3EI0A

Structure of the e221a mutant of the gloebacter violaceus pentameric ligand gated ion channnel (glic)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYAANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title Structure of a potentially open state of a proton-activated pentameric ligand-gated ion channel
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein
total genus 79
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3ei0A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3ei0A01
3UU5A 2WN9A 5L47A 4B5DA 1OEDA 3RIAA 3EI0A 3ZKRA 5JMEA 3UU4A 5CFBA 2BR8A 5SYOA 5AFNA 5AFJA 2BG9E 2PH9A 3WTMA 4HFIA 2WNCA 1UV6A 4AFHA 5BW2A 4ZRUA 2BJ0A 5J5FA 3RI5A 3EHZA 4AFTA 1OEDE 4X5TA 4QAAA 3RQUA 2M6BA 2X00D 3PMZA 4PIRA 4ILAA 2YMDA 4UM3S 2WNLA 5IUXA 4WV9A 4IL9A 4EZ1A 3P50A 2MAWA 3IGQA 4ZJSA 2YN6A 3TLTA 3UU8A 5L4EA 3WTIA 2PGZA 4UXUA 3PEOA 2XQ9A 2YKSA 3ZDHA 3SQ6A 4QACA 4TNVA 4ZK1A 4HFCA 5HEUA 3UQ4A 4A98A 4COFA 2BG9B 2XQ4A 4XK9A 3RIFA 4IREA 3TLWA 2W8GA 3RHWA 4HFEA 3WTHA 4LMKA 2KSRA 4UM3P 3TLUA 2XNVA 3UU3A 3U8MA 1UW6A 3WTLA 2UZ6A 1UX2A 2M6IA 4LMLA 4HQPA 3SIOA 3RQWA 1OEDB 4ZZCA 4QH5A 5AFHA 2VL0A 5HEGA 4UM1A 3UQ7A 4D01A 4QH4A 2QC1B 4TWHA 5L4HA 4TWDA 2XZ5A 2BYPA 3SQ9A 2Y56A 3T4MA 5KZUA 5AFMA 4A97A 3U8KA 4ALXA 5J5IA 4F8HA 5AFKA 5HEOA 3WIPA 3JADA 5KE4A 2ZJUA 2XNTA 2XYSA 3P4WA 3WTJA 3U8JA 4Z91A 4FRRA 2WNJA 2XQ6A 5AINA 3TLVA 1I9BA 2BYQA 3WTKA 4AFGA 3GUAA 5BP0A 3UU6A 2LKGA 2Y7YA 4ZK4A 5TVCA 4ZJTA 4TWFA 4ZZBA 2LKHA 2XQ7A 3JAFA 2BYRA 3C79A 3LSVA 5FJVA 4HFDA 3ZDGA 2W8FA 2XNUA 3TLSA 4BFQA 5J5HA 5HCMA 4DBMA 3JAEA 4Z90A 2BG9C 3WTOA 3WTNA 2BYNA 2YMEA 5BRXA 4NPPA 5J0ZA 2YOEA 4HFHA 4ILCA 4BQTA 4ZR6A 5AFLA 2LLYA 4ILBA 2X00A 2Y58A 5LXBA 5HCJA 1OEDC 2ZJVA 2C9TA 2BYSA 2XQ5A 2WZYA 2Y54A 4HFBA 4TNWA 5CO5A 2XQ3A 3U8NA 5J5GA 5HEJA 4NZBA 4UM3A 4UY2A 3SH1A 5AFMB 2BG9A 3U8LA 2XQ8A 3EAMA 4IL4A 3UUBA 2XQAA 4QABA 5HEHA 2Y57A 4XHEA 5LG3A 2BR7A 4LMJA 2XYTA 3C84A 4QH1A 2XZ6A 2LM2A
