3EI0A

Structure of the e221a mutant of the gloebacter violaceus pentameric ligand gated ion channnel (glic)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYAANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a potentially open state of a proton-activated pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein
molecule keywords Glr4197 protein
total genus 79
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3ei0A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3ei0A01
3UU5A 4XHEA 5HEHA 5BP0A 2BYPA 3ZDHA 1I9BA 5AFMA 4ILCA 4ALXA 2UZ6A 4UM3P 2M6BA 4ZK4A 2XQ9A 2BYRA 4ZR6A 4Z91A 2BG9B 3SQ6A 2BYNA 3RHWA 4B5DA 5HEGA 4AFGA 3WTMA 4IL9A 4COFA 4F8HA 3C84A 2PGZA 4PIRA 4ZJTA 4NZBA 5FJVA 2Y57A 2XQ5A 4UY2A 3T4MA 2WN9A 3TLSA 2XQ7A 2LKHA 1OEDC 2LKGA 3UQ7A 4ZZCA 1UW6A 4EZ1A 5CO5A 5J0ZA 2YN6A 2XQ3A 4A97A 5HEJA 2XZ5A 3WTLA 4LMKA 4LMJA 3EI0A 1OEDA 1OEDE 1UX2A 5L4HA 2WNLA 2WZYA 3SIOA 5AFNA 5BW2A 2WNJA 5AINA 5LXBA 4TWHA 3P4WA 3ZKRA 1UV6A 2QC1B 5HCMA 5TVCA 3ZDGA 2X00A 4DBMA 4ILAA 4HFHA 2KSRA 4NPPA 2XQ4A 2BYSA 3TLVA 4A98A 4HFDA 2MAWA 5J5GA 4QAAA 4QABA 2XNVA 3PEOA 2BG9A 2BG9E 2M6IA 4TNWA 5J5IA 4ZK1A 3WTOA 3UU4A 2XNTA 2XQ8A 5IUXA 4TWFA 2PH9A 3U8MA 4UM1A 2BYQA 5HCJA 4Z90A 3JADA 2BR7A 2XNUA 2XZ6A 3EAMA 1OEDB 2LM2A 4HFBA 2WNCA 2XYSA 3WTNA 4D01A 5J5HA 3RIAA 2X00D 2YMDA 5BRXA 3UU8A 4HQPA 4FRRA 4QACA 3WTKA 5CFBA 3SQ9A 2YMEA 3TLUA 3WTJA 4AFHA 3SH1A 2VL0A 2BJ0A 2W8GA 3UU6A 2XQ6A 4X5TA 3JAFA 2XYTA 5HEOA 4UXUA 5AFLA 5KZUA 4IL4A 2ZJVA 5SYOA 3RQWA 3LSVA 5HEUA 2Y56A 4BFQA 3EHZA 5LG3A 2ZJUA 3RIFA 4QH1A 3C79A 3UQ4A 4QH5A 4HFEA 4BQTA 4HFIA 3WTHA 2LLYA 4UM3S 2YOEA 4HFCA 5L47A 3JAEA 5AFMB 4ZRUA 5AFKA 4ILBA 4TWDA 2Y58A 3U8JA 4QH4A 3RI5A 2BR8A 2W8FA 4UM3A 3PMZA 2BG9C 3UU3A 2YKSA 3P50A 4TNVA 4LMLA 5AFJA 3UUBA 5L4EA 3WTIA 4IREA 2Y54A 3U8KA 3RQUA 5KE4A 5J5FA 4ZZBA 2XQAA 4ZJSA 2C9TA 4XK9A 3U8LA 4AFTA 5AFHA 3IGQA 3TLWA 5JMEA 3TLTA 4WV9A 2Y7YA 3WIPA 3GUAA 3U8NA
chains in the Genus database with same CATH superfamily
2CPTA 2UUCT 3E0ZA 5BP0A 4ILCA 4ANJA 2BYRA 2DWGA 4YLHA 3ZPOA 4IE0A 4QXCB 3LK2B 3ZT6A 2BVLA 2V6YA 3FZHB 2LKGA 2MTQA 4KP3C 1T98A 5LA6E 5F8PA 3I1AA 1BR4A 3MXZA 5AQHB 1OWAA 2VKOA 2FJDA 1UX5A 3G06A 2UUAT 4HFHA 4DV7T 4ZS3A 4KHPT 2BDEA 5LJNA 3QK6A 3ZMUB 2WB5A 2X9WA 1JNRA 1LKXA 5AQMB 4ZI3C 3DP7A 3RYCE 5LXTE 2XJ7A 3AA0B 1YD8G 4ZOLE 2YMDA 3AE8A 5KX5E 5IWAT 2VL0A 2W8GA 3HKDE 2L8KA 5FVKA 5HXRA 4CXWA 3RQWA 3LSVA 4HTEA 4JI2T 3EHZA 3WTHA 2XAFB 4OYJA 2H3RA 3AVRA 3PUSA 5L47A 2LJLA 2XM2A 1DU2A 2V7MA 1WCRA 3F57A 2LSYA 3MACA 3RQUA 1VCSA 5J5FA 2XQAA 3ZC0A 2IHR1 2NOXA 5CA1E 4YT0A 3TLWA 2VQFT 3KVBA 4EXTA 2EHOB 2BS2A 3HKCE 3U8NA 3UFGA 4DR1T 4H9QC 3AECA 2HPLA 2UUBT 4YTNA 3AEDA 4DVDA 3PUAA 1UURA 2XQYA 4ZS2A 4PK4A 1UW6A 2MYSA 2WDQA 5FVLA 3C4WA 5AFNA 5AFUL 3P4QA 2VL8A 2KSRA 2BZBA 2XQ4A 4AXPA 5KMGP 4QAAA 3T8OA 1IJ6A 2XPKA 1NENA 3UTKA 4JUYA 4JV5T 2ZLYA 4L0RA 4CI3B 2WMNA 1XMQT 4BJNA 2KZ7B 3FXDB 3PE0A 4CQIA 2CXFA 5CFBA 2XQ6A 3SRZA 2XYTA 2MOZA 3N2OA 5KDMC 5DABA 3X1DA 4DO0A 5HEUA 4C91A 3ANWA 2CE7A 4KX6A 4AQFC 4IDOA 2LE8A 2LLYA 4EAHA 2E5LT 4IE6A 2W2UA 2NW9A 1KNRA 4G63A 4HWIB 5JR9B 4OFZA 4O2BE 3N5LA 4LMLA 2W67A 5L4EA 3UUNA 4AKIA 1YQ4A 3MA9A 3O1JA 3FXEB 3U8KA 2LHRA 3BQLA 2C9TA 3LJCA 3IGQA 2BBHA 5LMUT 1IJ5A 3CKDA 5L3CB 4ZI2C 2CEAA 1HR0T 4WZXA 4UM3P 2MBGA 2LHNA 4YXDA 2BYNA 1MMGA 3RLFF 4TV8E 2XQ5A 3HKEE 1OEDC 4PJLA 2DNXA 4EZ1A 3RRCA 5LCYA 4U7YA 2A3DA 2LSJA 2UXNB 2KWIB 3ZKRA 1G73A 4ILAA 4CXXA 4H63V 3AE5A 4XAXB 1L0VA 5AQJB 1D0ZA 3CQCB 3ETUA 5AQSB 1HNZT 2BYQA 2JMHA 1AJ3A 1I6ZA 3HA4A 3C4ZA 2R6GF 4P0BA 5BRXA 5JREA 3OYZA 1X9BA 5FXXA 5GONE 3UFEA 3AEBA 4HGAA 4X20E 5SYOA 3K3OA 1KF6A 2LSGA 3IBPA 1VRBA 1O3XA 5LMNT 4G2AA 2JQKA 2Y58A 3AEFA 2BG9C 1HS7A 2P9BA 4U3CA 5JTGA 3FBLA 3NRYA 2L9QA 4JI5T 2ZM6T 5JDGA 2H88A 4I55E 2E8IA 1HG2A 3ZT7A 1I9BA 3RIUA 2BS3A 