3EHYA

Crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor (r)-2-(4-methoxyphenylsulfonamido)propanoic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Biotin-tagged probes for MMP expression and activation: design, synthesis, and binding properties
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2008-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3ehyA00
2OVZA 3GBOA 1AF0A 3HY7A 1JKYA 2MLRA 3EDHA 2W15A 4Q1LA 3F18A 1XFVA 2X3AA 1IACA 1IABA 3LJTA 5I0LA 3WV1A 4XCTA 1YOUA 1A85A 4XM6A 1JIWP 3Q2GA 1GO7P 2JSDA 4IJOA 4A7BA 4AXQA 1I1IP 1G4KA 2MLSA 4J4MA 4QKZA 1HFSA 3UVCA 3L0VA 2X3BA 4L6TA 2Y6CA 4GWNA 4GR8A 1OS2A 4DPEA 1XFYA 1B3DA 1HTDA 1GE7A 2FV9A 4GQLA 1QICA 2V4BA 1ATLA 5B5OA 2DDYA 3LILA 1SRPA 3OHLA 3HBUP 2J83A 1XFZA 1RM8A 2EROA 2K9CA 1I73A 1BSWA 2XS4A 1DMTA 1PWUA 1H71P 2O36A 4H84A 3WV3A 1L6JA 3G42A 1CK7A 4AIGA 3VI1A 1SATA 2KRJA 1C7KA 4HMAA 2DW0A 4A3WA 1XUCA 4G9LA 1JAOA 2JT6A 1Y0VA 3LIKA 2YB9A 1KUFA 1UTZA 4PKUA 3KEKA 5I4OA 3ZUKA 2D1NA 3LEAA 1GKCA 3KMEA 3LK8A 4L19A 3WV2A 2W12A 2XS3A 1AKLA 1PWQA 1OM7A 1A86A 5LABA 5D2BA 1ROSA 3RTTA 3L0TA 3HYGA 3ELMA 2OXWA 4GF1A 3NX7A 1XURA 5L79A 5D1UA 2USNA 2E2DA 1K7IA 4I03A 1IAGA 1XFUA 4L63A 5I3MA 1J7NA 1IAEA 1Y8JA 4EFSA 3EDIA 1CGEA 4JPAA 4CTHA 1EUBA 1YP1A 1CQRA 4PKRA 830CA 5BOYA 2DW1A 4JA1A 4AYKA 4PKTA 2DW2A 1KAPP 2L0RA 3DWBA 3AIGA 2OY4A 1JAPA 4R3VA 3ZXHA 1QIBA 1ZP5A 1KUIA 2W14A 1R54A 1KUKA 1WNIA 1BQQM 1KUGA 3HB2P 4DF9A 3B8ZA 1D8FA 1ZVXA 1GKDA 1SU3A 3KRYA 1HV5A 1B8YA 1CGFA 1D5JA 1S4BP 1UEAA 3KEJA 1OM8A 1G12A 4AUOA 1SLNA 4FXQA 1BKCE 3HY9A 1MMRA 2MZIA 1OM6A 2MZEA 5CXAA 1OS9A 3RTSA 4IN9A 4FU4A 3P1VA 2Y6DA 1ZTQA 2OVXA 1EB6A 1G49A 1R1HA 2WO8A 5D1TA 5I12A 4ZR5A 1QJIA 3OHOA 5D7WA 4DV8A 1FLSA 1XFWA 1EAKA 3DL1A 3F19A 1JJ9A 2OW0A 3TSKA 1HFCA 4ON1A 2MZHA 1BZSA 1PWWA 2E3XA 2OXZA 2QPJA 4PKQA 1YCMA 2JT5A 5H8XA 3I7GA 1UMSA 4DD8A 3EHXA 4H1QA 3F17A 3EWJA 1BIWA 4PKWA 3TVCA 5BOTA 1BUVM 5I43A 1DTHA 4JQGA 2OZRA 3G5CA 1R55A 1MMPA 3HDBA 2HU6A 4PKSA 1ZXCA 2CLTA 4FXYP 3KECA 1Y93A 456CA 4H30A 1GE5A 2JIHA 3Q2HA 3K7NA 966CA 2ERQA 4ILWD 1KUHA 4HX3A 4H3XA 2X3CA 3LUNA 1O0TA 1CIZA 1CXVA 1RMZA 2OY2A 4PKVA 3HDAP 1FM1A 2Z2DA 2W0DA 4GR3A 2POJA 1MMBA 1ND1A 1JH1A 3AYKA 2X7MA 2CKIA 3F15A 3LIRA 1PWPA 5D1SA 1C8TA 1ZS0A 3LGPA 4WF6A 1GE6A 3P24A 1ASTA 1K7GA 5BPAA 3O64A 1K7QA 5D3CA 4IUWA 1AYKA 4GR0A 3U1RA 4XM7A 2SRTA 1OMJA 3KWVC 1UMTA 3F1AA 2JNPA 2RJQA 4H76A 2O3EA 3DPEA 2AIGP 4GUYA 5CUHA 4H82A 2OI0A 1OO9A 1I76A 2OW9A 1HY7A 2D1OA 1D7XA 3EDZA 1JIZA 3DSLA 3AYUA 1JAQA 1JANA 2OW2A 1MNCA 2PJTA 1R1IA 1SMPA 3HBVP 1KBCA 1ZXVA 3N2VA 1JK3A 3KMCA 3CKIA 1XFXA 4H2EA 1IADA 4JIJA 3VTGA 1IAAA 3TT4A 3B92A 2WO9A 3MA2A 1G9KA 4XM8A 3B2ZA 3F16A 2RJPA 1BKCI 1BM6A 3LQBA 3LQ0A 1C3IA 1XUDA 4GWMA 1BKCA 3DNGA 3EHYA 3TS4A 