3EI0A

Structure of the e221a mutant of the gloebacter violaceus pentameric ligand gated ion channnel (glic)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
310
Chain Sequence
b'PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYAANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title Structure of a potentially open state of a proton-activated pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein
total genus 79
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3ei0A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3ei0A01
4AFHA 4QH4A 2W8GA 3WTJA 4ZZCA 3TLVA 2YKSA 3RQWA 2XNVA 2XZ5A 3RIFA 2BYRA 5AFNA 4WV9A 5HEJA 4IL9A 3PMZA 4ALXA 2XYTA 2LM2A 4UM1A 5AFJA 4LMJA 3TLUA 1OEDB 3UU6A 2M6BA 5CFBA 3U8JA 3JAFA 5HEOA 4HFDA 2XNTA 4BFQA 4ZZBA 3EHZA 4ZRUA 3UUBA 3LSVA 4A97A 2ZJVA 3U8KA 3WTIA 3WTOA 2BJ0A 4LMLA 3U8NA 3TLWA 4IREA 3GUAA 5HCMA 5TVCA 4Z91A 5AFMA 4NZBA 3P4WA 4PIRA 3ZDGA 4ZJSA 2BG9C 2MAWA 2PH9A 5BW2A 4XHEA 5L4EA 3PEOA 3UU4A 2PGZA 5HEGA 4BQTA 3SQ9A 2XYSA 2YOEA 2UZ6A 2XQ7A 3UU5A 3EI0A 4TNVA 2LKGA 4AFTA 5L4HA 5AFHA 2BG9E 3EAMA 2M6IA 2WN9A 1I9BA 2YMDA 3JADA 2BG9A 4HFEA 2XQAA 4ILBA 1UV6A 4D01A 4UM3S 4QABA 2XZ6A 4UXUA 5AFMB 2BYPA 2ZJUA 4HFBA 3WTMA 2BYQA 3UQ7A 5J5HA 3RI5A 4ZK4A 4AFGA 3T4MA 3U8LA 2YN6A 4HFIA 2X00D 4ZJTA 3SQ6A 5BRXA 3TLSA 5J5FA 3TLTA 2Y58A 5KZUA 2WNLA 4HQPA 2LLYA 2XQ6A 5HEHA 2BR8A 4ILCA 3WTKA 5BP0A 2BR7A 2KSRA 4TWFA 5AINA 4EZ1A 3WTLA 4UM3P 4XK9A 2BG9B 2WNJA 2XQ4A 3RIAA 2XQ3A 2XQ8A 3UQ4A 5L47A 4COFA 1UX2A 2XNUA 3P50A 4TNWA 2XQ9A 3SH1A 5J5GA 2LKHA 4TWDA 3ZKRA 4LMKA 1UW6A 4ZK1A 5AFLA 5AFKA 3RHWA 2WNCA 2BYNA 5IUXA 4QH5A 4HFCA 4QAAA 5JMEA 4DBMA 5KE4A 2VL0A 3WTHA 5FJVA 4UY2A 5HCJA 4B5DA 4F8HA 3U8MA 4A98A 2QC1B 5LXBA 3C79A 3JAEA 2Y7YA 5CO5A 5SYOA 4NPPA 4QH1A 4Z90A 1OEDE 2Y57A 4ZR6A 5J0ZA 3WTNA 4HFHA 4TWHA 3UU8A 3SIOA 1OEDA 2XQ5A 5J5IA 2C9TA 2YMEA 5LG3A 4ILAA 2Y54A 3C84A 5HEUA 4UM3A 4X5TA 3WIPA 4QACA 2WZYA 2Y56A 4IL4A 3RQUA 3IGQA 3ZDHA 2BYSA 2X00A 2W8FA 1OEDC 3UU3A 4FRRA
chains in the Genus database with same CATH superfamily
2Q9QC 3AVRA 5LYJE 2E9XD 4H9RC 2UU9T 3PMZA 2N1GA 2NW8A 3U8JA 3QNUA 3ZC0A 2IUBA 5JRCB 3EABA 5EK3A 3PURA 2NR4A 4G2AA 4DO0A 4IDNA 4X1IE 2Y8DA 2VKOA 4UXNB 4IDPA 1YKEB 4OX9T 4XHEA 2PGZA 4ISTA 2KINB 4WBNE 2QYWA 2IIUA 4G63A 1I9BA 2KNDA 4YSYA 2XZEA 4E7SA 2D0TA 4EAHA 2X9WA 4ZJTA 3CX6B 3TLSA 3PTRB 4IHJE 2JQKA 2LM9A 4QX8B 5FYMA 3U78A 2WM9A 5AFKA 4LF8T 4B3RT 3FZFB 4X66T 2PG8A 1KF6A 3WTNA 5J0ZA 3Q5DA 3CPZA 5ABFA 1VRBA 2CXLA 3C64A 4AISA 4JI2T 4ZHQE 4TV9E 4PJMA 5AQVB 2BYRA 5JDGA 3LK2B 1MMGA 2EHOB 3OTOT 4WW0A 5AFJA 3MK7C 3ZSSA 3HKCE 1HS7A 3H3AA 2XAGB 2WBLA 5HEOA 3MXZA 4YT0A 4ZI3D 3EHZA 3ZYKA 2Q9QA 3UUBA 2ZJVA 5JDLA 3RC8A 3WTIA 3RX6A 4JI0T 2BJ0A 3E08A 5AQIB 1M7KA 5HXEA 3PUGA 4CI3B 4NUVA 5HWXA 4PK6A 3EDVA 5F8PA 5CJ5A 3J9X1 5HXCA 2WZHA 1VCSA 1ZKEA 2XY8B 2EHOD 4HWHA 2BDEA 4DV2T 4U2ZA 1KFYA 3F2EA 2HPJA 5AQNB 3UT5E 4O2BE 5IYZE 2VVSA 3TLTA 5KZUA 2N9DA 2WAUA 4ILCA 5AINA 4ZS3A 4IDOA 2G0UA 3Q5EA 3HA4A 3RIAA 2V7IA 4ZK1A 2WCAA 3ZKRA 2BS4A 4XZCA 4FJOA 3LFMA 3O1JA 1SE7A 1IBMT 4TWHA 4DV6T 1HG5A 2P9BA 5HEUA 3ZMTB 2Y56A 1XWMA 2LSKA 2XPKA 3AE7A 3N9NA 3R84B 4GOUA 1JNZA 1HG2A 3B57A 4AXPA 4IDZA 3RPUA 4YXDA 1XZYA 2V5CA 2H7VC 4P0BA 4P09A 2I0MA 3SRZA 4DNDA 3UU6A 1XNRT 5KDMC 3SS1A 3GA8A 2YU2A 4ZXLA 3L09A 3MKDA 1DU2A 2CLYC 2J62A 4LMLA 2QGSA 4MHCA 2V6XA 2IW5B 3RYFE 5BW2A 1HTJF 4I4TE 3PEOA 4EV6A 2W61A 2IDOB 3SQ9A 1HF8A 5LJNA 2LKGA 2YMDA 1D0XA 3ZMVB 4PK5A 3WTMA 3AA6B 3RI5A 2JQQA 3T4MA 2WDVA 4A56A 2V7JA 2WSSV 5LB7B 3O1HA 3KVBA 5HEHA 2BR8A 2PBIA 5JVDE 2BR7A 3AAIA 1OWAA 2XNUA 2LOSA 4KI0F 4TWDA 2XASB 2LEHA 4EXTA 2MTQA 4QH5A 3PUVF 5IUXA 3CK6A 4DR2T 4NXNT 1WFDA 4WNKA 3C4XA 3HI2A 4DR4T 4YLHA 1NWMX 3UUXB 4NIQA 1VCTA 2XAHB 2V6YB 2W00A 1OEDA 2AXDS 5LG3A 3ZC1A 3I9YA 1S35A 4LFCT 4EGWA 5AQTB 3TLVA 4O4LE 