4JEUB 2YINA 4Z91A 2H7OA 3CWZB 1UK5A 1IBMT 4HWFA 1R8IA 3N9NA 5EK2A 2OLTA 2XQ3A 4B3MT 2XZ5A 1SUMB 3QUJA 3ZC1A 1CUNA 2DCFA 4UVCB 5HXCA 4TWHA 2K9AA 2WSSV 4ISSA 2YEVC 2BYSA 1J5WA 5LBQB 5JRCA 4HFDA 1B7TA 2M6IA 4ZK1A 1XDOA 3FZMB 2C5JA 3WTOA 3NWIA 4UM1A 2E9XC 2BR7A 5JDNA 1FIOA 4DV2T 1V9DA 3MKDA 3N2GE 5HAXA 3LG7A 5L3FB 4BFQA 1W9RA 2CCQA 2PG8A 2WY2A 4GK0E 5AFKA 4TWDA 4LF8T 4UM3A 2JQQA 2Y8DA 2YKSA 4DV6T 4EEBA 2B76A 2D2SA 4DNDA 5LNKA 3V5UA 2W63A 1D0XA 1HG5A 4YHJA 4I50E 4CZZB 2WAUA 4EZ4A 3BQKA 4ALXA 3RPUA 4ZK4A 4Q25A 5HWYA 4NXMT 4WYVA 3ZLIA 5DQVA 2ODUA 1S94A 2XQ7A 1FMVA 4CN6A 4KUMB 2WP9A 2V8SV 5C2TA 2XUEA 2QC1B 3V5SA 4NPPA 2PJQA 2MAWA 4YTPA 1OXZA 5FXWA 3Q5EA 3AE9A 3HR0A 4UVAB 3RC8A 3JADA 3AA1B 3NBXX 2QYWA 4HQPA 2JRKA 4LFAT 4MLKA 3TLUA 4GKJT 2CM0A 4YHHT 3O4XE 1XMOT 1S35A 4ZEYA 2LRKA 2VVNA 5LG3A 1LRZA 4UM3S 4GK5E 3JAEA 2DLRA 3J9X1 3HKBE 1EZ3A 3GN5B 3K1SA 2Y54A 3T1HT 4B3ST 4ZZBA 3AEAA 1XZYA 2NTYA 3JCFA 4AFTA 4QWNB 4GIWA 3W15B 2IDOB 5IYZE 2BBJA 5HXHA 3H3AA 4YJ2E 4DMWA 2A9UA 4LFBT 4EV6A 5HEHA 2XZEA 5JDQA 3O1HA 3I9WA 1WLXA 4PFPA 3C84A 1D1AA 2XTLA 4U74A 3I0QA 4L5GA 4PW8A 2Q9QB 4M1PA 1N36T 2E5VA 4P09A 3AEGA 5HXEA 2WZYA 3SIOA 3BK9A 2WNJA 5H6QB 1UV6A 4UXNB 2XSAA 3ZDGA 4AI6A 2XSBA 3KINB 5AQTB 3UU4A 1MIWA 3CK6A 2XAJB 5ABGA 3TKLB 2FJBA 2XNUA 4IIJE 2LM2A 4UF0A 2WNCA 2WMOA 2CRBA 3OBVE 2YMEA 4C90A 3A5XA 1NWMX 2BJ0A 5LHHB 2FBWA 4DBQA 4IDQA 3L39A 4NIQA 4HKAA 2V5CA 1NEKA 2IC9A 5LB7B 1UX4A 4WBOA 2BR8A 2KXPB 3AE4A 1KEYA 5CGMA 3IF8B 3CQXC 2K5BB 2BVMA 1H7CA 3KFWX 2J62A 4DIDB 2M67A 2Y7YA 4UR9A 4B3TT 2LRLA 4HFVA 4J2CA 1UCUA 4CI1B 2CHNA 1U5PA 4PFOA 2KLQA 3CPZA 2J1DG 3I0OA 3WTMA 2CHOA 5HXSA 3ZT5A 2QRXA 2XAQB 4EYUA 4BA9A 3EI0A 1D1CA 1W0BA 3RYFE 2A2FX 5HCMA 2UXCT 3PU8A 5TVCA 1NAFA 1YW0A 4A98A 1BR2A 3UULA 3PUGA 5ABFA 4IDZA 4MALA 4Z90A 4N78D 4JBWF 2UXXB 5FYMA 3AXJA 3PUWF 2Y56A 4DV0T 3FZLB 1N32T 4PJNA 5J2TE 4IE5A 3OYXA 3ZSSA 4ILBA 2WWUA 3VU7H 3RI5A 5C3JA 2ZM0A 3GN5A 3Q9DA 4IGUA 4EB6E 3ONXA 4H9SE 2LM9A 2W0GA 2XAGB 3VR8A 2BS4A 2X9HA 4XK9A 2KMFA 3R6NA 5BR8T 4WV9A 3PUYF 3GUAA 4XHEA 4DR5T 3P7IA 3O9XA 3L3PA 2BG9B 4XZCA 3R84B 5HEGA 4COFA 2NWBA 4UY2A 2WN9A 1ZP0A 2XHEB 5JRCB 3P4SA 3WTLA 4LMKA 1WR0A 2VVSA 4ZXLA 5L3EB 3M3ZB 2LOPA 4HEAA 1MMNA 3C4XA 4I0UA 3RYHE 3PEOA 4AIUA 4I43B 2V5DA 4TWFA 2QVAA 3CX6B 3AE7A 5J1GA 2GK9A 4AKHA 1IAPA 1OEDB 3EABA 3KV4A 3H3MA 5FKYA 2VB6A 1N33T 3UU8A 4NUVA 3IEEA 3D0TA 3PUQA 4UXUA 5ADXL 1XDPA 3E08A 3ONLC 4B3RT 5ABHA 4DUYT 1T7SA 4MFRA 2E9XD 2WDRA 4IDNA 2E9XB 5AFMB 1U4QA 5ETWA 1HFAA 3CX7B 3P8CD 4TNVA 2XM1A 3OVUA 3PURA 4YFSA 3CVRA 2V6XA 5KE4A 2C5IT 3ZSTA 3QB5K 2BKOA 2X0LB 1E2AA 4ASKA 1SHZC 2H89A 5BMVE 4ERRA 2M6BA 5AQFB 3SQ6A 2W62A 3L09A 3O1IA 5HYAA 4ZJTA 3N9LA 3RIUC 5L2LA 5FJVA 4LFCT 4O4HE 1W0AA 3OKQA 4H63H 4ZZCA 2CXDA 4P1NA 3GWHA 5FXVA 1LVKA 5AINA 1QSDA 2KNDA 4DBMA 3BQIA 3UT5E 3K3NA 1QLBA 1YQ3A 2BG9A 2BG9E 3N9PA 2BKPA 2XNTA 2JPFA 2XQ8A 3J7Yq 4L9IA 2Z6EA 1E1HB 3GMIA 3WTNA 4DMVA 3ZN0B 3ZEFB 3SWHA 2X00D 1BR0A 4YJ3E 4CI2B 3SQ9A 4AFHA 3ZYKA 4YTMA 3PU3A 2D9DA 4O4LE 5HEOA 2Q9QC 2N9DA 2LSIA 2WBLA 3AE3A 2V26A 5FL1A 3RIFA 2UXBT 3C79A 2F4VT 3F31A 1HNXT 3CX8B 2CMRA 2KT9A 4UELA 2HN1A 2HN2A 3M65A 2V7IA 5AQNB 4U72A 2UU9T 4YSYA 4U2ZA 5KXJA 2YDSA 4KMCA 4TUYE 4YY3T 4UV8B 4ADZA 5AFHA 2RPAA 4QKNA 3N9QA 1WFDA 1HNWT 5AQIB 2PBIA 3UU5A 2WU2A 4WBNE 4GYSA 2X9XA 3RGLA 4DR3T 5FP3A 5ABFB 3WAJA 1HF8A 3QOFA 2D5UA 4ISTA 4O8SA 4ZI7E 4F8HA 1M62A 1US7B 5LHIB 3AE6A 4A97A 4LF6T 4TV9E 1UX2A 3NRXA 5EK4A 2CWOA 2I59A 4FI5A 4EIWA 2YDQA 4A5XA 3H37A 1IZNB 1T72A 4JLEA 3PUZF 4PK6A 4QXBB 3SOLA 5E0OA 4H9PC 4FJOA 4EOZB 5H6RB 2XYSA 4TX5A 2DI4A 4CN4A 3F2EA 1FMWA 2QA7A 4IL4A 4ZI3D 3RF1A 3MK7C 2YU1A 3B5MA 4BQTA 4K0KT 3ZCJA 4IHJE 3U8JA 1XNQT 1I94T 2W8FA 4LF5T 3ZJ1A 3FZFB 5CA0E 4HE8A 4K0UA 5F3JA 4HWCA 5FNVE 4AQFA 4OX9T 3MZKB 3FZKB 3U8LA 3RKOA 5JDMA 2W66A 4DR4T 