3EI0A

Structure of the e221a mutant of the gloebacter violaceus pentameric ligand gated ion channnel (glic)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYAANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a potentially open state of a proton-activated pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein
molecule keywords Glr4197 protein
total genus 79
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3ei0A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3ei0A01
5J0ZA 3RQUA 3C84A 3JADA 3U8LA 4QAAA 2XQ9A 3IGQA 2XYSA 4ZR6A 2W8FA 3PEOA 3U8MA 4LMLA 2XNTA 4Z90A 3UU6A 5HCMA 4UM3P 2YN6A 4IL9A 4HQPA 3WIPA 5J5FA 2XQ4A 3WTHA 3EAMA 5BW2A 2WNLA 5LG3A 3TLVA 4AFGA 3TLWA 2XQ6A 3WTIA 5AFMA 5AFNA 3RI5A 4HFDA 5IUXA 2QC1B 3SH1A 4PIRA 2XQ7A 5HEJA 4COFA 2M6BA 4ZJTA 5LXBA 5J5IA 2Y54A 4ZZBA 2BYPA 2XYTA 5L4EA 5AFJA 3RIAA 4QH1A 3UU4A 4B5DA 3ZKRA 2XZ6A 5KZUA 4IREA 1OEDE 2BG9C 5HCJA 3JAEA 4QABA 4UY2A 5J5GA 3WTMA 2BG9A 3RHWA 4TWDA 2BYSA 4ILCA 4QH4A 3UQ4A 2LKGA 2YKSA 3SQ9A 3ZDHA 3WTKA 1UW6A 4ZK4A 4LMKA 3U8KA 2XQ8A 2BYRA 2PGZA 3RQWA 2WNJA 3U8NA 3ZDGA 5SYOA 2WNCA 2Y7YA 4UXUA 5KE4A 2M6IA 5CO5A 2LKHA 4A97A 5CFBA 4TNWA 4AFTA 4ZK1A 3EHZA 4HFCA 4FRRA 3WTLA 1OEDC 5L4HA 2LLYA 3UU8A 3SIOA 4HFBA 1UX2A 4A98A 4F8HA 4ILBA 3SQ6A 4WV9A 4ZZCA 3P4WA 3WTNA 2BR7A 3UU3A 4QH5A 1I9BA 2BYNA 3UQ7A 3GUAA 2KSRA 5J5HA 3UUBA 2MAWA 5HEGA 1UV6A 2X00A 5JMEA 4UM3A 4XHEA 2XNUA 5HEOA 4AFHA 3T4MA 5HEUA 2BYQA 2VL0A 3WTOA 4HFEA 2LM2A 3PMZA 3U8JA 5AFHA 4HFIA 2PH9A 4ZJSA 4BQTA 3RIFA 3WTJA 5FJVA 3TLSA 5TVCA 3EI0A 2YMDA 4UM3S 4IL4A 4HFHA 5BP0A 2YMEA 2Y58A 2BR8A 5AFKA 2XQ3A 5HEHA 3LSVA 4X5TA 3C79A 2XQAA 5AINA 5BRXA 2ZJUA 2ZJVA 3TLTA 5AFLA 3JAFA 2C9TA 2XQ5A 2Y56A 4LMJA 4ILAA 2BG9E 2XZ5A 2BG9B 3UU5A 5L47A 2WZYA 2W8GA 4QACA 3TLUA 4NZBA 1OEDB 4ALXA 4ZRUA 4D01A 4TNVA 2YOEA 4TWFA 2XNVA 4UM1A 2BJ0A 4TWHA 4NPPA 4BFQA 4Z91A 2WN9A 4XK9A 2UZ6A 4EZ1A 4DBMA 5AFMB 2Y57A 2X00D 1OEDA 3P50A
chains in the Genus database with same CATH superfamily
2KWHA 2LSJA 2W8FA 2W66A 5FY7A 1FJGT 3K8PC 3HA4A 3WIPA 2XQ4A 2VKOA 2VQFT 2L9QA 3HI2A 3RPUA 4ADZA 5JDHA 1X9BA 2Q9QB 2E9XD 2Y54A 5FL1A 1KF6A 2HH7A 2CHNA 2NTXA 2UXBT 3I9YA 2CHOA 3B57A 4TV8E 3ZMZB 4ZK4A 3D0TA 5CB4E 2XQ8A 2PGZA 1G8XA 3NKZA 4MALA 3RH3A 2WNCA 4CI3B 3DTOA 2X0HA 4IE4A 4IIJE 3C51A 4L9IA 4ZK1A 3EHZA 2LSKA 3I0QA 2MPKA 4ILBA 2IIUA 4IHJE 2XAQB 2WSSV 4DBQA 2W63A 3QB5A 5LP6E 2RP4A 4EEBA 1SHZC 1WYBA 5JDQA 5J2TE 4HFIA 4X64T 3CK6A 5AQTB 5GONE 3BQIA 3TLTA 2B76A 4HGAA 2XAGB 3FZMB 2W61A 2WZYA 3AA1B 2RPAA 2W67A 4J2CA 2L8KA 2VB6A 4KHZF 1HNXT 3NZQA 1ZV4X 3LJCA 2IDOB 4XK9A 1SUMB 4EYYR 4L0RA 4BJMA 2H7OA 2XQ9A 4ZR6A 3PEOA 2WMOA 1YD8G 3BQKA 4GK5E 4PIRA 3EVYA 2M6BA 3ZEFB 2JQHA 2E5LT 5AFJA 3ZKRA 5F8PA 4QABA 2KWIB 3RIUA 4NIQA 2NP9A 2YKSA 5J1GA 3U8KA 3ZPOA 2PTFA 3RYCE 4HKAA 2JQQA 3CQXC 5LB7B 3MACA 4DR5T 4YY3T 3SQ6A 4WV9A 5KDMC 4CQIA 1E7PA 2EHOC 3PUSA 2PFVA 3L09A 5FXWA 1YW0A 4C91A 4XHEA 3ABVA 1HX8A 1HG5A 1ZHCA 1XNQT 4I4TE 1N36T 2V7MA 1IJ6A 4YSXA 2N1GA 1LKXA 4UR9A 1WLXA 3IBPA 4ILAA 2XZ5A 4UV8B 4YTMA 3SFEA 4JI2T 2XSAA 1HF8A 2H88A 2J1DG 1WFDA 1BR4A 3AECA 3JC6D 2KLQA 3O1JA 4DV0T 2UXNB 4QAAA 4AKIA 4O8SA 3LBXB 2XAHB 2LE8A 3JC6C 3G06A 5LHHB 5LG3A 1JNZA 2FJAA 5AQNB 1OXZA 3ZLIA 2BYPA 2W4XA 5AQOB 1J1JA 2X9HA 2QA7A 3HKCE 1WR0A 3N9PA 5J5GA 3WTMA 2DNXA 2WU5A 4WW0A 2XASB 3M3ZB 4AKRB 3RGLA 3ONJA 1X79A 3SFDA 4B3MT 3H3AA 4EXTA 3LBXA 4AKHA 2NWBA 2JMKA 4U33A 2CWOA 1UX2A 2K3WA 3PUAA 5LXTE 4EZ4A 4CZZB 4B3RT 4CXYA 3GUAA 3EDUA 5HEOA 2YK0A 3AAEB 5EK4A 2ACXA 2YMDA 3AA0B 4IE6A 1WYCA 2BR8A 5AINA 2XQAA 5JVDE 2XQ5A 5DJQC 4DIDB 4I0UA 4OX9T 3T1HT 5HWYA 5JR9C 2V26A 3ONXA 3K1SA 4LF6T 2WDRA 4M1PA 3RX6A 4EZ1A 2N2NA 4Q25A 5AFMB 3U8LA 3Q2MA 2PJQA 2W0GA 4U7YA 5AQPB 3ZT5A 3ZSSA 2WU2A 4YJ3E 4MLKA 2Z6EA 2VURA 3GWHA 4OHFA 4HFDA 4QHOA 2LEHA 3KVBA 3AAIA 1W0BA 