3EHXA

Crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor (r)-2-(biphenyl-4-ylsulfonamido)-4-methylpentanoic acid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Biotin-tagged probes for MMP expression and activation: design, synthesis, and binding properties
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 45
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2008-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3ehxA00
2MLSA 3RTTA 1DMTA 3L0VA 4IN9A 2QPJA 4L6TA 1JIZA 2OW1A 3LUNA 3DSLA 2FV5A 1YCMA 2CKIA 4GR8A 1BSWA 3EDGA 5D1UA 3DL1A 2SRTA 2Z2DA 3HDAP 1CQRA 1R1JA 3LKAA 5D7WA 1UMSA 1GO8P 2OXZA 3EDIA 4L19A 4DV8A 4I35A 2O36A 1QIAA 1WNIA 4H1QA 5JMYA 1XFXA 4PKUA 3HY7A 966CA 1O0QA 3N2VA 3HDBA 4H84A 3EDZA 1C7KA 1JAQA 1EUBA 2L0RA 3LGPA 1UTTA 4G9LA 3MA2A 2E2DA 2TCLA 3HBUP 4JPAA 2RJPA 2YB9A 1MMPA 1CIZA 4EFSA 3LEAA 3Q2HA 1FLSA 1Y0VA 2ERPA 4IUWA 2J83A 5LABA 2OW0A 1B8YA 1ATLA 2D1NA 3KRYA 1MMRA 1GO7P 2OW9A 3WV2A 4QKZA 4PKQA 2X3AA 2USNA 4WKIA 4H2EA 4G0DA 1SRPA 3VTGA 4GUYA 1GE5A 1S4BP 1G05A 2MZIA 2FV9A 3O2XA 1C8TA 3B2ZA 2J0TA 1FBLA 2Y6DA 2OXWA 4L63A 5BOYA 1XFZA 3KECA 1ZS0A 1JAOA 3KWVC 1EAKA 2N8RA 3F17A 2JT5A 4XBHA 3B92A 1YOUA 4DF9A 1OM7A 1H71P 1OMJA 1GXDA 4PKTA 1BM6A 3BA0A 1B3DA 2KRJA 2W15A 1GE7A 4JA1A 3WV1A 4PKSA 1GE6A 4H49A 1BUVM 1BKCE 2WO9A 4H30A 2OI0A 3O64A 3EDHA 1UEAA 5I2ZA 1QIBA 1YQYA 2DW1A 2W12A 1JH1A 2OY2A 1I1IP 2K2GA 3B8ZA 4WK7A 3ZVSA 1I76A 2AYKA 1BKCI 3AYUA 5L79A 2Y6CA 2POJA 3G42A 2OY4A 3HBVP 1XFYA 3U1RA 1MMBA 2K9CA 1JJ9A 4AUOA 3LMCA 1I73A 1HOVA 3N2UA 1SU3A 4XCTA 1XFWA 1USNA 2I47A 1CGEA 5I0LA 4PKRA 2XS4A 3LK8A 2MLRA 1DTHA 4GWNA 2HU6A 2E3XA 4XM7A 1AF0A 3EHXA 4AIGA 1CGLA 4FU4A 3F1AA 1ASTA 1OO9A 3DPFA 1R1HA 3VI1A 1R55A 1HV5A 3TVCA 2MZHA 4I03A 456CA 1Y8JA 1G12A 1HTDA 1SLNA 4AYKA 1QJJA 2MZEA 3ZXHA 5CUHA 1ZXCA 1HY7A 2DW2A 3Q2GA 4H3XA 1BQOA 1D8MA 1QICA 3KEJA 2RJQA 4H82A 1G4KA 2JNPA 2X3CA 1GKCA 3F15A 1IADA 1BQQM 1G49A 2PJTA 1XUCA 1KAPP 3AIGA 4WZVA 1KUKA 3K7NA 2JSDA 1CAQA 3HYGA 4XM6A 3LIKA 5D2BA 3L0TA 1ROSA 1C3IA 1OS2A 1RM8A 4HMAA 2WO8A 2A8HA 2JIHA 2D1OA 4JIJA 1R1IA 3LJGA 2OXUA 3KEKA 2V4BA 1JANA 4FXQA 4DD8A 2OVZA 3SHIA 1Q3AA 4GR3A 5D1TA 2CLTA 2OVXA 1KUGA 1XUDA 1HFSA 3LE9A 5D3CA 3E8RA 1BKCA 4Q1LA 3KHIA 2DDYA 1RMZA 1KUHA 4ILWD 4ZR5A 1JAPA 1KUIA 1CK7A 3DNGA 1XFUA 3DWBA 3LQBA 2OW2A 2W14A 1PWPA 1Z3JA 4HX3A 2W0DA 1Y93A 1KUFA 3HB2P 3LILA 3GBOA 1OM8A 1MMQA 1O0TA 4GR0A 1JK3A 4PKWA 2JT6A 4FXYP 3UVCA 3TS4A 1CGFA 4R3VA 3F16A 2AIGP 3LJZA 3TT4A 4PKVA 1JIWP 3F18A 3TSKA 2WOAA 1SMPA 1D8FA 1K7GA 5I4OA 4CTHA 1A86A 5B5OA 1GKDA 2DDFA 1L6JA 1SATA 1R54A 1KBCA 2DW0A 1A85A 1D7XA 3KMEA 830CA 3HY9A 1ZP5A 3P24A 5I3MA 4JP4A 3V96B 1IAGA 4J4MA 2ERQA 3LIRA 4GQLA 3AYKA 4JQGA 4GF1A 5BOTA 3LQ0A 1IACA 1IAAA 1K7QA 1XURA 3F19A 4WF6A 