4B6XA 4IDPA 2RA1A 5AQKB 3EVYA 2FUPA 2KINB 3A8YC 3FHNA 4B5DA 2ES0A 5CJ5A 4GOUA 3I9YA 2LKHA 5AQQB 5AQPB 2LOSA 2XASB 5J0ZA 1HX1B 2LSKA 4AKGA 3KBUA 5L4HA 2WNLA 5BW2A 5FMNA 2Q9QA 2VKJA 4PJJA 2V7LA 3ESLA 3ZJ2A 2HPJA 3OPCA 3C50A 3P4PA 1JNZA 4OYKA 2B1EA 4QHOA 1BR1A 4BJMA 4ZI2D 1ZKEA 4PK5A 4X1KE 1HX8A 4FRRA 3RH3A 2W61A 4TZ4C 3QB5A 3JAFA 1IBKT 2X0YA 3C64A 3OJAA 2WZIA 2Y6XA 1D0YA 4JI3T 4V1Av 4CN1A 1W09A 2L3LA 2X66A 4PJMA 1WR6A 3OTOT 4IT4A 3ZCIA 2W00A 4EZHA 3PMZA 2IMLA 3KBTA 3GA8A 4OHFA 4DV1T 2CLYC 2J4GA 5ABEA 3IA3A 5LJMA 5C8YE 2YK0A 3KV9A 4DV4T 5L3GB 3ZDHA 4JYAT 3E22E 2C5KT 3PJAJ 5AQLB 2PGZA 2ZMAA 2NW8A 4UEMA 4JI4T 3T1YT 5CO5A 2H7VC 4PAGA 5HEJA 2X68A 4YSZA 3PTRB 3VR9A 1X79A 5JQGE 5FXZA 2JMKA 5A1LA 2VQET 3TLVA 4HWHA 5JDLA 4O4JE 3RYIE 3NVOA 4HWDA 5IUXA 4JI7T 3ZMTB 4U31A 2XZ6A 3EAMA 1MMAA 4HFBA 5J5HA 1GQEA 2AXDS 4AQYT 3Q2MA 4QXHB 3WTJA 3MJXA 2V7KA 4X5TA 1ZEEA 5AFLA 1IBLT 2UXDT 2ZJUA 2CBJA 3EUHA 5AQOB 3VRAA 4QH1A 3WI3A 2E9XA 4HFCA 4ZRUA 2AE9A 4QX7B 2WZHA 4GYRA 2ODVA 4KHZF 2IAKA 3N9OA 4AQGA 2JIWA 3EDVA 5LG4A 3B57A 3AAAB 3ZYMA 5LGTB 3LBXB 3TLTA 3SFEA 4JEHB 2HH7A 4YSXA 4UIGA 3WAKA 5JR9C 1VOMA 2K48A 2JQHA 2XQ9A 2QGSA 2ZM8A 5FY0A 4ZHQE 4KBMB 3ETVA 3CIRA 2IUBA 2MPKA 4LMJA 4PNIA 3AB3B 3DTOA 5FL0A 5LXBA 2XY8B 4IE4A 4EEDA 4DV5T 1T8BA 4MBQA 3U8MA 2JJ9A 2CBIA 3RKGA 3LBXA 5HCJA 4NUUA 2WS3A 4JI1T 3NZPA 2CXLA 3C98B 2CA5A 5LGUB 4ILUA 4F6RC 4X64T 4X62T 5M4YA 3DJBA 2Q9QD 2VKHA 3LK3B 2VWAA 3U3IA 4AISA 4LF7T 2G0UA 2E2AA 2D0UA 3VHLA 4X66T 3UQ4A 2YDRA 2BKNA 2JQ9A 1CHUA 4QH4A 3P50A 2V7JA 4X1YE 3UUBA 4GKKT 2Y48B 3FB2A 3Q5XA 3FBZA 4IREA 3L8RA 2YU2A 2I6HA 3U78A 3S4UA 5JMEA 3SS1A 1KNPA 3RX6A 2EHOD 1Y64B 1D1BA 3AEEA 2BYPA 3PUVF 2UZ6A 2V1DB 3AVSA 2CLYB 2CWYA 3TLSA 5CB4E 3UQ7A 1YKHB 4JI0T 2YN6A 4X65T 5HWXA 2WU5A 3RC3A 3P4WA 5DQWA 4EGWA 2WM9A 3KDSE 3VRBA 4U7IA 4H9NC 4QABA 2XNVA 2N2NA 1LVFA 2X9YA 5AQGB 5F5WA 4D01A 2DWKA 4Z8XA 3RIAA 3LDQB 4QACA 3WTKA 2SPCA 1MIYA 3SH1A 3UU6A 1YKEB 3AE1A 2EHOA 2WWVA 4CXYA 3HL6A 5EZYE 2PTFA 3AAIA 5JR9A 3IHRA 4HN9A 5FY7A 4QH5A 2ACZA 4HFEA 1KNZA 1UUSA 2OV9A 4IE7A 5TAOA 1N34T 4XBFB 4UVBB 1KK7A 3ANWB 3UU3A 3UUXB 5AFJA 5J2UE 3WTIA 2W4XA 1WYBA 2XAHB 3ZYLA 2NTXA 2HHHT 1G8XA 3ZMSB 3KVAA 2C0SA 3WIPA 1XWMA 1MMDA 1FEWA 2VK9A 3EDUA 4LF9T 2J47A 4E7ZA 5AFMA 4E7SA 2D0TA 4AFGA 4PIRA 5L3DB 3AA6B 3PDYA 5DJQC 3T4MA 2NP9A 4DR7T 2RP4A 1HCIA 1FJGT 5LYJE 1Z8UA 1SA0E 2DHRA 4KI0F 2IIUA 2X00A 5LOVE 2VKDA 4DR2T 3KV5A 2K24A 3ZMZB 4AKLA 3NZQA 4TNWA 5J5IA 4DBRA 5IHYA 2I0MA 2X51A 3KV6A 4AKRB 1WRDA 3PUXF 5AQUB 3RRWA 1MIVA 2NR4A 3HI2A 1UGOA 4JI6T 2FJAA 2K3WA 2LT3A 3LFMA 1MNEA 2WQYA 1ZOYA 3AAEB 5AQRB 4P0AA 4TN7B 2DL1A 1HTJF 2ZM2A 3B13A 4U2YA 2PFVA 5LBMA 3C51A 3NKZA 4H9RC 4UF0B 2IW5B 2ACXA 1J5ET 3ABVA 1KFYA 3K8PC 4I4TE 1VCTA 1MNDA 2OA5A 4O2AE 3PV0F 5FY1A 2KWHA 2VURA 4ZR6A 3RHWA 4IL9A 3AXJB 4NZBA 4BAYB 2Y57A 1Z0PA 3A7MA 4WNKA 3UUMA 5LGNB 2WCAA 1Y01A 1OEDA 1OEDE 2IC6A 3PJAA 3LK42 4DV3T 3ZMVB 3SFDA 5AQVB 4NXNT 5J5GA 5LP6E 3ONJA 5JDFA 3CQGB 4DUZT 4QX8B 2PH9A 2LEHA 3CMLA 3VKHA 2NW7A 1SE7A 3Q5DA 2V6YB 4WW0A 5JVDE 3Q5WA 3JC6D 3AE2A 4UV9B 4MHCA 2EHOC 4EYYR 3N9MA 4LF4T 1ZHCA 3JC6C 4JI8T 3QC9A 1ZV4X 1WYCA 1YXRA 4U33A 2X0HA 1XNRT 5KZUA 4DR6T 2ZJVA 3K3QC 5LHGB 2A72A 2WDVA 3N2KE 3VKGA 5L3BB 4X1IE 3ZN1B 3P4RA 4HFIA 2X67A 2YOEA 4A56A 1J1JA 1QUUA 4H9OC 1M7KA 2N1GA 2FJEA 4OK0A 4ZJSA 5EK3A 4O4IE 5JDHA 3QNUA 1E7PA 2VASA 5JH7E 3AA7B
chains in the Genus database with same CATH topology