1MMQA 1UTTA 2A8HA 1D8MA 2J0TA 1HOVA 1CAQA 1FBLA 1GO8P 2I47A 2TCLA 3EDGA 1O0QA 3LUMA 3KHIA 1USNA 1GXDA 5JMYA 1SLMA 2OXUA 3K7LA 4I35A 3ZVSA 3BA0A 2DDFA 4WK7A 2FV5A 4WKIA 2W13A 1Z3JA 3DPFA 3O2XA 2AYKA 3LMCA 3V96B 1QJJA 1YQYA 1G05A 2YIGA 5I2ZA 4JP4A 2OW1A 3LE9A 3N2UA 3E8RA 1Q3AA 2N8RA 1R1JA 2K2GA 1PWVA 3LKAA 5B5PA 1QIAA 1BQOA 1QUAA 2WOAA 4G0DA 3SHIA 2ERPA 3LJZA 3USNA 5L7FA 1CGLA 4XBHA 1BUDA 3I7IA 5CZMA 4WKEA 4FVLA 4WZVA 4H49A 3LJGA
chains in the Genus database with same CATH superfamily
2OVZA 3GBOA 1AF0A 3HY7A 1JKYA 2MLRA 3EDHA 2W15A 4Q1LA 3F18A 1XFVA 2X3AA 1IACA 1IABA 3LJTA 5I0LA 3WV1A 4XCTA 1YOUA 1A85A 4XM6A 1JIWP 3Q2GA 1GO7P 2JSDA 4IJOA 4A7BA 4AXQA 1I1IP 1G4KA 2MLSA 4J4MA 4QKZA 1HFSA 3UVCA 3L0VA 2X3BA 4L6TA 2Y6CA 4GWNA 4GR8A 1OS2A 4DPEA 1XFYA 1B3DA 1HTDA 1GE7A 2FV9A 4GQLA 4L7AA 1QICA 2V4BA 1ATLA 5B5OA 2DDYA 3LILA 1SRPA 3OHLA 3HBUP 2J83A 1XFZA 1RM8A 2EROA 2K9CA 1I73A 1BSWA 2XS4A 1DMTA 1PWUA 1H71P 2O36A 4H84A 3WV3A 1L6JA 3G42A 1CK7A 4AIGA 3VI1A 1SATA 2KRJA 1C7KA 4HMAA 2DW0A 4A3WA 1XUCA 4G9LA 1JAOA 2JT6A 1Y0VA 3LIKA 2YB9A 1KUFA 1UTZA 4PKUA 3KEKA 5I4OA 3ZUKA 2D1NA 3LEAA 1GKCA 3KMEA 3LK8A 4L19A 3WV2A 2W12A 2XS3A 3DTKA 1AKLA 1PWQA 1OM7A 1A86A 5LABA 5D2BA 1ROSA 3RTTA 3L0TA 3HYGA 3ELMA 2OXWA 4GF1A 3NX7A 1XURA 5L79A 5D1UA 2USNA 2E2DA 1K7IA 4I03A 1IAGA 1XFUA 4L63A 5I3MA 1J7NA 1IAEA 1Y8JA 4EFSA 3EDIA 1CGEA 4JPAA 4CTHA 1EUBA 1YP1A 1CQRA 4PKRA 830CA 5BOYA 2DW1A 4JA1A 4AYKA 4PKTA 2DW2A 1KAPP 2L0RA 3DWBA 3AIGA 2OY4A 1JAPA 4R3VA 3ZXHA 1QIBA 1ZP5A 1KUIA 2W14A 1R54A 1KUKA 1WNIA 1BQQM 1KUGA 3HB2P 4DF9A 3B8ZA 1D8FA 1ZVXA 1GKDA 1SU3A 3KRYA 1HV5A 3DTEA 1B8YA 1CGFA 1D5JA 1S4BP 1UEAA 3KEJA 1OM8A 1G12A 4AUOA 1SLNA 4FXQA 1BKCE 3HY9A 1MMRA 2MZIA 1OM6A 2MZEA 5CXAA 1OS9A 3RTSA 4IN9A 4FU4A 3P1VA 2Y6DA 1ZTQA 2OVXA 1EB6A 1G49A 1R1HA 2WO8A 5D1TA 5I12A 2YUFA 4ZR5A 1QJIA 3OHOA 5D7WA 4DV8A 1FLSA 1XFWA 1EAKA 3DL1A 3F19A 1JJ9A 2OW0A 3TSKA 1HFCA 4ON1A 2MZHA 1BZSA 1PWWA 2E3XA 2OXZA 2QPJA 4PKQA 1YCMA 2JT5A 5H8XA 3I7GA 1UMSA 4DD8A 3EHXA 4H1QA 3F17A 3EWJA 1BIWA 4PKWA 3TVCA 5BOTA 1BUVM 5I43A 1DTHA 4JQGA 2OZRA 3G5CA 1R55A 1MMPA 3HDBA 2HU6A 4PKSA 1ZXCA 1TVIA 2CLTA 4FXYP 3KECA 1Y93A 456CA 4H30A 1GE5A 2JIHA 3Q2HA 3K7NA 966CA 2ERQA 4ILWD 1KUHA 4HX3A 4H3XA 2X3CA 3LUNA 1O0TA 1CIZA 1CXVA 1RMZA 2OY2A 4PKVA 3HDAP 1FM1A 2Z2DA 1OZ9A 2W0DA 4GR3A 2POJA 1MMBA 1ND1A 1JH1A 3AYKA 2X7MA 2CKIA 3F15A 3LIRA 1PWPA 5D1SA 1C8TA 1ZS0A 3LGPA 4WF6A 1GE6A 3P24A 1ASTA 1K7GA 5BPAA 3O64A 1K7QA 5D3CA 4IUWA 1AYKA 4GR0A 3U1RA 4XM7A 2SRTA 1OMJA 3KWVC 1UMTA 3F1AA 2JNPA 2RJQA 4H76A 2O3EA 3DPEA 2AIGP 4GUYA 5CUHA 4H82A 2OI0A 1OO9A 1I76A 2OW9A 1HY7A 2D1OA 1D7XA 3EDZA 1JIZA 3DSLA 3AYUA 1JAQA 1JANA 2OW2A 1MNCA 2PJTA 1R1IA 1SMPA 3HBVP 1XM5A 1KBCA 1ZXVA 3N2VA 1JK3A 3KMCA 3CKIA 