1ZVXA 3P1VA 1IABA 1OS9A 3I7GA 1HFCA 4A3WA 3K7LA 1PWVA 4FVLA 4WKEA 1J7NA 2XS3A 5I12A 1OM6A 1QJIA 5H8XA 3LJTA 3G5CA 1JKYA 1PWWA 1UMTA 2W13A 5B5PA 3ZUKA 2EROA 3NX7A 2O3EA 3EHYA 5I43A 2X3BA 1D5JA 3ELMA 1ZXVA 1BIWA 5CXAA 1PWUA 1YP1A 4IJOA 1XFVA 3DPEA 1CXVA 1IAEA 1ND1A 1ZTQA 3KMCA 3OHLA 5D1SA 1UTZA 1K7IA 4XM8A 3OHOA 1MNCA 4DPEA 2OZRA 1BUDA 1AKLA 1FM1A 4H76A 3I7IA 1AYKA 5CZMA 1EB6A 1BZSA 1QUAA 3WV3A 4ON1A 3RTSA 5BPAA 3USNA 3LUMA 1SLMA 1PWQA 4AXQA 4A7BA 2YIGA 1G9KA 3EWJA 3CKIA 4GWMA 5L7FA 2X7MA
chains in the Genus database with same CATH superfamily
2MLSA 3RTTA 1DMTA 3L0VA 4IN9A 2QPJA 4L6TA 1JIZA 2OW1A 3LUNA 3DSLA 2FV5A 1YCMA 2CKIA 4GR8A 1BSWA 3EDGA 5D1UA 3DL1A 2SRTA 2Z2DA 3HDAP 1CQRA 1R1JA 3LKAA 5D7WA 1UMSA 1GO8P 2OXZA 3EDIA 4L19A 4DV8A 4I35A 2O36A 1QIAA 1WNIA 4H1QA 5JMYA 1XFXA 4PKUA 3HY7A 966CA 1O0QA 3N2VA 3HDBA 4H84A 3EDZA 1C7KA 1JAQA 1EUBA 2L0RA 3LGPA 1UTTA 4G9LA 3MA2A 2E2DA 2TCLA 3HBUP 4JPAA 2RJPA 2YB9A 1MMPA 1CIZA 4EFSA 3LEAA 3Q2HA 1FLSA 1Y0VA 2ERPA 4IUWA 2J83A 5LABA 2OW0A 1B8YA 1ATLA 2D1NA 3KRYA 1MMRA 1GO7P 2OW9A 3WV2A 4QKZA 4PKQA 2X3AA 1OZ9A 2USNA 4WKIA 4H2EA 4G0DA 1SRPA 3VTGA 4GUYA 1GE5A 1S4BP 4L7AA 1G05A 2MZIA 2FV9A 3O2XA 1C8TA 3B2ZA 2J0TA 1FBLA 2Y6DA 2OXWA 4L63A 5BOYA 1XFZA 3KECA 1ZS0A 1JAOA 3KWVC 1EAKA 2N8RA 3F17A 2JT5A 4XBHA 3B92A 1YOUA 4DF9A 1OM7A 1H71P 1OMJA 1GXDA 4PKTA 1BM6A 3BA0A 1B3DA 2KRJA 2W15A 1GE7A 4JA1A 3WV1A 4PKSA 1GE6A 4H49A 1BUVM 1BKCE 2WO9A 4H30A 2OI0A 3O64A 3EDHA 1UEAA 5I2ZA 1QIBA 1YQYA 2DW1A 2W12A 1JH1A 2OY2A 1I1IP 2K2GA 3B8ZA 4WK7A 3ZVSA 1I76A 2AYKA 1BKCI 3AYUA 5L79A 2Y6CA 2POJA 3G42A 2OY4A 3HBVP 1TVIA 1XFYA 3U1RA 1MMBA 2K9CA 1JJ9A 4AUOA 3LMCA 1I73A 1HOVA 3N2UA 1SU3A 4XCTA 1XFWA 1USNA 2I47A 1CGEA 5I0LA 4PKRA 2XS4A 3LK8A 2MLRA 1DTHA 4GWNA 2HU6A 2E3XA 4XM7A 1AF0A 3EHXA 4AIGA 1CGLA 4FU4A 3F1AA 1ASTA 1OO9A 3DPFA 1R1HA 3VI1A 1R55A 1HV5A 3TVCA 2MZHA 4I03A 456CA 1Y8JA 1G12A 1HTDA 1SLNA 4AYKA 1QJJA 2MZEA 3ZXHA 5CUHA 1ZXCA 1HY7A 2DW2A 3Q2GA 4H3XA 1BQOA 1D8MA 1QICA 3KEJA 2RJQA 4H82A 1G4KA 2JNPA 2X3CA 1GKCA 3F15A 1IADA 1BQQM 1G49A 2PJTA 1XUCA 1KAPP 3AIGA 4WZVA 1KUKA 3K7NA 2JSDA 1CAQA 3HYGA 4XM6A 3LIKA 5D2BA 3L0TA 1ROSA 1C3IA 1OS2A 1RM8A 4HMAA 2WO8A 2A8HA 2JIHA 2D1OA 4JIJA 1R1IA 3LJGA 2OXUA 3KEKA 2V4BA 1JANA 4FXQA 4DD8A 1XAXA 2OVZA 3SHIA 1Q3AA 4GR3A 5D1TA 2CLTA 2OVXA 1KUGA 1XUDA 1HFSA 3LE9A 5D3CA 3E8RA 1BKCA 4Q1LA 3DTIA 3KHIA 2DDYA 1RMZA 1KUHA 4ILWD 4ZR5A 1JAPA 1KUIA 1CK7A 3DNGA 1XFUA 3DWBA 3LQBA 2OW2A 2W14A 1PWPA 1Z3JA 4HX3A 2W0DA 1Y93A 1KUFA 3HB2P 3LILA 3GBOA 1OM8A 1MMQA 1O0TA 4GR0A 1JK3A 4PKWA 2JT6A 4FXYP 3UVCA 3TS4A 1CGFA 4R3VA 3F16A 2AIGP 3LJZA 3TT4A 4PKVA 1JIWP 3F18A 3TSKA 2WOAA 1SMPA 3DTKA 1D8FA 1K7GA 5I4OA 4CTHA 1A86A 5B5OA 1GKDA 2DDFA 1L6JA 1SATA 1R54A 1KBCA 2DW0A 1A85A 1D7XA 3KMEA 