3UU5A 4XHEA 5HEHA 5BP0A 2BYPA 3ZDHA 1I9BA 5AFMA 4ILCA 4ALXA 2UZ6A 4UM3P 2M6BA 4ZK4A 2XQ9A 2BYRA 4ZR6A 4Z91A 2BG9B 3SQ6A 2BYNA 3RHWA 4B5DA 5HEGA 4AFGA 3WTMA 4IL9A 4COFA 4F8HA 3C84A 2PGZA 4PIRA 4ZJTA 4NZBA 5FJVA 2Y57A 2XQ5A 4UY2A 3T4MA 2WN9A 3TLSA 2XQ7A 2LKHA 1OEDC 2LKGA 3UQ7A 4ZZCA 1UW6A 4EZ1A 5CO5A 5J0ZA 2YN6A 2XQ3A 4A97A 5HEJA 2XZ5A 3WTLA 4LMKA 4LMJA 3EI0A 1OEDA 1OEDE 1UX2A 5L4HA 2WNLA 2WZYA 3SIOA 5AFNA 5BW2A 2WNJA 5AINA 5LXBA 4TWHA 3P4WA 3ZKRA 1UV6A 2QC1B 5HCMA 5TVCA 3ZDGA 2X00A 4DBMA 4ILAA 4HFHA 2KSRA 4NPPA 2XQ4A 2BYSA 3TLVA 4A98A 4HFDA 2MAWA 5J5GA 4QAAA 4QABA 2XNVA 3PEOA 2BG9A 2BG9E 2M6IA 4TNWA 5J5IA 4ZK1A 3WTOA 3UU4A 2XNTA 2XQ8A 5IUXA 4TWFA 2PH9A 3U8MA 4UM1A 2BYQA 5HCJA 4Z90A 3JADA 2BR7A 2XNUA 2XZ6A 3EAMA 1OEDB 2LM2A 4HFBA 2WNCA 2XYSA 3WTNA 4D01A 5J5HA 3RIAA 2X00D 2YMDA 5BRXA 3UU8A 4HQPA 4FRRA 4QACA 3WTKA 5CFBA 3SQ9A 2YMEA 3TLUA 3WTJA 4AFHA 3SH1A 2VL0A 2BJ0A 2W8GA 3UU6A 2XQ6A 4X5TA 3JAFA 2XYTA 5HEOA 4UXUA 5AFLA 5KZUA 4IL4A 2ZJVA 5SYOA 3RQWA 3LSVA 5HEUA 2Y56A 4BFQA 3EHZA 5LG3A 2ZJUA 3RIFA 4QH1A 3C79A 3UQ4A 4QH5A 4HFEA 4BQTA 4HFIA 3WTHA 2LLYA 4UM3S 2YOEA 4HFCA 5L47A 3JAEA 5AFMB 4ZRUA 5AFKA 4ILBA 4TWDA 2Y58A 3U8JA 4QH4A 3RI5A 2BR8A 2W8FA 4UM3A 3PMZA 2BG9C 3UU3A 2YKSA 3P50A 4TNVA 4LMLA 5AFJA 3UUBA 5L4EA 3WTIA 4IREA 2Y54A 3U8KA 3RQUA 5KE4A 5J5FA 4ZZBA 2XQAA 4ZJSA 2C9TA 4XK9A 3U8LA 4AFTA 5AFHA 3IGQA 3TLWA 5JMEA 3TLTA 4WV9A 2Y7YA 3WIPA 3GUAA 3U8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UU5 A;  4XHE A;  5HEH A;  5BP0 A;  2BYP A;  3ZDH A;  1I9B A;  5AFM A;  4ILC A;  4ALX A;  2UZ6 A;  4UM3 P;  2M6B A;  4ZK4 A;  2XQ9 A;  2BYR A;  4ZR6 A;  4Z91 A;  2BG9 B;  3SQ6 A;  2BYN A;  3RHW A;  4B5D A;  5HEG A;  4AFG A;  3WTM A;  4IL9 A;  4COF A;  4F8H A;  3C84 A;  2PGZ A;  4PIR A;  4ZJT A;  4NZB A;  5FJV A;  2Y57 A;  2XQ5 A;  4UY2 A;  3T4M A;  2WN9 A;  3TLS A;  2XQ7 A;  2LKH A;  1OED C;  2LKG A;  3UQ7 A;  4ZZC A;  1UW6 A;  4EZ1 A;  5CO5 A;  5J0Z A;  2YN6 A;  2XQ3 A;  4A97 A;  5HEJ A;  2XZ5 A;  3WTL A;  4LMK A;  4LMJ A;  3EI0 A;  1OED A;  1OED E;  1UX2 A;  5L4H A;  2WNL A;  2WZY A;  3SIO A;  5AFN A;  5BW2 A;  2WNJ A;  5AIN A;  5LXB A;  4TWH A;  3P4W A;  3ZKR A;  1UV6 A;  2QC1 B;  5HCM A;  5TVC A;  3ZDG A;  2X00 A;  4DBM A;  4ILA A;  4HFH A;  2KSR A;  4NPP A;  2XQ4 A;  2BYS A;  3TLV A;  4A98 A;  4HFD A;  2MAW A;  5J5G A;  4QAA A;  4QAB A;  2XNV A;  3PEO A;  2BG9 A;  2BG9 E;  2M6I A;  4TNW A;  5J5I A;  4ZK1 A;  3WTO A;  3UU4 A;  2XNT A;  2XQ8 A;  5IUX A;  4TWF A;  2PH9 A;  3U8M A;  4UM1 A;  2BYQ A;  5HCJ A;  4Z90 A;  3JAD A;  2BR7 A;  2XNU A;  2XZ6 A;  3EAM A;  1OED B;  2LM2 A;  4HFB A;  2WNC A;  2XYS A;  3WTN A;  4D01 A;  5J5H A;  3RIA A;  2X00 D;  2YMD A;  5BRX A;  3UU8 A;  4HQP A;  4FRR A;  4QAC A;  3WTK A;  5CFB A;  3SQ9 A;  2YME A;  3TLU A;  3WTJ A;  4AFH A;  3SH1 A;  2VL0 A;  2BJ0 A;  2W8G A;  3UU6 A;  2XQ6 A;  4X5T A;  3JAF A;  2XYT A;  5HEO A;  4UXU A;  5AFL A;  5KZU A;  4IL4 A;  2ZJV A;  5SYO A;  3RQW A;  3LSV A;  5HEU A;  2Y56 A;  4BFQ A;  3EHZ A;  5LG3 A;  2ZJU A;  3RIF A;  4QH1 A;  3C79 A;  3UQ4 A;  4QH5 A;  4HFE A;  4BQT A;  4HFI A;  3WTH A;  2LLY A;  4UM3 S;  2YOE A;  4HFC A;  5L47 A;  3JAE A;  5AFM B;  4ZRU A;  5AFK A;  4ILB A;  4TWD A;  2Y58 A;  3U8J A;  4QH4 A;  3RI5 A;  2BR8 A;  2W8F A;  4UM3 A;  3PMZ A;  2BG9 C;  3UU3 A;  2YKS A;  3P50 A;  4TNV A;  4LML A;  5AFJ A;  3UUB A;  5L4E A;  3WTI A;  4IRE A;  2Y54 A;  3U8K A;  3RQU A;  5KE4 A;  5J5F A;  4ZZB A;  2XQA A;  4ZJS A;  2C9T A;  4XK9 A;  3U8L A;  4AFT A;  5AFH A;  3IGQ A;  3TLW A;  5JME A;  3TLT A;  4WV9 A;  2Y7Y A;  3WIP A;  3GUA A;  3U8N A; 
#chains in the Genus database with same CATH topology