1YKEB 2BYSA 1MIVA 1MIWA 4AI6A 3DJBA 4ZS2A 4ZI2D 3CVRA 4DV3T 1XZYA 2I59A 3FZKB 2Y7YA 4UXUA 4OYJA 1S94A 1AJ3A 1OEDC 2NR4A 4WNKA 3LG7A 1S35A 3N2KE 2L3LA 4K0UA 4B3ST 3V5UA 2BR7A 1XMQT 2QYWA 4IDPA 3N9LA 5LGUB 1G73A 2E5VA 5F5WA 5HEGA 5JMEA 1EZ3A 3EDVA 1D1AA 1N34T 4IL4A 2PG8A 3C4XA 3WAJA 4PW8A 3C4ZA 1FIOA 2K5BB 4EEDA 2VKHA 2JJ9A 3OBVE 2ZLYA 5EZYE 1CHUA 2JQ9A 2X66A 3O9XA 2IHR1 5L2LA 4AKGA 2V6YB 2I6HA 4D01A 2YOEA 3N9QA 2CBIA 2WB5A 2RA1A 5M4YA 4KX6A 4I43B 2DI4A 2Y57A 5JDGA 2IC6A 1T72A 5JR9B 5AFUL 3WTHA 5ABHA 3AEBA 5AFMA 3PTRB 5AQGB 5LJNA 2QC1B 3GN5B 1T98A 3VR8A 1HR0T 5J5IA 4GYSA 2E9XB 4B5DA 3VKGA 2CRBA 4DR1T 2YDSA 1UW6A 1MMAA 4U2YA 5ETWA 2LSIA 2VK9A 5LGNB 4IDZA 2DHRA 4O4LE 2ODVA 2C5IT 2DL1A 4YJ2E 3K3OA 3P4PA 4Z8XA 5ABGA 1WCRA 4EGWA 3DP7A 4ZEYA 2JMHA 3ZJ2A 3FBZA 4CI1B 5AQMB 3RC3A 5L3DB 4DBRA 4DVDA 5KXJA 1E1HB 2VL0A 2NOXA 3RYHE 4JI1T 3PMZA 3BQLA 2LHNA 2HPLA 2UUAT 3EI0A 3AE4A 4UM3S 2ZM2A 2CLYC 1WR6A 1Y64B 5AFLA 3JAFA 1VCTA 3RRCA 1D0ZA 3PUQA 1SA0E 5F3JA 1KFYA 3FXEB 5FXXA 4NZBA 5JRCB 3RKOA 3OTOT 1UURA 4DBMA 2V7KA 3P50A 4PJMA 4CXWA 3C84A 4Z90A 1IZNB 5JH7E 2IW5B 4K0KT 4U74A 3AE2A 1D1CA 3HL6A 5IUXA 1HCIA 4DUZT 3SS1A 3NRXA 1BR0A 2XQYA 4IT4A 3JAEA 4TV9E 4LF4T 2LKGA 1HTJF 3RQWA 2VWAA 4JV5T 4F6RC 3R84B 4XZCA 4CN6A 4TZ4C 1FMWA 3R6NA 3E0ZA 5AQQB 2X0LB 3SOLA 2WDVA 2JIWA 3UQ7A 2JPFA 5E0OA 3TKLB 5LGTB 1T8BA 5JDMA 5AQJB 5AQLB 4HFEA 4QX8B 5AFHA 2H7VC 1NWMX 3N5LA 4DR3T 3AE1A 1HNZT 4X1KE 1ZKEA 3IHRA 2CLYB 4NXNT 5FY1A 2CXLA 5LNKA 4DV7T 3TLUA 3EABA 1D0YA 4EZHA 4FJOA 3PV0F 3UUXB 4IDQA 4AISA 2LRLA 1MMDA 2BS4A 2YU2A 3KINB 3MZKB 5FKYA 5AQKB 5EK3A 3J9X1 1V9DA 2C0SA 2V1DB 3TLVA 2XQ6A 3L3PA 2AE9A 3SH1A 5HEJA 4OYKA 3NVOA 3T1YT 5KZUA 4P1NA 2BG9C 3NBXX 3I0OA 5IWAT 4LFBT 4HWFA 2H89A 1CUNA 4ILCA 3ZDHA 1N32T 3X1DA 2IC9A 3E08A 2BS3A 1KNZA 3LK42 4H9OC 4U3CA 4ILUA 4KMCA 4TNWA 2KNDA 2I0MA 3MJXA 4AQFA 5L3BB 2HPJA 2E9XA 3N9NA 2BYNA 2K9AA 4UM3A 4CI2B 2HHHT 3Q5WA 3T4MA 3CX8B 2W62A 4O2BE 2E8IA 2CXFA 4GYRA 4UVCB 1I6ZA 3I9WA 5FJVA 1I94T 3RYFE 2FBWA 2XQ3A 3AEAA 2E2AA 5CA1E 3O4XE 1XDOA 4LF8T 4G63A 2YDQA 2XNVA 4Z91A 4I55E 2X9WA 4HE8A 3OYXA 2X9XA 1UUSA 2MTQA 3UU6A 2LRKA 4HQPA 2NTYA 4H9SE 4U7IA 4X1IE 2D2SA 4AKLA 3FZFB 3RI5A 2DLRA 2WP9A 4JI3T 3GA8A 4I50E 5FVKA 2QRXA 4EIWA 2FJBA 3P4SA 3RHWA 4JI8T 3MA9A 4DMWA 3PUYF 5CO5A 4X1YE 3HKBE 1YXRA 2DCFA 3UU8A 4HFBA 2JRKA 4ZZCA 3P4WA 3CQGB 4QH5A 3KBUA 2DWGA 4BA9A 3QK6A 3RF1A 4H63V 2MAWA 2F4VT 4FI5A 4YLHA 2C5KT 3UT5E 1J5ET 5BMVE 3VR9A 4DR7T 4E7SA 5KX5E 3RKGA 2Y58A 4AQYT 1GQEA 5AFKA 4YXDA 2ZJVA 2C9TA 5LMNT 2LM9A 2PBIA 4UF0A 2E9XC 4KP3C 4B3TT 4ANJA 2BJ0A 4EB6E 3ZJ1A 3QUJA 2X00D 1OEDA 5J0ZA 2LOSA 5AQRB 5JQGE 2J47A 3P8CD 3ZYKA 3C64A 3TLWA 5AFNA 2MYSA 4OFZA 5C3JA 2D0TA 3B5MA 3UUNA 2A3DA 2YEVC 2XYTA 2D9DA 4TN7B 5HCJA 4CN1A 2VKJA 2UUCT 3UULA 5LHIB 3H37A 3RLFF 4E7ZA 5L3EB 5IHYA 4PJJA 4X66T 4ASKA 3ZYMA 5CFBA 4A56A 3AEFA 5L4HA 3ONLC 3ETUA 4QKNA 4DV4T 4CXXA 3GMIA 5J2UE 5J5HA 3PUVF 5FNVE 4AFHA 2BKPA 2BYQA 4QXHB 2KZ7B 2KT9A 4JEHB 3AEEA 4NXMT 4PJLA 3ZC1A 2ZM8A 2MBGA 2XHEB 1DU2A 2V6XA 3ZMTB 3C79A 3O1IA 1KK7A 3CKDA 4LMJA 3CPZA 1MIYA 2BG9B 3PURA 5L47A 1U4QA 2X0YA 4NUVA 2W8GA 3A5XA 4ZRUA 3AXJA 2CM0A 4H9QC 2WN9A 5A1LA 5DABA 3OVUA 2BZBA 5TVCA 3SRZA 3RQUA 3JADA 4WBOA 4MFRA 3OKQA 5AQFB 3F57A 2A9UA 4AFGA 3WTIA 3AEGA 3ANWA 5LBQB 4GKJT 1VRBA 4ZJTA 4KUMB 4QH1A 1D0XA 3ZN0B 3QNUA 4UY2A 3AAAB 4IDOA 3PU3A 3WTKA 4JLEA 1M7KA 2IMLA 4LMKA 4DR4T 1SE7A 3PU8A 4A97A 5DQVA 3ZN1B 3B13A 2V7IA 1KNRA 2Y8DA 3FXDB 4IE0A 3PDYA 4TX5A 3RRWA 2A72A 2CWYA 4ZI7E 2DWKA 2V5DA 2VVNA 3FZLB 5EK2A 2LT3A 1UX4A 4DV6T 3ZSTA 1VCSA 5FMNA 5LJMA 3MXZA 3UTKA 3U8JA 2KINB 4HWDA 2EHOD 4H9RC 1B7TA 5BP0A 4QX7B 1Z8UA 2BBJA 2UXXB 3CX6B 5HEHA 2X67A 5JDLA 5LYJE 4ZHQE 5CA0E 3UU5A 5JDNA 4LF5T 4U72A 4EOZB 4GKKT 2GK9A 5L3CB 4TUYE 1YKHB 4UELA 4BFQA 3OYZA 2K24A 2V6YA 2LSGA 2IAKA 