830CA 3HY9A 1ZP5A 3P24A 5I3MA 4JP4A 3V96B 1IAGA 4J4MA 2ERQA 3LIRA 4GQLA 3AYKA 4JQGA 4GF1A 5BOTA 3LQ0A 1IACA 1IAAA 1K7QA 1XURA 3F19A 4WF6A 1ZVXA 3P1VA 1IABA 1OS9A 3I7GA 1HFCA 4A3WA 3K7LA 1PWVA 4FVLA 4WKEA 1J7NA 2XS3A 5I12A 1OM6A 1QJIA 5H8XA 3LJTA 3G5CA 1JKYA 1PWWA 1UMTA 2W13A 5B5PA 3ZUKA 2EROA 3NX7A 2O3EA 3EHYA 5I43A 2X3BA 1D5JA 3ELMA 1ZXVA 1XM5A 1BIWA 5CXAA 1PWUA 1YP1A 4IJOA 1XFVA 3DPEA 1CXVA 1IAEA 1ND1A 1ZTQA 3KMCA 3OHLA 5D1SA 1UTZA 1K7IA 2YUFA 3DTEA 3OHOA 4XM8A 1MNCA 4DPEA 2OZRA 1BUDA 1AKLA 1FM1A 4H76A 3I7IA 1AYKA 5CZMA 1EB6A 1BZSA 1QUAA 3WV3A 4ON1A 3RTSA 5BPAA 3USNA 3LUMA 1SLMA 1PWQA 4AXQA 4A7BA 2YIGA 1G9KA 3EWJA 3CKIA 4GWMA 5L7FA 2X7MA
chains in the Genus database with same CATH topology
2MLSA 3RTTA 1DMTA 3L0VA 4IN9A 2QPJA 4L6TA 1JIZA 2OW1A 3LUNA 3DSLA 2FV5A 1YCMA 2CKIA 4GR8A 1BSWA 3EDGA 5D1UA 3DL1A 2SRTA 2Z2DA 3HDAP 1CQRA 1R1JA 3LKAA 5D7WA 1UMSA 1GO8P 2OXZA 3EDIA 4L19A 4DV8A 4I35A 2O36A 1QIAA 1WNIA 4H1QA 5JMYA 1XFXA 4PKUA 3HY7A 966CA 1O0QA 3N2VA 3HDBA 4H84A 3EDZA 1C7KA 1JAQA 1EUBA 2L0RA 3LGPA 1UTTA 4G9LA 3MA2A 2E2DA 2TCLA 3HBUP 4JPAA 2RJPA 2YB9A 1MMPA 1CIZA 4EFSA 3LEAA 3Q2HA 1FLSA 1Y0VA 2ERPA 4IUWA 2J83A 5LABA 2OW0A 1B8YA 1ATLA 2D1NA 3KRYA 1MMRA 1GO7P 2OW9A 3WV2A 4QKZA 4PKQA 2X3AA 2USNA 4WKIA 4H2EA 4G0DA 1SRPA 3VTGA 4GUYA 1GE5A 1S4BP 4L7AA 1G05A 2MZIA 2FV9A 3O2XA 1C8TA 3B2ZA 2J0TA 1FBLA 2Y6DA 2OXWA 4L63A 5BOYA 1XFZA 3KECA 1ZS0A 1JAOA 3KWVC 1EAKA 2N8RA 3F17A 2JT5A 4XBHA 3B92A 1YOUA 4DF9A 1OM7A 1H71P 1OMJA 1GXDA 4PKTA 1BM6A 3BA0A 1B3DA 2KRJA 2W15A 1GE7A 4JA1A 3WV1A 4PKSA 1GE6A 4H49A 1BUVM 1BKCE 2WO9A 4H30A 2OI0A 3O64A 3EDHA 1UEAA 5I2ZA 1QIBA 1YQYA 2DW1A 2W12A 1JH1A 2OY2A 1I1IP 2K2GA 3B8ZA 4WK7A 3ZVSA 1I76A 2AYKA 1BKCI 3AYUA 5L79A 2Y6CA 2POJA 3G42A 2OY4A 3HBVP 1XFYA 3U1RA 1MMBA 2K9CA 1JJ9A 4AUOA 3LMCA 1I73A 1HOVA 3N2UA 1SU3A 4XCTA 1XFWA 1USNA 2I47A 1CGEA 5I0LA 4PKRA 2XS4A 3LK8A 2MLRA 1DTHA 4GWNA 2HU6A 2E3XA 4XM7A 1AF0A 3EHXA 4AIGA 1CGLA 4FU4A 3F1AA 1ASTA 1OO9A 3DPFA 1R1HA 3VI1A 1R55A 1HV5A 3TVCA 2MZHA 4I03A 456CA 1Y8JA 1G12A 1HTDA 1SLNA 4AYKA 1QJJA 2MZEA 3ZXHA 5CUHA 1ZXCA 1HY7A 2DW2A 3Q2GA 4H3XA 1BQOA 1D8MA 1QICA 3KEJA 2RJQA 4H82A 1G4KA 2JNPA 2X3CA 1GKCA 3F15A 1IADA 1BQQM 1G49A 2PJTA 1XUCA 1KAPP 3AIGA 4WZVA 1KUKA 3K7NA 2JSDA 1CAQA 3HYGA 4XM6A 3LIKA 5D2BA 3L0TA 1ROSA 1C3IA 1OS2A 1RM8A 4HMAA 2WO8A 2A8HA 2JIHA 2D1OA 4JIJA 1R1IA 3LJGA 2OXUA 3KEKA 2V4BA 1JANA 4FXQA 4DD8A 2OVZA 3SHIA 1Q3AA 4GR3A 5D1TA 2CLTA 2OVXA 1KUGA 1XUDA 1HFSA 3LE9A 5D3CA 3E8RA 1BKCA 4Q1LA 3DTIA 3KHIA 2DDYA 1RMZA 1KUHA 4ILWD 4ZR5A 1JAPA 1KUIA 1CK7A 3DNGA 1XFUA 3DWBA 3LQBA 2OW2A 2W14A 1PWPA 1Z3JA 4HX3A 2W0DA 1Y93A 1KUFA 3HB2P 3LILA 3GBOA 1OM8A 1MMQA 1O0TA 4GR0A 1JK3A 4PKWA 2JT6A 4FXYP 3UVCA 3TS4A 1CGFA 4R3VA 3F16A 2AIGP 3LJZA 3TT4A 