 2CPT A;  2UUC T;  3E0Z A;  5BP0 A;  4ILC A;  4ANJ A;  2BYR A;  2DWG A;  4YLH A;  3ZPO A;  4IE0 A;  4QXC B;  3LK2 B;  3ZT6 A;  2BVL A;  2V6Y A;  3FZH B;  2LKG A;  2MTQ A;  4KP3 C;  1T98 A;  5LA6 E;  5F8P A;  3I1A A;  1BR4 A;  3MXZ A;  5AQH B;  1OWA A;  2VKO A;  2FJD A;  1UX5 A;  3G06 A;  2UUA T;  4HFH A;  4DV7 T;  4ZS3 A;  4KHP T;  2BDE A;  5LJN A;  3QK6 A;  3ZMU B;  2WB5 A;  2X9W A;  1JNR A;  1LKX A;  5AQM B;  4ZI3 C;  3DP7 A;  3RYC E;  5LXT E;  2XJ7 A;  3AA0 B;  1YD8 G;  4ZOL E;  2YMD A;  3AE8 A;  5KX5 E;  5IWA T;  2VL0 A;  2W8G A;  3HKD E;  2L8K A;  5FVK A;  5HXR A;  4CXW A;  3RQW A;  3LSV A;  4HTE A;  4JI2 T;  3EHZ A;  3WTH A;  2XAF B;  4OYJ A;  2H3R A;  3AVR A;  3PUS A;  5L47 A;  2LJL A;  2XM2 A;  1DU2 A;  2V7M A;  1WCR A;  3F57 A;  2LSY A;  3MAC A;  3RQU A;  1VCS A;  5J5F A;  2XQA A;  3ZC0 A;  2IHR 1;  2NOX A;  5CA1 E;  4YT0 A;  3TLW A;  2VQF T;  3KVB A;  4EXT A;  2EHO B;  2BS2 A;  3HKC E;  3U8N A;  3UFG A;  4DR1 T;  4H9Q C;  3AEC A;  2HPL A;  2UUB T;  4YTN A;  3AED A;  4DVD A;  3PUA A;  1UUR A;  2XQY A;  4ZS2 A;  4PK4 A;  1UW6 A;  2MYS A;  2WDQ A;  5FVL A;  3C4W A;  5AFN A;  5AFU L;  3P4Q A;  2VL8 A;  2KSR A;  2BZB A;  2XQ4 A;  4AXP A;  5KMG P;  4QAA A;  3T8O A;  1IJ6 A;  2XPK A;  1NEN A;  3UTK A;  4JUY A;  4JV5 T;  2ZLY A;  4L0R A;  4CI3 B;  2WMN A;  1XMQ T;  4BJN A;  2KZ7 B;  3FXD B;  3PE0 A;  4CQI A;  2CXF A;  5CFB A;  2XQ6 A;  3SRZ A;  2XYT A;  2MOZ A;  3N2O A;  5KDM C;  5DAB A;  3X1D A;  4DO0 A;  5HEU A;  4C91 A;  3ANW A;  2CE7 A;  4KX6 A;  4AQF C;  4IDO A;  2LE8 A;  2LLY A;  4EAH A;  2E5L T;  4IE6 A;  2W2U A;  2NW9 A;  1KNR A;  4G63 A;  4HWI B;  5JR9 B;  4OFZ A;  4O2B E;  3N5L A;  4LML A;  2W67 A;  5L4E A;  3UUN A;  4AKI A;  1YQ4 A;  3MA9 A;  3O1J A;  3FXE B;  3U8K A;  2LHR A;  3BQL A;  2C9T A;  3LJC A;  3IGQ A;  2BBH A;  5LMU T;  1IJ5 A;  3CKD A;  5L3C B;  4ZI2 C;  2CEA A;  1HR0 T;  4WZX A;  4UM3 P;  2MBG A;  2LHN A;  4YXD A;  2BYN A;  1MMG A;  3RLF F;  4TV8 E;  2XQ5 A;  3HKE E;  1OED C;  4PJL A;  2DNX A;  4EZ1 A;  3RRC A;  5LCY A;  4U7Y A;  2A3D A;  2LSJ A;  2UXN B;  2KWI B;  3ZKR A;  1G73 A;  4ILA A;  4CXX A;  4H63 V;  3AE5 A;  4XAX B;  1L0V A;  5AQJ B;  1D0Z A;  3CQC B;  3ETU A;  5AQS B;  1HNZ T;  2BYQ A;  2JMH A;  1AJ3 A;  1I6Z A;  3HA4 A;  3C4Z A;  2R6G F;  4P0B A;  5BRX A;  5JRE A;  3OYZ A;  1X9B A;  5FXX A;  5GON E;  3UFE A;  3AEB A;  4HGA A;  4X20 E;  5SYO A;  3K3O A;  1KF6 A;  2LSG A;  3IBP A;  1VRB A;  1O3X A;  5LMN T;  4G2A A;  2JQK A;  2Y58 A;  3AEF A;  2BG9 C;  1HS7 A;  2P9B A;  4U3C A;  5JTG A;  3FBL A;  3NRY A;  2L9Q A;  4JI5 T;  2ZM6 T;  5JDG A;  2H88 A;  4I55 E;  2E8I A;  1HG2 A;  3ZT7 A;  1I9B A;  3RIU A;  2BS3 A;  4JEU B;  2YIN A;  4Z91 A;  2H7O A;  3CWZ B;  1UK5 A;  1IBM T;  4HWF A;  1R8I A;  3N9N A;  5EK2 A;  2OLT A;  2XQ3 A;  4B3M T;  2XZ5 A;  1SUM B;  3QUJ A;  3ZC1 A;  1CUN A;  2DCF A;  4UVC B;  5HXC A;  4TWH A;  2K9A A;  2WSS V;  4ISS A;  2YEV C;  2BYS A;  1J5W A;  5LBQ B;  5JRC A;  4HFD A;  1B7T A;  2M6I A;  4ZK1 A;  1XDO A;  3FZM B;  2C5J A;  3WTO A;  3NWI A;  4UM1 A;  2E9X C;  2BR7 A;  5JDN A;  1FIO A;  4DV2 T;  1V9D A;  3MKD A;  3N2G E;  5HAX A;  3LG7 A;  5L3F B;  4BFQ A;  1W9R A;  2CCQ A;  2PG8 A;  2WY2 A;  4GK0 E;  5AFK A;  4TWD A;  4LF8 T;  4UM3 A;  2JQQ A;  2Y8D A;  2YKS A;  4DV6 T;  4EEB A;  2B76 A;  2D2S A;  4DND A;  5LNK A;  3V5U A;  2W63 A;  1D0X A;  1HG5 A;  4YHJ A;  4I50 E;  4CZZ B;  2WAU A;  4EZ4 A;  3BQK A;  4ALX A;  3RPU A;  4ZK4 A;  4Q25 A;  5HWY A;  4NXM T;  4WYV A;  3ZLI A;  5DQV A;  2ODU A;  1S94 A;  2XQ7 A;  1FMV A;  4CN6 A;  4KUM B;  2WP9 A;  2V8S V;  5C2T A;  2XUE A;  2QC1 B;  3V5S A;  4NPP A;  2PJQ A;  2MAW A;  4YTP A;  1OXZ A;  5FXW A;  3Q5E A;  3AE9 A;  3HR0 A;  4UVA B;  3RC8 A;  3JAD A;  3AA1 B;  3NBX X;  2QYW A;  4HQP A;  2JRK A;  4LFA T;  4MLK A;  3TLU A;  4GKJ T;  2CM0 A;  4YHH T;  3O4X E;  1XMO T;  1S35 A;  4ZEY A;  2LRK A;  2VVN A;  5LG3 A;  1LRZ A;  4UM3 S;  4GK5 E;  3JAE A;  2DLR A;  3J9X 1;  3HKB E;  1EZ3 A;  3GN5 B;  3K1S A;  2Y54 A;  3T1H T;  4B3S T;  4ZZB A;  3AEA A;  1XZY A;  2NTY A;  3JCF A;  4AFT A;  4QWN B;  4GIW A;  3W15 B;  2IDO B;  5IYZ E;  2BBJ A;  5HXH A;  3H3A A;  4YJ2 E;  4DMW A;  2A9U A;  4LFB T;  4EV6 A;  5HEH A;  2XZE A;  5JDQ A;  3O1H A;  3I9W A;  1WLX A;  