3EI0A

Structure of the e221a mutant of the gloebacter violaceus pentameric ligand gated ion channnel (glic)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYAANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title Structure of a potentially open state of a proton-activated pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein
total genus 79
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3ei0A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3ei0A01
2MAWA 5HEHA 1OEDE 5AFHA 4WV9A 2Y54A 1OEDA 2BJ0A 4AFHA 4QACA 5FJVA 2BYPA 2LKHA 3ZDHA 3WTOA 3EHZA 2WNJA 1UX2A 3EAMA 4TNWA 3JAEA 5AFMA 2BYQA 5L4HA 2BR7A 4LMLA 2VL0A 4HFIA 2XQ5A 4QH4A 3JADA 4TNVA 4EZ1A 4ILBA 4NZBA 2PH9A 1UV6A 3U8LA 5AINA 4TWDA 2WNLA 2W8GA 3TLSA 2YKSA 3RIFA 3WIPA 4LMKA 2QC1B 5HCMA 5HEJA 3U8MA 3WTJA 5HEGA 2LM2A 3IGQA 2BG9C 5L47A 4LMJA 4ALXA 3ZDGA 2X00A 2XQ8A 3PEOA 4IREA 3TLVA 2XNTA 4ZK1A 4QH1A 4X5TA 2BG9B 5KE4A 5AFKA 4HFEA 3SIOA 3RIAA 2YN6A 2XQ4A 2YMDA 3GUAA 2M6IA 2XQAA 4BFQA 5HEUA 2XZ5A 5TVCA 3SQ6A 4UM3A 3SQ9A 3RQUA 3U8KA 4ZJTA 5IUXA 4QH5A 2XQ3A 4HQPA 4ZR6A 4HFHA 1OEDC 2YMEA 4ILCA 5L4EA 2ZJVA 3WTKA 4B5DA 2YOEA 2XYSA 2BR8A 4ZK4A 2XQ7A 3SH1A 1OEDB 4ZZBA 2BYSA 5AFJA 4A98A 3RI5A 5J5GA 5J5IA 3T4MA 2XNUA 3ZKRA 2Y56A 5SYOA 2ZJUA 3TLTA 4BQTA 2XQ9A 3UU6A 4PIRA 4Z91A 5J5FA 5KZUA 4A97A 5LXBA 4UXUA 3UU4A 2XYTA 2XZ6A 3WTMA 5BP0A 5AFMB 4HFBA 2Y7YA 4DBMA 1I9BA 5AFLA 2Y58A 5BW2A 3UQ4A 2PGZA 3UU5A 3PMZA 3UU3A 3UU8A 2UZ6A 3WTIA 3U8JA 2XNVA 4AFGA 3TLWA 5HCJA 5HEOA 4XHEA 3P50A 2LKGA 4UM3P 4ZJSA 3C79A 4UY2A 4D01A 3EI0A 4UM3S 3P4WA 5JMEA 4HFDA 3WTNA 5J5HA 4XK9A 4UM1A 2W8FA 2BYRA 4COFA 3UUBA 4F8HA 2BG9E 3JAFA 5J0ZA 4Z90A 2XQ6A 2BG9A 4IL4A 3RHWA 2WNCA 3C84A 4QABA 5CFBA 5CO5A 2Y57A 5BRXA 4ZZCA 4ZRUA 2WN9A 4TWHA 4FRRA 2C9TA 2X00D 3WTHA 4AFTA 2BYNA 3U8NA 4ILAA 4IL9A 5AFNA 3TLUA 2KSRA 4NPPA 2WZYA 4QAAA 3UQ7A 5LG3A 2LLYA 4HFCA 3WTLA 3LSVA 4TWFA 3RQWA 2M6BA 1UW6A
chains in the Genus database with same CATH superfamily
2XAQB 1IZNB 1XDPA 1N36T 2WMOA 3T8OA 3AB3B 2BKNA 4C91A 2NTYA 3JAEA 5AFMA 4NZBA 1UV6A 5JQGE 3AEBA 4LMKA 3Q5EA 2A72A 2E5VA 2R6GF 2VVSA 2BG9C 3EDVA 4LMJA 3IEEA 1W0AA 5LG4A 3AVRA 3Q9DA 3CVRA 3U3IA 2WWVA 2PBIA 3QUJA 2M6IA 1WYCA 2XZ5A 5AQKB 4UVAB 5FNVE 4BAYB 4ISTA 5LJNA 4I0UA 3ZT6A 3MJXA 2FJBA 4AXPA 3SH1A 1MIYA 2YEVC 1JNZA 4WBOA 1U5PA 5FYMA 4AKIA 5H6RB 2JQ9A 2LSGA 3KVBA 5BW2A 2D2SA 1D0XA 2V6YA 2H89A 2WDQA 2KLQA 3ONJA 3EI0A 4JI1T 4OYKA 5L3FB 4P0AA 4DV1T 2ODVA 3N2KE 4XK9A 3JAFA 1HF8A 3HKDE 2WNCA 4JI2T 3HKBE 3E22E 3RYCE 3K3OA 1HG2A 1BR0A 1W9RA 2DCFA 1HR0T 3O9XA 3UQ7A 3LSVA 1OEDE 4YHJA 2H3RA 2W0GA 3ZMZB 5FJVA 3WTOA 4UVBB 4AIUA 4TNWA 3LJCA 2BR7A 4YSXA 1IBMT 4QH4A 3N9MA 5ABFB 2N2NA 1LRZA 4DR5T 3PE0A 3P4PA 4EEDA 5GONE 1XNQT 3QNUA 2DLRA 3IF8B 4X62T 2NR4A 4WBNE 2EHOC 3N9QA 2RP4A 4KHPT 3ZC1A 5ABHA 2PFVA 4MBQA 4ZR6A 2XM1A 1OXZA 3QC9A 2WAUA 4LF8T 3U78A 4ZZBA 4PK4A 5FXVA 5SYOA 3WAJA 2DL1A 3CMLA 5LXBA 3ZMTB 4UXUA 3WTMA 3QB5K 2D0UA 3O1IA 5JR9A 2L3LA 3C98B 4B3MT 4A56A 4UM3P 4YTMA 5FY1A 4FJOA 2XHEB 2CLYB 4DR2T 2UXBT 3V5SA 2JMHA 2W8FA 2BYRA 3KV9A 4EYYR 3P7IA 3KV6A 3RF1A 4ZRUA 1HNZT 1KNPA 2VKOA 4LF5T 2D5UA 3U8NA 4YFSA 4CN1A 1NEKA 2MAWA 5HEHA 3UTKA 2Q9QB 3FXEB 5AQHB 4ZI7E 3AA7B 5L3DB 1UURA 1UX5A 4EZ1A 4G2AA 1Y01A 5LGTB 4X65T 3U8LA 2V7LA 3JC6C 3WIPA 1WCRA 1T98A 5HEGA 1VCTA 3I9YA 4P0BA 4ALXA 4GOUA 3AECA 2XQ8A 2ZM2A 3A5XA 3HKEE 2YN6A 2C5JA 4MFRA 4EB6E 5TVCA 2I0MA 2XTLA 1HFAA 4V1Av 4JI8T 2OLTA 1KNRA 4ZI2C 3F57A 3PJAA 4U33A 4OYJA 3O1HA 5J5FA 4UV8B 4GKJT 3UU4A 2AXDS 2LOPA 4AKHA 3D0TA 2LJLA 2P9BA 3HA4A 2W00A 2UZ6A 3U8JA 2JQQA 4XHEA 4WW0A 2LSJA 2UU9T 4ZHQE 2M67A 4B3RT 3WTNA 4LFBT 5E0OA 4G63A 5J0ZA 5AFUL 3W15B 3NZPA 3O4XE 2E9XC 2BG9A 3E08A 3RHWA 4QABA 2YDRA 1X9BA 4I50E 2VB6A 3TLUA 3K3NA 3ANWA 4UXNB 4YSZA 4GK0E 3KV4A 1ZKEA 4U7YA 4DV6T 4YLHA 2DNXA 