4PKVA 1JIWP 3F18A 3TSKA 2WOAA 1SMPA 3DTKA 1D8FA 1K7GA 5I4OA 4CTHA 1A86A 5B5OA 1GKDA 2DDFA 1L6JA 1SATA 1R54A 1KBCA 2DW0A 1A85A 1D7XA 3KMEA 830CA 3HY9A 1ZP5A 3P24A 5I3MA 4JP4A 3V96B 1IAGA 4J4MA 2ERQA 3LIRA 4GQLA 3AYKA 4JQGA 4GF1A 5BOTA 3LQ0A 1IACA 1IAAA 1K7QA 1XURA 3F19A 4WF6A 1ZVXA 3P1VA 1IABA 1OS9A 3I7GA 1HFCA 4A3WA 3K7LA 1PWVA 4FVLA 4WKEA 1J7NA 2XS3A 5I12A 1OM6A 1QJIA 5H8XA 3LJTA 3G5CA 1JKYA 1PWWA 1UMTA 2W13A 5B5PA 3ZUKA 2EROA 3NX7A 2O3EA 3EHYA 5I43A 2X3BA 1D5JA 3ELMA 1ZXVA 1BIWA 5CXAA 1PWUA 1YP1A 4IJOA 1XFVA 3DPEA 1CXVA 1IAEA 1ND1A 1ZTQA 3KMCA 3OHLA 5D1SA 1UTZA 1K7IA 2YUFA 3DTEA 3OHOA 4XM8A 1MNCA 4DPEA 2OZRA 1BUDA 1AKLA 1FM1A 4H76A 3I7IA 1AYKA 5CZMA 1EB6A 1BZSA 1QUAA 3WV3A 4ON1A 3RTSA 5BPAA 3USNA 3LUMA 1SLMA 1PWQA 4AXQA 4A7BA 2YIGA 1G9KA 3EWJA 3CKIA 4GWMA 5L7FA 2X7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLS A;  3RTT A;  1DMT A;  3L0V A;  4IN9 A;  2QPJ A;  4L6T A;  1JIZ A;  2OW1 A;  3LUN A;  3DSL A;  2FV5 A;  1YCM A;  2CKI A;  4GR8 A;  1BSW A;  3EDG A;  5D1U A;  3DL1 A;  2SRT A;  2Z2D A;  3HDA P;  1CQR A;  1R1J A;  3LKA A;  5D7W A;  1UMS A;  1GO8 P;  2OXZ A;  3EDI A;  4L19 A;  4DV8 A;  4I35 A;  2O36 A;  1QIA A;  1WNI A;  4H1Q A;  5JMY A;  1XFX A;  4PKU A;  3HY7 A;  966C A;  1O0Q A;  3N2V A;  3HDB A;  4H84 A;  3EDZ A;  1C7K A;  1JAQ A;  1EUB A;  2L0R A;  3LGP A;  1UTT A;  4G9L A;  3MA2 A;  2E2D A;  2TCL A;  3HBU P;  4JPA A;  2RJP A;  2YB9 A;  1MMP A;  1CIZ A;  4EFS A;  3LEA A;  3Q2H A;  1FLS A;  1Y0V A;  2ERP A;  4IUW A;  2J83 A;  5LAB A;  2OW0 A;  1B8Y A;  1ATL A;  2D1N A;  3KRY A;  1MMR A;  1GO7 P;  2OW9 A;  3WV2 A;  4QKZ A;  4PKQ A;  2X3A A;  2USN A;  4WKI A;  4H2E A;  4G0D A;  1SRP A;  3VTG A;  4GUY A;  1GE5 A;  1S4B P;  1G05 A;  2MZI A;  2FV9 A;  3O2X A;  1C8T A;  3B2Z A;  2J0T A;  1FBL A;  2Y6D A;  2OXW A;  4L63 A;  5BOY A;  1XFZ A;  3KEC A;  1ZS0 A;  1JAO A;  3KWV C;  1EAK A;  2N8R A;  3F17 A;  2JT5 A;  4XBH A;  3B92 A;  1YOU A;  4DF9 A;  1OM7 A;  1H71 P;  1OMJ A;  1GXD A;  4PKT A;  1BM6 A;  3BA0 A;  1B3D A;  2KRJ A;  2W15 A;  1GE7 A;  4JA1 A;  3WV1 A;  4PKS A;  1GE6 A;  4H49 A;  1BUV M;  1BKC E;  2WO9 A;  4H30 A;  2OI0 A;  3O64 A;  3EDH A;  1UEA A;  5I2Z A;  1QIB A;  1YQY A;  2DW1 A;  2W12 A;  1JH1 A;  2OY2 A;  1I1I P;  2K2G A;  3B8Z A;  4WK7 A;  3ZVS A;  1I76 A;  2AYK A;  1BKC I;  3AYU A;  5L79 A;  2Y6C A;  2POJ A;  3G42 A;  2OY4 A;  3HBV P;  1XFY A;  3U1R A;  1MMB A;  2K9C A;  1JJ9 A;  4AUO A;  3LMC A;  1I73 A;  1HOV A;  3N2U A;  1SU3 A;  4XCT A;  1XFW A;  1USN A;  2I47 A;  1CGE A;  5I0L A;  4PKR A;  2XS4 A;  3LK8 A;  2MLR A;  1DTH A;  4GWN A;  2HU6 A;  2E3X A;  4XM7 A;  1AF0 A;  3EHX A;  4AIG A;  1CGL A;  4FU4 A;  3F1A A;  1AST A;  1OO9 A;  3DPF A;  1R1H A;  3VI1 A;  1R55 A;  