4PFP A;  3C84 A;  1D1A A;  2XTL A;  4U74 A;  3I0Q A;  4L5G A;  4PW8 A;  2Q9Q B;  4M1P A;  1N36 T;  2E5V A;  4P09 A;  3AEG A;  5HXE A;  2WZY A;  3SIO A;  3BK9 A;  2WNJ A;  5H6Q B;  1UV6 A;  4UXN B;  2XSA A;  3ZDG A;  4AI6 A;  2XSB A;  3KIN B;  5AQT B;  3UU4 A;  1MIW A;  3CK6 A;  2XAJ B;  5ABG A;  3TKL B;  2FJB A;  2XNU A;  4IIJ E;  2LM2 A;  4UF0 A;  2WNC A;  2WMO A;  2CRB A;  3OBV E;  2YME A;  4C90 A;  3A5X A;  1NWM X;  2BJ0 A;  5LHH B;  2FBW A;  4DBQ A;  4IDQ A;  3L39 A;  4NIQ A;  4HKA A;  2V5C A;  1NEK A;  2IC9 A;  5LB7 B;  1UX4 A;  4WBO A;  2BR8 A;  2KXP B;  3AE4 A;  1KEY A;  5CGM A;  3IF8 B;  3CQX C;  2K5B B;  2BVM A;  1H7C A;  3KFW X;  2J62 A;  4DID B;  2M67 A;  2Y7Y A;  4UR9 A;  4B3T T;  2LRL A;  4HFV A;  4J2C A;  1UCU A;  4CI1 B;  2CHN A;  1U5P A;  4PFO A;  2KLQ A;  3CPZ A;  2J1D G;  3I0O A;  3WTM A;  2CHO A;  5HXS A;  3ZT5 A;  2QRX A;  2XAQ B;  4EYU A;  4BA9 A;  3EI0 A;  1D1C A;  1W0B A;  3RYF E;  2A2F X;  5HCM A;  2UXC T;  3PU8 A;  5TVC A;  1NAF A;  1YW0 A;  4A98 A;  1BR2 A;  3UUL A;  3PUG A;  5ABF A;  4IDZ A;  4MAL A;  4Z90 A;  4N78 D;  4JBW F;  2UXX B;  5FYM A;  3AXJ A;  3PUW F;  2Y56 A;  4DV0 T;  3FZL B;  1N32 T;  4PJN A;  5J2T E;  4IE5 A;  3OYX A;  3ZSS A;  4ILB A;  2WWU A;  3VU7 H;  3RI5 A;  5C3J A;  2ZM0 A;  3GN5 A;  3Q9D A;  4IGU A;  4EB6 E;  3ONX A;  4H9S E;  2LM9 A;  2W0G A;  2XAG B;  3VR8 A;  2BS4 A;  2X9H A;  4XK9 A;  2KMF A;  3R6N A;  5BR8 T;  4WV9 A;  3PUY F;  3GUA A;  4XHE A;  4DR5 T;  3P7I A;  3O9X A;  3L3P A;  2BG9 B;  4XZC A;  3R84 B;  5HEG A;  4COF A;  2NWB A;  4UY2 A;  2WN9 A;  1ZP0 A;  2XHE B;  5JRC B;  3P4S A;  3WTL A;  4LMK A;  1WR0 A;  2VVS A;  4ZXL A;  5L3E B;  3M3Z B;  2LOP A;  4HEA A;  1MMN A;  3C4X A;  4I0U A;  3RYH E;  3PEO A;  4AIU A;  4I43 B;  2V5D A;  4TWF A;  2QVA A;  3CX6 B;  3AE7 A;  5J1G A;  2GK9 A;  4AKH A;  1IAP A;  1OED B;  3EAB A;  3KV4 A;  3H3M A;  5FKY A;  2VB6 A;  1N33 T;  3UU8 A;  4NUV A;  3IEE A;  3D0T A;  3PUQ A;  4UXU A;  5ADX L;  1XDP A;  3E08 A;  3ONL C;  4B3R T;  5ABH A;  4DUY T;  1T7S A;  4MFR A;  2E9X D;  2WDR A;  4IDN A;  2E9X B;  5AFM B;  1U4Q A;  5ETW A;  1HFA A;  3CX7 B;  3P8C D;  4TNV A;  2XM1 A;  3OVU A;  3PUR A;  4YFS A;  3CVR A;  2V6X A;  5KE4 A;  2C5I T;  3ZST A;  3QB5 K;  2BKO A;  2X0L B;  1E2A A;  4ASK A;  1SHZ C;  2H89 A;  5BMV E;  4ERR A;  2M6B A;  5AQF B;  3SQ6 A;  2W62 A;  3L09 A;  3O1I A;  5HYA A;  4ZJT A;  3N9L A;  3RIU C;  5L2L A;  5FJV A;  4LFC T;  4O4H E;  1W0A A;  3OKQ A;  4H63 H;  4ZZC A;  2CXD A;  4P1N A;  3GWH A;  5FXV A;  1LVK A;  5AIN A;  1QSD A;  2KND A;  4DBM A;  3BQI A;  3UT5 E;  3K3N A;  1QLB A;  1YQ3 A;  2BG9 A;  2BG9 E;  3N9P A;  2BKP A;  2XNT A;  2JPF A;  2XQ8 A;  3J7Y q;  4L9I A;  2Z6E A;  1E1H B;  3GMI A;  3WTN A;  4DMV A;  3ZN0 B;  3ZEF B;  3SWH A;  2X00 D;  1BR0 A;  4YJ3 E;  4CI2 B;  3SQ9 A;  4AFH A;  3ZYK A;  4YTM A;  3PU3 A;  2D9D A;  4O4L E;  5HEO A;  2Q9Q C;  2N9D A;  2LSI A;  2WBL A;  3AE3 A;  2V26 A;  5FL1 A;  3RIF A;  2UXB T;  3C79 A;  2F4V T;  3F31 A;  1HNX T;  3CX8 B;  2CMR A;  2KT9 A;  4UEL A;  2HN1 A;  2HN2 A;  3M65 A;  2V7I A;  5AQN B;  4U72 A;  2UU9 T;  4YSY A;  4U2Z A;  5KXJ A;  2YDS A;  4KMC A;  4TUY E;  4YY3 T;  4UV8 B;  4ADZ A;  5AFH A;  2RPA A;  4QKN A;  3N9Q A;  1WFD A;  1HNW T;  5AQI B;  2PBI A;  3UU5 A;  2WU2 A;  4WBN E;  4GYS A;  2X9X A;  3RGL A;  4DR3 T;  5FP3 A;  5ABF B;  3WAJ A;  1HF8 A;  3QOF A;  2D5U A;  4IST A;  4O8S A;  4ZI7 E;  4F8H A;  1M62 A;  1US7 B;  5LHI B;  3AE6 A;  4A97 A;  4LF6 T;  4TV9 E;  1UX2 A;  3NRX A;  5EK4 A;  2CWO A;  2I59 A;  4FI5 A;  4EIW A;  2YDQ A;  4A5X A;  3H37 A;  1IZN B;  1T72 A;  4JLE A;  3PUZ F;  4PK6 A;  4QXB B;  3SOL A;  5E0O A;  4H9P C;  4FJO A;  4EOZ B;  5H6R B;  2XYS A;  4TX5 A;  2DI4 A;  4CN4 A;  3F2E A;  1FMW A;  2QA7 