;  2BTZ A;  1YC1 A;  4LP0 A;  4URN A;  3B24 A;  2IWS A;  1UYH A;  2YEI A;  3CYG A;  3RLP A;  3INW A;  3IED A;  1YT0 A;  3T2S A;  4YKY A;  2GQP A;  4DZY A;  1UYD A;  1YS3 A;  3GIG B;  2CCU A;  1OSF A;  1ZXM A;  2XJX A;  4LPB A;  4O09 A;  2BU6 A;  5D7D A;  5D7C A;  1NHH A;  4XTJ A;  4GQT A;  1UYL A;  2XHR A;  2O1W A;  2CCT A;  3K99 A;  3ZKD A;  4K4O A;  4XD8 A;  5D6Q A;  1QY8 A;  1UYK A;  3R92 A;  3A0Z A;  2HKJ A;  4KTN A;  4GT8 A;  5CTX A;  1US7 A;  3OWB A;  3O2F A;  3VHA A;  1YT1 A;  1B62 A;  1TID A;  3TTZ A;  4P8O A;  2BT0 A;  2E0A A;  2XJG A;  3A0Y A;  2VWC A;  1EA6 A;  1S16 A;  4JAU A;  3PEH A;  4LWH A;  4CE1 A;  3G7E A;  2BU5 A;  4B6C A;  2YEG A;  1S14 A;  2ZBK B;  4MPN A;  5M4M A;  3ZM7 A;  2YI6 A;  5CTU A;  2YEA A;  3EHH A;  4PRV A;  4ASA A;  3A0W A;  1Z5C A;  4HY1 A;  1Z59 A;  2WEP A;  4CE2 A;  3Q5J A;  4L91 A;  4E02 A;  1Y8O A;  5D7R A;  3LNU A;  5FND A;  4HYP A;  1BYQ A;  1AJ6 A;  3QTF A;  4JAV A;  2CG9 A;  1YSR A;  1TBW A;  4B7P A;  1Y4S A;  4GFN A;  4L8Z A;  4XCJ A;  4FPP A;  3NMQ A;  4XIR A;  3K97 A;  2ESA A;  5CF0 A;  5M4E A;  3B25 A;  4NH7 A;  3C11 A;  1QYE A;  4FCP A;  2C1I A;  2WI6 A;  3VHC A;  2QFO A;  1EI1 A;  5FNF A;  5M4K A;  1GKX A;  4CWF A;  4LWF A;  2YKI A;  2YEB A;  4XCL A;  1PVG A;  3G7B A;  4BIU A;  2WI3 A;  3HEK A;  4E00 A;  4PRX A;  3JZ3 A;  4WUC A;  1B3Q A;  4YKQ A;  4BIZ A;  3TZ4 A;  1TC0 A;  2IWX A;  2YEE A;  4MPE A;  1AH8 A;  4YKW A;  4YKX A;  1NHJ A;  5M4H A;  3RLR A;  2VW5 A;  4KSG A;  2YE9 A;  1UY7 A;  1I5B A;  1L0O A;  2BU7 A;  3T10 A;  4MP2 A;  1AMW A;  4HXZ A;  2IOP A;  4CWO A;  2FYP A;  2C1G A;  3Q5K A;  3T0H A;  3O6O A;  2YEH A;  4U7O A;  3FT8 A;  4FMT A;  4XC0 A;  5FNC A;  2XD6 A;  3D36 A;  5IDM A;  5CPH A;  4EM7 A;  4CWS A;  3OPD A;  3RLQ A;  2Q8I A;  3A0R A;  5F5R A;  3A0X A;  2XX2 A;  4KQV A;  3PEJ A;  2YED A;  3D0B A;  4L90 A;  4LWI A;  4URL A;  1UYC A;  3G75 A;  1YC4 A;  2XDX A;  2ZDY A;  4X9L A;  4URM A;  2BU8 A;  4CE3 A;  2Q8G A;  3LMM A;  3WHA A;  4EGI A;  4I3H A;  1YET A;  3O0I A;  2PNR A;  2XX5 A;  4XE2 A;  3CGZ A;  3OWD A;  2YK2 A;  1Z5A A;  4O07 A;  4GCZ A;  2K5B A;  4EFT A;  2HG1 A;  3T1K A;  4KP4 A;  4FCR A;  2BYI A;  1Y8P A;  4AWO A;  2YE5 A;  4EEH A;  1GKZ A;  4EGH A;  1U0Z A;  