2QA7A 1ZOYA 2VL0A 4PJMA 4ILBA 2BBJA 2SPCA 3FZLB 3K8PC 2ZLYA 5IYZE 2QC1B 3IA3A 5LGUB 3AVSA 1MMNA 2X00A 5AQOB 3RIUC 2KNDA 3AA1B 4QXBB 2HN1A 2X9WA 4J2CA 4CN6A 2W66A 2FUPA 4DV4T 5AQJB 3LK42 5FXXA 1ZHCA 4ILUA 1J5WA 3ZT5A 2XYSA 1MNDA 3H3MA 4AQFC 4AI6A 5J2UE 1UUSA 3IHRA 4B6XA 1HCIA 2JQKA 4Z91A 3RH3A 2VWAA 2WBLA 2CE7A 2MTQA 4PFPA 1I6ZA 5JDMA 2ACXA 5ABGA 4DBRA 1US7B 3LG7A 3FZMB 3PUYF 4ZJSA 4JYAT 3AE7A 4EV6A 4BJMA 3P4SA 4MALA 3PUWF 4YHHT 2LHNA 2X68A 3OYZA 4ZS2A 2XAJB 4JV5T 2X00D 2EHOA 4U7IA 4NXNT 2WZYA 1VOMA 3RGLA 2WQYA 1XWMA 3NVOA 4MHCA 2DWGA 4I4TE 4AFHA 5F3JA 2XQYA 2D0TA 1G73A 5JREA 2HPJA 5C8YE 2WSSV 3JADA 2X0HA 2ZM8A 2QYWA 3TLSA 3GN5B 3QOFA 2XJ7A 4DR3T 4PK6A 2WM9A 2WZIA 4IREA 5C3JA 3CPZA 5AQQB 3RYHE 4EZ4A 1MMDA 3KINB 2CBIA 3SQ9A 5IUXA 2YMEA 4B5DA 1Z0PA 1W0BA 4O4HE 2EHOD 1OEDB 5AFJA 2BYSA 1D1CA 4A98A 4NXMT 3CX7B 5J5IA 3T4MA 4PJNA 3PUXF 3UUMA 1XNRT 3B5MA 3MKDA 5M4YA 2YU1A 4P09A 1KK7A 4OFZA 3UU3A 5JDNA 2CLYC 4IHJE 3TLWA 4E7SA 5HEOA 3C4ZA 4UM3S 1FIOA 1WLXA 3ESLA 1IJ6A 2UUAT 3HI2A 3L09A 1N34T 2KZ7B 4U3CA 3L8RA 4IL4A 4TWHA 3RRCA 3VRAA 2A3DA 4JEHB 3OKQA 4YJ2E 2Q9QC 3M3ZB 3N9NA 2UXDT 3LBXB 4JUYA 2K5BB 4AQYT 2JPFA 4HWFA 1UX2A 4HTEA 2LRKA 2PH9A 2YDSA 3ZJ1A 5CB4E 2MOZA 3IGQA 4H9PC 4JI0T 5KE4A 5AFKA 3NRYA 5FXWA 2E9XA 2XQAA 5LBMA 4UV9B 4GIWA 2H7OA 2BVMA 2PTFA 3DP7A 4CI2B 4K0KT 4U2ZA 3OTOT 3PURA 5HXCA 4ADZA 2JQHA 4IE4A 1D1BA 2K3WA 3OPCA 5FMNA 3T1YT 3Q5XA 3VHLA 4DVDA 1V9DA 5JRCB 2Y8DA 2UUBT 1X79A 5DQVA 5FXZA 4HWIB 5JMEA 2FJAA 4H63H 5J5HA 2VQFT 4PAGA 3NBXX 4ERRA 2VK9A 2V8SV 4OHFA 4AISA 5BRXA 5JDQA 2WN9A 3DJBA 3RIUA 3KFWX 3AEGA 5HXEA 3Q5WA 4YTNA 4AFTA 2ES0A 1SE7A 4U72A 4ZI3C 3C51A 3CK6A 5LNKA 4KUMB 4HWDA 2I59A 5LB7B 4QACA 3E0ZA 3ETVA 3VKGA 4AQFA 3PUSA 2BYQA 4HFIA 4TNVA 1T72A 2J4GA 2GK9A 5LOVE 2WNLA 2W8GA 3Q2MA 4TN7B 3WTJA 5HEJA 3SFEA 2LM2A 2UXXB 5A1LA 5CJ5A 3AA0B 4HN9A 5TAOA 1LVKA 3RIAA 2UXCT 1J5ET 1VCSA 1QSDA 2NTXA 3ZMSB 4YSYA 4PK5A 2BZBA 5LYJE 2LSKA 2V6XA 1MNEA 1M7KA 2XZ6A 3G06A 4KBMB 5DJQC 1XDOA 3UT5E 2Y58A 2MPKA 3UU8A 5EK3A 5FY7A 3ZN1B 1HNWT 3I0QA 1YKEB 1FJGT 4EYUA 5F8PA 1VRBA 5ABEA 3CX8B 3CWZB 5DABA 3F2EA 5CFBA 5CO5A 2L9QA 4TZ4C 1HTJF 5JR9B 2V7KA 5JVDE 4O4LE 2XAFB 2BS2A 4IL9A 4GKKT 4H63V 1YXRA 3AEAA 1UW6A 3K3QC 1MIVA 2XSAA 4KMCA 2BJ0A 3UFGA 2C5KT 1LKXA 3RRWA 2BKPA 4IDZA 2LSYA 4DO0A 3H37A 4XBFB 1NWMX 5KDMC 4CXWA 1AJ3A 4O2BE 5L47A 3OVUA 4L0RA 2YINA 2XNTA 5ETWA 3PTRB 3VKHA 3LK2B 3FBZA 1R8IA 4EXTA 4H9QC 5L3GB 4P1NA 4QX7B 2CXDA 3PUGA 2X66A 4E7ZA 1OEDC 1M62A 3AXJB 2W63A 2UUCT 3BQIA 2CEAA 3A8YC 3N9OA 5FKYA 2Y56A 3L3PA 2Q9QA 2JIWA 4DR1T 3RC8A 2H7VC 4UF0B 5JDLA 2YU2A 3NRXA 4L9IA 4O4JE 2IC9A 2W4XA 4UY2A 2KWIB 2IDOB 4AKGA 2QVAA 3AE2A 3SFDA 2VKJA 1J1JA 2V1DB 2XQ6A 4ZZCA 5JDHA 3LDQB 3R84B 4YTPA 3AE6A 3RLFF 2KSRA 2IAKA 3C64A 4DUZT 5JDFA 5HYAA 4O8SA 2E5LT 2LLYA 2V7MA 3N2OA 3NWIA 1JNRA 5AQSB 2HPLA 4WNKA 2K9AA 3ETUA 5L4HA 4XAXB 3I1AA 5HXHA 3RKOA 2Q9QD 4TWDA 5LXTE 5HCMA 1YD8G 5AQFB 2QRXA 5AQLB 4UVCB 3HR0A 1N32T 3ZDGA 3R6NA 3RKGA 3TLVA 2CWYA 4QHOA 4I43B 2NW7A 2LSIA 4YXDA 2J62A 3NZQA 2JJ9A 3ZEFB 1T8BA 5LMUT 5CA0E 2XUEA 3PUQA 4HE8A 2CBJA 5LCYA 3KV5A 3JCFA 3RI5A 4HKAA 2CXLA 3CIRA 2VVNA 3F31A 4A97A 2WU5A 3KBUA 1HX8A 1D0YA 4QKNA 3L39A 2XSBA 1B7TA 4IE0A 3UQ4A 4XZCA 3WTIA 5LJMA 2LKGA 4YY3T 4D01A 5AQUB 2KT9A 1CHUA 5ADXL 4BA9A 5IWAT 1WRDA 2XZEA 5KXJA 2V7JA 3MZKB 3HKCE 4FRRA 4JBWF 2C9TA 1T7SA 2LE8A 2BYNA 5LHIB 2BDEA 1N33T 4KP3C 5J1GA 4GYSA 3AEEA 5EZYE 4FI5A 3ZCJA 3RYIE 2CWOA 3J7Yq 2KWHA 4HWHA 4WYVA 2NW9A 2N9DA 3ONXA 3S4UA 5AQGB 4PJJA 1D1AA 2WZHA 1KEYA 2E2AA 5L3BB 1E1HB 3CQCB 3PEOA 5CGMA 3SWHA 2VL8A 2LM9A 3MK7C 2RPAA 4BFQA 4X20E 4X66T 2V26A 3FZKB 4ILCA 2ZJVA 1ZEEA 3MACA 4EEBA 2XQ7A 3FHNA 1HNXT 3ZKRA 5EK2A 1S94A 3UU6A 4NUVA 1HG5A 2KXPB 2X67A 3PUZF 1KF6A 4X1IE 2CCQA 2Y6XA 4DBQA 2HHHT 1LVFA 2KINB 4IIJE 1YQ3A 5AQPB 5JR9C 