1XFXA 4H2EA 1IADA 4JIJA 3VTGA 1IAAA 3TT4A 3B92A 2WO9A 3MA2A 1G9KA 4XM8A 3B2ZA 3F16A 2RJPA 1BKCI 1BM6A 3LQBA 3LQ0A 1C3IA 1XUDA 4GWMA 1BKCA 3DNGA 3EHYA 3TS4A 1MMQA 1UTTA 2A8HA 1D8MA 2J0TA 1HOVA 1CAQA 1FBLA 1GO8P 2I47A 2TCLA 3EDGA 1O0QA 3LUMA 3KHIA 1USNA 1GXDA 5JMYA 3DTIA 1SLMA 2OXUA 3K7LA 4I35A 3ZVSA 3BA0A 2DDFA 4WK7A 2FV5A 4WKIA 2W13A 1Z3JA 3DPFA 3O2XA 2AYKA 3LMCA 3V96B 1QJJA 1YQYA 1G05A 2YIGA 5I2ZA 4JP4A 2OW1A 3LE9A 3N2UA 3E8RA 1Q3AA 2N8RA 1R1JA 2K2GA 1PWVA 3LKAA 5B5PA 1QIAA 1XAXA 1BQOA 1QUAA 2WOAA 4G0DA 3SHIA 2ERPA 3LJZA 3USNA 5L7FA 1CGLA 4XBHA 1BUDA 3I7IA 5CZMA 4WKEA 4FVLA 4WZVA 4H49A 3LJGA
chains in the Genus database with same CATH topology
2OVZA 3GBOA 1AF0A 3HY7A 1JKYA 2MLRA 3EDHA 2W15A 4Q1LA 3F18A 1XFVA 2X3AA 1IACA 1IABA 3LJTA 5I0LA 3WV1A 4XCTA 1YOUA 1A85A 4XM6A 1JIWP 3Q2GA 1GO7P 2JSDA 4IJOA 4A7BA 4AXQA 1I1IP 1G4KA 2MLSA 4J4MA 4QKZA 1HFSA 3UVCA 3L0VA 2X3BA 4L6TA 2Y6CA 4GWNA 4GR8A 1OS2A 4DPEA 1XFYA 1B3DA 1HTDA 1GE7A 2FV9A 4GQLA 4L7AA 1QICA 2V4BA 1ATLA 5B5OA 2DDYA 3LILA 1SRPA 3OHLA 3HBUP 2J83A 1XFZA 1RM8A 2EROA 2K9CA 1I73A 1BSWA 2XS4A 1DMTA 1PWUA 1H71P 2O36A 4H84A 3WV3A 1L6JA 3G42A 1CK7A 4AIGA 3VI1A 1SATA 2KRJA 1C7KA 4HMAA 2DW0A 4A3WA 1XUCA 4G9LA 1JAOA 2JT6A 1Y0VA 3LIKA 2YB9A 1KUFA 1UTZA 4PKUA 3KEKA 5I4OA 3ZUKA 2D1NA 3LEAA 1GKCA 3KMEA 3LK8A 4L19A 3WV2A 2W12A 2XS3A 3DTKA 1AKLA 1PWQA 1OM7A 1A86A 5LABA 5D2BA 1ROSA 3RTTA 3L0TA 3HYGA 3ELMA 2OXWA 4GF1A 3NX7A 1XURA 5L79A 5D1UA 2USNA 2E2DA 1K7IA 4I03A 1IAGA 1XFUA 4L63A 5I3MA 1J7NA 1IAEA 1Y8JA 4EFSA 3EDIA 1CGEA 4JPAA 4CTHA 1EUBA 1YP1A 1CQRA 4PKRA 830CA 5BOYA 2DW1A 4JA1A 4AYKA 4PKTA 2DW2A 1KAPP 2L0RA 3DWBA 3AIGA 2OY4A 1JAPA 4R3VA 3ZXHA 1QIBA 1ZP5A 1KUIA 2W14A 1R54A 1KUKA 1WNIA 1BQQM 1KUGA 3HB2P 4DF9A 3B8ZA 1D8FA 1ZVXA 1GKDA 1SU3A 3KRYA 1HV5A 3DTEA 1B8YA 1CGFA 1D5JA 1S4BP 1UEAA 3KEJA 1OM8A 1G12A 4AUOA 1SLNA 4FXQA 1BKCE 3HY9A 1MMRA 2MZIA 1OM6A 2MZEA 5CXAA 1OS9A 3RTSA 4IN9A 4FU4A 3P1VA 2Y6DA 1ZTQA 2OVXA 1EB6A 1G49A 1R1HA 2WO8A 5D1TA 5I12A 2YUFA 4ZR5A 1QJIA 3OHOA 5D7WA 4DV8A 1FLSA 1XFWA 1EAKA 3DL1A 3F19A 1JJ9A 2OW0A 3TSKA 1HFCA 4ON1A 2MZHA 1BZSA 1PWWA 2E3XA 2OXZA 2QPJA 4PKQA 1YCMA 2JT5A 5H8XA 3I7GA 1UMSA 4DD8A 3EHXA 4H1QA 3F17A 3EWJA 1BIWA 4PKWA 3TVCA 5BOTA 1BUVM 5I43A 1DTHA 4JQGA 2OZRA 3G5CA 1R55A 1MMPA 3HDBA 2HU6A 4PKSA 1ZXCA 2CLTA 4FXYP 3KECA 1Y93A 456CA 4H30A 1GE5A 2JIHA 3Q2HA 3K7NA 966CA 2ERQA 4ILWD 1KUHA 4HX3A 4H3XA 2X3CA 3LUNA 1O0TA 1CIZA 1CXVA 1RMZA 2OY2A 4PKVA 3HDAP 1FM1A 2Z2DA 2W0DA 4GR3A 2POJA 1MMBA 1ND1A 1JH1A 3AYKA 2X7MA 2CKIA 3F15A 3LIRA 1PWPA 5D1SA 1C8TA 1ZS0A 3LGPA 4WF6A 1GE6A 3P24A 1ASTA 1K7GA 5BPAA 3O64A 1K7QA 5D3CA 4IUWA 1AYKA 4GR0A 3U1RA 4XM7A 2SRTA 1OMJA 3KWVC 1UMTA 3F1AA 2JNPA 2RJQA 4H76A 2O3EA 3DPEA 2AIGP 4GUYA 5CUHA 4H82A 2OI0A 