3L8RA 1ZOYA 4H9OC 2UXBT 5F5WA 4XAXB 1R8IA 4QX7B 5AQMB 2F4VT 3U8NA 3AE4A 4ISSA 2RPAA 1HNWT 2MPKA 4ZJSA 3P4PA 3GN5B 4YTMA 4JLEA 2E5LT 2CLYB 2XTLA 3K3OA 3ETUA 3EI0A 2WY2A 3EAMA 2BVMA 2IC6A 4AI6A 2LT3A 4UM3S 2E5VA 4EEDA 3FZMB 4DBQA 2XZ6A 4JI7T 5JR9C 3EVYA 3Q9DA 5L3DB 4N78D 2D0UA 1QUUA 4L5GA 1Z8UA 1XDOA 3C98B 3ZMSB 3IA3A 2Y58A 2WNLA 3AXJA 3N9QA 1D1CA 1W9RA 4IE4A 4ZI7E 1LVKA 2XQ9A 4HFCA 1BR4A 2IMLA 3OJAA 3O9XA 3NVOA 2LRLA 3OKQA 2WWVA 2LSJA 1E7PA 2XAQB 2XUEA 3C79A 1MMDA 4DUZT 4DV7T 5LCYA 2KWIB 4PFPA 3C50A 4JI8T 3AA7B 3EUHA 5DQWA 3ZDHA 2CMRA 3RIUC 4C91A 2CPTA 4JV5T 2QA7A 2YK0A 3N2KE 2YKSA 4DIDB 2IHR1 3RKOA 4FI5A 1ZV4X 5L3CB 3X1DA 4U33A 1FEWA 3O4XE 2M6BA 1MIYA 3I0QA 4ZZBA 5ABEA 1UUSA 1QLBA 3PU3A 4JI4T 2KZ7B 5KMGP 3RLFF 1T72A 3LDQB 2E2AA 3ZT6A 2VB6A 2WU5A 2FUPA 3T1YT 1D1AA 3RC3A 4BQTA 4TUYE 4U31A 5AQUB 2ES0A 3N9PA 2R6GF 2BG9E 4O4JE 4YHHT 1HR0T 2X9HA 4QABA 2BYQA 4HKAA 4UVAB 4DVDA 4X64T 1QSDA 4AFGA 4KHPT 4O4HE 1LVFA 4HQPA 1WYCA 4X1KE 5BP0A 1YD8G 1ZP0A 2UUBT 4MLKA 2LHNA 2BG9B 2V7LA 1UX2A 1M62A 3MZKB 2BBJA 2BKNA 1EZ3A 2JQHA 4EB6E 5JMEA 3FBZA 3FB2A 4IE7A 4O2AE 3E0ZA 1W09A 2NWBA 3WAKA 3AA0B 2OV9A 2Y48B 3ZCJA 1LKXA 4EIWA 2FJBA 4YY3T 5L3EB 1BR0A 1YKHB 2XM1A 5LOVE 2W8GA 2XZ5A 5LMNT 4CN6A 5HXSA 4JI1T 4B6XA 3O1IA 5HXHA 2XNTA 1IAPA 3KV5A 2CCQA 5AFMA 3P4WA 3AAAB 5C2TA 5FVLA 4IE0A 5LHHB 4GYSA 4BJMA 5HEGA 2VASA 3P4RA 3I9WA 5C8YE 1NAFA 3VRBA 1J5ET 3ZCIA 4CXXA 5JDQA 4YSXA 3CWZB 4WZXA 5FNVE 1D0ZA 3D0TA 4TWFA 4AQGA 1MNEA 5DQVA 1L0VA 5AQRB 2WNJA 2XQ8A 4COFA 5HYAA 1WR0A 4IGUA 2MYSA 3RHWA 3JCFA 2WNCA 2BYNA 4QAAA 4H9NC 2BVLA 2LE8A 5LGNB 1HCIA 4DR6T 4CN1A 1G8XA 5JTGA 4NPPA 5AQKB 4H9SE 1S94A 2VKHA 2B1EA 2X66A 5H6RB 4P0AA 1YQ3A 3IF8B 2DCFA 5JQGE 5AFUL 2J4GA 3AEAA 3KV6A 3AEBA 3AE1A 3CQGB 2XNVA 2CEAA 3VHLA 1UK5A 2WQYA 3FBLA 3GWHA 2K3WA 3A8YC 3RH3A 5ABFB 2WB5A 3T1HT 2XHEB 5C3JA 5CFBA 3N9MA 3AE2A 5JREA 4LFAT 2V26A 4ZRUA 2ZM6T 2X9XA 1YXRA 3LSVA 3PJAJ 3UTKA 4O4IE 4JYAT 4K0KT 4ERRA 3ZDGA 4BJNA 2C5IT 4P1NA 2PH9A 2NW7A 5ADXL 4DV1T 5EZYE 5L4HA 2Q9QB 2YEVC 1J1JA 4UV8B 3F31A 2M67A 5KX5E 5AQOB 3U3IA 4ZEYA 2RA1A 3E22E 3JC6C 2VKJA 4IE5A 2YN6A 1D1BA 1T7SA 5FY0A 2MOZA 4YTPA 2XQ6A 1VOMA 3FXDB 3ONXA 4EZ1A 4UM3P 4XK9A 4H63H 2NOXA 2YDRA 4DBRA 1XNQT 4AQFA 1WCRA 2W2UA 3RYCE 1I94T 5LP6E 2Q9QD 2VL0A 4CXWA 4F8HA 5LXBA 4QH1A 3SFEA 2A9UA 2PFVA 4H9PC 4HWIB 2YMEA 3BQLA 4IL4A 1IZNB 1OEDC 4MBQA 5AFLA 4HWCA 4AFHA 2CWYA 5AFNA 4WV9A 4GKKT 5M4YA 5J2TE 3PE0A 1E2AA 4DMVA 5FXWA 2XQYA 4EOZB 4QKNA 1H7CA 5AQPB 5LGTB 4GYRA 2UXNB 5LG4A 2BKOA 1FMVA 2I59A 2LSIA 5HXRA 3GMIA 2CHNA 2WWUA 3NWIA 1SUMB 5J5FA 2UXXB 3VKGA 1GQEA 3LJCA 5TAOA 3Q5WA 3UQ4A 4UF0B 2C5KT 1UW6A 4LMKA 4DV3T 3DTOA 2HN1A 2GK9A 5H6QB 5HCJA 5KXJA 2FJEA 4OK0A 4DV0T 4KX6A 1OEDE 5LHIB 3NZPA 4KHZF 2ZLYA 2C9TA 1NEKA 1YW0A 4U3CA 4L9IA 2X00A 5FXXA 4NUUA 4TZ4C 3PU8A 3JC6D 3BQIA 3RQWA 4KMCA 2WMNA 5HEJA 4ALXA 1MMAA 2VVNA 4YJ2E 1OEDB 2VK9A 2FJDA 4TN7B 4A5XA 3NBXX 3AEEA 2NTYA 1XMQT 5LNKA 3ZT7A 3HL6A 4ZOLE 1HFAA 2V5DA 3UU4A 3RRCA 2V6YA 5AFHA 4XBFB 2KXPB 2CXFA 4JI3T 3K3QC 4ILBA 4U74A 1WRDA 4UXUA 4CQIA 2CXDA 3SQ6A 1WYBA 3NKZA 3FZHB 4CZZB 4AKHA 3P50A 4JI5T 1CHUA 2WS3A 3C4ZA 2BZBA 4PW8A 4U2YA 3AB3B 4Q25A 1OXZA 3GN5A 2WP9A 5SYOA 3TKLB 5AQSB 4HFHA 2XQ5A 5F3JA 5J5IA 3W15B 4O8SA 3RKGA 3VKHA 4MALA 2CA5A 3RQUA 3N9LA 5AQJB 3UU3A 5AQFB 4PAGA 3RYIE 4C90A 3AA1B 4LF5T 2XYTA 5L2LA 1CUNA 5DABA 1Z0PA 4LMJA 3T8OA 4IE6A 3ANWB 3AE6A 4HTEA 4F6RC 3BK9A 3CX8B 3KV4A 1IJ6A 2X68A 5LMUT 2XSBA 4M1PA 3HR0A 4I50E 3AE5A 3SWHA 2E9XC 1LRZA 4UELA 4DR3T 1T98A 1IJ5A 2XYSA 2UZ6A 3UU5A 2CM0A 2H88A 3LBXB 3P8CD 2WN9A 2CBJA 4PK4A 2ACZA 4D01A 3A5XA 4ZS2A 4ANJA 3U8LA 1X9BA 1ZEEA 4HEAA 4YHJA 2VWAA 3IEEA 2ODVA 3R6NA 5BMVE 3H3MA 2SPCA 3AVSA 4DBMA 3H37A 5KE4A 3ETVA 3CX7B 1KK7A 4A98A 4DUYT 5CO5A 2JMHA 5JDNA 2LJLA 3L39A 1N33T 5JR9B 2H89A 3ZLIA 1N36T 2ZM8A 2DL1A 