3BK9A 2BG9E 4Z90A 3C84A 4X1YE 3EVYA 1I94T 5FL1A 3ZLIA 4LF4T 2G0UA 3RQWA 4ISSA 1OEDA 1MMGA 4PJLA 2CRBA 3ZJ2A 3SOLA 2WNJA 3EAMA 4O2AE 3C4WA 2OA5A 3ZYMA 4TX5A 4EAHA 5AINA 1HX1B 2F4VT 2ODUA 2Z6EA 3CX6B 1UCUA 4KHZF 2A9UA 3O1JA 4QH1A 4JLEA 4BJNA 4HFEA 2XQ4A 3GA8A 1YKHB 3U8KA 5FVLA 3ZMUB 5L4EA 2CHNA 2BR8A 1BR1A 4KI0F 2WDVA 3GMIA 4IE7A 3LBXA 2X9XA 5HXSA 5KMGP 5KZUA 3EABA 4ZEYA 5AFMB 4U2YA 5BP0A 3JC6D 4DBMA 3OBVE 5AFLA 3MA9A 3VRBA 3UU5A 4IT4A 3PMZA 3PUAA 4DV2T 5LBQB 3P50A 4CN4A 5JTGA 4IDQA 4UELA 4U74A 4B3ST 4COFA 1YW0A 1WR6A 2A2FX 2D9DA 2JRKA 4F6RC 4O4IE 3H3AA 2IMLA 4N78D 5HAXA 4YT0A 4DMVA 4CXYA 2N1GA 4QAAA 4ZI2D 4HFVA 5AQIB 3SRZA 3B13A 3CQGB 2WB5A 5JH7E 2W67A 1XZYA 2K24A 5LA6E 4ZOLE 2BKOA 2XQ5A 2V6YB 3M65A 2NP9A 1SA0E 1IAPA 5JRCA 2E8IA 3ZT7A 2UXNB 3C50A 2MBGA 3WI3A 3AE9A 2E9XD 2YK0A 2LOSA 2X0LB 2YDQA 2WP9A 3GUAA 2FJEA 2VKHA 1SHZC 4UIGA 4X64T 1Z8UA 4HQPA 4CZZB 4HFHA 3MXZA 3ZYKA 4M1PA 3WTKA 2WCAA 1Y64B 4ANJA 1HS7A 3KDSE 3KVAA 4JI4T 1NENA 3K1SA 4PIRA 2CM0A 3ZCIA 3PDYA 3AA6B 4EGWA 2LRLA 4AFGA 5BR8T 3J9X1 2I6HA 2CXFA 5CA1E 4UEMA 5AQMB 5AQTB 3RPUA 3UUBA 3N2GE 5LHGB 2K48A 3VU7H 2Y57A 4IGUA 2W61A 4DMWA 5ABFA 2DHRA 2JMKA 4NIQA 3OJAA 2H88A 2Y54A 1S35A 2CPTA 4CQIA 2RA1A 2DWKA 3ZSSA 1UK5A 4LMLA 1WR0A 5JDGA 4DIDB 1MMAA 2BS4A 3U8MA 4MLKA 1DU2A 2V7IA 2BS3A 3QB5A 2BBHA 2LT3A 1XMQT 3FB2A 2YMDA 1ZV4X 3A7MA 4CI1B 4OK0A 3SQ6A 3QK6A 2XQ3A 5AQVB 2VASA 3RX6A 4IDPA 2XASB 2YOEA 5AQRB 2XNUA 5AQNB 2KMFA 3WAKA 2Y48B 2XYTA 4IDOA 1I9BA 4HGAA 4X1KE 2PGZA 4IE5A 4KX6A 3LFMA 3TKLB 5HWXA 3P4WA 3ONLC 5EK4A 5DQWA 4EOZB 3T1HT 2XM2A 2MYSA 4DV3T 2XPKA 3RYFE 2HN2A 3EDUA 1IBKT 2X0YA 4Z8XA 2IHR1 2IIUA 1WYBA 2NOXA 3P4RA 4DR6T 1O3XA 3WTLA 4HFCA 3AXJA 4DNDA 3AE5A 5AFHA 2XY8B 4WV9A 2C5IT 4AKLA 2BYPA 2OV9A 1KNZA 5L2LA 4LF9T 3FZFB 4TUYE 1GQEA 4UF0A 4CXXA 3PJAJ 3HL6A 3UFEA 3V5UA 3KBTA 1BR4A 3C4XA 4A5XA 3EUHA 1XMOT 4X5TA 2BG9B 3AE1A 4DR4T 3SIOA 1QUUA 3AAIA 5LMNT 2PJQA 3RQUA 4ZJTA 1NAFA 4QH5A 2ZM0A 3ANWB 2B76A 4LF6T 4HEAA 2V5CA 4U31A 2X51A 3AEFA 3PU8A 2B1EA 4BQTA 3AE3A 3TLTA 5HWYA 4LF7T 2LEHA 3GWHA 5F5WA 2W62A 4HFBA 2Y7YA 2WU2A 2WY2A 2WMNA 3N5LA 3X1DA 3UULA 1FEWA 2CA5A 2J1DG 4HFDA 3AE4A 2DI4A 4UM1A 4F8HA 5FP3A 2NWBA 3FBLA 2ZM6T 2WDRA 4ASKA 2WS3A 1KFYA 2HH7A 4L5GA 4TV8E 2XAGB 3AAEB 1IBLT 4K0UA 5AFNA 4QXHB 3Q5DA 3PV0F 4NPPA 1E7PA 2L8KA 5H6QB 2FBWA 3ZN0B 3P4QA 4UR9A 4HWCA 4DV0T 2IC6A 3ZDHA 1SUMB 3EHZA 4QX8B 1MIWA 3IBPA 3RC3A 4CI3B 1YQ4A 3OYXA 1CUNA 3PUVF 3BQKA 3RIFA 3FXDB 5C2TA 1FMWA 3BQLA 2ZMAA 4WZXA 5LP6E 4JI7T 3B57A 1FMVA 1QLBA 4AQGA 1W09A 4PFOA 4ZI3D 4YJ3E 2EHOB 5HEUA 1EZ3A 3CQXC 4UM3A 1E2AA 4IDNA 2ACZA 4ZS3A 4AKRB 3UUNA 2W2UA 3P8CD 4ZK4A 4OX9T 2CHOA 2NW8A 3NKZA 2C0SA 4TV9E 5KX5E 2IW5B 2AE9A 3N9LA 4DV7T 2VURA 2X9HA 2XNVA 3VR9A 5HCJA 4JEUB 4C90A 2BVLA 5LHHB 4NUUA 4QXCB 5L3CB 3FZHB 1IJ5A 1L0VA 5LGNB 2VKDA 2XAHB 2QGSA 4IE6A 4DV5T 4ILAA 3DTOA 2CMRA 5HXRA 3ZMVB 5LG3A 3GN5A 4H9SE 1G8XA 4JI3T 4JI6T 4H9RC 2LKHA 3ZSTA 1H7CA 5L3EB 2PG8A 3VR8A 2V5DA 3ZC0A 2YKSA 3N9PA 1BR2A 3AEDA 5BMVE 3AAAB 1UGOA 5FY0A 4ZK1A 3AE8A 3I0OA 1OWAA 5IHYA 4EZHA 1ZP0A 5FL0A 4I55E 3ZYLA 5J2TE 4H9OC 4DR7T 4QWNB 5J5GA 3LK3B 2ZJUA 4JI5T 2XQ9A 4DUYT 3UUXB 1U4QA 3ABVA 1UX4A 1D0ZA 4PW8A 4GYRA 4GK5E 4LFAT 4PNIA 3SS1A 2WWUA 1WFDA 3C79A 3I9WA 2FJDA 2LHRA 2J47A 2IUBA 4LFCT 2VQET 4Q25A 3PU3A 4H9NC 5FVKA 2E9XB 3WTHA 4ZXLA 3ZPOA 2X9YA 4EIWA 4B3TT 4TWFA 2M6BA 3CKDA
chains in the Genus database with same CATH topology