1HV5 A;  3TVC A;  2MZH A;  4I03 A;  456C A;  1Y8J A;  1G12 A;  1HTD A;  1SLN A;  4AYK A;  1QJJ A;  2MZE A;  3ZXH A;  5CUH A;  1ZXC A;  1HY7 A;  2DW2 A;  3Q2G A;  4H3X A;  1BQO A;  1D8M A;  1QIC A;  3KEJ A;  2RJQ A;  4H82 A;  1G4K A;  2JNP A;  2X3C A;  1GKC A;  3F15 A;  1IAD A;  1BQQ M;  1G49 A;  2PJT A;  1XUC A;  1KAP P;  3AIG A;  4WZV A;  1KUK A;  3K7N A;  2JSD A;  1CAQ A;  3HYG A;  4XM6 A;  3LIK A;  5D2B A;  3L0T A;  1ROS A;  1C3I A;  1OS2 A;  1RM8 A;  4HMA A;  2WO8 A;  2A8H A;  2JIH A;  2D1O A;  4JIJ A;  1R1I A;  3LJG A;  2OXU A;  3KEK A;  2V4B A;  1JAN A;  4FXQ A;  4DD8 A;  2OVZ A;  3SHI A;  1Q3A A;  4GR3 A;  5D1T A;  2CLT A;  2OVX A;  1KUG A;  1XUD A;  1HFS A;  3LE9 A;  5D3C A;  3E8R A;  1BKC A;  4Q1L A;  3KHI A;  2DDY A;  1RMZ A;  1KUH A;  4ILW D;  4ZR5 A;  1JAP A;  1KUI A;  1CK7 A;  3DNG A;  1XFU A;  3DWB A;  3LQB A;  2OW2 A;  2W14 A;  1PWP A;  1Z3J A;  4HX3 A;  2W0D A;  1Y93 A;  1KUF A;  3HB2 P;  3LIL A;  3GBO A;  1OM8 A;  1MMQ A;  1O0T A;  4GR0 A;  1JK3 A;  4PKW A;  2JT6 A;  4FXY P;  3UVC A;  3TS4 A;  1CGF A;  4R3V A;  3F16 A;  2AIG P;  3LJZ A;  3TT4 A;  4PKV A;  1JIW P;  3F18 A;  3TSK A;  2WOA A;  1SMP A;  1D8F A;  1K7G A;  5I4O A;  4CTH A;  1A86 A;  5B5O A;  1GKD A;  2DDF A;  1L6J A;  1SAT A;  1R54 A;  1KBC A;  2DW0 A;  1A85 A;  1D7X A;  3KME A;  830C A;  3HY9 A;  1ZP5 A;  3P24 A;  5I3M A;  4JP4 A;  3V96 B;  1IAG A;  4J4M A;  2ERQ A;  3LIR A;  4GQL A;  3AYK A;  4JQG A;  4GF1 A;  5BOT A;  3LQ0 A;  1IAC A;  1IAA A;  1K7Q A;  1XUR A;  3F19 A;  4WF6 A;  1ZVX A;  3P1V A;  1IAB A;  1OS9 A;  3I7G A;  1HFC A;  4A3W A;  3K7L A;  1PWV A;  4FVL A;  4WKE A;  1J7N A;  2XS3 A;  5I12 A;  1OM6 A;  1QJI A;  5H8X A;  3LJT A;  3G5C A;  1JKY A;  1PWW A;  1UMT A;  2W13 A;  5B5P A;  3ZUK A;  2ERO A;  3NX7 A;  2O3E A;  3EHY A;  5I43 A;  2X3B A;  1D5J A;  3ELM A;  1ZXV A;  1BIW A;  5CXA A;  1PWU A;  1YP1 A;  4IJO A;  1XFV A;  3DPE A;  1CXV A;  1IAE A;  1ND1 A;  1ZTQ A;  3KMC A;  3OHL A;  5D1S A;  1UTZ A;  1K7I A;  4XM8 A;  3OHO A;  1MNC A;  4DPE A;  2OZR A;  1BUD A;  1AKL A;  1FM1 A;  4H76 A;  3I7I A;  1AYK A;  5CZM A;  1EB6 A;  1BZS A;  1QUA A;  3WV3 A;  4ON1 A;  3RTS A;  5BPA A;  3USN A;  3LUM A;  1SLM A;  1PWQ A;  4AXQ A;  4A7B A;  2YIG A;  1G9K A;  3EWJ A;  3CKI A;  4GWM A;  5L7F A;  2X7M A; 
#chains in the Genus database with same CATH topology