chains in the Genus database with same CATH superfamily
2X67A 1OEDA 3ONJA 3RYIE 4P0AA 5ABFB 5LJMA 2J4GA 4O8SA 1BR4A 4UF0B 2WP9A 3RI5A 2RA1A 3C51A 3UT5E 5L3BB 2UXXB 3K8PC 1S35A 5FXWA 1IJ6A 4KMCA 3MA9A 4P09A 2FJAA 4NXMT 4YLHA 3WTHA 4PJNA 4EZHA 3AAEB 5CA0E 3N9MA 2N2NA 4CN6A 2VL0A 3ZMTB 3OTOT 5LGNB 5JQGE 5AQMB 1NEKA 4Q25A 3RYFE 4YJ3E 2A3DA 5JDHA 2XPKA 3WIPA 2W0GA 5LMNT 2YK0A 1KNPA 2XQ6A 4GK5E 2UXDT 1NAFA 4C91A 4ZK4A 3NBXX 4CI1B 4KUMB 3UUNA 2ODUA 4BAYB 4PJJA 4JEUB 2JRKA 4JUYA 4ADZA 3EDVA 4BQTA 2GK9A 3LFMA 4PFPA 4HE8A 3KFWX 2D2SA 4DBRA 3U8NA 3KV6A 3SOLA 4YSXA 4TN7B 3ZJ1A 3EAMA 3FHNA 2H7OA 1WFDA 4LF8T 1HNXT 3ZEFB 3I0QA 5EK2A 5AFUL 3IA3A 5DQWA 5SYOA 1BR0A 4DV0T 2V7LA 1XWMA 3WTMA 5TAOA 2UU9T 3Q5XA 2V7JA 3LDQB 2WWUA 2VL8A 2V26A 2IHR1 4WYVA 1Z0PA 4KX6A 2DLRA 1EZ3A 2KLQA 1LVKA 4PK6A 2I0MA 4AKIA 2HHHT 2BBJA 3HA4A 2V6XA 2Y48B 2H7VC 2V7KA 4DMVA 2OLTA 5ABHA 3T4MA 4GKKT 3LBXA 4F8HA 2W00A 2YDSA 4J2CA 2XNTA 3A8YC 2KT9A 1VRBA 2NW9A 2WAUA 4CI3B 2BYQA 4QXHB 1D1AA 3C98B 4U2YA 4TWFA 3JAFA 1FMVA 4IHJE 3JAEA 3ZT6A 3HKCE 2XASB 2BYNA 4NUVA 3KVBA 3CIRA 5HXSA 5JDNA 5J0ZA 3VU7H 1UX5A 5GONE 3RGLA 5LXBA 3ONLC 3PUXF 2WB5A 1WCRA 3BQIA 4P0BA 2X0LB 1KNZA 5AFMB 3UUBA 3IBPA 3HKBE 3SFEA 1UGOA 1IBMT 3C84A 5AQFB 3UU5A 2WZHA 2DI4A 4O4IE 3AA7B 4QXCB 4QX7B 5JR9A 2BR8A 4NXNT 5IYZE 5LJNA 2WNCA 4TUYE 3DTOA 4ZRUA 4YXDA 5EZYE 3T8OA 5JDMA 3RYCE 1N33T 3BQKA 3RYHE 2FJEA 3RLFF 2X51A 4JI2T 1J5ET 1HF8A 4O2BE 2MAWA 1YXRA 2XQ9A 3ZDHA 3GA8A 3AEDA 5FYMA 1X79A 5LXTE 2SPCA 5DJQC 3O1IA 2DWGA 5LHHB 2XM2A 1UW6A 4OYJA 3EABA 3KINB 1MMDA 3ZT5A 3L39A 2NR4A 2BYPA 4CXWA 1WR6A 2LHNA 5KDMC 2YDRA 3QB5K 2YINA 