2VKDA 2JQ9A 4X5TA 2DLRA 4IT4A 2X0YA 4DV5T 3QOFA 4LF6T 2YU1A 2WDRA 3MA9A 3OBVE 2JMKA 2L3LA 2J1DG 4HFDA 5LXTE 4H9QC 2XAJB 3ZMUB 2V8SV 4CXYA 1HX1B 2VURA 2QVAA 5GONE 4KP3C 3UULA 5JH7E 4QHOA 2HN2A 1KNPA 4NXMT 3RYHE 3P7IA 3ZT5A 4X65T 3P4QA 3KBUA 1YQ4A 4HN9A 4ZI2C 4U72A 2XQAA 4CI1B 2E9XA 3ZN1B 5AFMB 2NTXA 4JUYA 2V7MA 2X51A 1O3XA 5AQHB 4EYUA 4HFIA 2BS3A 3CKDA 4PFOA 3K1SA 4H63V 2H7OA 2LLYA 1ZHCA 2V7KA 3KFWX 3KINB 4PJJA 3VR9A 3UUMA 2A72A 2KLQA 5BR8T 3SH1A 2LKHA 3PUQA 4YJ3E 3WTHA 4V1Av 3ZEFB 2X67A 3F57A 4AQFC 4K0UA 1Y64B 4DR5T 4LF7T 4E7ZA 1BR2A 3SIOA 3PJAA 4ILAA 3AAEB 5JRCA 3RIFA 2YDQA 2UUAT 3CQCB 4UIGA 5CB4E 4I55E 5EK4A 2IAKA 3KBTA 4JBWF 4NZBA 4PIRA 3K3NA 4L0RA 3VRAA 3K8PC 2KT9A 5A1LA 4ADZA 3FHNA 5FXZA 4LF9T 3N2GE 5JDFA 2W67A 3OVUA 2CHOA 3AEFA 1T8BA 1UX5A 2B76A 5LJMA 4QWNB 5L3FB 4AQYT 3M3ZB 5FVKA 5FP3A 3CQXC 5JDMA 3FZLB 4GIWA 3I0OA 3WTLA 5L47A 2LSGA 3B13A 3WI3A 5L3GB 1I6ZA 2DHRA 2D5UA 2DNXA 1NENA 4B3ST 4Z8XA 5FMNA 5IHYA 4DV4T 3UUNA 3IBPA 2JJ9A 3U8MA 3N9OA 4U7YA 2W0GA 4PJLA 2Y57A 4JEUB 2EHOA 5HAXA 3VR8A 4ZI2D 2A3DA 1MNDA 3CIRA 1JNRA 3ZPOA 2PJQA 4DMWA 1E1HB 3G06A 3PUWF 4LF4T 3AECA 2L8KA 2WMOA 4CI2B 1SHZC 3KV9A 4IL9A 2LM2A 3PUZF 1UX4A 4UVCB 4AIUA 4YTNA 4OFZA 3AE8A 2WDQA 2FJAA 3ONLC 3ZYLA 4A97A 4KBMB 3CMLA 3KVAA 2NP9A 4BA9A 3PUXF 2CWOA 2K9AA 2PTFA 3CVRA 1US7B 2XQ7A 2KWHA 1D0YA 2XM2A 3A7MA 3PV0F 3JADA 2DWKA 5IWAT 2HHHT 1N34T 2ZJUA 3OYXA 3V5UA 2XJ7A 4ZK4A 3Q5XA 2LSYA 2MBGA 5LA6E 1KNRA 2W62A 3ONJA 5BRXA 2IC9A 2W4XA 4EEBA 2D2SA 2FBWA 1U5PA 2XQ3A 2K48A 4PJNA 3S4UA 1HNXT 3IHRA 4X20E 5E0OA 4MFRA 3ZN0B 3AEDA 4B5DA 2I6HA 4WBOA 2QC1B 1W0AA 4EYYR 3J7Yq 3OPCA 3QB5A 1MIWA 4AKIA 4X62T 4OYJA 5FY1A 2Y54A 2BBHA 3WIPA 4QACA 3UFGA 5HWYA 2DWGA 4HFVA 3V5SA 3FZKB 5J1GA 2X0HA 2ZM2A 1FMWA 4ASKA 3C4WA 4BAYB 3I1AA 4BFQA 4WYVA 4UF0A 5FL1A 3TLWA 4IREA 2UUCT 5AQGB 2RP4A 1HNZT 3N2OA 2X9YA 4YFSA 2OA5A 4QXBB 3QK6A 2CBIA 2OLTA 2YOEA 1UURA 4X1YE 3PDYA 2M6IA 3PUSA 3LK42 5EK2A 3BQKA 3ESLA 1UV6A 1U4QA 4KUMB 2LHRA 2BYPA 4HFBA 3NZQA 3QB5K 3NRYA 2X00D 1W0BA 5CA0E 4U7IA 5ABGA 3KDSE 4DR1T 2HPLA 3N5LA 3PUAA 2XQ4A 3ZSTA 3C51A 5FY7A 1HX8A 2WU2A 3RGLA 2HH7A 1MMNA 3AE3A 4IIJE 3P4SA 3QC9A 4ZR6A 5L3BB 2LOPA 5FKYA 4ILUA 2X0LB 2Z6EA 1KNZA 4QH4A 3WTJA 2W66A 4ZZCA 1UCUA 3DJBA 2A2FX 3DP7A 1V9DA 2V1DB 3AXJB 2Y6XA 3L3PA 3MACA 2VQET 4B3TT 5ETWA 3U8KA 2QRXA 4I43B 3WTOA 5AQQB 5TVCA 5LHGB 4Z91A 1FIOA 1Y01A 2BG9C 1J5WA 2AE9A 1FJGT 2L9QA 5LBQB 5L4EA 4B3MT 5AQLB 1BR1A 1WR6A 3ZJ2A 2XSAA 4AFTA 1B7TA 5J2UE 3HKEE 3EDUA 3AEGA 2UXDT 4UVBB 2YINA 4QXCB 5J5HA 1AJ3A 4JEHB 3AE9A 3NRXA 2JIWA 4CN4A 2C5JA 1UGOA 3WTKA 2VQFT 3SFDA 3ANWA 1N32T 4EZHA 5DJQC 4TNWA 4UEMA 5FXVA 4YSZA 2BKPA 2DI4A 3WAJA 4UY2A 1MIVA 3B5MA 2NW9A 4DR7T 4LFBT 3HKBE 1G73A 3Q2MA 3UU8A 3LBXA 2CRBA 2H3RA 4OYKA 1XMOT 3C84A 4UM3A 1IBLT 2ZMAA 3RRWA 3IGQA 2BYSA 1IBKT 2W63A 4FRRA 2ZM0A 4AKGA 4OHFA 2D9DA 1WLXA 5CGMA 4UM1A 5FL0A 4I0UA 3TLUA 2E8IA 3JAFA 4AKLA 4HWDA 3LK3B 4J2CA 2ODUA 2BS2A 3ZJ1A 3GUAA 5HCMA 3M65A 4PNIA 3ZYMA 2K5BB 3VU7H 1KEYA 2MAWA 3UFEA 4JI6T 2JRKA 2C0SA 4TNVA 5JR9A 2ACXA 5LGUB 3OYZA 2YDSA 2BG9A 4HFEA 3ZMZB 3UQ7A 2XAFB 4UR9A 2K24A 4AKRB 4TX5A 3SOLA 5CA1E 3HKDE 3MJXA 2LRKA 4TV8E 4UV9B 4EZ4A 2WZIA 4QXHB 2JPFA 2KSRA 4GK5E 2N2NA 4HGAA 4IDQA 2E9XB 3LG7A 3RF1A 4ZI3C 5J5GA 5JDHA 2CE7A 3QUJA 5ABHA 4GKJT 2VL8A 5LBMA 5FJVA 1X79A 1XDPA 2UXCT 2KMFA 3JAEA 2Y7YA 3FXEB 4HWFA 4Z90A 2J47A 3RIUA 1SA0E 4GK0E 2WZYA 2EHOC 3PUYF 3ABVA 2W8FA 4HE8A
chains in the Genus database with same CATH topology