 2MLS A;  3RTT A;  1DMT A;  3L0V A;  4IN9 A;  2QPJ A;  4L6T A;  1JIZ A;  2OW1 A;  3LUN A;  3DSL A;  2FV5 A;  1YCM A;  2CKI A;  4GR8 A;  1BSW A;  3EDG A;  5D1U A;  3DL1 A;  2SRT A;  2Z2D A;  3HDA P;  1CQR A;  1R1J A;  3LKA A;  5D7W A;  1UMS A;  1GO8 P;  2OXZ A;  3EDI A;  4L19 A;  4DV8 A;  4I35 A;  2O36 A;  1QIA A;  1WNI A;  4H1Q A;  5JMY A;  1XFX A;  4PKU A;  3HY7 A;  966C A;  1O0Q A;  3N2V A;  3HDB A;  4H84 A;  3EDZ A;  1C7K A;  1JAQ A;  1EUB A;  2L0R A;  3LGP A;  1UTT A;  4G9L A;  3MA2 A;  2E2D A;  2TCL A;  3HBU P;  4JPA A;  2RJP A;  2YB9 A;  1MMP A;  1CIZ A;  4EFS A;  3LEA A;  3Q2H A;  1FLS A;  1Y0V A;  2ERP A;  4IUW A;  2J83 A;  5LAB A;  2OW0 A;  1B8Y A;  1ATL A;  2D1N A;  3KRY A;  1MMR A;  1GO7 P;  2OW9 A;  3WV2 A;  4QKZ A;  4PKQ A;  2X3A A;  1OZ9 A;  2USN A;  4WKI A;  4H2E A;  4G0D A;  1SRP A;  3VTG A;  4GUY A;  1GE5 A;  1S4B P;  4L7A A;  1G05 A;  2MZI A;  2FV9 A;  3O2X A;  1C8T A;  3B2Z A;  2J0T A;  1FBL A;  2Y6D A;  2OXW A;  4L63 A;  5BOY A;  1XFZ A;  3KEC A;  1ZS0 A;  1JAO A;  3KWV C;  1EAK A;  2N8R A;  3F17 A;  2JT5 A;  4XBH A;  3B92 A;  1YOU A;  4DF9 A;  1OM7 A;  1H71 P;  1OMJ A;  1GXD A;  4PKT A;  1BM6 A;  3BA0 A;  1B3D A;  2KRJ A;  2W15 A;  1GE7 A;  4JA1 A;  3WV1 A;  4PKS A;  1GE6 A;  4H49 A;  1BUV M;  1BKC E;  2WO9 A;  4H30 A;  2OI0 A;  3O64 A;  3EDH A;  1UEA A;  5I2Z A;  1QIB A;  1YQY A;  2DW1 A;  2W12 A;  1JH1 A;  2OY2 A;  1I1I P;  2K2G A;  3B8Z A;  4WK7 A;  3ZVS A;  1I76 A;  2AYK A;  1BKC I;  3AYU A;  5L79 A;  2Y6C A;  2POJ A;  3G42 A;  2OY4 A;  3HBV P;  1TVI A;  1XFY A;  3U1R A;  1MMB A;  2K9C A;  1JJ9 A;  4AUO A;  3LMC A;  1I73 A;  1HOV A;  3N2U A;  1SU3 A;  4XCT A;  1XFW A;  1USN A;  2I47 A;  1CGE A;  5I0L A;  4PKR A;  2XS4 A;  3LK8 A;  2MLR A;  1DTH A;  4GWN A;  2HU6 A;  2E3X A;  4XM7 A;  1AF0 A;  3EHX A;  4AIG A;  1CGL A;  4FU4 A;  3F1A A;  1AST A;  1OO9 A;  3DPF A;  1R1H A;  3VI1 A;  1R55 A;  1HV5 A;  3TVC A;  2MZH A;  4I03 A;  456C A;  1Y8J A;  1G12 A;  1HTD A;  1SLN A;  4AYK A;  1QJJ A;  2MZE A;  3ZXH A;  5CUH A;  1ZXC A;  1HY7 A;  2DW2 A;  3Q2G A;  4H3X A;  1BQO A;  1D8M A;  1QIC A;  3KEJ A;  2RJQ A;  4H82 A;  1G4K A;  2JNP A;  2X3C A;  1GKC A;  3F15 A;  1IAD A;  1BQQ M;  1G49 A;  2PJT A;  1XUC A;  1KAP P;  3AIG A;  4WZV A;  1KUK A;  3K7N A;  2JSD A;  1CAQ A;  3HYG A;  4XM6 A;  3LIK A;  5D2B A;  3L0T A;  1ROS A;  1C3I A;  1OS2 A;  1RM8 A;  4HMA A;  2WO8 A;  2A8H A;  2JIH A;  2D1O A;  4JIJ A;  1R1I A;  3LJG A;  2OXU A;  3KEK A;  2V4B A;  1JAN A;  4FXQ A;  4DD8 A;  1XAX A;  2OVZ A;  3SHI A;  1Q3A A;  4GR3 A;  5D1T A;  2CLT A;  2OVX A;  1KUG A;  1XUD A;  1HFS A;  3LE9 A;  5D3C A;  3E8R A;  1BKC A;  4Q1L A;  3DTI A;  3KHI A;  2DDY A;  1RMZ A;  1KUH A;  4ILW D;  4ZR5 A;  1JAP A;  1KUI A;  1CK7 A;  3DNG A;  1XFU A;  3DWB A;  3LQB A;  2OW2 A;  2W14 A;  1PWP A;  1Z3J A;  4HX3 A;  2W0D A;  1Y93 A;  1KUF A;  3HB2 P;  3LIL A;  3GBO A;  1OM8 A;  1MMQ A;  1O0T A;  4GR0 A;  1JK3 A;  4PKW A;  2JT6 A;  4FXY P;  3UVC A;  3TS4 A;  1CGF A;  4R3V A;  3F16 A;  2AIG P;  3LJZ A;  3TT4 A;  4PKV A;  1JIW P;  3F18 A;  3TSK A;  2WOA A;  1SMP A;  3DTK A;  1D8F A;  1K7G