1OO9A 1I76A 2OW9A 1HY7A 2D1OA 1D7XA 3EDZA 1JIZA 3DSLA 3AYUA 1JAQA 1JANA 2OW2A 1MNCA 2PJTA 1R1IA 1SMPA 3HBVP 1KBCA 1ZXVA 3N2VA 1JK3A 3KMCA 3CKIA 1XFXA 4H2EA 1IADA 4JIJA 3VTGA 1IAAA 3TT4A 3B92A 2WO9A 3MA2A 1G9KA 4XM8A 3B2ZA 3F16A 2RJPA 1BKCI 1BM6A 3LQBA 3LQ0A 1C3IA 1XUDA 4GWMA 1BKCA 3DNGA 3EHYA 3TS4A 1MMQA 1UTTA 2A8HA 1D8MA 2J0TA 1HOVA 1CAQA 1FBLA 1GO8P 2I47A 2TCLA 3EDGA 1O0QA 3LUMA 3KHIA 1USNA 1GXDA 5JMYA 3DTIA 1SLMA 2OXUA 3K7LA 4I35A 3ZVSA 3BA0A 2DDFA 4WK7A 2FV5A 4WKIA 2W13A 1Z3JA 3DPFA 3O2XA 2AYKA 3LMCA 3V96B 1QJJA 1YQYA 1G05A 2YIGA 5I2ZA 4JP4A 2OW1A 3LE9A 3N2UA 3E8RA 1Q3AA 2N8RA 1R1JA 2K2GA 1PWVA 3LKAA 5B5PA 1QIAA 1BQOA 1QUAA 2WOAA 4G0DA 3SHIA 2ERPA 3LJZA 3USNA 5L7FA 1CGLA 4XBHA 1BUDA 3I7IA 5CZMA 4WKEA 4FVLA 4WZVA 4H49A 3LJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OVZ A;  3GBO A;  1AF0 A;  3HY7 A;  1JKY A;  2MLR A;  3EDH A;  2W15 A;  4Q1L A;  3F18 A;  1XFV A;  2X3A A;  1IAC A;  1IAB A;  3LJT A;  5I0L A;  3WV1 A;  4XCT A;  1YOU A;  1A85 A;  4XM6 A;  1JIW P;  3Q2G A;  1GO7 P;  2JSD A;  4IJO A;  4A7B A;  4AXQ A;  1I1I P;  1G4K A;  2MLS A;  4J4M A;  4QKZ A;  1HFS A;  3UVC A;  3L0V A;  2X3B A;  4L6T A;  2Y6C A;  4GWN A;  4GR8 A;  1OS2 A;  4DPE A;  1XFY A;  1B3D A;  1HTD A;  1GE7 A;  2FV9 A;  4GQL A;  1QIC A;  2V4B A;  1ATL A;  5B5O A;  2DDY A;  3LIL A;  1SRP A;  3OHL A;  3HBU P;  2J83 A;  1XFZ A;  1RM8 A;  2ERO A;  2K9C A;  1I73 A;  1BSW A;  2XS4 A;  1DMT A;  1PWU A;  1H71 P;  2O36 A;  4H84 A;  3WV3 A;  1L6J A;  3G42 A;  1CK7 A;  4AIG A;  3VI1 A;  1SAT A;  2KRJ A;  1C7K A;  4HMA A;  2DW0 A;  4A3W A;  1XUC A;  4G9L A;  1JAO A;  2JT6 A;  1Y0V A;  3LIK A;  2YB9 A;  1KUF A;  1UTZ A;  4PKU A;  3KEK A;  5I4O A;  3ZUK A;  2D1N A;  3LEA A;  1GKC A;  3KME A;  3LK8 A;  4L19 A;  3WV2 A;  2W12 A;  2XS3 A;  1AKL A;  1PWQ A;  1OM7 A;  1A86 A;  5LAB A;  5D2B A;  1ROS A;  3RTT A;  3L0T A;  3HYG A;  3ELM A;  2OXW A;  4GF1 A;  3NX7 A;  1XUR A;  5L79 A;  5D1U A;  2USN A;  2E2D A;  1K7I A;  4I03 A;  1IAG A;  1XFU A;  4L63 A;  5I3M A;  1J7N A;  1IAE A;  1Y8J A;  4EFS A;  3EDI A;  1CGE A;  4JPA A;  4CTH A;  1EUB A;  1YP1 A;  1CQR A;  4PKR A;  830C A;  5BOY A;  2DW1 A;  4JA1 A;  4AYK A;  4PKT A;  2DW2 A;  1KAP P;  2L0R A;  3DWB A;  3AIG A;  2OY4 A;  1JAP A;  4R3V A;  3ZXH A;  1QIB A;  1ZP5 A;  1KUI A;  2W14 A;  1R54 A;  1KUK A;  1WNI A;  1BQQ M;  1KUG A;  3HB2 P;  4DF9 A;  3B8Z A;  1D8F A;  1ZVX A;  1GKD A;  1SU3 A;  3KRY A;  1HV5 A;  1B8Y A;  1CGF A;  1D5J A;  1S4B P;  1UEA A;  3KEJ A;  1OM8 A;  1G12 A;  4AUO A;  1SLN A;  4FXQ A;  1BKC E;  3HY9 A;  1MMR A;  2MZI A;  1OM6 A;  2MZE A;  5CXA A;  1OS9 A;  3RTS A;  4IN9 A;  4FU4 A;  3P1V A;  2Y6D A;  1ZTQ A;  2OVX A;  1EB6 A;  1G49 A;  1R1H A;  2WO8 A;  5D1T A;  