4AFHA 4QH4A 2W8GA 3WTJA 4ZZCA 3TLVA 2YKSA 3RQWA 2XNVA 2XZ5A 3RIFA 2BYRA 5AFNA 4WV9A 5HEJA 4IL9A 3PMZA 4ALXA 2XYTA 2LM2A 4UM1A 5AFJA 4LMJA 3TLUA 1OEDB 3UU6A 2M6BA 5CFBA 3U8JA 3JAFA 5HEOA 4HFDA 2XNTA 4BFQA 4ZZBA 3EHZA 4ZRUA 3UUBA 3LSVA 4A97A 2ZJVA 3U8KA 3WTIA 3WTOA 2BJ0A 4LMLA 3U8NA 3TLWA 4IREA 3GUAA 5HCMA 5TVCA 4Z91A 5AFMA 4NZBA 3P4WA 4PIRA 3ZDGA 4ZJSA 2BG9C 2MAWA 2PH9A 5BW2A 4XHEA 5L4EA 3PEOA 3UU4A 2PGZA 5HEGA 4BQTA 3SQ9A 2XYSA 2YOEA 2UZ6A 2XQ7A 3UU5A 3EI0A 4TNVA 2LKGA 4AFTA 5L4HA 5AFHA 2BG9E 3EAMA 2M6IA 2WN9A 1I9BA 2YMDA 3JADA 2BG9A 4HFEA 2XQAA 4ILBA 1UV6A 4D01A 4UM3S 4QABA 2XZ6A 4UXUA 5AFMB 2BYPA 2ZJUA 4HFBA 3WTMA 2BYQA 3UQ7A 5J5HA 3RI5A 4ZK4A 4AFGA 3T4MA 3U8LA 2YN6A 4HFIA 2X00D 4ZJTA 3SQ6A 5BRXA 3TLSA 5J5FA 3TLTA 2Y58A 5KZUA 2WNLA 4HQPA 2LLYA 2XQ6A 5HEHA 2BR8A 4ILCA 3WTKA 5BP0A 2BR7A 2KSRA 4TWFA 5AINA 4EZ1A 3WTLA 4UM3P 4XK9A 2BG9B 2WNJA 2XQ4A 3RIAA 2XQ3A 2XQ8A 3UQ4A 5L47A 4COFA 1UX2A 2XNUA 3P50A 4TNWA 2XQ9A 3SH1A 5J5GA 2LKHA 4TWDA 3ZKRA 4LMKA 1UW6A 4ZK1A 5AFLA 5AFKA 3RHWA 2WNCA 2BYNA 5IUXA 4QH5A 4HFCA 4QAAA 5JMEA 4DBMA 5KE4A 2VL0A 3WTHA 5FJVA 4UY2A 5HCJA 4B5DA 4F8HA 3U8MA 4A98A 2QC1B 5LXBA 3C79A 3JAEA 2Y7YA 5CO5A 5SYOA 4NPPA 4QH1A 4Z90A 1OEDE 2Y57A 4ZR6A 5J0ZA 3WTNA 4HFHA 4TWHA 3UU8A 3SIOA 1OEDA 2XQ5A 5J5IA 2C9TA 2YMEA 5LG3A 4ILAA 2Y54A 3C84A 5HEUA 4UM3A 4X5TA 3WIPA 4QACA 2WZYA 2Y56A 4IL4A 3RQUA 3IGQA 3ZDHA 2BYSA 2X00A 2W8FA 1OEDC 3UU3A 4FRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AFH A;  4QH4 A;  2W8G A;  3WTJ A;  4ZZC A;  3TLV A;  2YKS A;  3RQW A;  2XNV A;  2XZ5 A;  3RIF A;  2BYR A;  5AFN A;  4WV9 A;  5HEJ A;  4IL9 A;  3PMZ A;  4ALX A;  2XYT A;  2LM2 A;  4UM1 A;  5AFJ A;  4LMJ A;  3TLU A;  1OED B;  3UU6 A;  2M6B A;  5CFB A;  3U8J A;  3JAF A;  5HEO A;  4HFD A;  2XNT A;  4BFQ A;  4ZZB A;  3EHZ A;  4ZRU A;  3UUB A;  3LSV A;  4A97 A;  2ZJV A;  3U8K A;  3WTI A;  3WTO A;  2BJ0 A;  4LML A;  3U8N A;  3TLW A;  4IRE A;  3GUA A;  5HCM A;  5TVC A;  4Z91 A;  5AFM A;  4NZB A;  3P4W A;  4PIR A;  3ZDG A;  4ZJS A;  2BG9 C;  2MAW A;  2PH9 A;  5BW2 A;  4XHE A;  5L4E A;  3PEO A;  3UU4 A;  2PGZ A;  5HEG A;  4BQT A;  3SQ9 A;  2XYS A;  2YOE A;  2UZ6 A;  2XQ7 A;  3UU5 A;  3EI0 A;  4TNV A;  2LKG A;  4AFT A;  5L4H A;  5AFH A;  2BG9 E;  3EAM A;  2M6I A;  2WN9 A;  1I9B A;  2YMD A;  3JAD A;  2BG9 A;  4HFE A;  2XQA A;  4ILB A;  1UV6 A;  4D01 A;  4UM3 S;  4QAB A;  2XZ6 A;  4UXU A;  5AFM B;  2BYP A;  2ZJU A;  4HFB A;  3WTM A;  2BYQ A;  3UQ7 A;  5J5H A;  3RI5 A;  4ZK4 A;  4AFG A;  3T4M A;  3U8L A;  2YN6 A;  4HFI A;  2X00 D;  4ZJT A;  3SQ6 A;  5BRX A;  3TLS A;  5J5F A;  3TLT A;  2Y58 A;  5KZU A;  2WNL A;  4HQP A;  2LLY A;  2XQ6 A;  5HEH A;  2BR8 A;  4ILC A;  3WTK A;  5BP0 A;  2BR7 A;  2KSR A;  4TWF A;  5AIN A;  4EZ1 A;  3WTL A;  4UM3 P;  4XK9 A;  2BG9 B;  2WNJ A;  2XQ4 A;  3RIA A;  2XQ3 A;  2XQ8 A;  3UQ4 A;  5L47 A;  4COF A;  1UX2 A;  2XNU A;  3P50 A;  4TNW A;  2XQ9 A;  3SH1 A;  5J5G A;  2LKH A;  4TWD A;  3ZKR A;  4LMK A;  1UW6 A;  4ZK1 A;  5AFL A;  5AFK A;  3RHW A;  2WNC A;  2BYN A;  5IUX A;  4QH5 A;  4HFC A;  4QAA A;  5JME A;  4DBM A;  5KE4 A;  2VL0 A;  3WTH A;  5FJV A;  4UY2 A;  5HCJ A;  4B5D A;  4F8H A;  3U8M A;  4A98 A;  2QC1 B;  5LXB A;  3C79 A;  3JAE A;  2Y7Y A;  5CO5 A;  5SYO A;  4NPP A;  4QH1 A;  4Z90 A;  1OED E;  2Y57 A;  4ZR6 A;  5J0Z A;  3WTN A;  4HFH A;  4TWH A;  3UU8 A;  3SIO A;  1OED A;  2XQ5 A;  5J5I A;  2C9T A;  2YME A;  5LG3 A;  4ILA A;  2Y54 A;  3C84 A;  5HEU A;  4UM3 A;  4X5T A;  3WIP A;  4QAC A;  2WZY A;  2Y56 A;  4IL4 A;  3RQU A;  3IGQ A;  3ZDH A;  2BYS A;  2X00 A;  2W8F A;  1OED C;  3UU3 A;  4FRR A; 
#chains in the Genus database with same CATH topology