4Z91A 4KHPT 3CVRA 1HS7A 2QA7A 3TLVA 2E2AA 3RRCA 4PNIA 3O1JA 3WTNA 1X9BA 2YMEA 3AVSA 3KV9A 4LF4T 2QVAA 1U5PA 5HCJA 1G73A 3CQCB 3J7Yq 3IF8B 2BG9A 3U8LA 4DV1T 2WDRA 3WAJA 3QNUA 3JC6D 2XZ6A 3R84B 3EI0A 2IC6A 3NRYA 5FXVA 2A2FX 2BZBA 4KBMB 3JCFA 3ZJ2A 1JNZA 2LM9A 2C5KT 3RQUA 3I9WA 5AQGB 3NVOA 5LGUB 3TLTA 2VURA 3D0TA 3WTIA 2QGSA 4H9PC 1ZV4X 4UEMA 4HFCA 2VASA 2CRBA 1WR0A 3RIFA 4U2ZA 3MK7C 3PV0F 3O1HA 1XNQT 2XAJB 2LEHA 3RX6A 4HQPA 2CHNA 3Q5EA 2X0YA 3IEEA 3RIUA 2BVLA 5LMUT 1SE7A 2V5CA 5LYJE 4ALXA 4B3MT 3GWHA 3CQXC 4HWHA 2WS3A 5KE4A 2IDOB 1IJ5A 5TVCA 4ZJTA 5FJVA 2WDVA 3JC6C 4MFRA 3O9XA 1YKHB 3WTOA 3CPZA 5BRXA 4QXBB 5AFLA 2E8IA 2I6HA 2ZM8A 3AAAB 3VHLA 5JDQA 3L09A 2V6YB 5FL1A 4QH1A 4U31A 3RIAA 3ZYMA 5F3JA 4B3RT 4YY3T 2JPFA 2H3RA 2ZLYA 4ZEYA 4DV4T 1NENA 2ODVA 4QAAA 3AEAA 2M6BA 3PMZA 3MACA 2EHOD 4ILAA 3ZN0B 4DO0A 1KNRA 1IBLT 5JRCB 3P50A 4IDQA 5J2TE 4X1IE 1LVFA 3QUJA 4UXUA 3ZT7A 1T72A 4EB6E 2D5UA 3AE6A 4COFA 5H6RB 3ABVA 4AQFC 4U72A 4K0UA 1N34T 4AISA 2XZEA 3P4PA 2YU1A 1CUNA 2Y56A 1HG2A 2EHOB 3LK42 1U4QA 2X9HA 1HX1B 3UUMA 2ZM2A 3FBLA 2JQ9A 2HN2A 5LNKA 2BKNA 4X65T 5C2TA 4HWDA 4LF7T 3OKQA 3RC3A 4WBNE 1XDPA 2DL1A 4WZXA 2XHEB 4YHHT 4ILUA 2MOZA 1KEYA 4IIJE 2EHOC 4QHOA 2XQ8A 4EIWA 5AQOB 4HGAA 3ETVA 3E22E 2W2UA 2LM2A 1L0VA 1OWAA 2LRKA 4IDPA 1ZOYA 4CI2B 5BW2A 4YFSA 2BJ0A 3DP7A 2K5BB 1OEDE 2KNDA 4PJMA 4UM3S 3UULA 4ZI7E 2CMRA 4CN4A 4AKGA 4O2AE 5AQPB 4ZK1A 4WW0A 4IE4A 5C8YE 5JDLA 4IREA 2M67A 1W09A 4HFEA 4LFBT 3RPUA 4UIGA 3N9NA 4BJNA 3SIOA 1OEDB 4QH5A 2XAQB 4UM1A 1V9DA 4L9IA 2YEVC 3AVRA 1BR2A 2LE8A 5LHGB 3P4WA 5JTGA 4BA9A 4FRRA 3NKZA 2LKGA 5AQJB 4DV6T 2XQ7A 4HFDA 3TLSA 4OX9T 4M1PA 4Z90A 3NZPA 3CWZB 4ZR6A 1VCTA 1MMNA 2CBIA 1OEDC 3P7IA 4JLEA 3AE4A 3RRWA 2D0TA 2XQAA 1LKXA 3ZPOA 4QABA 2Y57A 1UK5A 4XHEA 2BR7A 4LF6T 5F8PA 4ZI3D 