1ZXN A;  3FV5 A;  4O04 A;  5BOD A;  4YKZ A;  3SL2 A;  4YKR A;  4ASF A;  3T0Z A;  2XDS A;  1UY9 A;  1H7U A;  5L3J A;  5M4N A;  5F3K A;  3CRL A;  4JQL A;  3ZXQ A;  3MNR P;  4XKA A;  4AWQ A;  3BM9 A;  3TZ5 A;  1BXD A;  4ASB A;  1THN A;  1UYM A;  2EXL A;  4XDM A;  2H8M A;  1KIJ A;  4HZ0 A;  4H7Q A;  2O1V A;  3K98 A;  3FT5 A;  2VCJ A;  3U67 A;  2XHX A;  2YKE A;  2H55 A;  5IDJ A;  1MU5 A;  4KFG A;  4BQG A;  2BRE A;  4QPK A;  2YI0 A;  4PU9 A;  1UYF A;  4MB9 A;  2YKC A;  2HHI A;  2YGA A;  1YES A;  4KSH A;  1I5A A;  1I5D A;  3HZ1 A;  4E72 A;  4LWE A;  1UY6 A;  4JAS A;  4HZ5 A;  3R91 A;  5M4P A;  2FWY A;  3VAD A;  4GGL A;  4PL9 A;  2YE7 A;  1KZN A;  4XIQ A;  2XJJ A;  1ID0 A;  2BRC A;  4XKO A;  4ZKI A;  1Z5B A;  2WI2 A;  4Q20 A;  2IOQ A;  4ASG A;  4WUD A;  2FXS A;  4U93 A;  1I5C A;  3INX A;  3K60 A;  4L94 A;  4LWG A;  4CWT A;  1QZR A;  2CGF A;  4GEE A;  2HCH A;  5CTY A;  2XDL A;  3R4P A;  3D2R A;  2WI1 A;  2YGF A;  2WI5 A;  4QPJ A;  3EKO A;  3CWV A;  3BMY A;  1B63 A;  3TUH A;  2JJC A;  5CTW A;  1YSZ A;  5BOC A;  4YKU A;  3VHD A;  1A4H A;  2CCS A;  3OW6 A;  4DUH A;  3HZ5 A;  2XK2 A;  1UYI A;  4L93 A;  3C0E A;  3R4O A;  2YI7 A;  1ZWH A;  2ZDX A;  4W7T A;  2WEQ A;  2YI5 A;  2IOR A;  4R1F A;  3EHG A;  3H80 A;  1I59 A;  3CRK A;  4URO A;  1F51 A;  2QF6 A;  2XAB A;  3HHU A;  3B28 A;  4CWQ A;  4O05 A;  1Y4U A;  1R62 A;  3OMU A;  4U7N A;  4XIP A;  3R4N A;  1I58 A;  3R4M A;  2XDU A;  1MX0 A;  1TIL A;  2ZKJ A;  1TC6 A;  2GFD A;  4BAE A;  4H85 A;  4CWP A;  3S5T A;  5C93 A;  2YE4 A;  2YK9 A;  4ZVI A;  1BKN A;  1TH8 A;  3LPS A;  4CWR A;  4AWP A;  2IWU A;  2Q8F A;  1U2O A;  1JM6 A;  5GGZ A;  1YT2 A;  1UYG A;  2YE8 A;  4P7A A;  1GJV A;  2UWD A;  3GIE A;  2YJX A;  2YEJ A;  2YE2 A;  2WI4 A;  4BQJ A;  1H7S A;  4MOT A;  4E01 A;  2YKB A;  3EHF A; 
#chains in the Genus database with same CATH homology
 3ZKB A;  1UYE A;  4MBC A;  2YEF A;  3U2K A;  3U2D A;  4XKK A;  3GIG A;  5FWK A;  2C2A A;  1AM1 A;  1ZW9 A;  4NH9 A;  2Q2E B;  5J71 A;  4R3M A;  4FCQ A;  2AKP A;  3HYY A;  2BSM A;  2BZ5 A;  4CWN A;  4R3A A;  4HXW A;  3EKR A;  4MPC A;  3A0T A;  4O0B A;  5D6P A;  4V25 A;  4YKT A;  2WI7 A;  3HYZ A;  4WUB A;  3RKZ A;  2FWZ A;  2YE3 A;  3DGE A;  2XDK A;  2O1U A;  2YGE A;  3WQ9 