A;  5I4O A;  4CTH A;  1A86 A;  5B5O A;  1GKD A;  2DDF A;  1L6J A;  1SAT A;  1R54 A;  1KBC A;  2DW0 A;  1A85 A;  1D7X A;  3KME A;  830C A;  3HY9 A;  1ZP5 A;  3P24 A;  5I3M A;  4JP4 A;  3V96 B;  1IAG A;  4J4M A;  2ERQ A;  3LIR A;  4GQL A;  3AYK A;  4JQG A;  4GF1 A;  5BOT A;  3LQ0 A;  1IAC A;  1IAA A;  1K7Q A;  1XUR A;  3F19 A;  4WF6 A;  1ZVX A;  3P1V A;  1IAB A;  1OS9 A;  3I7G A;  1HFC A;  4A3W A;  3K7L A;  1PWV A;  4FVL A;  4WKE A;  1J7N A;  2XS3 A;  5I12 A;  1OM6 A;  1QJI A;  5H8X A;  3LJT A;  3G5C A;  1JKY A;  1PWW A;  1UMT A;  2W13 A;  5B5P A;  3ZUK A;  2ERO A;  3NX7 A;  2O3E A;  3EHY A;  5I43 A;  2X3B A;  1D5J A;  3ELM A;  1ZXV A;  1XM5 A;  1BIW A;  5CXA A;  1PWU A;  1YP1 A;  4IJO A;  1XFV A;  3DPE A;  1CXV A;  1IAE A;  1ND1 A;  1ZTQ A;  3KMC A;  3OHL A;  5D1S A;  1UTZ A;  1K7I A;  2YUF A;  3DTE A;  3OHO A;  4XM8 A;  1MNC A;  4DPE A;  2OZR A;  1BUD A;  1AKL A;  1FM1 A;  4H76 A;  3I7I A;  1AYK A;  5CZM A;  1EB6 A;  1BZS A;  1QUA A;  3WV3 A;  4ON1 A;  3RTS A;  5BPA A;  3USN A;  3LUM A;  1SLM A;  1PWQ A;  4AXQ A;  4A7B A;  2YIG A;  1G9K A;  3EWJ A;  3CKI A;  4GWM A;  5L7F A;  2X7M A; 
#chains in the Genus database with same CATH homology
 2MLS A;  3RTT A;  1DMT A;  3L0V A;  4IN9 A;  2QPJ A;  4L6T A;  1JIZ A;  2OW1 A;  3LUN A;  3DSL A;  2FV5 A;  1YCM A;  2CKI A;  4GR8 A;  1BSW A;  3EDG A;  5D1U A;  3DL1 A;  2SRT A;  2Z2D A;  3HDA P;  1CQR A;  1R1J A;  3LKA A;  5D7W A;  1UMS A;  1GO8 P;  2OXZ A;  3EDI A;  4L19 A;  4DV8 A;  4I35 A;  2O36 A;  1QIA A;  1WNI A;  4H1Q A;  5JMY A;  1XFX A;  4PKU A;  3HY7 A;  966C A;  1O0Q A;  3N2V A;  3HDB A;  4H84 A;  3EDZ A;  1C7K A;  1JAQ A;  1EUB A;  2L0R A;  3LGP A;  1UTT A;  4G9L A;  3MA2 A;  2E2D A;  2TCL A;  3HBU P;  4JPA A;  2RJP A;  2YB9 A;  1MMP A;  1CIZ A;  4EFS A;  3LEA A;  3Q2H A;  1FLS A;  1Y0V A;  2ERP A;  4IUW A;  2J83 A;  5LAB A;  2OW0 A;  1B8Y A;  1ATL A;  2D1N A;  3KRY A;  1MMR A;  1GO7 P;  2OW9 A;  3WV2 A;  4QKZ A;  4PKQ A;  2X3A A;  2USN A;  4WKI A;  4H2E A;  4G0D A;  1SRP A;  3VTG A;  4GUY A;  1GE5 A;  1S4B P;  4L7A A;  1G05 A;  2MZI A;  2FV9 A;  3O2X A;  1C8T A;  3B2Z A;  2J0T A;  1FBL A;  2Y6D A;  2OXW A;  4L63 A;  5BOY A;  1XFZ A;  3KEC A;  1ZS0 A;  1JAO A;  3KWV C;  1EAK A;  2N8R A;  3F17 A;  2JT5 A;  4XBH A;  3B92 A;  1YOU A;  4DF9 A;  1OM7 A;  1H71 P;  1OMJ A;  1GXD A;  4PKT A;  1BM6 A;  3BA0 A;  1B3D A;  2KRJ A;  2W15 A;  1GE7 A;  4JA1 A;  3WV1 A;  4PKS A;  1GE6 A;  4H49 A;  1BUV M;  1BKC E;  2WO9 A;  4H30 A;  2OI0 A;  3O64 A;  3EDH A;  1UEA A;  5I2Z A;  1QIB A;  1YQY A;  2DW1 A;  2W12 A;  1JH1 A;  2OY2 A;  1I1I P;  2K2G A;  3B8Z A;  4WK7 A;  3ZVS A;  1I76 A;  2AYK A;  1BKC I;  3AYU A;  5L79 A;  2Y6C A;  2POJ A;  3G42 A;  2OY4 A;  3HBV P;  1XFY