5I12 A;  4ZR5 A;  1QJI A;  3OHO A;  5D7W A;  4DV8 A;  1FLS A;  1XFW A;  1EAK A;  3DL1 A;  3F19 A;  1JJ9 A;  2OW0 A;  3TSK A;  1HFC A;  4ON1 A;  2MZH A;  1BZS A;  1PWW A;  2E3X A;  2OXZ A;  2QPJ A;  4PKQ A;  1YCM A;  2JT5 A;  5H8X A;  3I7G A;  1UMS A;  4DD8 A;  3EHX A;  4H1Q A;  3F17 A;  3EWJ A;  1BIW A;  4PKW A;  3TVC A;  5BOT A;  1BUV M;  5I43 A;  1DTH A;  4JQG A;  2OZR A;  3G5C A;  1R55 A;  1MMP A;  3HDB A;  2HU6 A;  4PKS A;  1ZXC A;  2CLT A;  4FXY P;  3KEC A;  1Y93 A;  456C A;  4H30 A;  1GE5 A;  2JIH A;  3Q2H A;  3K7N A;  966C A;  2ERQ A;  4ILW D;  1KUH A;  4HX3 A;  4H3X A;  2X3C A;  3LUN A;  1O0T A;  1CIZ A;  1CXV A;  1RMZ A;  2OY2 A;  4PKV A;  3HDA P;  1FM1 A;  2Z2D A;  2W0D A;  4GR3 A;  2POJ A;  1MMB A;  1ND1 A;  1JH1 A;  3AYK A;  2X7M A;  2CKI A;  3F15 A;  3LIR A;  1PWP A;  5D1S A;  1C8T A;  1ZS0 A;  3LGP A;  4WF6 A;  1GE6 A;  3P24 A;  1AST A;  1K7G A;  5BPA A;  3O64 A;  1K7Q A;  5D3C A;  4IUW A;  1AYK A;  4GR0 A;  3U1R A;  4XM7 A;  2SRT A;  1OMJ A;  3KWV C;  1UMT A;  3F1A A;  2JNP A;  2RJQ A;  4H76 A;  2O3E A;  3DPE A;  2AIG P;  4GUY A;  5CUH A;  4H82 A;  2OI0 A;  1OO9 A;  1I76 A;  2OW9 A;  1HY7 A;  2D1O A;  1D7X A;  3EDZ A;  1JIZ A;  3DSL A;  3AYU A;  1JAQ A;  1JAN A;  2OW2 A;  1MNC A;  2PJT A;  1R1I A;  1SMP A;  3HBV P;  1KBC A;  1ZXV A;  3N2V A;  1JK3 A;  3KMC A;  3CKI A;  1XFX A;  4H2E A;  1IAD A;  4JIJ A;  3VTG A;  1IAA A;  3TT4 A;  3B92 A;  2WO9 A;  3MA2 A;  1G9K A;  4XM8 A;  3B2Z A;  3F16 A;  2RJP A;  1BKC I;  1BM6 A;  3LQB A;  3LQ0 A;  1C3I A;  1XUD A;  4GWM A;  1BKC A;  3DNG A;  3EHY A;  3TS4 A;  1MMQ A;  1UTT A;  2A8H A;  1D8M A;  2J0T A;  1HOV A;  1CAQ A;  1FBL A;  1GO8 P;  2I47 A;  2TCL A;  3EDG A;  1O0Q A;  3LUM A;  3KHI A;  1USN A;  1GXD A;  5JMY A;  1SLM A;  2OXU A;  3K7L A;  4I35 A;  3ZVS A;  3BA0 A;  2DDF A;  4WK7 A;  2FV5 A;  4WKI A;  2W13 A;  1Z3J A;  3DPF A;  3O2X A;  2AYK A;  3LMC A;  3V96 B;  1QJJ A;  1YQY A;  1G05 A;  2YIG A;  5I2Z A;  4JP4 A;  2OW1 A;  3LE9 A;  3N2U A;  3E8R A;  1Q3A A;  2N8R A;  1R1J A;  2K2G A;  1PWV A;  3LKA A;  5B5P A;  1QIA A;  1BQO A;  1QUA A;  2WOA A;  4G0D A;  3SHI A;  2ERP A;  3LJZ A;  3USN A;  5L7F A;  1CGL A;  4XBH A;  1BUD A;  3I7I A;  5CZM A;  4WKE A;  4FVL A;  4WZV A;  4H49 A;  3LJG A; 
#chains in the Genus database with same CATH topology
 2OVZ A;  3GBO A;  1AF0 A;  3HY7 A;  1JKY A;  2MLR A;  3EDH A;  2W15 A;  4Q1L A;  3F18 A;  1XFV A;  2X3A A;  1IAC A;  1IAB A;  3LJT A;  5I0L A;  3WV1 A;  4XCT A;  1YOU A;  1A85 A;  4XM6 A;  1JIW P;  3Q2G A;  1GO7 P;  2JSD A;  4IJO A;  4A7B A;  4AXQ A;  1I1I P;  1G4K A;  2MLS A;  4J4M A;  4QKZ A;  1HFS A;  3UVC A;  3L0V A;  2X3B A;  4L6T A;  2Y6C A;  4GWN A;  4GR8 A;  1OS2 A;  4DPE A;  1XFY A;  