5FY1A 4ERRA 5LOVE 4K0KT 4X64T 2NW7A 1XNRT 2Q9QA 3C50A 2P9BA 4GIWA 3W15B 3AE3A 4UELA 3UU8A 3PURA 4JI6T 4HKAA 3UQ4A 4H9QC 4IT4A 2IUBA 4DR1T 2WMOA 3ZC0A 2NP9A 4AKLA 1UX2A 4ZZCA 3NRXA 4DR2T 5HEGA 4E7ZA 4D01A 3MXZA 5L4HA 4C90A 5HXCA 4H63H 1IAPA 2CA5A 3KV4A 2W63A 1KF6A 3U3IA 3WTJA 3AA1B 4GKJT 4JV5T 2Y8DA 3C4ZA 1G8XA 1UUSA 2VKDA 2V5DA 3LSVA 2MYSA 1QUUA 3P4RA 4FI5A 3ZMSB 4ZI3C 4DBQA 4JYAT 3FB2A 4HFHA 3KBTA 5FMNA 3F31A 3TKLB 4O4HE 1T8BA 5CO5A 2XQ3A 3B13A 2ACZA 3FZMB 3SH1A 5HEHA 4AFTA 3E08A 3FZFB 3ZCJA 3AAIA 3AE1A 4HFIA 3H3MA 4AFHA 4XAXB 4EEDA 3PJAJ 5DABA 2C5JA 4QWNB 1I94T 4PAGA 4H9OC 3ZC1A 3ANWA 2E9XA 2IMLA 4EZ4A 2K24A 2XSBA 4A98A 3KDSE 2IW5B 3TLWA 5LGTB 4OYKA 1CHUA 2XNVA 3U8MA 2K3WA 5JR9B 1J1JA 1VCSA 4QH4A 4TWHA 3OVUA 4IE6A 3S4UA 4GK0E 2ACXA 4A97A 4TZ4C 5AQIB 5AFKA 1I6ZA 2BS2A 3VKHA 4EGWA 2BBHA 4PW8A 5J1GA 5AQSB 3N9PA 5HCMA 4DBMA 2JQKA 3ESLA 3SWHA 4JI7T 3RH3A 4HWIB 5JR9C 4UVAB 2F4VT 5HEJA 2V7IA 2VKOA 4I0UA 4CN1A 1E2AA 4PK5A 5KX5E 4JEHB 1YD8G 5LG4A 4YTMA 3ZMVB 4QKNA 5CFBA 1KFYA 3AEBA 4JI8T 4I43B 2WU2A 5AFNA 2BG9E 3VR8A 3PUGA 3NZQA 4AI6A 1HTJF 1NWMX 5FXZA 3N5LA 1YW0A 5L2LA 1HFAA 2KWHA 2DCFA 1R8IA 3NWIA 3ZLIA 5CB4E 1US7B 2LT3A 3GN5A 4X20E 1ZP0A 2OA5A 3MKDA 2BG9B 2XQ4A 3HR0A 3RF1A 4EXTA 3EVYA 4JI0T 3UTKA 4UV9B 2CM0A 5AFHA 4IGUA 3HKDE 4TWDA 5HXRA 3SQ9A 4HWCA 2X9YA 4NUUA 5JDGA 2ZMAA 3B57A 2CHOA 4TX5A 3PE0A 1I9BA 4ZS3A 3WTKA 4AFGA 4EV6A 4H63V 4AQYT 4Z8XA 3SS1A 2LOSA 2W8FA 2XNUA 3AE2A 2FJDA 2BG9C 2R6GF 2WY2A 3MJXA 2PG8A 3OYZA 5AQVB 4DVDA 4DUZT 2YOEA 3G06A 2PFVA 5HXHA 4GOUA 5FKYA 4EYUA 4DV2T 2BYSA 4XZCA 3BK9A 5J5GA 2LSIA 5L3EB 3PUSA 4IL4A 5AQKB 4KHZF 4YHJA 4AQGA 2UUBT 2HH7A 2WCAA 1WLXA 2PJQA 4V1Av 5JMEA 3ZSTA 3FZKB 4JI1T 3PUWF 2RP4A 5AQRB 3LJCA 2CWOA 4H9NC 2ES0A 2A9UA 3FXEB 4YTNA 2X00D 4ZXLA 3B5MA 4WV9A 