A;  4IL4 A;  4ZI3 D;  3RF1 A;  3MK7 C;  2YU1 A;  3B5M A;  4BQT A;  4K0K T;  3ZCJ A;  4IHJ E;  3U8J A;  1XNQ T;  1I94 T;  2W8F A;  4LF5 T;  3ZJ1 A;  3FZF B;  5CA0 E;  4HE8 A;  4K0U A;  5F3J A;  4HWC A;  5FNV E;  4AQF A;  4OX9 T;  3MZK B;  3FZK B;  3U8L A;  3RKO A;  5JDM A;  2W66 A;  4DR4 T;  4B6X A;  4IDP A;  2RA1 A;  5AQK B;  3EVY A;  2FUP A;  2KIN B;  3A8Y C;  3FHN A;  4B5D A;  2ES0 A;  5CJ5 A;  4GOU A;  3I9Y A;  2LKH A;  5AQQ B;  5AQP B;  2LOS A;  2XAS B;  5J0Z A;  1HX1 B;  2LSK A;  4AKG A;  3KBU A;  5L4H A;  2WNL A;  5BW2 A;  5FMN A;  2Q9Q A;  2VKJ A;  4PJJ A;  2V7L A;  3ESL A;  3ZJ2 A;  2HPJ A;  3OPC A;  3C50 A;  3P4P A;  1JNZ A;  4OYK A;  2B1E A;  4QHO A;  1BR1 A;  4BJM A;  4ZI2 D;  1ZKE A;  4PK5 A;  4X1K E;  1HX8 A;  4FRR A;  3RH3 A;  2W61 A;  4TZ4 C;  3QB5 A;  3JAF A;  1IBK T;  2X0Y A;  3C64 A;  3OJA A;  2WZI A;  2Y6X A;  1D0Y A;  4JI3 T;  4V1A v;  4CN1 A;  1W09 A;  2L3L A;  2X66 A;  4PJM A;  1WR6 A;  3OTO T;  4IT4 A;  3ZCI A;  2W00 A;  4EZH A;  3PMZ A;  2IML A;  3KBT A;  3GA8 A;  4OHF A;  4DV1 T;  2CLY C;  2J4G A;  5ABE A;  3IA3 A;  5LJM A;  5C8Y E;  2YK0 A;  3KV9 A;  4DV4 T;  5L3G B;  3ZDH A;  4JYA T;  3E22 E;  2C5K T;  3PJA J;  5AQL B;  2PGZ A;  2ZMA A;  2NW8 A;  4UEM A;  4JI4 T;  3T1Y T;  5CO5 A;  2H7V C;  4PAG A;  5HEJ A;  2X68 A;  4YSZ A;  3PTR B;  3VR9 A;  1X79 A;  5JQG E;  5FXZ A;  2JMK A;  5A1L A;  2VQE T;  3TLV A;  4HWH A;  5JDL A;  4O4J E;  3RYI E;  3NVO A;  4HWD A;  5IUX A;  4JI7 T;  3ZMT B;  4U31 A;  2XZ6 A;  3EAM A;  1MMA A;  4HFB A;  5J5H A;  1GQE A;  2AXD S;  4AQY T;  3Q2M A;  4QXH B;  3WTJ A;  3MJX A;  2V7K A;  4X5T A;  1ZEE A;  5AFL A;  1IBL T;  2UXD T;  2ZJU A;  2CBJ A;  3EUH A;  5AQO B;  3VRA A;  4QH1 A;  3WI3 A;  2E9X A;  4HFC A;  4ZRU A;  2AE9 A;  4QX7 B;  2WZH A;  4GYR A;  2ODV A;  4KHZ F;  2IAK A;  3N9O A;  4AQG A;  2JIW A;  3EDV A;  5LG4 A;  3B57 A;  3AAA B;  3ZYM A;  5LGT B;  3LBX B;  3TLT A;  3SFE A;  4JEH B;  2HH7 A;  4YSX A;  4UIG A;  3WAK A;  5JR9 C;  1VOM A;  2K48 A;  2JQH A;  2XQ9 A;  2QGS A;  2ZM8 A;  5FY0 A;  4ZHQ E;  4KBM B;  3ETV A;  3CIR A;  2IUB A;  2MPK A;  4LMJ A;  4PNI A;  3AB3 B;  3DTO A;  5FL0 A;  5LXB A;  2XY8 B;  4IE4 A;  4EED A;  4DV5 T;  1T8B A;  4MBQ A;  3U8M A;  2JJ9 A;  2CBI A;  3RKG A;  3LBX A;  5HCJ A;  4NUU A;  2WS3 A;  4JI1 T;  3NZP A;  2CXL A;  3C98 B;  2CA5 A;  5LGU B;  4ILU A;  4F6R C;  4X64 T;  4X62 T;  5M4Y A;  3DJB A;  2Q9Q D;  2VKH A;  3LK3 B;  2VWA A;  3U3I A;  4AIS A;  4LF7 T;  2G0U A;  2E2A A;  2D0U A;  3VHL A;  4X66 T;  3UQ4 A;  2YDR A;  2BKN A;  2JQ9 A;  1CHU A;  4QH4 A;  3P50 A;  2V7J A;  4X1Y E;  3UUB A;  4GKK T;  2Y48 B;  3FB2 A;  3Q5X A;  3FBZ A;  4IRE A;  3L8R A;  2YU2 A;  2I6H A;  3U78 A;  3S4U A;  5JME A;  3SS1 A;  1KNP A;  3RX6 A;  2EHO D;  1Y64 B;  1D1B A;  3AEE A;  2BYP A;  3PUV F;  2UZ6 A;  2V1D B;  3AVS A;  2CLY B;  2CWY A;  3TLS A;  5CB4 E;  3UQ7 A;  1YKH B;  4JI0 T;  2YN6 A;  4X65 T;  5HWX A;  2WU5 A;  3RC3 A;  3P4W A;  5DQW A;  4EGW A;  2WM9 A;  3KDS E;  3VRB A;  4U7I A;  4H9N C;  4QAB A;  2XNV A;  2N2N A;  1LVF A;  2X9Y A;  5AQG B;  5F5W A;  4D01 A;  2DWK A;  4Z8X A;  3RIA A;  3LDQ B;  4QAC A;  3WTK A;  2SPC A;  1MIY A;  3SH1 A;  3UU6 A;  1YKE B;  3AE1 A;  2EHO A;  2WWV A;  4CXY A;  3HL6 A;  5EZY E;  2PTF A;  3AAI A;  5JR9 A;  3IHR A;  4HN9 A;  5FY7 A;  4QH5 A;  2ACZ A;  4HFE A;  1KNZ A;  1UUS A;  2OV9 A;  4IE7 A;  5TAO A;  1N34 T;  4XBF B;  4UVB B;  1KK7 A;  3ANW B;  3UU3 A;  3UUX B;  5AFJ A;  5J2U E;  3WTI A;  2W4X A;  1WYB A;  2XAH B;  3ZYL A;  2NTX A;  2HHH T;  1G8X A;  3ZMS B;  3KVA A;  2C0S A;  3WIP A;  1XWM A;  1MMD A;  1FEW A;  2VK9 A;  3EDU A;  4LF9 T;  2J47 A;  4E7Z A;  5AFM A;  4E7S A;  2D0T A;  4AFG A;  4PIR A;  5L3D B;  3AA6 B;  3PDY A;  5DJQ C;  3T4M A;  2NP9 A;  4DR7 T;  