4YHHT 3ZCIA 4O4JE 1XWMA 3QOFA 2XNTA 4IL9A 2QVAA 1XDPA 2XJ7A 3T8OA 5BW2A 3P7IA 5ADXL 4PJNA 5H6RB 3UFGA 1IBKT 4U2ZA 4COFA 3ZT6A 5LXBA 2KXPB 3UU4A 5FYMA 2XZ6A 3AB3B 1NEKA 1Z0PA 4TWDA 1IBMT 3IA3A 2XPKA 3SQ9A 4LF9T 2WNJA 4JEUB 2Q9QC 3L39A 5SYOA 2UXCT 1HNWT 4ISSA 4IGUA 4YTPA 3ESLA 4HTEA 3ZMVB 3PUXF 3Q9DA 2LLYA 1IJ5A 2X51A 4H9NC 5HAXA 3WTNA 1BR1A 1LRZA 1Y01A 4DR6T 1YQ3A 3U3IA 4JI5T 4BJNA 3FZHB 2X00A 3UUMA 5LMUT 4O4IE 5C2TA 2BKOA 4DV5T 4HFHA 5AQUB 2Y56A 2FJEA 2BG9E 2Y48B 3ZT7A 3VRAA 3MKDA 2BVMA 4ZOLE 3UFEA 3CQCB 4HWCA 1L0VA 3LFMA 4KHPT 4NPPA 4X20E 5ABFA 3HKDE 3E22E 4PFPA 2OLTA 3VRBA 5AQSB 4EYUA 5LCYA 3KDSE 4KBMB 2KMFA 2LSYA 5FXZA 2UXDT 2K48A 2XM1A 3HKEE 1OWAA 3N2OA 3J7Yq 2LJLA 4PK4A 4WZXA 5C8YE 4EV6A 4ZI3D 2CA5A 2WMNA 2ZMAA 1NENA 4QXBB 4UIGA 4H63H 2WM9A 3I1AA 5KE4A 1MNEA 1BR2A 2CMRA 4AQFC 4FRRA 2V7JA 4UEMA 1QSDA 3PUWF 4A98A 2LOPA 2D5UA 2XZEA 3Q5DA 3N9MA 2WWUA 4YSZA 3UUBA 3WI3A 5HXSA 2XNUA 3AE7A 3PE0A 3WTOA 3CX7B 3P4QA 3AXJB 2PH9A 3WTJA 2J62A 4LFCT 2QGSA 3K3NA 2ZJUA 3AVRA 4XAXB 3AE5A 5JRCA 2N9DA 3AE3A 3KBTA 2BVLA 2WDQA 2OV9A 4TWFA 2CXDA 4B6XA 2HN1A 3AA7B 4UVBB 5AQIB 3C98B 1UK5A 4UM3P 2YN6A 3C4WA 3A8YC 2WZIA 3FHNA 5LBMA 1UCUA 2VKDA 2XQ7A 3CIRA 2D0UA 4ZZBA 3RIAA 1UGOA 4HN9A 2BG9A 1VOMA 5FVLA 3UQ4A 4MHCA 4UV9B 4DMVA 1W9RA 4O4HE 2XAFB 3KFWX 3C50A 2NW8A 5FXVA 4AIUA 4AFTA 3RIUC 4EAHA 4F8HA 1YQ4A 2NW7A 4DNDA 3KV4A 2HN2A 3H3MA 3ZYLA 1XNRT 3PJAJ 3GN5A 3M65A 1QLBA 4CN4A 4AXPA 3KV9A 3SWHA 4PAGA 3W15B 3TLSA 3AA6B 3MK7C 4PNIA 2YMEA 3LSVA 2CEAA 1ZOYA 4PK6A 2EHOB 3LDQB 4LF7T 3KVAA 1ZEEA 1E2AA 2P9BA 3VKHA 4JYAT 3WAKA 4ZI2C 4DV1T 4IE5A 5LHGB 2FUPA 3F2EA 3ZMSB 4P0AA 3P4RA 5L3FB 2WS3A 1ZP0A 1FMVA 2G0UA 2VASA 5HCMA 1US7B 4PK5A 5J5FA 3U78A 5AQHB 2XUEA 2UUBT 3EAMA 3JCFA 1IAPA 2VVSA 4A5XA 4HWHA 1KEYA 1WRDA 2ES0A 1QUUA 4IREA 2WY2A 3K3QC 5JREA 1M62A 1UX5A 2FJDA 3IF8B 3AE9A 3OJAA 1W09A 4OK0A 2ZM0A 2ZM6T 3ZDGA 3Q5EA 3CWZB 4DO0A 2M6IA 2XSBA 3VU7H 2LKHA 4X65T 2IUBA 3WTLA 4GK0E 2J4GA 5HYAA 5H6QB 3A7MA 3S4UA 2W00A 3ETVA 5HEUA 2Y6XA 4MBQA 5FP3A 2Q9QD 4ZJSA 4BQTA 3RIFA 1MMGA 4JBWF 1O3XA 5BRXA 1H7CA 2R6GF 4YTNA 3RC8A 2CCQA 5IYZE 2MOZA 4P0BA 1U5PA 1OEDB 3AE6A 4ALXA 4TNVA 2VL8A 1N33T 4V1Av 2YDRA 2W2UA 3IGQA 2CPTA 3U8MA 2V5CA 4L5GA 3QB5K 3O1HA 3CMLA 3FBLA 5HXRA 2WWVA 2WNLA 2M67A 2WBLA 2A2FX 2B1EA 4NUUA 4HWIB 4BAYB 1OEDE 1XMOT 5BR8T 2SPCA 2UU9T 4YFSA 2AXDS 5LA6E 3VHLA 1W0AA 5JDFA 4PFOA 5HXCA 4P09A 4LFAT 4YSYA 3RYIE 2WCAA 3V5SA 5KMGP 2EHOA 1T7SA 2ACZA 5FY0A 1I9BA 4ISTA 4DR2T 2BKNA 4DUYT 1UV6A 4JI4T 3ZCJA 2XM2A 4IE7A 3OPCA 4AQGA 3PJAA 3N2GE 1HX1B 1HG2A 3ZMUB 4C90A 2CE7A 2XAJB 3Q5XA 4GOUA 5JTGA 3NZPA 3N9OA 4H9PC 2Q9QA 4YHJA 4JUYA 2JQKA 4KI0F 2WZHA 4HEAA 3PUZF 4TWHA 4HFVA 1FEWA 2C5JA 3QC9A 3AVSA 3F31A 2YU1A 3PUGA 2XYSA 5DQWA 4LMLA 3NWIA 5ABEA 3ANWB 1HS7A 1LVFA 2BDEA 2X68A 1J5WA 3KV6A 4ERRA 2WQYA 3LK3B 4O2AE 5AQVB 3KV5A 4QWNB 5LOVE 5FL0A 2XY8B 4U31A 4JI6T 5L4EA 4JI7T 2LHRA 3IEEA 4N78D 4IDNA 2XTLA 2YINA 4UF0B 3AE8A 4YT0A 4ZS3A 2NW9A 5CGMA 4XBFB 4QH4A 4UXNB 2H3RA 3FB2A 5HXEA 2ODUA 2BYRA 3U8NA 1NAFA 2V8SV 5TAOA 4QXCB 2BS2A 2V7LA 4HFCA 1IBLT 4X62T 5HXHA 3SIOA 1D1BA 2WAUA 2BBHA 3UU3A 5ABFB 5LG4A 2KSRA 1MNDA 2CBJA 4G2AA 4WYVA 3ZC0A 1R8IA 2LM2A 1JNRA 1LVKA 4DV2T 4WBNE 5JR9A 3HR0A 3AEDA 4X5TA 1HFAA 2OA5A 1KNPA 5CJ5A 5HWXA 1MMNA 4JI0T 2VQET 4QACA 4GIWA 4ZI3C 3EUHA 4ZXLA 2X9YA 3NRYA 3LK2B 4UM1A 5L3GB 4UVAB 3BK9A 3L8RA 2UZ6A
chains in the Genus database with same CATH topology