2N9DA 1T7SA 4EZ1A 2UUAT 3IGQA 1MIVA 3QOFA 4UR9A 2KZ7B 2VVSA 1IZNB 4QX8B 2IC9A 3FZHB 4HEAA 3RQWA 2DWKA 4YSZA 2G0UA 4AKRB 2X9WA 5L3DB 4B6XA 5KZUA 1H7CA 3X1DA 3PTRB 2YDQA 4H9SE 3U8KA 4FJOA 3P8CD 3V5SA 4O4JE 3JADA 2XYSA 2WNJA 4DV3T 2B76A 1J5WA 1WRDA 4LFCT 3AXJB 2WBLA 2KMFA 1HNZT 3HI2A 1D1BA 2H88A 2V8SV 4DUYT 1BR1A 1ZHCA 2CXFA 2PTFA 3Q5WA 3AEGA 5EK3A 4O4LE 5LCYA 3H3AA 2UXCT 3AEFA 2HN1A 4B3TT 4LMJA 5L4EA 2HPLA 3KV5A 5L47A 4IDNA 2BVMA 4DIDB 1N36T 2E5VA 3M3ZB 5JH7E 5FVKA 1T98A 4U33A 1AJ3A 1W9RA 1XMOT 4GYSA 2CXDA 3N9OA 2OV9A 2WNLA 2KINB 2ZM0A 3ZMZB 2YN6A 5C3JA 5F5WA 4A56A 4TV8E 3OPCA 2YKSA 1Z8UA 4TNVA 2AE9A 1Y64B 2NTYA 5FXXA 3EUHA 4G2AA 4U7YA 4EEBA 4LF5T 5IWAT 5J5IA 2NOXA 3R6NA 3HL6A 1MMAA 3U8JA 5L3FB 4GYRA 3N9QA 3N2KE 5ABFA 3PJAA 4U74A 4ZZBA 1MMGA 3C79A 3ZDGA 4X1KE 4UF0A 3QK6A 2AXDS 3FXDB 2LSGA 3VR9A 1VOMA 2Y58A 2C9TA 2Y54A 5JREA 4MHCA 2CBJA 3WI3A 4TV9E 4CQIA 5FVLA 2W67A 4EOZB 1YQ4A 2VQFT 4DR5T 4B5DA 4DR6T 3M65A 5EK4A 1WYCA 3UU4A 2XSAA 3P4SA 2JQQA 4IE7A 2BKOA 2WMNA 4JI5T 4DNDA 2RPAA 2X9XA 3HKEE 3AA6B 4XBFB 5J5FA 3L3PA 4YT0A 2XTLA 2W62A 2VKHA 2A72A 1MIWA 4JI3T 2Q9QD 2J62A 1WYBA 5ABGA 1LRZA 2WDQA 3AB3B 4XK9A 2KSRA 4HFVA 1DU2A 3WTLA 3RKGA 2YU2A 5AQUB 2MPKA 2IAKA 2UXBT 3BQLA 5H6QB 2Q9QB 5IHYA 5AQNB 5ABEA 1QLBA 5JVDE 2NW8A 3Q5DA 1UURA 3QC9A 2LHRA 3N2GE 3WAKA 3UU6A 2Y7YA 4U7IA 2CE7A 2LKHA 2J1DG 2W61A 3T1HT 3DJBA 1W0AA 2Z6EA 5FNVE 4L5GA 2LLYA 3EDUA 3J9X1 3PU3A 5LBMA 2XQ5A 3Q2MA 3LG7A 1OXZA 2JIWA 3OJAA 5L3CB 4P1NA 2Q9QC 4E7SA 3ETUA 2MBGA 2CWYA 3ZKRA 2XUEA 2MTQA 2PH9A 5LP6E 1MNDA 2VB6A 4IE0A 1D1CA 3FBZA 4UV8B 3Q9DA 2C0SA 3LBXB 2YMDA 3VKGA 4ZJSA 1D0YA 4ZI2D 4KP3C 4EAHA 3OYXA 4HWFA 2FBWA 4OHFA 4LMKA 1N32T 4UM3P 2IIUA 4YSYA 3CKDA 4PFOA 3F57A 2E9XD 2WZIA 2M6IA 1D0ZA 4AKHA 1D0XA 3PUVF 2NWBA 4I4TE 1E1HB 2VQET 5KXJA 