2MAWA 5HEHA 1OEDE 5AFHA 4WV9A 2Y54A 1OEDA 2BJ0A 4AFHA 4QACA 5FJVA 2BYPA 2LKHA 3ZDHA 3WTOA 3EHZA 2WNJA 1UX2A 3EAMA 4TNWA 3JAEA 5AFMA 2BYQA 5L4HA 2BR7A 4LMLA 2VL0A 4HFIA 2XQ5A 4QH4A 3JADA 4TNVA 4EZ1A 4ILBA 4NZBA 2PH9A 1UV6A 3U8LA 5AINA 4TWDA 2WNLA 2W8GA 3TLSA 2YKSA 3RIFA 3WIPA 4LMKA 2QC1B 5HCMA 5HEJA 3U8MA 3WTJA 5HEGA 2LM2A 3IGQA 2BG9C 5L47A 4LMJA 4ALXA 3ZDGA 2X00A 2XQ8A 3PEOA 4IREA 3TLVA 2XNTA 4ZK1A 4QH1A 4X5TA 2BG9B 5KE4A 5AFKA 4HFEA 3SIOA 3RIAA 2YN6A 2XQ4A 2YMDA 3GUAA 2M6IA 2XQAA 4BFQA 5HEUA 2XZ5A 5TVCA 3SQ6A 4UM3A 3SQ9A 3RQUA 3U8KA 4ZJTA 5IUXA 4QH5A 2XQ3A 4HQPA 4ZR6A 4HFHA 1OEDC 2YMEA 4ILCA 5L4EA 2ZJVA 3WTKA 4B5DA 2YOEA 2XYSA 2BR8A 4ZK4A 2XQ7A 3SH1A 1OEDB 4ZZBA 2BYSA 5AFJA 4A98A 3RI5A 5J5GA 5J5IA 3T4MA 2XNUA 3ZKRA 2Y56A 5SYOA 2ZJUA 3TLTA 4BQTA 2XQ9A 3UU6A 4PIRA 4Z91A 5J5FA 5KZUA 4A97A 5LXBA 4UXUA 3UU4A 2XYTA 2XZ6A 3WTMA 5BP0A 5AFMB 4HFBA 2Y7YA 4DBMA 1I9BA 5AFLA 2Y58A 5BW2A 3UQ4A 2PGZA 3UU5A 3PMZA 3UU3A 3UU8A 2UZ6A 3WTIA 3U8JA 2XNVA 4AFGA 3TLWA 5HCJA 5HEOA 4XHEA 3P50A 2LKGA 4UM3P 4ZJSA 3C79A 4UY2A 4D01A 3EI0A 4UM3S 3P4WA 5JMEA 4HFDA 3WTNA 5J5HA 4XK9A 4UM1A 2W8FA 2BYRA 4COFA 3UUBA 4F8HA 2BG9E 3JAFA 5J0ZA 4Z90A 2XQ6A 2BG9A 4IL4A 3RHWA 2WNCA 3C84A 4QABA 5CFBA 5CO5A 2Y57A 5BRXA 4ZZCA 4ZRUA 2WN9A 4TWHA 4FRRA 2C9TA 2X00D 3WTHA 4AFTA 2BYNA 3U8NA 4ILAA 4IL9A 5AFNA 3TLUA 2KSRA 4NPPA 2WZYA 4QAAA 3UQ7A 5LG3A 2LLYA 4HFCA 3WTLA 3LSVA 4TWFA 3RQWA 2M6BA 1UW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MAW A;  5HEH A;  1OED E;  5AFH A;  4WV9 A;  2Y54 A;  1OED A;  2BJ0 A;  4AFH A;  4QAC A;  5FJV A;  2BYP A;  2LKH A;  3ZDH A;  3WTO A;  3EHZ A;  2WNJ A;  1UX2 A;  3EAM A;  4TNW A;  3JAE A;  5AFM A;  2BYQ A;  5L4H A;  2BR7 A;  4LML A;  2VL0 A;  4HFI A;  2XQ5 A;  4QH4 A;  3JAD A;  4TNV A;  4EZ1 A;  4ILB A;  4NZB A;  2PH9 A;  1UV6 A;  3U8L A;  5AIN A;  4TWD A;  2WNL A;  2W8G A;  3TLS A;  2YKS A;  3RIF A;  3WIP A;  4LMK A;  2QC1 B;  5HCM A;  5HEJ A;  3U8M A;  3WTJ A;  5HEG A;  2LM2 A;  3IGQ A;  2BG9 C;  5L47 A;  4LMJ A;  4ALX A;  3ZDG A;  2X00 A;  2XQ8 A;  3PEO A;  4IRE A;  3TLV A;  2XNT A;  4ZK1 A;  4QH1 A;  4X5T A;  2BG9 B;  5KE4 A;  5AFK A;  4HFE A;  3SIO A;  3RIA A;  2YN6 A;  2XQ4 A;  2YMD A;  3GUA A;  2M6I A;  2XQA A;  4BFQ A;  5HEU A;  2XZ5 A;  5TVC A;  3SQ6 A;  4UM3 A;  3SQ9 A;  3RQU A;  3U8K A;  4ZJT A;  5IUX A;  4QH5 A;  2XQ3 A;  4HQP A;  4ZR6 A;  4HFH A;  1OED C;  2YME A;  4ILC A;  5L4E A;  2ZJV A;  3WTK A;  4B5D A;  2YOE A;  2XYS A;  2BR8 A;  4ZK4 A;  2XQ7 A;  3SH1 A;  1OED B;  4ZZB A;  2BYS A;  5AFJ A;  4A98 A;  3RI5 A;  5J5G A;  5J5I A;  3T4M A;  2XNU A;  3ZKR A;  2Y56 A;  5SYO A;  2ZJU A;  3TLT A;  4BQT A;  2XQ9 A;  3UU6 A;  4PIR A;  4Z91 A;  5J5F A;  5KZU A;  4A97 A;  5LXB A;  4UXU A;  3UU4 A;  2XYT A;  2XZ6 A;  3WTM A;  5BP0 A;  5AFM B;  4HFB A;  2Y7Y A;  4DBM A;  1I9B A;  5AFL A;  2Y58 A;  5BW2 A;  3UQ4 A;  2PGZ A;  3UU5 A;  3PMZ A;  3UU3 A;  3UU8 A;  2UZ6 A;  3WTI A;  3U8J A;  2XNV A;  4AFG A;  3TLW A;  5HCJ A;  5HEO A;  4XHE A;  3P50 A;  2LKG A;  4UM3 P;  4ZJS A;  3C79 A;  4UY2 A;  4D01 A;  3EI0 A;  4UM3 S;  3P4W A;  5JME A;  4HFD A;  3WTN A;  5J5H A;  4XK9 A;  4UM1 A;  2W8F A;  2BYR A;  4COF A;  3UUB A;  4F8H A;  2BG9 E;  3JAF A;  5J0Z A;  4Z90 A;  2XQ6 A;  2BG9 A;  4IL4 A;  3RHW A;  2WNC A;  3C84 A;  4QAB A;  5CFB A;  5CO5 A;  2Y57 A;  5BRX A;  4ZZC A;  4ZRU A;  2WN9 A;  4TWH A;  4FRR A;  2C9T A;  2X00 D;  3WTH A;  4AFT A;  2BYN A;  3U8N A;  4ILA A;  4IL9 A;  5AFN A;  3TLU A;  2KSR A;  4NPP A;  2WZY A;  4QAA A;  3UQ7 A;  5LG3 A;  2LLY A;  4HFC A;  3WTL A;  3LSV A;  4TWF A;  3RQW A;  2M6B A;  1UW6 A; 
#chains in the Genus database with same CATH topology