5J0ZA 3RQUA 3C84A 3JADA 3U8LA 4QAAA 2XQ9A 3IGQA 2XYSA 4ZR6A 2W8FA 3PEOA 3U8MA 4LMLA 2XNTA 4Z90A 3UU6A 5HCMA 4UM3P 2YN6A 4IL9A 4HQPA 3WIPA 5J5FA 2XQ4A 3WTHA 3EAMA 5BW2A 2WNLA 5LG3A 3TLVA 4AFGA 3TLWA 2XQ6A 3WTIA 5AFMA 5AFNA 3RI5A 4HFDA 5IUXA 2QC1B 3SH1A 4PIRA 2XQ7A 5HEJA 4COFA 2M6BA 4ZJTA 5LXBA 5J5IA 2Y54A 4ZZBA 2BYPA 2XYTA 5L4EA 5AFJA 3RIAA 4QH1A 3UU4A 4B5DA 3ZKRA 2XZ6A 5KZUA 4IREA 1OEDE 2BG9C 5HCJA 3JAEA 4QABA 4UY2A 5J5GA 3WTMA 2BG9A 3RHWA 4TWDA 2BYSA 4ILCA 4QH4A 3UQ4A 2LKGA 2YKSA 3SQ9A 3ZDHA 3WTKA 1UW6A 4ZK4A 4LMKA 3U8KA 2XQ8A 2BYRA 2PGZA 3RQWA 2WNJA 3U8NA 3ZDGA 5SYOA 2WNCA 2Y7YA 4UXUA 5KE4A 2M6IA 5CO5A 2LKHA 4A97A 5CFBA 4TNWA 4AFTA 4ZK1A 3EHZA 4HFCA 4FRRA 3WTLA 1OEDC 5L4HA 2LLYA 3UU8A 3SIOA 4HFBA 1UX2A 4A98A 4F8HA 4ILBA 3SQ6A 4WV9A 4ZZCA 3P4WA 3WTNA 2BR7A 3UU3A 4QH5A 1I9BA 2BYNA 3UQ7A 3GUAA 2KSRA 5J5HA 3UUBA 2MAWA 5HEGA 1UV6A 2X00A 5JMEA 4UM3A 4XHEA 2XNUA 5HEOA 4AFHA 3T4MA 5HEUA 2BYQA 2VL0A 3WTOA 4HFEA 2LM2A 3PMZA 3U8JA 5AFHA 4HFIA 2PH9A 4ZJSA 4BQTA 3RIFA 3WTJA 5FJVA 3TLSA 5TVCA 3EI0A 2YMDA 4UM3S 4IL4A 4HFHA 5BP0A 2YMEA 2Y58A 2BR8A 5AFKA 2XQ3A 5HEHA 3LSVA 4X5TA 3C79A 2XQAA 5AINA 5BRXA 2ZJUA 2ZJVA 3TLTA 5AFLA 3JAFA 2C9TA 2XQ5A 2Y56A 4LMJA 4ILAA 2BG9E 2XZ5A 2BG9B 3UU5A 5L47A 2WZYA 2W8GA 4QACA 3TLUA 4NZBA 1OEDB 4ALXA 4ZRUA 4D01A 4TNVA 2YOEA 4TWFA 2XNVA 4UM1A 2BJ0A 4TWHA 4NPPA 4BFQA 4Z91A 2WN9A 4XK9A 2UZ6A 4EZ1A 4DBMA 5AFMB 2Y57A 2X00D 1OEDA 3P50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J0Z A;  3RQU A;  3C84 A;  3JAD A;  3U8L A;  4QAA A;  2XQ9 A;  3IGQ A;  2XYS A;  4ZR6 A;  2W8F A;  3PEO A;  3U8M A;  4LML A;  2XNT A;  4Z90 A;  3UU6 A;  5HCM A;  4UM3 P;  2YN6 A;  4IL9 A;  4HQP A;  3WIP A;  5J5F A;  2XQ4 A;  3WTH A;  3EAM A;  5BW2 A;  2WNL A;  5LG3 A;  3TLV A;  4AFG A;  3TLW A;  2XQ6 A;  3WTI A;  5AFM A;  5AFN A;  3RI5 A;  4HFD A;  5IUX A;  2QC1 B;  3SH1 A;  4PIR A;  2XQ7 A;  5HEJ A;  4COF A;  2M6B A;  4ZJT A;  5LXB A;  5J5I A;  2Y54 A;  4ZZB A;  2BYP A;  2XYT A;  5L4E A;  5AFJ A;  3RIA A;  4QH1 A;  3UU4 A;  4B5D A;  3ZKR A;  2XZ6 A;  5KZU A;  4IRE A;  1OED E;  2BG9 C;  5HCJ A;  3JAE A;  4QAB A;  4UY2 A;  5J5G A;  3WTM A;  2BG9 A;  3RHW A;  4TWD A;  2BYS A;  4ILC A;  4QH4 A;  3UQ4 A;  2LKG A;  2YKS A;  3SQ9 A;  3ZDH A;  3WTK A;  1UW6 A;  4ZK4 A;  4LMK A;  3U8K A;  2XQ8 A;  2BYR A;  2PGZ A;  3RQW A;  2WNJ A;  3U8N A;  3ZDG A;  5SYO A;  2WNC A;  2Y7Y A;  4UXU A;  5KE4 A;  2M6I A;  5CO5 A;  2LKH A;  4A97 A;  5CFB A;  4TNW A;  4AFT A;  4ZK1 A;  3EHZ A;  4HFC A;  4FRR A;  3WTL A;  1OED C;  5L4H A;  2LLY A;  3UU8 A;  3SIO A;  4HFB A;  1UX2 A;  4A98 A;  4F8H A;  4ILB A;  3SQ6 A;  4WV9 A;  4ZZC A;  3P4W A;  3WTN A;  2BR7 A;  3UU3 A;  4QH5 A;  1I9B A;  2BYN A;  3UQ7 A;  3GUA A;  2KSR A;  5J5H A;  3UUB A;  2MAW A;  5HEG A;  1UV6 A;  2X00 A;  5JME A;  4UM3 A;  4XHE A;  2XNU A;  5HEO A;  4AFH A;  3T4M A;  5HEU A;  2BYQ A;  2VL0 A;  3WTO A;  4HFE A;  2LM2 A;  3PMZ A;  3U8J A;  5AFH A;  4HFI A;  2PH9 A;  4ZJS A;  4BQT A;  3RIF A;  3WTJ A;  5FJV A;  3TLS A;  5TVC A;  3EI0 A;  2YMD A;  4UM3 S;  4IL4 A;  4HFH A;  5BP0 A;  2YME A;  2Y58 A;  2BR8 A;  5AFK A;  2XQ3 A;  5HEH A;  3LSV A;  4X5T A;  3C79 A;  2XQA A;  5AIN A;  5BRX A;  2ZJU A;  2ZJV A;  3TLT A;  5AFL A;  3JAF A;  2C9T A;  2XQ5 A;  2Y56 A;  4LMJ A;  4ILA A;  2BG9 E;  2XZ5 A;  2BG9 B;  3UU5 A;  5L47 A;  2WZY A;  2W8G A;  4QAC A;  3TLU A;  4NZB A;  1OED B;  4ALX A;  4ZRU A;  4D01 A;  4TNV A;  2YOE A;  4TWF A;  2XNV A;  4UM1 A;  2BJ0 A;  4TWH A;  4NPP A;  4BFQ A;  4Z91 A;  2WN9 A;  4XK9 A;  2UZ6 A;  4EZ1 A;  4DBM A;  5AFM B;  2Y57 A;  2X00 D;  1OED A;  3P50 A; 
#chains in the Genus database with same CATH topology