A;  2BU2 A;  2QG2 A;  2Q8H A;  5IN9 A;  2YKJ A;  4XIT A;  3QDD A;  3H4L A;  4BXI A;  1AH6 A;  2YE6 A;  3Q5L A;  3EHJ A;  2CH4 A;  1UY8 A;  2WER A;  3TZ0 A;  3CGY A;  2XCM A;  3B26 A;  4HYM A;  1YC3 A;  2YJW A;  3KE6 A;  3TZ2 A;  3ZXO A;  4AS9 A;  1Y8N A;  1YER A;  3GIF A;  2JKI A;  2YEC A;  4HY6 A;  4I5S A;  2XHT A;  4V26 A;  2XX4 A;  1NHI A;  4EMV A;  2BYH A;  2QG0 A;  5J6A A;  1BGQ A;  4EFU A;  4H81 A;  3B27 A;  2VCI A;  4MP7 A;  4NH8 A;  4EGK A;  2BTZ A;  1YC1 A;  4LP0 A;  4URN A;  3B24 A;  2IWS A;  1UYH A;  2YEI A;  3RLP A;  3INW A;  3IED A;  1YT0 A;  3T2S A;  4YKY A;  2GQP A;  4DZY A;  1UYD A;  1YS3 A;  3GIG B;  2CCU A;  1OSF A;  1ZXM A;  2XJX A;  4LPB A;  4O09 A;  2BU6 A;  5D7D A;  5D7C A;  1NHH A;  4XTJ A;  4GQT A;  1UYL A;  2XHR A;  2O1W A;  2CCT A;  3K99 A;  3ZKD A;  4K4O A;  4XD8 A;  5D6Q A;  1QY8 A;  1UYK A;  3R92 A;  3A0Z A;  2HKJ A;  4KTN A;  4GT8 A;  5CTX A;  1US7 A;  3OWB A;  3O2F A;  3VHA A;  1YT1 A;  1B62 A;  1TID A;  3TTZ A;  4P8O A;  2BT0 A;  2E0A A;  2XJG A;  3A0Y A;  2VWC A;  1EA6 A;  1S16 A;  4JAU A;  3PEH A;  4LWH A;  4CE1 A;  3G7E A;  2BU5 A;  4B6C A;  2YEG A;  1S14 A;  2ZBK B;  4MPN A;  5M4M A;  3ZM7 A;  2YI6 A;  5CTU A;  2YEA A;  3EHH A;  4PRV A;  4ASA A;  3A0W A;  1Z5C A;  4HY1 A;  1Z59 A;  2WEP A;  4CE2 A;  3Q5J A;  4L91 A;  4E02 A;  1Y8O A;  5D7R A;  3LNU A;  5FND A;  4HYP A;  1BYQ A;  1AJ6 A;  3QTF A;  4JAV A;  2CG9 A;  1YSR A;  1TBW A;  4B7P A;  1Y4S A;  4GFN A;  4L8Z A;  4XCJ A;  4FPP A;  3NMQ A;  4XIR A;  3K97 A;  2ESA A;  5CF0 A;  5M4E A;  3B25 A;  4NH7 A;  3C11 A;  1QYE A;  4FCP A;  2WI6 A;  3VHC A;  2QFO A;  1EI1 A;  5FNF A;  5M4K A;  1GKX A;  4CWF A;  4LWF A;  2YKI A;  2YEB A;  4XCL A;  1PVG A;  3G7B A;  4BIU A;  2WI3 A;  3HEK A;  4E00 A;  4PRX A;  3JZ3 A;  4WUC A;  1B3Q A;  4YKQ A;  4BIZ A;  3TZ4 A;  1TC0 A;  2IWX A;  2YEE A;  4MPE A;  1AH8 A;  4YKW A;  4YKX A;  1NHJ A;  5M4H A;  3RLR A;  2VW5 A;  4KSG A;  2YE9 A;  1UY7 A;  1I5B A;  1L0O A;  2BU7 A;  3T10 A;  4MP2 A;  1AMW A;  4HXZ A;  2IOP A;  4CWO A;  2FYP A;  3Q5K A;  3T0H A;  3O6O A;  2YEH A;  4U7O A;  4FMT A;  3FT8 A;  4XC0 A;  5FNC A;  2XD6 A;  3D36 A;  5IDM A;  5CPH A;  4EM7 A;  4CWS A;  3OPD A;  3RLQ A;  2Q8I A;  3A0R A;  5F5R A;  3A0X A;  