5AFMA 3N2OA 2D0UA 2B1EA 2CEAA 3L8RA 3UFGA 5M4YA 2LSKA 2CCQA 5CJ5A 4HTEA 2I59A 1JNRA 1ZKEA 5LHIB 3CQGB 4OFZA 5AQTB 2JQHA 3ANWB 2BYRA 2E9XB 3CX8B 5CA1E 2XY8B 3LK3B 4BFQA 5DQVA 2W4XA 2J47A 3CX6B 4ILBA 2C5IT 5BMVE 4HFBA 3F2EA 4TNWA 4X62T 2WWVA 3V5UA 1M62A 2XM1A 2CLYB 4ISSA 4EYYR 5CGMA 3KBUA 5KMGP 4ZI2C 4A5XA 2XYTA 2UUCT 2WN9A 2LSYA 4PK4A 4BJMA 3FZLB 4ISTA 2WQYA 4IE5A 2XAGB 3A5XA 4N78D 3E0ZA 4YTPA 1YKEB 2E9XC 4IDOA 4ZHQE 4UVCB 3LK2B 4PIRA 1S94A 5IUXA 2N1GA 4DR4T 2PGZA 3SQ6A 2W8GA 3RHWA 2CLYC 3H37A 3UU3A 3AECA 2Y6XA 4LMLA 2LRLA 3PU8A 2QC1B 2XZ5A 2CPTA 3SRZA 2X0HA 3K3NA 1SHZC 3PDYA 2ZJUA 2JJ9A 2V7MA 3SFDA 3PUQA 1SUMB 5AQHB 3I1AA 5FY7A 3GN5B 4F6RC 2VWAA 5FP3A 2XAFB 5J5HA 2XJ7A 5JDFA 3ZYKA 2DHRA 2D9DA 5HXEA 5L3GB 2E5LT 2LJLA 2VK9A 4LFAT 3QB5A 3RC8A 1FIOA 2PBIA 3AE7A 4WBOA 1HNWT 2WZYA 3UFEA 4B3ST 2V1DB 2KWIB 1MNEA 1QSDA 1W0BA 2K9AA 3N9LA 4DR7T 2WSSV 5ETWA 1O3XA 1HG5A 3CX7B 3PUAA 3O4XE 3AE8A 2WU5A 1HCIA 1M7KA 4HN9A 1XZYA 2NTXA 2QYWA 1IBKT 2BS3A 4G63A 4PJLA 1ZEEA 3CK6A 3ZN1B 2LOPA 4I50E 4IL9A 4DR3T 1E7PA 3PEOA 2XAHB 3AE9A 3KVAA 5HEUA 4L0RA 5E0OA 5HWXA 4JI4T 4H9RC 3TLUA 5HAXA 4DV5T 2UZ6A 3I9YA 2BDEA 3CMLA 1UX4A 3UQ7A 4ASKA 3T1YT 4MBQA 4IDZA 2W66A 2V6YA 4AQFA 3RIUC 5A1LA 5HEOA 3K3OA 4U3CA 4ANJA 1XDOA 3C4WA 3I0OA 3GMIA 1B7TA 1Y01A 5BP0A 4KI0F 3C64A 5FY0A 2X66A 4ZS2A 4NPPA 4AXPA 1XMQT 5JRCA 2X00A 3ZSSA 3C4XA 2LSJA 2ZJVA 3P4QA 3RKOA 4CZZB 3ZCIA 4UM3A 4ZOLE 1HX8A 3VRAA 3PUYF 3A7MA 2UXNB 5HWYA 2KXPB 2K48A 3K1SA 2X68A 3AXJA 2L8KA 3AE5A 4CXYA 5AFJA 3ZMUB 2EHOA 1UV6A 1FEWA 2FJBA 3AEEA 3EHZA 4CXXA 4X5TA 3ZYLA 2L3LA 1YQ3A 4MALA 4UVBB 1UCUA 2JMKA 4OK0A 4QACA 3OBVE 1FJGT 2DNXA 2VKJA 3K3QC 5ADXL 1HR0T 3MZKB 5AQLB 1GQEA 4LF9T 3IHRA 1SA0E 2ZM6T 2XQYA 2WM9A 4JBWF 3VRBA 1MIYA 5LA6E 1KK7A 2CXLA 4DV7T 4X66T 5HYAA 4YJ2E 5AINA 5BR8T 4X1YE 3GUAA 2FUPA 2BS4A 4MLKA 5LBQB 4DMWA 2JMHA 3AA0B 4NIQA 3U78A 4ILCA 4WNKA 2VVNA 2HPJA 5AQQB 2QRXA 3UUXB 5J2UE 5LB7B 4NZBA 2L9QA 4UY2A 5FL0A 4AIUA 3ONXA 4UXNB 3PUZF 5LG3A 2H89A 4I55E 2BKPA 1FMWA