2RP4 A;  1HCI A;  1FJG T;  5LYJ E;  1Z8U A;  1SA0 E;  2DHR A;  4KI0 F;  2IIU A;  2X00 A;  5LOV E;  2VKD A;  4DR2 T;  3KV5 A;  2K24 A;  3ZMZ B;  4AKL A;  3NZQ A;  4TNW A;  5J5I A;  4DBR A;  5IHY A;  2I0M A;  2X51 A;  3KV6 A;  4AKR B;  1WRD A;  3PUX F;  5AQU B;  3RRW A;  1MIV A;  2NR4 A;  3HI2 A;  1UGO A;  4JI6 T;  2FJA A;  2K3W A;  2LT3 A;  3LFM A;  1MNE A;  2WQY A;  1ZOY A;  3AAE B;  5AQR B;  4P0A A;  4TN7 B;  2DL1 A;  1HTJ F;  2ZM2 A;  3B13 A;  4U2Y A;  2PFV A;  5LBM A;  3C51 A;  3NKZ A;  4H9R C;  4UF0 B;  2IW5 B;  2ACX A;  1J5E T;  3ABV A;  1KFY A;  3K8P C;  4I4T E;  1VCT A;  1MND A;  2OA5 A;  4O2A E;  3PV0 F;  5FY1 A;  2KWH A;  2VUR A;  4ZR6 A;  3RHW A;  4IL9 A;  3AXJ B;  4NZB A;  4BAY B;  2Y57 A;  1Z0P A;  3A7M A;  4WNK A;  3UUM A;  5LGN B;  2WCA A;  1Y01 A;  1OED A;  1OED E;  2IC6 A;  3PJA A;  3LK4 2;  4DV3 T;  3ZMV B;  3SFD A;  5AQV B;  4NXN T;  5J5G A;  5LP6 E;  3ONJ A;  5JDF A;  3CQG B;  4DUZ T;  4QX8 B;  2PH9 A;  2LEH A;  3CML A;  3VKH A;  2NW7 A;  1SE7 A;  3Q5D A;  2V6Y B;  4WW0 A;  5JVD E;  3Q5W A;  3JC6 D;  3AE2 A;  4UV9 B;  4MHC A;  2EHO C;  4EYY R;  3N9M A;  4LF4 T;  1ZHC A;  3JC6 C;  4JI8 T;  3QC9 A;  1ZV4 X;  1WYC A;  1YXR A;  4U33 A;  2X0H A;  1XNR T;  5KZU A;  4DR6 T;  2ZJV A;  3K3Q C;  5LHG B;  2A72 A;  2WDV A;  3N2K E;  3VKG A;  5L3B B;  4X1I E;  3ZN1 B;  3P4R A;  4HFI A;  2X67 A;  2YOE A;  4A56 A;  1J1J A;  1QUU A;  4H9O C;  1M7K A;  2N1G A;  2FJE A;  4OK0 A;  4ZJS A;  5EK3 A;  4O4I E;  5JDH A;  3QNU A;  1E7P A;  2VAS A;  5JH7 E;  3AA7 B; 
#chains in the Genus database with same CATH homology
 3UU5 A;  4XHE A;  5HEH A;  5BP0 A;  2BYP A;  3ZDH A;  1I9B A;  5AFM A;  4ILC A;  4ALX A;  2UZ6 A;  4UM3 P;  2M6B A;  4ZK4 A;  2XQ9 A;  2BYR A;  4ZR6 A;  4Z91 A;  2BG9 B;  3SQ6 A;  2BYN A;  3RHW A;  4B5D A;  5HEG A;  4AFG A;  3WTM A;  4IL9 A;  4COF A;  4F8H A;  3C84 A;  2PGZ A;  4PIR A;  4ZJT A;  4NZB A;  5FJV A;  2Y57 A;  2XQ5 A;  4UY2 A;  3T4M A;  2WN9 A;  3TLS A;  2XQ7 A;  2LKH A;  1OED C;  2LKG A;  3UQ7 A;  4ZZC A;  1UW6 A;  4EZ1 A;  5CO5 A;  5J0Z A;  2YN6 A;  2XQ3 A;  4A97 A;  5HEJ A;  2XZ5 A;  3WTL A;  4LMK A;  4LMJ A;  3EI0 A;  1OED A;  1OED E;  1UX2 A;  5L4H A;  2WNL A;  2WZY A;  3SIO A;  5AFN A;  5BW2 A;  2WNJ A;  5AIN A;  5LXB A;  4TWH A;  3P4W A;  3ZKR A;  1UV6 A;  2QC1 B;  5HCM A;  5TVC A;  3ZDG A;  2X00 A;  4DBM A;  4ILA A;  4HFH A;  2KSR A;  4NPP A;  2XQ4 A;  2BYS A;  3TLV A;  4A98 A;  4HFD A;  2MAW A;  5J5G A;  4QAA A;  4QAB A;  2XNV A;  3PEO A;  2BG9 A;  2BG9 E;  2M6I A;  4TNW A;  5J5I A;  4ZK1 A;  3WTO A;  3UU4 A;  2XNT A;  2XQ8 A;  5IUX A;  4TWF A;  2PH9 A;  3U8M A;  4UM1 A;  2BYQ A;  5HCJ A;  4Z90 A;  3JAD A;  2BR7 A;  2XNU A;  2XZ6 A;  3EAM A;  1OED B;  2LM2 A;  4HFB A;  2WNC A;  2XYS A;  3WTN A;  4D01 A;  5J5H A;  3RIA A;  2X00 D;  2YMD A;  5BRX A;  3UU8 A;  4HQP A;  4FRR A;  4QAC A;  3WTK A;  5CFB A;  3SQ9 A;  2YME A;  3TLU A;  3WTJ A;  4AFH A;  3SH1 A;  2VL0 A;  2BJ0 A;  2W8G A;  3UU6 A;  2XQ6 A;  4X5T A;  3JAF A;  2XYT A;  5HEO A;  4UXU A;  5AFL A;  5KZU A;  4IL4 A;  2ZJV A;  5SYO A;  3RQW A;  3LSV A;  5HEU A;  2Y56 A;  4BFQ A;  3EHZ A;  5LG3 A;  2ZJU A;  3RIF A;  4QH1 A;  3C79 A;  3UQ4 A;  4QH5 A;  4HFE A;  4BQT A;  4HFI A;  3WTH A;  2LLY A;  4UM3 S;  2YOE A;  4HFC A;  5L47 A;  3JAE A;  5AFM B;  4ZRU A;  5AFK A;  4ILB A;  4TWD A;  2Y58 A;  3U8J A;  4QH4 A;  3RI5 A;  2BR8 A;  2W8F A;  4UM3 A;  3PMZ A;  2BG9 C;  3UU3 A;  2YKS A;  3P50 A;  4TNV A;  4LML A;  5AFJ A;  3UUB A;  5L4E A;  3WTI A;  4IRE A;  2Y54 A;  3U8K A;  3RQU A;  5KE4 A;  5J5F A;  4ZZB A;  2XQA A;  4ZJS A;  2C9T A;  4XK9 A;  3U8L A;  4AFT A;  5AFH A;  3IGQ A;  3TLW A;  5JME A;  3TLT A;  4WV9 A;  2Y7Y A;  3WIP A;  3GUA A;  3U8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...