 2XAQ B;  1IZN B;  1XDP A;  1N36 T;  2WMO A;  3T8O A;  3AB3 B;  2BKN A;  4C91 A;  2NTY A;  3JAE A;  5AFM A;  4NZB A;  1UV6 A;  5JQG E;  3AEB A;  4LMK A;  3Q5E A;  2A72 A;  2E5V A;  2R6G F;  2VVS A;  2BG9 C;  3EDV A;  4LMJ A;  3IEE A;  1W0A A;  5LG4 A;  3AVR A;  3Q9D A;  3CVR A;  3U3I A;  2WWV A;  2PBI A;  3QUJ A;  2M6I A;  1WYC A;  2XZ5 A;  5AQK B;  4UVA B;  5FNV E;  4BAY B;  4IST A;  5LJN A;  4I0U A;  3ZT6 A;  3MJX A;  2FJB A;  4AXP A;  3SH1 A;  1MIY A;  2YEV C;  1JNZ A;  4WBO A;  1U5P A;  5FYM A;  4AKI A;  5H6R B;  2JQ9 A;  2LSG A;  3KVB A;  5BW2 A;  2D2S A;  1D0X A;  2V6Y A;  2H89 A;  2WDQ A;  2KLQ A;  3ONJ A;  3EI0 A;  4JI1 T;  4OYK A;  5L3F B;  4P0A A;  4DV1 T;  2ODV A;  3N2K E;  4XK9 A;  3JAF A;  1HF8 A;  3HKD E;  2WNC A;  4JI2 T;  3HKB E;  3E22 E;  3RYC E;  3K3O A;  1HG2 A;  1BR0 A;  1W9R A;  2DCF A;  1HR0 T;  3O9X A;  3UQ7 A;  3LSV A;  1OED E;  4YHJ A;  2H3R A;  2W0G A;  3ZMZ B;  5FJV A;  3WTO A;  4UVB B;  4AIU A;  4TNW A;  3LJC A;  2BR7 A;  4YSX A;  1IBM T;  4QH4 A;  3N9M A;  5ABF B;  2N2N A;  1LRZ A;  4DR5 T;  3PE0 A;  3P4P A;  4EED A;  5GON E;  1XNQ T;  3QNU A;  2DLR A;  3IF8 B;  4X62 T;  2NR4 A;  4WBN E;  2EHO C;  3N9Q A;  2RP4 A;  4KHP T;  3ZC1 A;  5ABH A;  2PFV A;  4MBQ A;  4ZR6 A;  2XM1 A;  1OXZ A;  3QC9 A;  2WAU A;  4LF8 T;  3U78 A;  4ZZB A;  4PK4 A;  5FXV A;  5SYO A;  3WAJ A;  2DL1 A;  3CML A;  5LXB A;  3ZMT B;  4UXU A;  3WTM A;  3QB5 K;  2D0U A;  3O1I A;  5JR9 A;  2L3L A;  3C98 B;  4B3M T;  4A56 A;  4UM3 P;  4YTM A;  5FY1 A;  4FJO A;  2XHE B;  2CLY B;  4DR2 T;  2UXB T;  3V5S A;  2JMH A;  2W8F A;  2BYR A;  3KV9 A;  4EYY R;  3P7I A;  3KV6 A;  3RF1 A;  4ZRU A;  1HNZ T;  1KNP A;  2VKO A;  4LF5 T;  2D5U A;  3U8N A;  4YFS A;  4CN1 A;  1NEK A;  2MAW A;  5HEH A;  3UTK A;  2Q9Q B;  3FXE B;  5AQH B;  4ZI7 E;  3AA7 B;  5L3D B;  1UUR A;  1UX5 A;  4EZ1 A;  4G2A A;  1Y01 A;  5LGT B;  4X65 T;  3U8L A;  2V7L A;  3JC6 C;  3WIP A;  1WCR A;  1T98 A;  5HEG A;  1VCT A;  3I9Y A;  4P0B A;  4ALX A;  4GOU A;  3AEC A;  2XQ8 A;  2ZM2 A;  3A5X A;  3HKE E;  2YN6 A;  2C5J A;  4MFR A;  4EB6 E;  5TVC A;  2I0M A;  2XTL A;  1HFA A;  4V1A v;  4JI8 T;  2OLT A;  1KNR A;  4ZI2 C;  3F57 A;  3PJA A;  4U33 A;  4OYJ A;  3O1H A;  5J5F A;  4UV8 B;  4GKJ T;  3UU4 A;  2AXD S;  2LOP A;  4AKH A;  3D0T A;  2LJL A;  2P9B A;  3HA4 A;  2W00 A;  2UZ6 A;  3U8J A;  2JQQ A;  4XHE A;  4WW0 A;  2LSJ A;  2UU9 T;  4ZHQ E;  2M67 A;  4B3R T;  3WTN A;  4LFB T;  5E0O A;  4G63 A;  5J0Z A;  5AFU L;  3W15 B;  3NZP A;  3O4X E;  2E9X C;  2BG9 A;  3E08 A;  3RHW A;  4QAB A;  2YDR A;  1X9B A;  4I50 E;  2VB6 A;  3TLU A;  3K3N A;  3ANW A;  4UXN B;  4YSZ A;  4GK0 E;  3KV4 A;  1ZKE A;  4U7Y A;  4DV6 T;  4YLH A;  2DNX A;  2QA7 A;  1ZOY A;  2VL0 A;  4PJM A;  4ILB A;  2BBJ A;  2SPC A;  3FZL B;  3K8P C;  2ZLY A;  5IYZ E;  2QC1 B;  3IA3 A;  5LGU B;  3AVS A;  1MMN A;  2X00 A;  5AQO B;  3RIU C;  2KND A;  3AA1 B;  4QXB B;  2HN1 A;  2X9W A;  4J2C A;  4CN6 A;  2W66 A;  2FUP A;  4DV4 T;  5AQJ B;  3LK4 2;  5FXX A;  1ZHC A;  4ILU A;  1J5W A;  3ZT5 A;  2XYS A;  1MND A;  3H3M A;  4AQF C;  4AI6 A;  5J2U E;  1UUS A;  3IHR A;  4B6X A;  1HCI A;  2JQK A;  4Z91 A;  3RH3 A;  2VWA A;  2WBL A;  2CE7 A;  2MTQ A;  4PFP A;  1I6Z A;  5JDM A;  2ACX A;  5ABG A;  4DBR A;  1US7 B;  3LG7 A;  3FZM B;  3PUY F;  4ZJS A;  4JYA T;  3AE7 A;  4EV6 A;  4BJM A;  3P4S A;  4MAL A;  3PUW F;  4YHH T;  2LHN A;  2X68 A;  3OYZ A;  4ZS2 A;  2XAJ B;  4JV5 T;  2X00 D;  2EHO A;  4U7I A;  4NXN T;  2WZY A;  1VOM A;  3RGL A;  2WQY A;  1XWM A;  3NVO A;  4MHC A;  2DWG A;  4I4T E;  4AFH A;  5F3J A;  2XQY A;  2D0T A;  1G73 A;  5JRE A;  2HPJ A;  5C8Y E;  2WSS V;  3JAD A;  2X0H A;  2ZM8 A;  2QYW A;  3TLS A;  3GN5 B;  3QOF A;  2XJ7 A;  4DR3 T;  4PK6 A;  2WM9 A;  2WZI A;  4IRE A;  5C3J A;  3CPZ A;  5AQQ B;  3RYH E;  4EZ4 A;  1MMD A;  3KIN B;  2CBI A;  3SQ9 A;  5IUX A;  2YME A;  4B5D A;  1Z0P A;  1W0B A;  4O4H E;  2EHO D;  1OED B;  5AFJ A;  2BYS A;  1D1C A;  4A98 A;  4NXM T;  3CX7 B;  5J5I A;  3T4M A;  4PJN A;  3PUX F;  3UUM A;  1XNR T;  3B5M A;  3MKD A;  5M4Y A;  2YU1 A;  4P09 A;  1KK7 A;  4OFZ A;  3UU3 A;  5JDN A;  2CLY C;  4IHJ E;  3TLW A;  4E7S A;  5HEO A;  3C4Z A;  4UM3 S;  1FIO A;  1WLX A;  3ESL A;  1IJ6 A;  2UUA T;  3HI2 A;  3L09 A;  1N34 T;  2KZ7 B;  4U3C A;  3L8R