 2KWH A;  2LSJ A;  2W8F A;  2W66 A;  5FY7 A;  1FJG T;  3K8P C;  3HA4 A;  3WIP A;  2XQ4 A;  2VKO A;  2VQF T;  2L9Q A;  3HI2 A;  3RPU A;  4ADZ A;  5JDH A;  1X9B A;  2Q9Q B;  2E9X D;  2Y54 A;  5FL1 A;  1KF6 A;  2HH7 A;  2CHN A;  2NTX A;  2UXB T;  3I9Y A;  2CHO A;  3B57 A;  4TV8 E;  3ZMZ B;  4ZK4 A;  3D0T A;  5CB4 E;  2XQ8 A;  2PGZ A;  1G8X A;  3NKZ A;  4MAL A;  3RH3 A;  2WNC A;  4CI3 B;  3DTO A;  2X0H A;  4IE4 A;  4IIJ E;  3C51 A;  4L9I A;  4ZK1 A;  3EHZ A;  2LSK A;  3I0Q A;  2MPK A;  4ILB A;  2IIU A;  4IHJ E;  2XAQ B;  2WSS V;  4DBQ A;  2W63 A;  3QB5 A;  5LP6 E;  2RP4 A;  4EEB A;  1SHZ C;  1WYB A;  5JDQ A;  5J2T E;  4HFI A;  4X64 T;  3CK6 A;  5AQT B;  5GON E;  3BQI A;  3TLT A;  2B76 A;  4HGA A;  2XAG B;  3FZM B;  2W61 A;  2WZY A;  3AA1 B;  2RPA A;  2W67 A;  4J2C A;  2L8K A;  2VB6 A;  4KHZ F;  1HNX T;  3NZQ A;  1ZV4 X;  3LJC A;  2IDO B;  4XK9 A;  1SUM B;  4EYY R;  4L0R A;  4BJM A;  2H7O A;  2XQ9 A;  4ZR6 A;  3PEO A;  2WMO A;  1YD8 G;  3BQK A;  4GK5 E;  4PIR A;  3EVY A;  2M6B A;  3ZEF B;  2JQH A;  2E5L T;  5AFJ A;  3ZKR A;  5F8P A;  4QAB A;  2KWI B;  3RIU A;  4NIQ A;  2NP9 A;  2YKS A;  5J1G A;  3U8K A;  3ZPO A;  2PTF A;  3RYC E;  4HKA A;  2JQQ A;  3CQX C;  5LB7 B;  3MAC A;  4DR5 T;  4YY3 T;  3SQ6 A;  4WV9 A;  5KDM C;  4CQI A;  1E7P A;  2EHO C;  3PUS A;  2PFV A;  3L09 A;  5FXW A;  1YW0 A;  4C91 A;  4XHE A;  3ABV A;  1HX8 A;  1HG5 A;  1ZHC A;  1XNQ T;  4I4T E;  1N36 T;  2V7M A;  1IJ6 A;  4YSX A;  2N1G A;  1LKX A;  4UR9 A;  1WLX A;  3IBP A;  4ILA A;  2XZ5 A;  4UV8 B;  4YTM A;  3SFE A;  4JI2 T;  2XSA A;  1HF8 A;  2H88 A;  2J1D G;  1WFD A;  1BR4 A;  3AEC A;  3JC6 D;  2KLQ A;  3O1J A;  4DV0 T;  2UXN B;  4QAA A;  4AKI A;  4O8S A;  3LBX B;  2XAH B;  2LE8 A;  3JC6 C;  3G06 A;  5LHH B;  5LG3 A;  1JNZ A;  2FJA A;  5AQN B;  1OXZ A;  3ZLI A;  2BYP A;  2W4X A;  5AQO B;  1J1J A;  2X9H A;  2QA7 A;  3HKC E;  1WR0 A;  3N9P A;  5J5G A;  3WTM A;  2DNX A;  2WU5 A;  4WW0 A;  2XAS B;  3M3Z B;  4AKR B;  3RGL A;  3ONJ A;  1X79 A;  3SFD A;  4B3M T;  3H3A A;  4EXT A;  3LBX A;  4AKH A;  2NWB A;  2JMK A;  4U33 A;  2CWO A;  1UX2 A;  2K3W A;  3PUA A;  5LXT E;  4EZ4 A;  4CZZ B;  4B3R T;  4CXY A;  3GUA A;  3EDU A;  5HEO A;  2YK0 A;  3AAE B;  5EK4 A;  2ACX A;  2YMD A;  3AA0 B;  4IE6 A;  1WYC A;  2BR8 A;  5AIN A;  2XQA A;  5JVD E;  2XQ5 A;  5DJQ C;  4DID B;  4I0U A;  4OX9 T;  3T1H T;  5HWY A;  5JR9 C;  2V26 A;  3ONX A;  3K1S A;  4LF6 T;  2WDR A;  4M1P A;  3RX6 A;  4EZ1 A;  2N2N A;  4Q25 A;  5AFM B;  3U8L A;  3Q2M A;  2PJQ A;  2W0G A;  4U7Y A;  5AQP B;  3ZT5 A;  3ZSS A;  2WU2 A;  4YJ3 E;  4MLK A;  2Z6E A;  2VUR A;  3GWH A;  4OHF A;  4HFD A;  4QHO A;  2LEH A;  3KVB A;  3AAI A;  1W0B A;  1YKE B;  2BYS A;  1MIV A;  1MIW A;  4AI6 A;  3DJB A;  4ZS2 A;  4ZI2 D;  3CVR A;  4DV3 T;  1XZY A;  2I59 A;  3FZK B;  2Y7Y A;  4UXU A;  4OYJ A;  1S94 A;  1AJ3 A;  1OED C;  2NR4 A;  4WNK A;  3LG7 A;  1S35 A;  3N2K E;  2L3L A;  4K0U A;  4B3S T;  3V5U A;  2BR7 A;  1XMQ T;  2QYW A;  4IDP A;  3N9L A;  5LGU B;  1G73 A;  2E5V A;  5F5W A;  5HEG A;  5JME A;  1EZ3 A;  3EDV A;  1D1A A;  1N34 T;  4IL4 A;  2PG8 A;  3C4X A;  3WAJ A;  4PW8 A;  3C4Z A;  1FIO A;  2K5B B;  4EED A;  2VKH A;  2JJ9 A;  3OBV E;  2ZLY A;  5EZY E;  1CHU A;  2JQ9 A;  2X66 A;  3O9X A;  2IHR 1;  5L2L A;  4AKG A;  2V6Y B;  2I6H A;  4D01 A;  2YOE A;  3N9Q A;  2CBI A;  2WB5 A;  2RA1 A;  5M4Y A;  4KX6 A;  4I43 B;  2DI4 A;  2Y57 A;  5JDG A;  2IC6 A;  1T72 A;  5JR9 B;  5AFU L;  3WTH A;  5ABH A;  3AEB A;  5AFM A;  3PTR B;  5AQG B;  5LJN A;  2QC1 B;  3GN5 B;  1T98 A;  3VR8 A;  1HR0 T;  5J5I A;  4GYS A;  2E9X B;  4B5D A;  3VKG A;  2CRB A;  4DR1 T;  2YDS A;  1UW6 A;  1MMA A;  4U2Y A;  5ETW A;  2LSI A;  2VK9 A;  5LGN B;  4IDZ A;  2DHR A;  4O4L E;  2ODV A;  2C5I T;  2DL1 A;  4YJ2 E;  3K3O A;  3P4P A;  4Z8X A;  5ABG A;  1WCR A;  4EGW A;  3DP7 A;  4ZEY A;  2JMH A;  3ZJ2 A;  3FBZ A;  4CI1 B;  5AQM B;  3RC3 A;  5L3D B;  4DBR A;  4DVD A;  5KXJ A;  1E1H B;  2VL0 A;  2NOX A;  3RYH E;  4JI1 T;  3PMZ A;  3BQL A;  2LHN A;  2HPL A;  2UUA T;  3EI0 A;  3AE4 A;  4UM3 S;  2ZM2 A;  2CLY C;  1WR6 A;  1Y64 B;  5AFL A;  3JAF A;  1VCT A;  3RRC A;  1D0Z A;  3PUQ A;  1SA0 E;  5F3J A;  1KFY A;  3FXE B;  5FXX A;  4NZB A;  5JRC B;  3RKO A;  3OTO T;  1UUR A;  4DBM A;  2V7K A;  3P50 A;  