 2Q9Q C;  3AVR A;  5LYJ E;  2E9X D;  4H9R C;  2UU9 T;  3PMZ A;  2N1G A;  2NW8 A;  3U8J A;  3QNU A;  3ZC0 A;  2IUB A;  5JRC B;  3EAB A;  5EK3 A;  3PUR A;  2NR4 A;  4G2A A;  4DO0 A;  4IDN A;  4X1I E;  2Y8D A;  2VKO A;  4UXN B;  4IDP A;  1YKE B;  4OX9 T;  4XHE A;  2PGZ A;  4IST A;  2KIN B;  4WBN E;  2QYW A;  2IIU A;  4G63 A;  1I9B A;  2KND A;  4YSY A;  2XZE A;  4E7S A;  2D0T A;  4EAH A;  2X9W A;  4ZJT A;  3CX6 B;  3TLS A;  3PTR B;  4IHJ E;  2JQK A;  2LM9 A;  4QX8 B;  5FYM A;  3U78 A;  2WM9 A;  5AFK A;  4LF8 T;  4B3R T;  3FZF B;  4X66 T;  2PG8 A;  1KF6 A;  3WTN A;  5J0Z A;  3Q5D A;  3CPZ A;  5ABF A;  1VRB A;  2CXL A;  3C64 A;  4AIS A;  4JI2 T;  4ZHQ E;  4TV9 E;  4PJM A;  5AQV B;  2BYR A;  5JDG A;  3LK2 B;  1MMG A;  2EHO B;  3OTO T;  4WW0 A;  5AFJ A;  3MK7 C;  3ZSS A;  3HKC E;  1HS7 A;  3H3A A;  2XAG B;  2WBL A;  5HEO A;  3MXZ A;  4YT0 A;  4ZI3 D;  3EHZ A;  3ZYK A;  2Q9Q A;  3UUB A;  2ZJV A;  5JDL A;  3RC8 A;  3WTI A;  3RX6 A;  4JI0 T;  2BJ0 A;  3E08 A;  5AQI B;  1M7K A;  5HXE A;  3PUG A;  4CI3 B;  4NUV A;  5HWX A;  4PK6 A;  3EDV A;  5F8P A;  5CJ5 A;  3J9X 1;  5HXC A;  2WZH A;  1VCS A;  1ZKE A;  2XY8 B;  2EHO D;  4HWH A;  2BDE A;  4DV2 T;  4U2Z A;  1KFY A;  3F2E A;  2HPJ A;  5AQN B;  3UT5 E;  4O2B E;  5IYZ E;  2VVS A;  3TLT A;  5KZU A;  2N9D A;  2WAU A;  4ILC A;  5AIN A;  4ZS3 A;  4IDO A;  2G0U A;  3Q5E A;  3HA4 A;  3RIA A;  2V7I A;  4ZK1 A;  2WCA A;  3ZKR A;  2BS4 A;  4XZC A;  4FJO A;  3LFM A;  3O1J A;  1SE7 A;  1IBM T;  4TWH A;  4DV6 T;  1HG5 A;  2P9B A;  5HEU A;  3ZMT B;  2Y56 A;  1XWM A;  2LSK A;  2XPK A;  3AE7 A;  3N9N A;  3R84 B;  4GOU A;  1JNZ A;  1HG2 A;  3B57 A;  4AXP A;  4IDZ A;  3RPU A;  4YXD A;  1XZY A;  2V5C A;  2H7V C;  4P0B A;  4P09 A;  2I0M A;  3SRZ A;  4DND A;  3UU6 A;  1XNR T;  5KDM C;  3SS1 A;  3GA8 A;  2YU2 A;  4ZXL A;  3L09 A;  3MKD A;  1DU2 A;  2CLY C;  2J62 A;  4LML A;  2QGS A;  4MHC A;  2V6X A;  2IW5 B;  3RYF E;  5BW2 A;  1HTJ F;  4I4T E;  3PEO A;  4EV6 A;  2W61 A;  2IDO B;  3SQ9 A;  1HF8 A;  5LJN A;  2LKG A;  2YMD A;  1D0X A;  3ZMV B;  4PK5 A;  3WTM A;  3AA6 B;  3RI5 A;  2JQQ A;  3T4M A;  2WDV A;  4A56 A;  2V7J A;  2WSS V;  5LB7 B;  3O1H A;  3KVB A;  5HEH A;  2BR8 A;  2PBI A;  5JVD E;  2BR7 A;  3AAI A;  1OWA A;  2XNU A;  2LOS A;  4KI0 F;  4TWD A;  2XAS B;  2LEH A;  4EXT A;  2MTQ A;  4QH5 A;  3PUV F;  5IUX A;  3CK6 A;  4DR2 T;  4NXN T;  1WFD A;  4WNK A;  3C4X A;  3HI2 A;  4DR4 T;  4YLH A;  1NWM X;  3UUX B;  4NIQ A;  1VCT A;  2XAH B;  2V6Y B;  2W00 A;  1OED A;  2AXD S;  5LG3 A;  3ZC1 A;  3I9Y A;  1S35 A;  4LFC T;  4EGW A;  5AQT B;  3TLV A;  4O4L E;  3L8R A;  1ZOY A;  4H9O C;  2UXB T;  5F5W A;  4XAX B;  1R8I A;  4QX7 B;  5AQM B;  2F4V T;  3U8N A;  3AE4 A;  4ISS A;  2RPA A;  1HNW T;  2MPK A;  4ZJS A;  3P4P A;  3GN5 B;  4YTM A;  4JLE A;  2E5L T;  2CLY B;  2XTL A;  3K3O A;  3ETU A;  3EI0 A;  2WY2 A;  3EAM A;  2BVM A;  2IC6 A;  4AI6 A;  2LT3 A;  4UM3 S;  2E5V A;  4EED A;  3FZM B;  4DBQ A;  2XZ6 A;  4JI7 T;  5JR9 C;  3EVY A;  3Q9D A;  5L3D B;  4N78 D;  2D0U A;  1QUU A;  4L5G A;  1Z8U A;  1XDO A;  3C98 B;  3ZMS B;  3IA3 A;  2Y58 A;  2WNL A;  3AXJ A;  3N9Q A;  1D1C A;  1W9R A;  4IE4 A;  4ZI7 E;  1LVK A;  2XQ9 A;  4HFC A;  1BR4 A;  2IML A;  3OJA A;  3O9X A;  3NVO A;  2LRL A;  3OKQ A;  2WWV A;  2LSJ A;  1E7P A;  2XAQ B;  2XUE A;  3C79 A;  1MMD A;  4DUZ T;  4DV7 T;  5LCY A;  2KWI B;  4PFP A;  3C50 A;  4JI8 T;  3AA7 B;  3EUH A;  5DQW A;  3ZDH A;  2CMR A;  3RIU C;  4C91 A;  2CPT A;  4JV5 T;  2QA7 A;  2YK0 A;  3N2K E;  2YKS A;  4DID B;  2IHR 1;  3RKO A;  4FI5 A;  1ZV4 X;  5L3C B;  3X1D A;  4U33 A;  1FEW A;  3O4X E;  2M6B A;  1MIY A;  3I0Q A;  4ZZB A;  5ABE A;  1UUS A;  1QLB A;  3PU3 A;  4JI4 T;  2KZ7 B;  5KMG P;  3RLF F;  1T72 A;  3LDQ B;  2E2A A;  3ZT6 A;  2VB6 A;  2WU5 A;  2FUP A;  3T1Y T;  1D1A A;  3RC3 A;  4BQT A;  4TUY E;  4U31 A;  5AQU B;  2ES0 A;  3N9P A;  2R6G F;  2BG9 E;  4O4J E;  4YHH T;  1HR0 T;  2X9H A;  4QAB A;  2BYQ A;  4HKA A;  4UVA B;  4DVD A;  4X64 T;  1QSD A;  4AFG A;  4KHP T;  4O4H E;  1LVF A;  4HQP A;  1WYC A;  4X1K E;  5BP0 A;  1YD8 G;  1ZP0 A;  2UUB T;  4MLK A;  2LHN A;  2BG9 B;  2V7L A;  1UX2 A;  1M62 A;  3MZK B;  2BBJ A;  2BKN A;  1EZ3 A;  2JQH A;  4EB6 E;  5JME A;  3FBZ A;  3FB2 A;  4IE7 A;  4O2A