1B3D A;  1HTD A;  1GE7 A;  2FV9 A;  4GQL A;  4L7A A;  1QIC A;  2V4B A;  1ATL A;  5B5O A;  2DDY A;  3LIL A;  1SRP A;  3OHL A;  3HBU P;  2J83 A;  1XFZ A;  1RM8 A;  2ERO A;  2K9C A;  1I73 A;  1BSW A;  2XS4 A;  1DMT A;  1PWU A;  1H71 P;  2O36 A;  4H84 A;  3WV3 A;  1L6J A;  3G42 A;  1CK7 A;  4AIG A;  3VI1 A;  1SAT A;  2KRJ A;  1C7K A;  4HMA A;  2DW0 A;  4A3W A;  1XUC A;  4G9L A;  1JAO A;  2JT6 A;  1Y0V A;  3LIK A;  2YB9 A;  1KUF A;  1UTZ A;  4PKU A;  3KEK A;  5I4O A;  3ZUK A;  2D1N A;  3LEA A;  1GKC A;  3KME A;  3LK8 A;  4L19 A;  3WV2 A;  2W12 A;  2XS3 A;  3DTK A;  1AKL A;  1PWQ A;  1OM7 A;  1A86 A;  5LAB A;  5D2B A;  1ROS A;  3RTT A;  3L0T A;  3HYG A;  3ELM A;  2OXW A;  4GF1 A;  3NX7 A;  1XUR A;  5L79 A;  5D1U A;  2USN A;  2E2D A;  1K7I A;  4I03 A;  1IAG A;  1XFU A;  4L63 A;  5I3M A;  1J7N A;  1IAE A;  1Y8J A;  4EFS A;  3EDI A;  1CGE A;  4JPA A;  4CTH A;  1EUB A;  1YP1 A;  1CQR A;  4PKR A;  830C A;  5BOY A;  2DW1 A;  4JA1 A;  4AYK A;  4PKT A;  2DW2 A;  1KAP P;  2L0R A;  3DWB A;  3AIG A;  2OY4 A;  1JAP A;  4R3V A;  3ZXH A;  1QIB A;  1ZP5 A;  1KUI A;  2W14 A;  1R54 A;  1KUK A;  1WNI A;  1BQQ M;  1KUG A;  3HB2 P;  4DF9 A;  3B8Z A;  1D8F A;  1ZVX A;  1GKD A;  1SU3 A;  3KRY A;  1HV5 A;  3DTE A;  1B8Y A;  1CGF A;  1D5J A;  1S4B P;  1UEA A;  3KEJ A;  1OM8 A;  1G12 A;  4AUO A;  1SLN A;  4FXQ A;  1BKC E;  3HY9 A;  1MMR A;  2MZI A;  1OM6 A;  2MZE A;  5CXA A;  1OS9 A;  3RTS A;  4IN9 A;  4FU4 A;  3P1V A;  2Y6D A;  1ZTQ A;  2OVX A;  1EB6 A;  1G49 A;  1R1H A;  2WO8 A;  5D1T A;  5I12 A;  2YUF A;  4ZR5 A;  1QJI A;  3OHO A;  5D7W A;  4DV8 A;  1FLS A;  1XFW A;  1EAK A;  3DL1 A;  3F19 A;  1JJ9 A;  2OW0 A;  3TSK A;  1HFC A;  4ON1 A;  2MZH A;  1BZS A;  1PWW A;  2E3X A;  2OXZ A;  2QPJ A;  4PKQ A;  1YCM A;  2JT5 A;  5H8X A;  3I7G A;  1UMS A;  4DD8 A;  3EHX A;  4H1Q A;  3F17 A;  3EWJ A;  1BIW A;  4PKW A;  3TVC A;  5BOT A;  1BUV M;  5I43 A;  1DTH A;  4JQG A;  2OZR A;  3G5C A;  1R55 A;  1MMP A;  3HDB A;  2HU6 A;  4PKS A;  1ZXC A;  1TVI A;  2CLT A;  4FXY P;  3KEC A;  1Y93 A;  456C A;  4H30 A;  1GE5 A;  2JIH A;  3Q2H A;  3K7N A;  966C A;  2ERQ A;  4ILW D;  1KUH A;  4HX3 A;  4H3X A;  2X3C A;  3LUN A;  1O0T A;  1CIZ A;  1CXV A;  1RMZ A;  2OY2 A;  4PKV A;  3HDA P;  1FM1 A;  2Z2D A;  1OZ9 A;  2W0D A;  4GR3 A;  2POJ A;  1MMB A;  1ND1 A;  1JH1 A;  3AYK A;  2X7M A;  2CKI A;  3F15 A;  3LIR A;  1PWP A;  5D1S A;  1C8T A;  1ZS0 A;  3LGP A;  4WF6 A;  1GE6 A;  3P24 A;  1AST A;  1K7G A;  5BPA A;  3O64 A;  1K7Q A;  5D3C A;  4IUW A;  1AYK A;  4GR0 A;  3U1R A;  4XM7 A;  2SRT A;  1OMJ A;  3KWV C;  1UMT A;  3F1A A;  2JNP A;  2RJQ A;  4H76 A;  2O3E A;  3DPE A;  2AIG P;  4GUY A;  5CUH A;  4H82 A;  2OI0 A;  1OO9 A;  1I76 A;  2OW9 A;  1HY7 A;  