A;  4IL4 A;  4TWH A;  3RRC A;  3VRA A;  2A3D A;  4JEH B;  3OKQ A;  4YJ2 E;  2Q9Q C;  3M3Z B;  3N9N A;  2UXD T;  3LBX B;  4JUY A;  2K5B B;  4AQY T;  2JPF A;  4HWF A;  1UX2 A;  4HTE A;  2LRK A;  2PH9 A;  2YDS A;  3ZJ1 A;  5CB4 E;  2MOZ A;  3IGQ A;  4H9P C;  4JI0 T;  5KE4 A;  5AFK A;  3NRY A;  5FXW A;  2E9X A;  2XQA A;  5LBM A;  4UV9 B;  4GIW A;  2H7O A;  2BVM A;  2PTF A;  3DP7 A;  4CI2 B;  4K0K T;  4U2Z A;  3OTO T;  3PUR A;  5HXC A;  4ADZ A;  2JQH A;  4IE4 A;  1D1B A;  2K3W A;  3OPC A;  5FMN A;  3T1Y T;  3Q5X A;  3VHL A;  4DVD A;  1V9D A;  5JRC B;  2Y8D A;  2UUB T;  1X79 A;  5DQV A;  5FXZ A;  4HWI B;  5JME A;  2FJA A;  4H63 H;  5J5H A;  2VQF T;  4PAG A;  3NBX X;  4ERR A;  2VK9 A;  2V8S V;  4OHF A;  4AIS A;  5BRX A;  5JDQ A;  2WN9 A;  3DJB A;  3RIU A;  3KFW X;  3AEG A;  5HXE A;  3Q5W A;  4YTN A;  4AFT A;  2ES0 A;  1SE7 A;  4U72 A;  4ZI3 C;  3C51 A;  3CK6 A;  5LNK A;  4KUM B;  4HWD A;  2I59 A;  5LB7 B;  4QAC A;  3E0Z A;  3ETV A;  3VKG A;  4AQF A;  3PUS A;  2BYQ A;  4HFI A;  4TNV A;  1T72 A;  2J4G A;  2GK9 A;  5LOV E;  2WNL A;  2W8G A;  3Q2M A;  4TN7 B;  3WTJ A;  5HEJ A;  3SFE A;  2LM2 A;  2UXX B;  5A1L A;  5CJ5 A;  3AA0 B;  4HN9 A;  5TAO A;  1LVK A;  3RIA A;  2UXC T;  1J5E T;  1VCS A;  1QSD A;  2NTX A;  3ZMS B;  4YSY A;  4PK5 A;  2BZB A;  5LYJ E;  2LSK A;  2V6X A;  1MNE A;  1M7K A;  2XZ6 A;  3G06 A;  4KBM B;  5DJQ C;  1XDO A;  3UT5 E;  2Y58 A;  2MPK A;  3UU8 A;  5EK3 A;  5FY7 A;  3ZN1 B;  1HNW T;  3I0Q A;  1YKE B;  1FJG T;  4EYU A;  5F8P A;  1VRB A;  5ABE A;  3CX8 B;  3CWZ B;  5DAB A;  3F2E A;  5CFB A;  5CO5 A;  2L9Q A;  4TZ4 C;  1HTJ F;  5JR9 B;  2V7K A;  5JVD E;  4O4L E;  2XAF B;  2BS2 A;  4IL9 A;  4GKK T;  4H63 V;  1YXR A;  3AEA A;  1UW6 A;  3K3Q C;  1MIV A;  2XSA A;  4KMC A;  2BJ0 A;  3UFG A;  2C5K T;  1LKX A;  3RRW A;  2BKP A;  4IDZ A;  2LSY A;  4DO0 A;  3H37 A;  4XBF B;  1NWM X;  5KDM C;  4CXW A;  1AJ3 A;  4O2B E;  5L47 A;  3OVU A;  4L0R A;  2YIN A;  2XNT A;  5ETW A;  3PTR B;  3VKH A;  3LK2 B;  3FBZ A;  1R8I A;  4EXT A;  4H9Q C;  5L3G B;  4P1N A;  4QX7 B;  2CXD A;  3PUG A;  2X66 A;  4E7Z A;  1OED C;  1M62 A;  3AXJ B;  2W63 A;  2UUC T;  3BQI A;  2CEA A;  3A8Y C;  3N9O A;  5FKY A;  2Y56 A;  3L3P A;  2Q9Q A;  2JIW A;  4DR1 T;  3RC8 A;  2H7V C;  4UF0 B;  5JDL A;  2YU2 A;  3NRX A;  4L9I A;  4O4J E;  2IC9 A;  2W4X A;  4UY2 A;  2KWI B;  2IDO B;  4AKG A;  2QVA A;  3AE2 A;  3SFD A;  2VKJ A;  1J1J A;  2V1D B;  2XQ6 A;  4ZZC A;  5JDH A;  3LDQ B;  3R84 B;  4YTP A;  3AE6 A;  3RLF F;  2KSR A;  2IAK A;  3C64 A;  4DUZ T;  5JDF A;  5HYA A;  4O8S A;  2E5L T;  2LLY A;  2V7M A;  3N2O A;  3NWI A;  1JNR A;  5AQS B;  2HPL A;  4WNK A;  2K9A A;  3ETU A;  5L4H A;  4XAX B;  3I1A A;  5HXH A;  3RKO A;  2Q9Q D;  4TWD A;  5LXT E;  5HCM A;  1YD8 G;  5AQF B;  2QRX A;  5AQL B;  4UVC B;  3HR0 A;  1N32 T;  3ZDG A;  3R6N A;  3RKG A;  3TLV A;  2CWY A;  4QHO A;  4I43 B;  2NW7 A;  2LSI A;  4YXD A;  2J62 A;  3NZQ A;  2JJ9 A;  3ZEF B;  1T8B A;  5LMU T;  5CA0 E;  2XUE A;  3PUQ A;  4HE8 A;  2CBJ A;  5LCY A;  3KV5 A;  3JCF A;  3RI5 A;  4HKA A;  2CXL A;  3CIR A;  2VVN A;  3F31 A;  4A97 A;  2WU5 A;  3KBU A;  1HX8 A;  1D0Y A;  4QKN A;  3L39 A;  2XSB A;  1B7T A;  4IE0 A;  3UQ4 A;  4XZC A;  3WTI A;  5LJM A;  2LKG A;  4YY3 T;  4D01 A;  5AQU B;  2KT9 A;  1CHU A;  5ADX L;  4BA9 A;  5IWA T;  1WRD A;  2XZE A;  5KXJ A;  2V7J A;  3MZK B;  3HKC E;  4FRR A;  4JBW F;  2C9T A;  1T7S A;  2LE8 A;  2BYN A;  5LHI B;  2BDE A;  1N33 T;  4KP3 C;  5J1G A;  4GYS A;  3AEE A;  5EZY E;  4FI5 A;  3ZCJ A;  3RYI E;  2CWO A;  3J7Y q;  2KWH A;  4HWH A;  4WYV A;  2NW9 A;  2N9D A;  3ONX A;  3S4U A;  5AQG B;  4PJJ A;  1D1A A;  2WZH A;  1KEY A;  2E2A A;  5L3B B;  1E1H B;  3CQC B;  3PEO A;  5CGM A;  3SWH A;  2VL8 A;  2LM9 A;  3MK7 C;  2RPA A;  4BFQ A;  4X20 E;  4X66 T;  2V26 A;  3FZK B;  4ILC A;  2ZJV A;  1ZEE A;  3MAC A;  4EEB A;  2XQ7 A;  3FHN A;  1HNX T;  3ZKR A;  5EK2 A;  1S94 A;  3UU6 A;  4NUV A;  1HG5 A;  2KXP B;  2X67 A;  3PUZ F;  1KF6 A;  4X1I E;  2CCQ A;  2Y6X A;  4DBQ A;  2HHH T;  1LVF A;  2KIN B;  4IIJ E;  1YQ3 A;  5AQP B;  5JR9 C;  3BK9 A;  2BG9 E;  4Z90 A;  3C84 A;  4X1Y E;  3EVY A;  1I94 T;  5FL1 A;  3ZLI A;  4LF4 T;  2G0U A;  3RQW A;  4ISS A;  1OED A;  1MMG A;  4PJL A;  2CRB A;  3ZJ2 A;  3SOL A;  2WNJ A;  3EAM A;  4O2A E;  3C4W A;  2OA5 A;  3ZYM A;  4TX5 A;  4EAH A;  5AIN A;  1HX1 B;  2F4V T;  2ODU A;  2Z6E A;  3CX6 B;  1UCU A;  4KHZ F;  2A9U A;  3O1J A;  4QH1 A;  4JLE A;  4BJN A;  4HFE A;  2XQ4 A;  3GA8 A;  1YKH B;  3U8K A;  5FVL A;  3ZMU B;  5L4E A;  2CHN A;  2BR8 A;  1BR1 A;  4KI0 F;  2WDV A;  3GMI A;  4IE7 A;  3LBX A;  2X9X A;  5HXS A;  5KMG P;  5KZU A;  3EAB A;  4ZEY A;  5AFM B;  4U2Y A;  5BP0 A;  3JC6 D;  4DBM A;  3OBV E;  5AFL A;  3MA9 A;  3VRB A;  3UU5 A;  4IT4 A;  3PMZ A;  3PUA A;  4DV2 T;  5LBQ B;  3P50 A;  4CN4 A;  5JTG A;  4IDQ A;  4UEL A;  4U74 A;  4B3S T;  4COF A;  1YW0 A;  1WR6 A;  2A2F X;  2D9D A;  2JRK A;  4F6R C;  4O4I E;  3H3A A;  2IML A;  4N78 D;  5HAX A;  4YT0 A;  4DMV A;  4CXY A;  2N1G A;  4QAA A;  4ZI2 D;  4HFV A;  5AQI B;  3SRZ A;  3B13 A;  3CQG B;  2WB5 A;  5JH7 E;  2W67 A;  1XZY A;  2K24 A;  5LA6 E;  4ZOL E;  2BKO A;  2XQ5 A;  2V6Y B;  3M65 A;  2NP9 A;  1SA0 E;  1IAP A;  5JRC A;  2E8I A;  3ZT7 A;  2UXN B;  3C50 A;  2MBG A;  3WI3 A;  3AE9 A;  2E9X D;  2YK0 A;  2LOS A;  2X0L B;  2YDQ A;  2WP9 A;  3GUA A;  2FJE A;  2VKH A;  1SHZ C;  4UIG A;  4X64 T;  1Z8U A;  4HQP A;  4CZZ B;  4HFH A;  3MXZ A;  3ZYK A;  4M1P A;  3WTK A;  2WCA A;  1Y64 B;  4ANJ A;  1HS7 A;  3KDS E;  3KVA A;  4JI4 T;  1NEN A;  3K1S A;  4PIR A;  2CM0 A;  3ZCI A;  3PDY A;  3AA6 B;  4EGW A;  2LRL A;  4AFG A;  5BR8 T;  3J9X 1;  2I6H A;  2CXF A;  5CA1 E;  4UEM A;  5AQM B;  5AQT B;  3RPU A;  3UUB A;  3N2G E;  5LHG B;  2K48 A;  3VU7 H;  2Y57 A;  4IGU A;  2W61 A;  4DMW A;  5ABF A;  2DHR A;  2JMK A;  4NIQ A;  3OJA A;  2H88 A;  2Y54 A;  1S35 A;  2CPT A;  4CQI A;  2RA1 A;  2DWK A;  3ZSS A;  1UK5 A;  4LML A;  1WR0 A;  5JDG A;  4DID B;  1MMA A;  2BS4 A;  3U8M A;  4MLK A;  1DU2 A;  2V7I A;  2BS3 A;  3QB5 A;  2BBH A;  2LT3 A;  1XMQ T;  3FB2 A;  2YMD A;  1ZV4 X;  3A7M A;  4CI1 B;  4OK0 A;  3SQ6 A;  3QK6 A;  2XQ3 A;  5AQV B;  2VAS A;  3RX6 A;  4IDP A;  2XAS B;  2YOE A;  5AQR B;  2XNU A;  5AQN B;  2KMF A;  3WAK A;  2Y48 B;  2XYT A;  4IDO A;  1I9B A;  4HGA A;  4X1K E;  2PGZ A;  4IE5 A;  4KX6 A;  3LFM A;  3TKL B;  5HWX A;  3P4W A;  3ONL C;  5EK4 A;  5DQW A;  4EOZ B;  3T1H T;  2XM2 A;  2MYS A;  4DV3 T;  2XPK A;  3RYF E;  2HN2 A;  3EDU A;  1IBK T;  2X0Y A;  4Z8X A;  2IHR 1;  2IIU A;  1WYB A;  2NOX A;  3P4R A;  4DR6 T;  1O3X A;  3WTL A;  4HFC A;  3AXJ A;  4DND A;  3AE5 A;  5AFH A;  2XY8 B;  4WV9 A;  2C5I T;  4AKL A;  2BYP A;  2OV9 A;  1KNZ A;  5L2L A;  4LF9 T;  3FZF B;  4TUY E;  1GQE A;  4UF0 A;  4CXX A;  3PJA J;  3HL6 A;  3UFE A;  3V5U A;  3KBT A;  1BR4 A;  3C4X A;  4A5X A;  3EUH A;  1XMO T;  4X5T A;  2BG9 B;  3AE1 A;  4DR4 T;  3SIO A;  1QUU A;  3AAI A;  5LMN T;  2PJQ A;  3RQU A;  4ZJT A;  1NAF A;  4QH5 A;  2ZM0 A;  3ANW B;  2B76 A;  4LF6 T;  4HEA A;  2V5C A;  4U31 A;  2X51 A;  3AEF A;  3PU8 A;  2B1E A;  4BQT A;  3AE3 A;  3TLT A;  5HWY A;  4LF7 T;  2LEH A;  3GWH A;  5F5W A;  2W62 A;  4HFB A;  2Y7Y A;  2WU2 A;  2WY2 A;  2WMN A;  3N5L A;  3X1D A;  3UUL A;  1FEW A;  2CA5 A;  2J1D G;  4HFD A;  3AE4 A;  2DI4 A;  4UM1 A;  4F8H A;  5FP3 A;  2NWB A;  3FBL A;  2ZM6 T;  2WDR A;  4ASK A;  2WS3 A;  1KFY A;  2HH7 A;  4L5G A;  4TV8 E;  2XAG B;  3AAE B;  1IBL T;  4K0U A;  5AFN A;  4QXH B;  3Q5D A;  3PV0 F;  4NPP A;  1E7P A;  2L8K A;  5H6Q B;  2FBW A;  3ZN0 