E;  3E0Z A;  1W09 A;  2NWB A;  3WAK A;  3AA0 B;  2OV9 A;  2Y48 B;  3ZCJ A;  1LKX A;  4EIW A;  2FJB A;  4YY3 T;  5L3E B;  1BR0 A;  1YKH B;  2XM1 A;  5LOV E;  2W8G A;  2XZ5 A;  5LMN T;  4CN6 A;  5HXS A;  4JI1 T;  4B6X A;  3O1I A;  5HXH A;  2XNT A;  1IAP A;  3KV5 A;  2CCQ A;  5AFM A;  3P4W A;  3AAA B;  5C2T A;  5FVL A;  4IE0 A;  5LHH B;  4GYS A;  4BJM A;  5HEG A;  2VAS A;  3P4R A;  3I9W A;  5C8Y E;  1NAF A;  3VRB A;  1J5E T;  3ZCI A;  4CXX A;  5JDQ A;  4YSX A;  3CWZ B;  4WZX A;  5FNV E;  1D0Z A;  3D0T A;  4TWF A;  4AQG A;  1MNE A;  5DQV A;  1L0V A;  5AQR B;  2WNJ A;  2XQ8 A;  4COF A;  5HYA A;  1WR0 A;  4IGU A;  2MYS A;  3RHW A;  3JCF A;  2WNC A;  2BYN A;  4QAA A;  4H9N C;  2BVL A;  2LE8 A;  5LGN B;  1HCI A;  4DR6 T;  4CN1 A;  1G8X A;  5JTG A;  4NPP A;  5AQK B;  4H9S E;  1S94 A;  2VKH A;  2B1E A;  2X66 A;  5H6R B;  4P0A A;  1YQ3 A;  3IF8 B;  2DCF A;  5JQG E;  5AFU L;  2J4G A;  3AEA A;  3KV6 A;  3AEB A;  3AE1 A;  3CQG B;  2XNV A;  2CEA A;  3VHL A;  1UK5 A;  2WQY A;  3FBL A;  3GWH A;  2K3W A;  3A8Y C;  3RH3 A;  5ABF B;  2WB5 A;  3T1H T;  2XHE B;  5C3J A;  5CFB A;  3N9M A;  3AE2 A;  5JRE A;  4LFA T;  2V26 A;  4ZRU A;  2ZM6 T;  2X9X A;  1YXR A;  3LSV A;  3PJA J;  3UTK A;  4O4I E;  4JYA T;  4K0K T;  4ERR A;  3ZDG A;  4BJN A;  2C5I T;  4P1N A;  2PH9 A;  2NW7 A;  5ADX L;  4DV1 T;  5EZY E;  5L4H A;  2Q9Q B;  2YEV C;  1J1J A;  4UV8 B;  3F31 A;  2M67 A;  5KX5 E;  5AQO B;  3U3I A;  4ZEY A;  2RA1 A;  3E22 E;  3JC6 C;  2VKJ A;  4IE5 A;  2YN6 A;  1D1B A;  1T7S A;  5FY0 A;  2MOZ A;  4YTP A;  2XQ6 A;  1VOM A;  3FXD B;  3ONX A;  4EZ1 A;  4UM3 P;  4XK9 A;  4H63 H;  2NOX A;  2YDR A;  4DBR A;  1XNQ T;  4AQF A;  1WCR A;  2W2U A;  3RYC E;  1I94 T;  5LP6 E;  2Q9Q D;  2VL0 A;  4CXW A;  4F8H A;  5LXB A;  4QH1 A;  3SFE A;  2A9U A;  2PFV A;  4H9P C;  4HWI B;  2YME A;  3BQL A;  4IL4 A;  1IZN B;  1OED C;  4MBQ A;  5AFL A;  4HWC A;  4AFH A;  2CWY A;  5AFN A;  4WV9 A;  4GKK T;  5M4Y A;  5J2T E;  3PE0 A;  1E2A A;  4DMV A;  5FXW A;  2XQY A;  4EOZ B;  4QKN A;  1H7C A;  5AQP B;  5LGT B;  4GYR A;  2UXN B;  5LG4 A;  2BKO A;  1FMV A;  2I59 A;  2LSI A;  5HXR A;  3GMI A;  2CHN A;  2WWU A;  3NWI A;  1SUM B;  5J5F A;  2UXX B;  3VKG A;  1GQE A;  3LJC A;  5TAO A;  3Q5W A;  3UQ4 A;  4UF0 B;  2C5K T;  1UW6 A;  4LMK A;  4DV3 T;  3DTO A;  2HN1 A;  2GK9 A;  5H6Q B;  5HCJ A;  5KXJ A;  2FJE A;  4OK0 A;  4DV0 T;  4KX6 A;  1OED E;  5LHI B;  3NZP A;  4KHZ F;  2ZLY A;  2C9T A;  1NEK A;  1YW0 A;  4U3C A;  4L9I A;  2X00 A;  5FXX A;  4NUU A;  4TZ4 C;  3PU8 A;  3JC6 D;  3BQI A;  3RQW A;  4KMC A;  2WMN A;  5HEJ A;  4ALX A;  1MMA A;  2VVN A;  4YJ2 E;  1OED B;  2VK9 A;  2FJD A;  4TN7 B;  4A5X A;  3NBX X;  3AEE A;  2NTY A;  1XMQ T;  5LNK A;  3ZT7 A;  3HL6 A;  4ZOL E;  1HFA A;  2V5D A;  3UU4 A;  3RRC A;  2V6Y A;  5AFH A;  4XBF B;  2KXP B;  2CXF A;  4JI3 T;  3K3Q C;  4ILB A;  4U74 A;  1WRD A;  4UXU A;  4CQI A;  2CXD A;  3SQ6 A;  1WYB A;  3NKZ A;  3FZH B;  4CZZ B;  4AKH A;  3P50 A;  4JI5 T;  1CHU A;  2WS3 A;  3C4Z A;  2BZB A;  4PW8 A;  4U2Y A;  3AB3 B;  4Q25 A;  1OXZ A;  3GN5 A;  2WP9 A;  5SYO A;  3TKL B;  5AQS B;  4HFH A;  2XQ5 A;  5F3J A;  5J5I A;  3W15 B;  4O8S A;  3RKG A;  3VKH A;  4MAL A;  2CA5 A;  3RQU A;  3N9L A;  5AQJ B;  3UU3 A;  5AQF B;  4PAG A;  3RYI E;  4C90 A;  3AA1 B;  4LF5 T;  2XYT A;  5L2L A;  1CUN A;  5DAB A;  1Z0P A;  4LMJ A;  3T8O A;  4IE6 A;  3ANW B;  3AE6 A;  4HTE A;  4F6R C;  3BK9 A;  3CX8 B;  3KV4 A;  1IJ6 A;  2X68 A;  5LMU T;  2XSB A;  4M1P A;  3HR0 A;  4I50 E;  3AE5 A;  3SWH A;  2E9X C;  1LRZ A;  4UEL A;  4DR3 T;  1T98 A;  1IJ5 A;  2XYS A;  2UZ6 A;  3UU5 A;  2CM0 A;  2H88 A;  3LBX B;  3P8C D;  2WN9 A;  2CBJ A;  4PK4 A;  2ACZ A;  4D01 A;  3A5X A;  4ZS2 A;  4ANJ A;  3U8L A;  1X9B A;  1ZEE A;  4HEA A;  4YHJ A;  2VWA A;  3IEE A;  