2D1O A;  1D7X A;  3EDZ A;  1JIZ A;  3DSL A;  3AYU A;  1JAQ A;  1JAN A;  2OW2 A;  1MNC A;  2PJT A;  1R1I A;  1SMP A;  3HBV P;  1XM5 A;  1KBC A;  1ZXV A;  3N2V A;  1JK3 A;  3KMC A;  3CKI A;  1XFX A;  4H2E A;  1IAD A;  4JIJ A;  3VTG A;  1IAA A;  3TT4 A;  3B92 A;  2WO9 A;  3MA2 A;  1G9K A;  4XM8 A;  3B2Z A;  3F16 A;  2RJP A;  1BKC I;  1BM6 A;  3LQB A;  3LQ0 A;  1C3I A;  1XUD A;  4GWM A;  1BKC A;  3DNG A;  3EHY A;  3TS4 A;  1MMQ A;  1UTT A;  2A8H A;  1D8M A;  2J0T A;  1HOV A;  1CAQ A;  1FBL A;  1GO8 P;  2I47 A;  2TCL A;  3EDG A;  1O0Q A;  3LUM A;  3KHI A;  1USN A;  1GXD A;  5JMY A;  3DTI A;  1SLM A;  2OXU A;  3K7L A;  4I35 A;  3ZVS A;  3BA0 A;  2DDF A;  4WK7 A;  2FV5 A;  4WKI A;  2W13 A;  1Z3J A;  3DPF A;  3O2X A;  2AYK A;  3LMC A;  3V96 B;  1QJJ A;  1YQY A;  1G05 A;  2YIG A;  5I2Z A;  4JP4 A;  2OW1 A;  3LE9 A;  3N2U A;  3E8R A;  1Q3A A;  2N8R A;  1R1J A;  2K2G A;  1PWV A;  3LKA A;  5B5P A;  1QIA A;  1XAX A;  1BQO A;  1QUA A;  2WOA A;  4G0D A;  3SHI A;  2ERP A;  3LJZ A;  3USN A;  5L7F A;  1CGL A;  4XBH A;  1BUD A;  3I7I A;  5CZM A;  4WKE A;  4FVL A;  4WZV A;  4H49 A;  3LJG A; 
#chains in the Genus database with same CATH homology
 2OVZ A;  3GBO A;  1AF0 A;  3HY7 A;  1JKY A;  2MLR A;  3EDH A;  2W15 A;  4Q1L A;  3F18 A;  1XFV A;  2X3A A;  1IAC A;  1IAB A;  3LJT A;  5I0L A;  3WV1 A;  4XCT A;  1YOU A;  1A85 A;  4XM6 A;  1JIW P;  3Q2G A;  1GO7 P;  2JSD A;  4IJO A;  4A7B A;  4AXQ A;  1I1I P;  1G4K A;  2MLS A;  4J4M A;  4QKZ A;  1HFS A;  3UVC A;  3L0V A;  2X3B A;  4L6T A;  2Y6C A;  4GWN A;  4GR8 A;  1OS2 A;  4DPE A;  1XFY A;  1B3D A;  1HTD A;  1GE7 A;  2FV9 A;  4GQL A;  4L7A A;  1QIC A;  2V4B A;  1ATL A;  5B5O A;  2DDY A;  3LIL A;  1SRP A;  3OHL A;  3HBU P;  2J83 A;  1XFZ A;  1RM8 A;  2ERO A;  2K9C A;  1I73 A;  1BSW A;  2XS4 A;  1DMT A;  1PWU A;  1H71 P;  2O36 A;  4H84 A;  3WV3 A;  1L6J A;  3G42 A;  1CK7 A;  4AIG A;  3VI1 A;  1SAT A;  2KRJ A;  1C7K A;  4HMA A;  2DW0 A;  4A3W A;  1XUC A;  4G9L A;  1JAO A;  2JT6 A;  1Y0V A;  3LIK A;  2YB9 A;  1KUF A;  1UTZ A;  4PKU A;  3KEK A;  5I4O A;  3ZUK A;  2D1N A;  3LEA A;  1GKC A;  3KME A;  3LK8 A;  4L19 A;  3WV2 A;  2W12 A;  2XS3 A;  3DTK A;  1AKL A;  1PWQ A;  1OM7 A;  1A86 A;  5LAB A;  5D2B A;  1ROS A;  3RTT A;  3L0T A;  3HYG A;  3ELM A;  2OXW A;  4GF1 A;  3NX7 A;  1XUR A;  5L79 A;  5D1U A;  2USN A;  2E2D A;  1K7I A;  4I03 A;  1IAG A;  1XFU A;  4L63 A;  5I3M A;  1J7N A;  1IAE A;  1Y8J A;  4EFS A;  3EDI A;  1CGE A;  4JPA A;  4CTH A;  1EUB A;  1YP1 A;  1CQR A;  4PKR A;  830C A;  5BOY A;  2DW1 A;  4JA1 A;  4AYK A;  4PKT A;  2DW2 A;  1KAP P;  2L0R A;  3DWB A;  3AIG A;  2OY4 A;  1JAP A;  4R3V A;  3ZXH A;  1QIB A;  1ZP5 A;  1KUI A;  2W14 A;  1R54 A;  1KUK A;  1WNI A;  1BQQ M;  1KUG A;  3HB2 P;  4DF9 A;  3B8Z A;  1D8F A;  1ZVX A;  1GKD A;  1SU3 A;  3KRY A;  1HV5 A;  3DTE A;  1B8Y A;  1CGF A;  1D5J A;  1S4B P;  1UEA A;  3KEJ A;  1OM8 A;  1G12 A;  4AUO A;  1SLN A;  4FXQ A;  1BKC E;  3HY9 A;  1MMR A;  2MZI A;  1OM6 A;  2MZE A;  5CXA A;  1OS9 A;  3RTS A;  4IN9 A;  4FU4 A;  3P1V A;  2Y6D A;  1ZTQ A;  2OVX A;  1EB6 A;  1G49 A;  1R1H A;  2WO8 A;  5D1T A;  5I12 A;  2YUF A;  4ZR5 A;  1QJI A;  3OHO A;  5D7W A;  4DV8 A;  1FLS A;  1XFW A;  1EAK A;  3DL1 A;  3F19 A;  1JJ9 A;  2OW0 A;  3TSK A;  1HFC A;  4ON1 A;  2MZH A;  1BZS A;  1PWW A;  2E3X A;  2OXZ A;  2QPJ A;  4PKQ A;  1YCM A;  2JT5 A;  5H8X A;  3I7G A;  1UMS A;  4DD8 A;  3EHX A;  4H1Q A;  3F17 A;  3EWJ A;  1BIW A;  4PKW A;  3TVC A;  5BOT A;  1BUV M;  5I43 A;  1DTH A;  4JQG A;  2OZR A;  3G5C A;  1R55 A;  1MMP A;  3HDB A;  2HU6 A;  4PKS A;  1ZXC A;  2CLT A;  4FXY P;  3KEC A;  1Y93 A;  456C A;  4H30 A;  1GE5 A;  2JIH A;  3Q2H A;  3K7N A;  966C A;  2ERQ A;  4ILW D;  1KUH A;  4HX3 A;  4H3X A;  2X3C A;  3LUN A;  1O0T A;  1CIZ A;  1CXV A;  1RMZ A;  2OY2 A;  4PKV A;  3HDA P;  1FM1 A;  2Z2D A;  2W0D A;  4GR3 A;  2POJ A;  1MMB A;  1ND1 A;  1JH1 A;  3AYK A;  2X7M A;  2CKI A;  3F15 A;  3LIR A;  1PWP A;  5D1S A;  1C8T A;  1ZS0 A;  3LGP A;  4WF6 A;  1GE6 A;  3P24 A;  1AST A;  1K7G A;  5BPA A;  3O64 A;  1K7Q A;  5D3C A;  4IUW A;  1AYK A;  4GR0 A;  3U1R A;  4XM7 A;  2SRT A;  1OMJ A;  3KWV C;  1UMT A;  3F1A A;  2JNP A;  2RJQ A;  4H76 A;  2O3E A;  3DPE A;  2AIG P;  4GUY A;  5CUH A;  4H82 A;  2OI0 A;  1OO9 A;  1I76 A;  2OW9 A;  1HY7 A;  2D1O A;  1D7X A;  3EDZ A;  1JIZ A;  3DSL A;  3AYU A;  1JAQ A;  1JAN A;  2OW2 A;  1MNC A;  2PJT A;  1R1I A;  1SMP A;  3HBV P;  1KBC A;  1ZXV A;  3N2V A;  1JK3 A;  3KMC A;  3CKI A;  1XFX A;  4H2E A;  1IAD A;  4JIJ A;  3VTG A;  1IAA A;  3TT4 A;  3B92 A;  2WO9 A;  3MA2 A;  1G9K A;  4XM8 A;  3B2Z A;  3F16 A;  2RJP A;  1BKC I;  1BM6 A;  3LQB A;  3LQ0 A;  1C3I A;  1XUD A;  4GWM A;  1BKC A;  3DNG A;  3EHY A;  3TS4 A;  1MMQ A;  1UTT A;  2A8H A;  1D8M A;  2J0T A;  1HOV A;  1CAQ A;  1FBL A;  1GO8 P;  2I47 A;  2TCL A;  3EDG A;  1O0Q A;  3LUM A;  3KHI A;  1USN A;  1GXD A;  5JMY A;  3DTI A;  1SLM A;  2OXU A;  3K7L A;  4I35 A;  3ZVS A;  3BA0 A;  2DDF A;  4WK7 A;  2FV5 A;  4WKI A;  2W13 A;  1Z3J A;  3DPF A;  3O2X A;  2AYK A;  3LMC A;  3V96 B;  1QJJ A;  1YQY A;  1G05 A;  2YIG A;  5I2Z A;  4JP4 A;  2OW1 A;  3LE9 A;  3N2U A;  3E8R A;  1Q3A A;  2N8R A;  1R1J A;  2K2G A;  1PWV A;  3LKA A;  5B5P A;  1QIA A;  1BQO A;  1QUA A;  2WOA A;  4G0D A;  3SHI A;  2ERP A;  3LJZ A;  3USN A;  5L7F A;  1CGL A;  4XBH A;  1BUD A;  3I7I A;  5CZM A;  4WKE A;  4FVL A;  4WZV A;  4H49 A;  3LJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...