chains in the Genus database with same CATH topology
3UU5A 2WN9A 5L47A 4B5DA 1OEDA 3RIAA 3EI0A 3ZKRA 5JMEA 3UU4A 5CFBA 2BR8A 5SYOA 5AFNA 5AFJA 2BG9E 2PH9A 3WTMA 4HFIA 2WNCA 1UV6A 4AFHA 5BW2A 4ZRUA 2BJ0A 5J5FA 3RI5A 3EHZA 4AFTA 1OEDE 4X5TA 4QAAA 3RQUA 2M6BA 2X00D 3PMZA 4PIRA 4ILAA 2YMDA 4UM3S 2WNLA 5IUXA 4WV9A 4IL9A 4EZ1A 3P50A 2MAWA 3IGQA 4ZJSA 2YN6A 3TLTA 3UU8A 5L4EA 3WTIA 2PGZA 4UXUA 3PEOA 2XQ9A 2YKSA 3ZDHA 3SQ6A 4QACA 4TNVA 4ZK1A 4HFCA 5HEUA 3UQ4A 4A98A 4COFA 2BG9B 2XQ4A 4XK9A 3RIFA 4IREA 3TLWA 2W8GA 3RHWA 4HFEA 3WTHA 4LMKA 2KSRA 4UM3P 3TLUA 2XNVA 3UU3A 3U8MA 1UW6A 3WTLA 2UZ6A 1UX2A 2M6IA 4LMLA 4HQPA 3SIOA 3RQWA 1OEDB 4ZZCA 4QH5A 5AFHA 2VL0A 5HEGA 4UM1A 3UQ7A 4D01A 4QH4A 2QC1B 4TWHA 5L4HA 4TWDA 2XZ5A 2BYPA 3SQ9A 2Y56A 3T4MA 5KZUA 5AFMA 4A97A 3U8KA 4ALXA 5J5IA 4F8HA 5AFKA 5HEOA 3WIPA 3JADA 5KE4A 2ZJUA 2XNTA 2XYSA 3P4WA 3WTJA 3U8JA 4Z91A 4FRRA 2WNJA 2XQ6A 5AINA 3TLVA 1I9BA 2BYQA 3WTKA 4AFGA 3GUAA 5BP0A 3UU6A 2LKGA 2Y7YA 4ZK4A 5TVCA 4ZJTA 4TWFA 4ZZBA 2LKHA 2XQ7A 3JAFA 2BYRA 3C79A 3LSVA 5FJVA 4HFDA 3ZDGA 2W8FA 2XNUA 3TLSA 4BFQA 5J5HA 5HCMA 4DBMA 3JAEA 4Z90A 2BG9C 3WTOA 3WTNA 2BYNA 2YMEA 5BRXA 4NPPA 5J0ZA 2YOEA 4HFHA 4ILCA 4BQTA 4ZR6A 5AFLA 2LLYA 4ILBA 2X00A 2Y58A 5LXBA 5HCJA 1OEDC 2ZJVA 2C9TA 2BYSA 2XQ5A 2WZYA 2Y54A 4HFBA 4TNWA 5CO5A 2XQ3A 3U8NA 5J5GA 5HEJA 4NZBA 4UM3A 4UY2A 3SH1A 5AFMB 2BG9A 3U8LA 2XQ8A 3EAMA 4IL4A 3UUBA 2XQAA 4QABA 5HEHA 2Y57A 4XHEA 5LG3A 2BR7A 4LMJA 2XYTA 3C84A 4QH1A 2XZ6A 2LM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UU5 A;  2WN9 A;  5L47 A;  4B5D A;  1OED A;  