2ODV A;  3R6N A;  5BMV E;  3H3M A;  2SPC A;  3AVS A;  4DBM A;  3H37 A;  5KE4 A;  3ETV A;  3CX7 B;  1KK7 A;  4A98 A;  4DUY T;  5CO5 A;  2JMH A;  5JDN A;  2LJL A;  3L39 A;  1N33 T;  5JR9 B;  2H89 A;  3ZLI A;  1N36 T;  2ZM8 A;  2DL1 A;  2VKD A;  2JQ9 A;  4X5T A;  2DLR A;  4IT4 A;  2X0Y A;  4DV5 T;  3QOF A;  4LF6 T;  2YU1 A;  2WDR A;  3MA9 A;  3OBV E;  2JMK A;  2L3L A;  2J1D G;  4HFD A;  5LXT E;  4H9Q C;  2XAJ B;  3ZMU B;  2V8S V;  4CXY A;  1HX1 B;  2VUR A;  2QVA A;  5GON E;  4KP3 C;  3UUL A;  5JH7 E;  4QHO A;  2HN2 A;  1KNP A;  4NXM T;  3RYH E;  3P7I A;  3ZT5 A;  4X65 T;  3P4Q A;  3KBU A;  1YQ4 A;  4HN9 A;  4ZI2 C;  4U72 A;  2XQA A;  4CI1 B;  2E9X A;  3ZN1 B;  5AFM B;  2NTX A;  4JUY A;  2V7M A;  2X51 A;  1O3X A;  5AQH B;  4EYU A;  4HFI A;  2BS3 A;  3CKD A;  4PFO A;  3K1S A;  4H63 V;  2H7O A;  2LLY A;  1ZHC A;  2V7K A;  3KFW X;  3KIN B;  4PJJ A;  3VR9 A;  3UUM A;  2A72 A;  2KLQ A;  5BR8 T;  3SH1 A;  2LKH A;  3PUQ A;  4YJ3 E;  3WTH A;  4V1A v;  3ZEF B;  2X67 A;  3F57 A;  4AQF C;  4K0U A;  1Y64 B;  4DR5 T;  4LF7 T;  4E7Z A;  1BR2 A;  3SIO A;  3PJA A;  4ILA A;  3AAE B;  5JRC A;  3RIF A;  2YDQ A;  2UUA T;  3CQC B;  4UIG A;  5CB4 E;  4I55 E;  5EK4 A;  2IAK A;  3KBT A;  4JBW F;  4NZB A;  4PIR A;  3K3N A;  4L0R A;  3VRA A;  3K8P C;  2KT9 A;  5A1L A;  4ADZ A;  3FHN A;  5FXZ A;  4LF9 T;  3N2G E;  5JDF A;  2W67 A;  3OVU A;  2CHO A;  3AEF A;  1T8B A;  1UX5 A;  2B76 A;  5LJM A;  4QWN B;  5L3F B;  4AQY T;  3M3Z B;  5FVK A;  5FP3 A;  3CQX C;  5JDM A;  3FZL B;  4GIW A;  3I0O A;  3WTL A;  5L47 A;  2LSG A;  3B13 A;  3WI3 A;  5L3G B;  1I6Z A;  2DHR A;  2D5U A;  2DNX A;  1NEN A;  4B3S T;  4Z8X A;  5FMN A;  5IHY A;  4DV4 T;  3UUN A;  3IBP A;  2JJ9 A;  3U8M A;  3N9O A;  4U7Y A;  2W0G A;  4PJL A;  2Y57 A;  4JEU B;  2EHO A;  5HAX A;  3VR8 A;  4ZI2 D;  2A3D A;  1MND A;  3CIR A;  1JNR A;  3ZPO A;  2PJQ A;  4DMW A;  1E1H B;  3G06 A;  3PUW F;  4LF4 T;  3AEC A;  2L8K A;  2WMO A;  4CI2 B;  1SHZ C;  3KV9 A;  4IL9 A;  2LM2 A;  3PUZ F;  1UX4 A;  4UVC B;  4AIU A;  4YTN A;  4OFZ A;  3AE8 A;  2WDQ A;  2FJA A;  3ONL C;  3ZYL A;  4A97 A;  4KBM B;  3CML A;  3KVA A;  2NP9 A;  4BA9 A;  3PUX F;  2CWO A;  2K9A A;  2PTF A;  3CVR A;  1US7 B;  2XQ7 A;  2KWH A;  1D0Y A;  2XM2 A;  3A7M A;  3PV0 F;  3JAD A;  2DWK A;  5IWA T;  2HHH T;  1N34 T;  2ZJU A;  3OYX A;  3V5U A;  2XJ7 A;  4ZK4 A;  3Q5X A;  2LSY A;  2MBG A;  5LA6 E;  1KNR A;  2W62 A;  3ONJ A;  5BRX A;  2IC9 A;  2W4X A;  4EEB A;  2D2S A;  2FBW A;  1U5P A;  2XQ3 A;  2K48 A;  4PJN A;  3S4U A;  1HNX T;  3IHR A;  4X20 E;  5E0O A;  4MFR A;  3ZN0 B;  3AED A;  4B5D A;  2I6H A;  4WBO A;  2QC1 B;  1W0A A;  4EYY R;  3J7Y q;  3OPC A;  3QB5 A;  1MIW A;  4AKI A;  4X62 T;  4OYJ A;  5FY1 A;  2Y54 A;  2BBH A;  3WIP A;  4QAC A;  3UFG A;  5HWY A;  2DWG A;  4HFV A;  3V5S A;  3FZK B;  5J1G A;  2X0H A;  2ZM2 A;  1FMW A;  4ASK A;  3C4W A;  4BAY B;  3I1A A;  4BFQ A;  4WYV A;  4UF0 A;  5FL1 A;  3TLW A;  4IRE A;  2UUC T;  5AQG B;  2RP4 A;  1HNZ T;  3N2O A;  2X9Y A;  4YFS A;  2OA5 A;  4QXB B;  3QK6 A;  2CBI A;  2OLT A;  2YOE A;  1UUR A;  4X1Y E;  3PDY A;  2M6I A;  3PUS A;  3LK4 2;  5EK2 A;  3BQK A;  3ESL A;  1UV6 A;  1U4Q A;  4KUM B;  2LHR A;  2BYP A;  4HFB A;  3NZQ A;  3QB5 K;  3NRY A;  2X00 D;  1W0B A;  5CA0 E;  4U7I A;  5ABG A;  3KDS E;  4DR1 T;  2HPL A;  3N5L A;  3PUA A;  2XQ4 A;  3ZST A;  3C51 A;  5FY7 A;  1HX8 A;  2WU2 A;  3RGL A;  2HH7 A;  1MMN A;  3AE3 A;  4IIJ E;  3P4S A;  3QC9 A;  4ZR6 A;  5L3B B;  2LOP A;  5FKY A;  4ILU A;  2X0L B;  2Z6E A;  1KNZ A;  4QH4 A;  3WTJ A;  2W66 A;  4ZZC A;  1UCU A;  3DJB A;  2A2F X;  3DP7 A;  1V9D A;  2V1D B;  3AXJ B;  2Y6X A;  3L3P A;  3MAC A;  2VQE T;  4B3T T;  5ETW A;  3U8K A;  2QRX A;  4I43 B;  3WTO A;  5AQQ B;  5TVC A;  5LHG B;  4Z91 A;  1FIO A;  1Y01 A;  