4PJM A;  4CXW A;  3C84 A;  4Z90 A;  1IZN B;  5JH7 E;  2IW5 B;  4K0K T;  4U74 A;  3AE2 A;  1D1C A;  3HL6 A;  5IUX A;  1HCI A;  4DUZ T;  3SS1 A;  3NRX A;  1BR0 A;  2XQY A;  4IT4 A;  3JAE A;  4TV9 E;  4LF4 T;  2LKG A;  1HTJ F;  3RQW A;  2VWA A;  4JV5 T;  4F6R C;  3R84 B;  4XZC A;  4CN6 A;  4TZ4 C;  1FMW A;  3R6N A;  3E0Z A;  5AQQ B;  2X0L B;  3SOL A;  2WDV A;  2JIW A;  3UQ7 A;  2JPF A;  5E0O A;  3TKL B;  5LGT B;  1T8B A;  5JDM A;  5AQJ B;  5AQL B;  4HFE A;  4QX8 B;  5AFH A;  2H7V C;  1NWM X;  3N5L A;  4DR3 T;  3AE1 A;  1HNZ T;  4X1K E;  1ZKE A;  3IHR A;  2CLY B;  4NXN T;  5FY1 A;  2CXL A;  5LNK A;  4DV7 T;  3TLU A;  3EAB A;  1D0Y A;  4EZH A;  4FJO A;  3PV0 F;  3UUX B;  4IDQ A;  4AIS A;  2LRL A;  1MMD A;  2BS4 A;  2YU2 A;  3KIN B;  3MZK B;  5FKY A;  5AQK B;  5EK3 A;  3J9X 1;  1V9D A;  2C0S A;  2V1D B;  3TLV A;  2XQ6 A;  3L3P A;  2AE9 A;  3SH1 A;  5HEJ A;  4OYK A;  3NVO A;  3T1Y T;  5KZU A;  4P1N A;  2BG9 C;  3NBX X;  3I0O A;  5IWA T;  4LFB T;  4HWF A;  2H89 A;  1CUN A;  4ILC A;  3ZDH A;  1N32 T;  3X1D A;  2IC9 A;  3E08 A;  2BS3 A;  1KNZ A;  3LK4 2;  4H9O C;  4U3C A;  4ILU A;  4KMC A;  4TNW A;  2KND A;  2I0M A;  3MJX A;  4AQF A;  5L3B B;  2HPJ A;  2E9X A;  3N9N A;  2BYN A;  2K9A A;  4UM3 A;  4CI2 B;  2HHH T;  3Q5W A;  3T4M A;  3CX8 B;  2W62 A;  4O2B E;  2E8I A;  2CXF A;  4GYR A;  4UVC B;  1I6Z A;  3I9W A;  5FJV A;  1I94 T;  3RYF E;  2FBW A;  2XQ3 A;  3AEA A;  2E2A A;  5CA1 E;  3O4X E;  1XDO A;  4LF8 T;  4G63 A;  2YDQ A;  2XNV A;  4Z91 A;  4I55 E;  2X9W A;  4HE8 A;  3OYX A;  2X9X A;  1UUS A;  2MTQ A;  3UU6 A;  2LRK A;  4HQP A;  2NTY A;  4H9S E;  4U7I A;  4X1I E;  2D2S A;  4AKL A;  3FZF B;  3RI5 A;  2DLR A;  2WP9 A;  4JI3 T;  3GA8 A;  4I50 E;  5FVK A;  2QRX A;  4EIW A;  2FJB A;  3P4S A;  3RHW A;  4JI8 T;  3MA9 A;  4DMW A;  3PUY F;  5CO5 A;  4X1Y E;  3HKB E;  1YXR A;  2DCF A;  3UU8 A;  4HFB A;  2JRK A;  4ZZC A;  3P4W A;  3CQG B;  4QH5 A;  3KBU A;  2DWG A;  4BA9 A;  3QK6 A;  3RF1 A;  4H63 V;  2MAW A;  2F4V T;  4FI5 A;  4YLH A;  2C5K T;  3UT5 E;  1J5E T;  5BMV E;  3VR9 A;  4DR7 T;  4E7S A;  5KX5 E;  3RKG A;  2Y58 A;  4AQY T;  1GQE A;  5AFK A;  4YXD A;  2ZJV A;  2C9T A;  5LMN T;  2LM9 A;  2PBI A;  4UF0 A;  2E9X C;  4KP3 C;  4B3T T;  4ANJ A;  2BJ0 A;  4EB6 E;  3ZJ1 A;  3QUJ A;  2X00 D;  1OED A;  5J0Z A;  2LOS A;  5AQR B;  5JQG E;  2J47 A;  3P8C D;  3ZYK A;  3C64 A;  3TLW A;  5AFN A;  2MYS A;  4OFZ A;  5C3J A;  2D0T A;  3B5M A;  3UUN A;  2A3D A;  2YEV C;  2XYT A;  2D9D A;  4TN7 B;  5HCJ A;  4CN1 A;  2VKJ A;  2UUC T;  3UUL A;  5LHI B;  3H37 A;  3RLF F;  4E7Z A;  5L3E B;  5IHY A;  4PJJ A;  4X66 T;  4ASK A;  3ZYM A;  5CFB A;  4A56 A;  3AEF A;  5L4H A;  3ONL C;  3ETU A;  4QKN A;  4DV4 T;  4CXX A;  3GMI A;  5J2U E;  5J5H A;  3PUV F;  5FNV E;  4AFH A;  2BKP A;  2BYQ A;  4QXH B;  2KZ7 B;  2KT9 A;  4JEH B;  3AEE A;  4NXM T;  4PJL A;  3ZC1 A;  2ZM8 A;  2MBG A;  2XHE B;  1DU2 A;  2V6X A;  3ZMT B;  3C79 A;  3O1I A;  1KK7 A;  3CKD A;  4LMJ A;  3CPZ A;  1MIY A;  2BG9 B;  3PUR A;  5L47 A;  1U4Q A;  2X0Y A;  4NUV A;  2W8G A;  3A5X A;  4ZRU A;  3AXJ A;  2CM0 A;  4H9Q C;  2WN9 A;  5A1L A;  5DAB A;  3OVU A;  2BZB A;  5TVC A;  3SRZ A;  3RQU A;  3JAD A;  4WBO A;  4MFR A;  3OKQ A;  5AQF B;  3F57 A;  2A9U A;  4AFG A;  3WTI A;  3AEG A;  3ANW A;  5LBQ B;  4GKJ T;  1VRB A;  4ZJT A;  4KUM B;  4QH1 A;  1D0X A;  3ZN0 B;  3QNU A;  4UY2 A;  3AAA B;  4IDO A;  3PU3 A;  3WTK A;  4JLE A;  1M7K A;  2IML A;  4LMK A;  4DR4 T;  1SE7 A;  3PU8 A;  4A97 A;  5DQV A;  3ZN1 B;  3B13 A;  2V7I A;  1KNR A;  2Y8D A;  3FXD B;  4IE0 A;  3PDY A;  4TX5 A;  3RRW A;  2A72 A;  2CWY A;  4ZI7 E;  2DWK A;  2V5D A;  2VVN A;  3FZL B;  5EK2 A;  2LT3 A;  1UX4 A;  4DV6 T;  3ZST A;  1VCS A;  5FMN A;  5LJM A;  3MXZ A;  3UTK A;  3U8J A;  2KIN B;  4HWD