A;  3U1R A;  1MMB A;  2K9C A;  1JJ9 A;  4AUO A;  3LMC A;  1I73 A;  1HOV A;  3N2U A;  1SU3 A;  4XCT A;  1XFW A;  1USN A;  2I47 A;  1CGE A;  5I0L A;  4PKR A;  2XS4 A;  3LK8 A;  2MLR A;  1DTH A;  4GWN A;  2HU6 A;  2E3X A;  4XM7 A;  1AF0 A;  3EHX A;  4AIG A;  1CGL A;  4FU4 A;  3F1A A;  1AST A;  1OO9 A;  3DPF A;  1R1H A;  3VI1 A;  1R55 A;  1HV5 A;  3TVC A;  2MZH A;  4I03 A;  456C A;  1Y8J A;  1G12 A;  1HTD A;  1SLN A;  4AYK A;  1QJJ A;  2MZE A;  3ZXH A;  5CUH A;  1ZXC A;  1HY7 A;  2DW2 A;  3Q2G A;  4H3X A;  1BQO A;  1D8M A;  1QIC A;  3KEJ A;  2RJQ A;  4H82 A;  1G4K A;  2JNP A;  2X3C A;  1GKC A;  3F15 A;  1IAD A;  1BQQ M;  1G49 A;  2PJT A;  1XUC A;  1KAP P;  3AIG A;  4WZV A;  1KUK A;  3K7N A;  2JSD A;  1CAQ A;  3HYG A;  4XM6 A;  3LIK A;  5D2B A;  3L0T A;  1ROS A;  1C3I A;  1OS2 A;  1RM8 A;  4HMA A;  2WO8 A;  2A8H A;  2JIH A;  2D1O A;  4JIJ A;  1R1I A;  3LJG A;  2OXU A;  3KEK A;  2V4B A;  1JAN A;  4FXQ A;  4DD8 A;  2OVZ A;  3SHI A;  1Q3A A;  4GR3 A;  5D1T A;  2CLT A;  2OVX A;  1KUG A;  1XUD A;  1HFS A;  3LE9 A;  5D3C A;  3E8R A;  1BKC A;  4Q1L A;  3DTI A;  3KHI A;  2DDY A;  1RMZ A;  1KUH A;  4ILW D;  4ZR5 A;  1JAP A;  1KUI A;  1CK7 A;  3DNG A;  1XFU A;  3DWB A;  3LQB A;  2OW2 A;  2W14 A;  1PWP A;  1Z3J A;  4HX3 A;  2W0D A;  1Y93 A;  1KUF A;  3HB2 P;  3LIL A;  3GBO A;  1OM8 A;  1MMQ A;  1O0T A;  4GR0 A;  1JK3 A;  4PKW A;  2JT6 A;  4FXY P;  3UVC A;  3TS4 A;  1CGF A;  4R3V A;  3F16 A;  2AIG P;  3LJZ A;  3TT4 A;  4PKV A;  1JIW P;  3F18 A;  3TSK A;  2WOA A;  1SMP A;  3DTK A;  1D8F A;  1K7G A;  5I4O A;  4CTH A;  1A86 A;  5B5O A;  1GKD A;  2DDF A;  1L6J A;  1SAT A;  1R54 A;  1KBC A;  2DW0 A;  1A85 A;  1D7X A;  3KME A;  830C A;  3HY9 A;  1ZP5 A;  3P24 A;  5I3M A;  4JP4 A;  3V96 B;  1IAG A;  4J4M A;  2ERQ A;  3LIR A;  4GQL A;  3AYK A;  4JQG A;  4GF1 A;  5BOT A;  3LQ0 A;  1IAC A;  1IAA A;  1K7Q A;  1XUR A;  3F19 A;  4WF6 A;  1ZVX A;  3P1V A;  1IAB A;  1OS9 A;  3I7G A;  1HFC A;  4A3W A;  3K7L A;  1PWV A;  4FVL A;  4WKE A;  1J7N A;  2XS3 A;  5I12 A;  1OM6 A;  1QJI A;  5H8X A;  3LJT A;  3G5C A;  1JKY A;  1PWW A;  1UMT A;  2W13 A;  5B5P A;  3ZUK A;  2ERO A;  3NX7 A;  2O3E A;  3EHY A;  5I43 A;  2X3B A;  1D5J A;  3ELM A;  1ZXV A;  1BIW A;  5CXA A;  1PWU A;  1YP1 A;  4IJO A;  1XFV A;  3DPE A;  1CXV A;  1IAE A;  1ND1 A;  1ZTQ A;  3KMC A;  3OHL A;  5D1S A;  1UTZ A;  1K7I A;  2YUF A;  3DTE A;  3OHO A;  4XM8 A;  1MNC A;  4DPE A;  2OZR A;  1BUD A;  1AKL A;  1FM1 A;  4H76 A;  3I7I A;  1AYK A;  5CZM A;  1EB6 A;  1BZS A;  1QUA A;  3WV3 A;  4ON1 A;  3RTS A;  5BPA A;  3USN A;  3LUM A;  1SLM A;  1PWQ A;  4AXQ A;  4A7B A;  2YIG A;  1G9K A;  3EWJ A;  3CKI A;  4GWM A;  5L7F A;  2X7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...