B;  3P4Q A;  4UR9 A;  4HWC A;  4DV0 T;  2IC6 A;  3ZDH A;  1SUM B;  3EHZ A;  4QX8 B;  1MIW A;  3IBP A;  3RC3 A;  4CI3 B;  1YQ4 A;  3OYX A;  1CUN A;  3PUV F;  3BQK A;  3RIF A;  3FXD B;  5C2T A;  1FMW A;  3BQL A;  2ZMA A;  4WZX A;  5LP6 E;  4JI7 T;  3B57 A;  1FMV A;  1QLB A;  4AQG A;  1W09 A;  4PFO A;  4ZI3 D;  4YJ3 E;  2EHO B;  5HEU A;  1EZ3 A;  3CQX C;  4UM3 A;  1E2A A;  4IDN A;  2ACZ A;  4ZS3 A;  4AKR B;  3UUN A;  2W2U A;  3P8C D;  4ZK4 A;  4OX9 T;  2CHO A;  2NW8 A;  3NKZ A;  2C0S A;  4TV9 E;  5KX5 E;  2IW5 B;  2AE9 A;  3N9L A;  4DV7 T;  2VUR A;  2X9H A;  2XNV A;  3VR9 A;  5HCJ A;  4JEU B;  4C90 A;  2BVL A;  5LHH B;  4NUU A;  4QXC B;  5L3C B;  3FZH B;  1IJ5 A;  1L0V A;  5LGN B;  2VKD A;  2XAH B;  2QGS A;  4IE6 A;  4DV5 T;  4ILA A;  3DTO A;  2CMR A;  5HXR A;  3ZMV B;  5LG3 A;  3GN5 A;  4H9S E;  1G8X A;  4JI3 T;  4JI6 T;  4H9R C;  2LKH A;  3ZST A;  1H7C A;  5L3E B;  2PG8 A;  3VR8 A;  2V5D A;  3ZC0 A;  2YKS A;  3N9P A;  1BR2 A;  3AED A;  5BMV E;  3AAA B;  1UGO A;  5FY0 A;  4ZK1 A;  3AE8 A;  3I0O A;  1OWA A;  5IHY A;  4EZH A;  1ZP0 A;  5FL0 A;  4I55 E;  3ZYL A;  5J2T E;  4H9O C;  4DR7 T;  4QWN B;  5J5G A;  3LK3 B;  2ZJU A;  4JI5 T;  2XQ9 A;  4DUY T;  3UUX B;  1U4Q A;  3ABV A;  1UX4 A;  1D0Z A;  4PW8 A;  4GYR A;  4GK5 E;  4LFA T;  4PNI A;  3SS1 A;  2WWU A;  1WFD A;  3C79 A;  3I9W A;  2FJD A;  2LHR A;  2J47 A;  2IUB A;  4LFC T;  2VQE T;  4Q25 A;  3PU3 A;  4H9N C;  5FVK A;  2E9X B;  3WTH A;  4ZXL A;  3ZPO A;  2X9Y A;  4EIW A;  4B3T T;  4TWF A;  2M6B A;  3CKD A; 
#chains in the Genus database with same CATH homology
 2MAW A;  5HEH A;  1OED E;  5AFH A;  4WV9 A;  2Y54 A;  1OED A;  2BJ0 A;  4AFH A;  4QAC A;  5FJV A;  2BYP A;  2LKH A;  3ZDH A;  3WTO A;  3EHZ A;  2WNJ A;  1UX2 A;  3EAM A;  4TNW A;  3JAE A;  5AFM A;  2BYQ A;  5L4H A;  2BR7 A;  4LML A;  2VL0 A;  4HFI A;  2XQ5 A;  4QH4 A;  3JAD A;  4TNV A;  4EZ1 A;  4ILB A;  4NZB A;  2PH9 A;  1UV6 A;  3U8L A;  5AIN A;  4TWD A;  2WNL A;  2W8G A;  3TLS A;  2YKS A;  3RIF A;  3WIP A;  4LMK A;  2QC1 B;  5HCM A;  5HEJ A;  3U8M A;  3WTJ A;  5HEG A;  2LM2 A;  3IGQ A;  2BG9 C;  5L47 A;  4LMJ A;  4ALX A;  3ZDG A;  2X00 A;  2XQ8 A;  3PEO A;  4IRE A;  3TLV A;  2XNT A;  4ZK1 A;  4QH1 A;  4X5T A;  2BG9 B;  5KE4 A;  5AFK A;  4HFE A;  3SIO A;  3RIA A;  2YN6 A;  2XQ4 A;  2YMD A;  3GUA A;  2M6I A;  2XQA A;  4BFQ A;  5HEU A;  2XZ5 A;  5TVC A;  3SQ6 A;  4UM3 A;  3SQ9 A;  3RQU A;  3U8K A;  4ZJT A;  5IUX A;  4QH5 A;  2XQ3 A;  4HQP A;  4ZR6 A;  4HFH A;  1OED C;  2YME A;  4ILC A;  5L4E A;  2ZJV A;  3WTK A;  4B5D A;  2YOE A;  2XYS A;  2BR8 A;  4ZK4 A;  2XQ7 A;  3SH1 A;  1OED B;  4ZZB A;  2BYS A;  5AFJ A;  4A98 A;  3RI5 A;  5J5G A;  5J5I A;  3T4M A;  2XNU A;  3ZKR A;  2Y56 A;  5SYO A;  2ZJU A;  3TLT A;  4BQT A;  2XQ9 A;  3UU6 A;  4PIR A;  4Z91 A;  5J5F A;  5KZU A;  4A97 A;  5LXB A;  4UXU A;  3UU4 A;  2XYT A;  2XZ6 A;  3WTM A;  5BP0 A;  5AFM B;  4HFB A;  2Y7Y A;  4DBM A;  1I9B A;  5AFL A;  2Y58 A;  5BW2 A;  3UQ4 A;  2PGZ A;  3UU5 A;  3PMZ A;  3UU3 A;  3UU8 A;  2UZ6 A;  3WTI A;  3U8J A;  2XNV A;  4AFG A;  3TLW A;  5HCJ A;  5HEO A;  4XHE A;  3P50 A;  2LKG A;  4UM3 P;  4ZJS A;  3C79 A;  4UY2 A;  4D01 A;  3EI0 A;  4UM3 S;  3P4W A;  5JME A;  4HFD A;  3WTN A;  5J5H A;  4XK9 A;  4UM1 A;  2W8F A;  2BYR A;  4COF A;  3UUB A;  4F8H A;  2BG9 E;  3JAF A;  5J0Z A;  4Z90 A;  2XQ6 A;  2BG9 A;  4IL4 A;  3RHW A;  2WNC A;  3C84 A;  4QAB A;  5CFB A;  5CO5 A;  2Y57 A;  5BRX A;  4ZZC A;  4ZRU A;  2WN9 A;  4TWH A;  4FRR A;  2C9T A;  2X00 D;  3WTH A;  4AFT A;  2BYN A;  3U8N A;  4ILA A;  4IL9 A;  5AFN A;  3TLU A;  2KSR A;  4NPP A;  2WZY A;  4QAA A;  3UQ7 A;  5LG3 A;  2LLY A;  4HFC A;  3WTL A;  3LSV A;  4TWF A;  3RQW A;  2M6B A;  1UW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...