2BG9 C;  1J5W A;  2AE9 A;  1FJG T;  2L9Q A;  5LBQ B;  5L4E A;  4B3M T;  5AQL B;  1BR1 A;  1WR6 A;  3ZJ2 A;  2XSA A;  4AFT A;  1B7T A;  5J2U E;  3HKE E;  3EDU A;  3AEG A;  2UXD T;  4UVB B;  2YIN A;  4QXC B;  5J5H A;  1AJ3 A;  4JEH B;  3AE9 A;  3NRX A;  2JIW A;  4CN4 A;  2C5J A;  1UGO A;  3WTK A;  2VQF T;  3SFD A;  3ANW A;  1N32 T;  4EZH A;  5DJQ C;  4TNW A;  4UEM A;  5FXV A;  4YSZ A;  2BKP A;  2DI4 A;  3WAJ A;  4UY2 A;  1MIV A;  3B5M A;  2NW9 A;  4DR7 T;  4LFB T;  3HKB E;  1G73 A;  3Q2M A;  3UU8 A;  3LBX A;  2CRB A;  2H3R A;  4OYK A;  1XMO T;  3C84 A;  4UM3 A;  1IBL T;  2ZMA A;  3RRW A;  3IGQ A;  2BYS A;  1IBK T;  2W63 A;  4FRR A;  2ZM0 A;  4AKG A;  4OHF A;  2D9D A;  1WLX A;  5CGM A;  4UM1 A;  5FL0 A;  4I0U A;  3TLU A;  2E8I A;  3JAF A;  4AKL A;  4HWD A;  3LK3 B;  4J2C A;  2ODU A;  2BS2 A;  3ZJ1 A;  3GUA A;  5HCM A;  3M65 A;  4PNI A;  3ZYM A;  2K5B B;  3VU7 H;  1KEY A;  2MAW A;  3UFE A;  4JI6 T;  2JRK A;  2C0S A;  4TNV A;  5JR9 A;  2ACX A;  5LGU B;  3OYZ A;  2YDS A;  2BG9 A;  4HFE A;  3ZMZ B;  3UQ7 A;  2XAF B;  4UR9 A;  2K24 A;  4AKR B;  4TX5 A;  3SOL A;  5CA1 E;  3HKD E;  3MJX A;  2LRK A;  4TV8 E;  4UV9 B;  4EZ4 A;  2WZI A;  4QXH B;  2JPF A;  2KSR A;  4GK5 E;  2N2N A;  4HGA A;  4IDQ A;  2E9X B;  3LG7 A;  3RF1 A;  4ZI3 C;  5J5G A;  5JDH A;  2CE7 A;  3QUJ A;  5ABH A;  4GKJ T;  2VL8 A;  5LBM A;  5FJV A;  1X79 A;  1XDP A;  2UXC T;  2KMF A;  3JAE A;  2Y7Y A;  3FXE B;  4HWF A;  4Z90 A;  2J47 A;  3RIU A;  1SA0 E;  4GK0 E;  2WZY A;  2EHO C;  3PUY F;  3ABV A;  2W8F A;  4HE8 A; 
#chains in the Genus database with same CATH homology
 4AFH A;  4QH4 A;  2W8G A;  3WTJ A;  4ZZC A;  3TLV A;  2YKS A;  3RQW A;  2XNV A;  2XZ5 A;  3RIF A;  2BYR A;  5AFN A;  4WV9 A;  5HEJ A;  4IL9 A;  3PMZ A;  4ALX A;  2XYT A;  2LM2 A;  4UM1 A;  5AFJ A;  4LMJ A;  3TLU A;  1OED B;  3UU6 A;  2M6B A;  5CFB A;  3U8J A;  3JAF A;  5HEO A;  4HFD A;  2XNT A;  4BFQ A;  4ZZB A;  3EHZ A;  4ZRU A;  3UUB A;  3LSV A;  4A97 A;  2ZJV A;  3U8K A;  3WTI A;  3WTO A;  2BJ0 A;  4LML A;  3U8N A;  3TLW A;  4IRE A;  3GUA A;  5HCM A;  5TVC A;  4Z91 A;  5AFM A;  4NZB A;  3P4W A;  4PIR A;  3ZDG A;  4ZJS A;  2BG9 C;  2MAW A;  2PH9 A;  5BW2 A;  4XHE A;  5L4E A;  3PEO A;  3UU4 A;  2PGZ A;  5HEG A;  4BQT A;  3SQ9 A;  2XYS A;  2YOE A;  2UZ6 A;  2XQ7 A;  3UU5 A;  3EI0 A;  4TNV A;  2LKG A;  4AFT A;  5L4H A;  5AFH A;  2BG9 E;  3EAM A;  2M6I A;  2WN9 A;  1I9B A;  2YMD A;  3JAD A;  2BG9 A;  4HFE A;  2XQA A;  4ILB A;  1UV6 A;  4D01 A;  4UM3 S;  4QAB A;  2XZ6 A;  4UXU A;  5AFM B;  2BYP A;  2ZJU A;  4HFB A;  3WTM A;  2BYQ A;  3UQ7 A;  5J5H A;  3RI5 A;  4ZK4 A;  4AFG A;  3T4M A;  3U8L A;  2YN6 A;  4HFI A;  2X00 D;  4ZJT A;  3SQ6 A;  5BRX A;  3TLS A;  5J5F A;  3TLT A;  2Y58 A;  5KZU A;  2WNL A;  4HQP A;  2LLY A;  2XQ6 A;  5HEH A;  2BR8 A;  4ILC A;  3WTK A;  5BP0 A;  2BR7 A;  2KSR A;  4TWF A;  5AIN A;  4EZ1 A;  3WTL A;  4UM3 P;  4XK9 A;  2BG9 B;  2WNJ A;  2XQ4 A;  3RIA A;  2XQ3 A;  2XQ8 A;  3UQ4 A;  5L47 A;  4COF A;  1UX2 A;  2XNU A;  3P50 A;  4TNW A;  2XQ9 A;  3SH1 A;  5J5G A;  2LKH A;  4TWD A;  3ZKR A;  4LMK A;  1UW6 A;  4ZK1 A;  5AFL A;  5AFK A;  3RHW A;  2WNC A;  2BYN A;  5IUX A;  4QH5 A;  4HFC A;  4QAA A;  5JME A;  4DBM A;  5KE4 A;  2VL0 A;  3WTH A;  5FJV A;  4UY2 A;  5HCJ A;  4B5D A;  4F8H A;  3U8M A;  4A98 A;  2QC1 B;  5LXB A;  3C79 A;  3JAE A;  2Y7Y A;  5CO5 A;  5SYO A;  4NPP A;  4QH1 A;  4Z90 A;  1OED E;  2Y57 A;  4ZR6 A;  5J0Z A;  3WTN A;  4HFH A;  4TWH A;  3UU8 A;  3SIO A;  1OED A;  2XQ5 A;  5J5I A;  2C9T A;  2YME A;  5LG3 A;  4ILA A;  2Y54 A;  3C84 A;  5HEU A;  4UM3 A;  4X5T A;  3WIP A;  4QAC A;  2WZY A;  2Y56 A;  4IL4 A;  3RQU A;  3IGQ A;  3ZDH A;  2BYS A;  2X00 A;  2W8F A;  1OED C;  3UU3 A;  4FRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...