2XX2 A;  4KQV A;  3PEJ A;  2YED A;  3D0B A;  4L90 A;  4LWI A;  4URL A;  1UYC A;  3G75 A;  1YC4 A;  2XDX A;  2ZDY A;  4X9L A;  4URM A;  2BU8 A;  4CE3 A;  2Q8G A;  3WHA A;  4EGI A;  4I3H A;  1YET A;  3O0I A;  2PNR A;  2XX5 A;  4XE2 A;  3CGZ A;  3OWD A;  2YK2 A;  1Z5A A;  4O07 A;  4GCZ A;  2K5B A;  4EFT A;  2HG1 A;  3T1K A;  4KP4 A;  4FCR A;  2BYI A;  1Y8P A;  4AWO A;  2YE5 A;  4EEH A;  1GKZ A;  4EGH A;  1U0Z A;  1ZXN A;  3FV5 A;  4O04 A;  5BOD A;  4YKZ A;  3SL2 A;  4YKR A;  4ASF A;  3T0Z A;  2XDS A;  1UY9 A;  1H7U A;  5L3J A;  5M4N A;  5F3K A;  3CRL A;  4JQL A;  3ZXQ A;  3MNR P;  4XKA A;  4AWQ A;  3BM9 A;  3TZ5 A;  1BXD A;  4ASB A;  1THN A;  1UYM A;  2EXL A;  4XDM A;  2H8M A;  1KIJ A;  4HZ0 A;  4H7Q A;  2O1V A;  3K98 A;  3FT5 A;  2VCJ A;  3U67 A;  2XHX A;  2YKE A;  2H55 A;  5IDJ A;  1MU5 A;  4KFG A;  4BQG A;  2BRE A;  4QPK A;  2YI0 A;  4PU9 A;  1UYF A;  4MB9 A;  2YKC A;  2YGA A;  1YES A;  4KSH A;  1I5A A;  1I5D A;  3HZ1 A;  4LWE A;  1UY6 A;  4JAS A;  4HZ5 A;  3R91 A;  5M4P A;  2FWY A;  3VAD A;  4GGL A;  4PL9 A;  2YE7 A;  1KZN A;  4XIQ A;  2XJJ A;  1ID0 A;  2BRC A;  4XKO A;  4ZKI A;  1Z5B A;  2WI2 A;  4Q20 A;  2IOQ A;  4ASG A;  4WUD A;  2FXS A;  4U93 A;  1I5C A;  3INX A;  3K60 A;  4L94 A;  4LWG A;  4CWT A;  1QZR A;  2CGF A;  4GEE A;  2HCH A;  5CTY A;  2XDL A;  3R4P A;  3D2R A;  2WI1 A;  2YGF A;  2WI5 A;  4QPJ A;  3EKO A;  3CWV A;  3BMY A;  1B63 A;  3TUH A;  2JJC A;  5CTW A;  1YSZ A;  5BOC A;  4YKU A;  3VHD A;  1A4H A;  2CCS A;  3OW6 A;  4DUH A;  3HZ5 A;  2XK2 A;  1UYI A;  4L93 A;  3C0E A;  3R4O A;  2YI7 A;  1ZWH A;  2ZDX A;  4W7T A;  2WEQ A;  2YI5 A;  2IOR A;  4R1F A;  3EHG A;  3H80 A;  1I59 A;  3CRK A;  4URO A;  2QF6 A;  2XAB A;  3HHU A;  3B28 A;  4CWQ A;  4O05 A;  1Y4U A;  1R62 A;  3OMU A;  4U7N A;  4XIP A;  3R4N A;  1I58 A;  3R4M A;  2XDU A;  1MX0 A;  1TIL A;  2ZKJ A;  1TC6 A;  2GFD A;  4BAE A;  4H85 A;  4CWP A;  5C93 A;  2YE4 A;  2YK9 A;  4ZVI A;  1BKN A;  1TH8 A;  3LPS A;  4CWR A;  4AWP A;  2IWU A;  2Q8F A;  1U2O A;  1JM6 A;  5GGZ A;  1YT2 A;  1UYG A;  2YE8 A;  4P7A A;  1GJV A;  2UWD A;  3GIE A;  2YJX A;  2YEJ A;  2YE2 A;  2WI4 A;  4BQJ A;  1H7S A;  4MOT A;  4E01 A;  2YKB A;  3EHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...