A;  2EHO D;  4H9R C;  1B7T A;  5BP0 A;  4QX7 B;  1Z8U A;  2BBJ A;  2UXX B;  3CX6 B;  5HEH A;  2X67 A;  5JDL A;  5LYJ E;  4ZHQ E;  5CA0 E;  3UU5 A;  5JDN A;  4LF5 T;  4U72 A;  4EOZ B;  4GKK T;  2GK9 A;  5L3C B;  4TUY E;  1YKH B;  4UEL A;  4BFQ A;  3OYZ A;  2K24 A;  2V6Y A;  2LSG A;  2IAK A;  4YHH T;  3ZCI A;  4O4J E;  1XWM A;  3QOF A;  2XNT A;  4IL9 A;  2QVA A;  1XDP A;  2XJ7 A;  3T8O A;  5BW2 A;  3P7I A;  5ADX L;  4PJN A;  5H6R B;  3UFG A;  1IBK T;  4U2Z A;  4COF A;  3ZT6 A;  5LXB A;  2KXP B;  3UU4 A;  5FYM A;  2XZ6 A;  3AB3 B;  1NEK A;  1Z0P A;  4TWD A;  1IBM T;  3IA3 A;  2XPK A;  3SQ9 A;  4LF9 T;  2WNJ A;  4JEU B;  2Q9Q C;  3L39 A;  5SYO A;  2UXC T;  1HNW T;  4ISS A;  4IGU A;  4YTP A;  3ESL A;  4HTE A;  3ZMV B;  3PUX F;  3Q9D A;  2LLY A;  1IJ5 A;  2X51 A;  4H9N C;  5HAX A;  3WTN A;  1BR1 A;  1LRZ A;  1Y01 A;  4DR6 T;  1YQ3 A;  3U3I A;  4JI5 T;  4BJN A;  3FZH B;  2X00 A;  3UUM A;  5LMU T;  4O4I E;  5C2T A;  2BKO A;  4DV5 T;  4HFH A;  5AQU B;  2Y56 A;  2FJE A;  2BG9 E;  2Y48 B;  3ZT7 A;  3VRA A;  3MKD A;  2BVM A;  4ZOL E;  3UFE A;  3CQC B;  4HWC A;  1L0V A;  3LFM A;  4KHP T;  4NPP A;  4X20 E;  5ABF A;  3HKD E;  3E22 E;  4PFP A;  2OLT A;  3VRB A;  5AQS B;  4EYU A;  5LCY A;  3KDS E;  4KBM B;  2KMF A;  2LSY A;  5FXZ A;  2UXD T;  2K48 A;  2XM1 A;  3HKE E;  1OWA A;  3N2O A;  3J7Y q;  2LJL A;  4PK4 A;  4WZX A;  5C8Y E;  4EV6 A;  4ZI3 D;  2CA5 A;  2WMN A;  2ZMA A;  1NEN A;  4QXB B;  4UIG A;  4H63 H;  2WM9 A;  3I1A A;  5KE4 A;  1MNE A;  1BR2 A;  2CMR A;  4AQF C;  4FRR A;  2V7J A;  4UEM A;  1QSD A;  3PUW F;  4A98 A;  2LOP A;  2D5U A;  2XZE A;  3Q5D A;  3N9M A;  2WWU A;  4YSZ A;  3UUB A;  3WI3 A;  5HXS A;  2XNU A;  3AE7 A;  3PE0 A;  3WTO A;  3CX7 B;  3P4Q A;  3AXJ B;  2PH9 A;  3WTJ A;  2J62 A;  4LFC T;  2QGS A;  3K3N A;  2ZJU A;  3AVR A;  4XAX B;  3AE5 A;  5JRC A;  2N9D A;  3AE3 A;  3KBT A;  2BVL A;  2WDQ A;  2OV9 A;  4TWF A;  2CXD A;  4B6X A;  2HN1 A;  3AA7 B;  4UVB B;  5AQI B;  3C98 B;  1UK5 A;  4UM3 P;  2YN6 A;  3C4W A;  3A8Y C;  2WZI A;  3FHN A;  5LBM A;  1UCU A;  2VKD A;  2XQ7 A;  3CIR A;  2D0U A;  4ZZB A;  3RIA A;  1UGO A;  4HN9 A;  2BG9 A;  1VOM A;  5FVL A;  3UQ4 A;  4MHC A;  4UV9 B;  4DMV A;  1W9R A;  4O4H E;  2XAF B;  3KFW X;  3C50 A;  2NW8 A;  5FXV A;  4AIU A;  4AFT A;  3RIU C;  4EAH A;  4F8H A;  1YQ4 A;  2NW7 A;  4DND A;  3KV4 A;  2HN2 A;  3H3M A;  3ZYL A;  1XNR T;  3PJA J;  3GN5 A;  3M65 A;  1QLB A;  4CN4 A;  4AXP A;  3KV9 A;  3SWH A;  4PAG A;  3W15 B;  3TLS A;  3AA6 B;  3MK7 C;  4PNI A;  2YME A;  3LSV A;  2CEA A;  1ZOY A;  4PK6 A;  2EHO B;  3LDQ B;  4LF7 T;  3KVA A;  1ZEE A;  1E2A A;  2P9B A;  3VKH A;  4JYA T;  3WAK A;  4ZI2 C;  4DV1 T;  4IE5 A;  5LHG B;  2FUP A;  3F2E A;  3ZMS B;  4P0A A;  3P4R A;  5L3F B;  2WS3 A;  1ZP0 A;  1FMV A;  2G0U A;  2VAS A;  5HCM A;  1US7 B;  4PK5 A;  5J5F A;  3U78 A;  5AQH B;  2XUE A;  2UUB T;  3EAM A;  3JCF A;  1IAP A;  2VVS A;  4A5X A;  4HWH A;  1KEY A;  1WRD A;  2ES0 A;  1QUU A;  4IRE A;  2WY2 A;  3K3Q C;  5JRE A;  1M62 A;  1UX5 A;  2FJD A;  3IF8 B;  3AE9 A;  3OJA A;  1W09 A;  4OK0 A;  2ZM0 A;  2ZM6 T;  3ZDG A;  3Q5E A;  3CWZ B;  4DO0 A;  2M6I A;  2XSB A;  3VU7 H;  2LKH A;  4X65 T;  2IUB A;  3WTL A;  4GK0 E;  2J4G A;  5HYA A;  5H6Q B;  3A7M A;  3S4U A;  2W00 A;  3ETV A;  5HEU A;  2Y6X A;  4MBQ A;  5FP3 A;  2Q9Q D;  4ZJS A;  4BQT A;  3RIF A;  1MMG A;  4JBW F;  1O3X A;  5BRX A;  1H7C A;  2R6G F;  4YTN A;  3RC8 A;  2CCQ A;  5IYZ E;  2MOZ A;  4P0B A;  1U5P A;  1OED B;  3AE6 A;  4ALX A;  4TNV A;  2VL8 A;  1N33 T;  4V1A v;  2YDR A;  2W2U A;  3IGQ A;  2CPT A;  3U8M A;  2V5C A;  4L5G A;  3QB5 K;  3O1H A;  3CML A;  3FBL A;  5HXR A;  2WWV A;  2WNL A;  2M67 A;  2WBL A;  2A2F X;  2B1E A;  4NUU A;  4HWI B;  4BAY B;  1OED E;  1XMO T;  5BR8 T;  2SPC A;  2UU9 T;  4YFS A;  2AXD S;  5LA6 E;  3VHL A;  1W0A A;  5JDF A;  4PFO A;  5HXC A;  4P09 A;  4LFA T;  4YSY A;  3RYI E;  2WCA A;  3V5S A;  5KMG P;  2EHO A;  1T7S A;  2ACZ A;  5FY0 A;  1I9B A;  4IST A;  4DR2 T;  2BKN A;  4DUY T;  1UV6 A;  4JI4 T;  3ZCJ A;  2XM2 A;  4IE7 A;  3OPC A;  4AQG A;  3PJA A;  3N2G E;  1HX1 B;  1HG2 A;  3ZMU B;  4C90 A;  2CE7 A;  2XAJ B;  3Q5X A;  4GOU A;  5JTG A;  3NZP A;  3N9O A;  4H9P C;  2Q9Q A;  4YHJ A;  4JUY A;  2JQK A;  4KI0 F;  2WZH A;  4HEA A;  3PUZ F;  4TWH A;  4HFV A;  1FEW A;  2C5J A;  3QC9 A;  3AVS A;  3F31 A;  2YU1 A;  3PUG A;  2XYS A;  5DQW A;  4LML A;  3NWI A;  5ABE A;  3ANW B;  1HS7 A;  1LVF A;  2BDE A;  2X68 A;  1J5W A;  3KV6 A;  4ERR A;  2WQY A;  3LK3 B;  4O2A E;  5AQV B;  3KV5 A;  4QWN B;  5LOV E;  5FL0 A;  2XY8 B;  4U31 A;  4JI6 T;  5L4E A;  4JI7 T;  2LHR A;  3IEE A;  4N78 D;  4IDN A;  2XTL A;  2YIN A;  4UF0 B;  3AE8 A;  4YT0 A;  4ZS3 A;  2NW9 A;  5CGM A;  4XBF B;  4QH4 A;  4UXN B;  2H3R A;  3FB2 A;  5HXE A;  2ODU A;  2BYR A;  3U8N A;  1NAF A;  2V8S V;  5TAO A;  4QXC B;  2BS2 A;  2V7L A;  4HFC A;  1IBL T;  4X62 T;  5HXH A;  3SIO A;  1D1B A;  2WAU A;  2BBH A;  3UU3 A;  5ABF B;  5LG4 A;  2KSR A;  1MND A;  2CBJ A;  4G2A A;  4WYV A;  3ZC0 A;  1R8I A;  2LM2 A;  1JNR A;  1LVK A;  4DV2 T;  4WBN E;  5JR9 A;  3HR0 A;  3AED A;  4X5T A;  1HFA A;  2OA5 A;  1KNP A;  5CJ5 A;  5HWX A;  1MMN A;  4JI0 T;  2VQE T;  4QAC A;  4GIW A;  4ZI3 C;  3EUH A;  4ZXL A;  2X9Y A;  3NRY A;  3LK2 B;  4UM1 A;  5L3G B;  4UVA B;  3BK9 A;  3L8R A;  2UZ6 A; 
#chains in the Genus database with same CATH homology
 5J0Z A;  3RQU A;  3C84 A;  3JAD A;  3U8L A;  4QAA A;  2XQ9 A;  3IGQ A;  2XYS A;  4ZR6 A;  2W8F A;  3PEO A;  3U8M A;  4LML A;  2XNT A;  4Z90 A;  3UU6 A;  5HCM A;  4UM3 P;  2YN6 A;  4IL9 A;  4HQP A;  3WIP A;  5J5F A;  2XQ4 A;  3WTH A;  3EAM A;  5BW2 A;  2WNL A;  5LG3 A;  3TLV A;  4AFG A;  3TLW A;  2XQ6 A;  3WTI A;  5AFM A;  5AFN A;  3RI5 A;  4HFD A;  5IUX A;  2QC1 B;  3SH1 A;  4PIR A;  2XQ7 A;  5HEJ A;  4COF A;  2M6B A;  4ZJT A;  5LXB A;  5J5I A;  2Y54 A;  4ZZB A;  2BYP A;  2XYT A;  5L4E A;  5AFJ A;  3RIA A;  4QH1 A;  3UU4 A;  4B5D A;  3ZKR A;  2XZ6 A;  5KZU A;  4IRE A;  1OED E;  2BG9 C;  5HCJ A;  3JAE A;  4QAB A;  4UY2 A;  5J5G A;  3WTM A;  2BG9 A;  3RHW A;  4TWD A;  2BYS A;  4ILC A;  4QH4 A;  3UQ4 A;  2LKG A;  2YKS A;  3SQ9 A;  3ZDH A;  3WTK A;  1UW6 A;  4ZK4 A;  4LMK A;  3U8K A;  2XQ8 A;  2BYR A;  2PGZ A;  3RQW A;  2WNJ A;  3U8N A;  3ZDG A;  5SYO A;  2WNC A;  2Y7Y A;  4UXU A;  5KE4 A;  2M6I A;  5CO5 A;  2LKH A;  4A97 A;  5CFB A;  4TNW A;  4AFT A;  4ZK1 A;  3EHZ A;  4HFC A;  4FRR A;  3WTL A;  1OED C;  5L4H A;  2LLY A;  3UU8 A;  3SIO A;  4HFB A;  1UX2 A;  4A98 A;  4F8H A;  4ILB A;  3SQ6 A;  4WV9 A;  4ZZC A;  3P4W A;  3WTN A;  2BR7 A;  3UU3 A;  4QH5 A;  1I9B A;  2BYN A;  3UQ7 A;  3GUA A;  2KSR A;  5J5H A;  3UUB A;  2MAW A;  5HEG A;  1UV6 A;  2X00 A;  5JME A;  4UM3 A;  4XHE A;  2XNU A;  5HEO A;  4AFH A;  3T4M A;  5HEU A;  2BYQ A;  2VL0 A;  3WTO A;  4HFE A;  2LM2 A;  3PMZ A;  3U8J A;  5AFH A;  4HFI A;  2PH9 A;  4ZJS A;  4BQT A;  3RIF A;  3WTJ A;  5FJV A;  3TLS A;  5TVC A;  3EI0 A;  2YMD A;  4UM3 S;  4IL4 A;  4HFH A;  5BP0 A;  2YME A;  2Y58 A;  2BR8 A;  5AFK A;  2XQ3 A;  5HEH A;  3LSV A;  4X5T A;  3C79 A;  2XQA A;  5AIN A;  5BRX A;  2ZJU A;  2ZJV A;  3TLT A;  5AFL A;  3JAF A;  2C9T A;  2XQ5 A;  2Y56 A;  4LMJ A;  4ILA A;  2BG9 E;  2XZ5 A;  2BG9 B;  3UU5 A;  5L47 A;  2WZY A;  2W8G A;  4QAC A;  3TLU A;  4NZB A;  1OED B;  4ALX A;  4ZRU A;  4D01 A;  4TNV A;  2YOE A;  4TWF A;  2XNV A;  4UM1 A;  2BJ0 A;  4TWH A;  4NPP A;  4BFQ A;  4Z91 A;  2WN9 A;  4XK9 A;  2UZ6 A;  4EZ1 A;  4DBM A;  5AFM B;  2Y57 A;  2X00 D;  1OED A;  3P50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...