3RIA A;  3EI0 A;  3ZKR A;  5JME A;  3UU4 A;  5CFB A;  2BR8 A;  5SYO A;  5AFN A;  5AFJ A;  2BG9 E;  2PH9 A;  3WTM A;  4HFI A;  2WNC A;  1UV6 A;  4AFH A;  5BW2 A;  4ZRU A;  2BJ0 A;  5J5F A;  3RI5 A;  3EHZ A;  4AFT A;  1OED E;  4X5T A;  4QAA A;  3RQU A;  2M6B A;  2X00 D;  3PMZ A;  4PIR A;  4ILA A;  2YMD A;  4UM3 S;  2WNL A;  5IUX A;  4WV9 A;  4IL9 A;  4EZ1 A;  3P50 A;  2MAW A;  3IGQ A;  4ZJS A;  2YN6 A;  3TLT A;  3UU8 A;  5L4E A;  3WTI A;  2PGZ A;  4UXU A;  3PEO A;  2XQ9 A;  2YKS A;  3ZDH A;  3SQ6 A;  4QAC A;  4TNV A;  4ZK1 A;  4HFC A;  5HEU A;  3UQ4 A;  4A98 A;  4COF A;  2BG9 B;  2XQ4 A;  4XK9 A;  3RIF A;  4IRE A;  3TLW A;  2W8G A;  3RHW A;  4HFE A;  3WTH A;  4LMK A;  2KSR A;  4UM3 P;  3TLU A;  2XNV A;  3UU3 A;  3U8M A;  1UW6 A;  3WTL A;  2UZ6 A;  1UX2 A;  2M6I A;  4LML A;  4HQP A;  3SIO A;  3RQW A;  1OED B;  4ZZC A;  4QH5 A;  5AFH A;  2VL0 A;  5HEG A;  4UM1 A;  3UQ7 A;  4D01 A;  4QH4 A;  2QC1 B;  4TWH A;  5L4H A;  4TWD A;  2XZ5 A;  2BYP A;  3SQ9 A;  2Y56 A;  3T4M A;  5KZU A;  5AFM A;  4A97 A;  3U8K A;  4ALX A;  5J5I A;  4F8H A;  5AFK A;  5HEO A;  3WIP A;  3JAD A;  5KE4 A;  2ZJU A;  2XNT A;  2XYS A;  3P4W A;  3WTJ A;  3U8J A;  4Z91 A;  4FRR A;  2WNJ A;  2XQ6 A;  5AIN A;  3TLV A;  1I9B A;  2BYQ A;  3WTK A;  4AFG A;  3GUA A;  5BP0 A;  3UU6 A;  2LKG A;  2Y7Y A;  4ZK4 A;  5TVC A;  4ZJT A;  4TWF A;  4ZZB A;  2LKH A;  2XQ7 A;  3JAF A;  2BYR A;  3C79 A;  3LSV A;  5FJV A;  4HFD A;  3ZDG A;  2W8F A;  2XNU A;  3TLS A;  4BFQ A;  5J5H A;  5HCM A;  4DBM A;  3JAE A;  4Z90 A;  2BG9 C;  3WTO A;  3WTN A;  2BYN A;  2YME A;  5BRX A;  4NPP A;  5J0Z A;  2YOE A;  4HFH A;  4ILC A;  4BQT A;  4ZR6 A;  5AFL A;  2LLY A;  4ILB A;  2X00 A;  2Y58 A;  5LXB A;  5HCJ A;  1OED C;  2ZJV A;  2C9T A;  2BYS A;  2XQ5 A;  2WZY A;  2Y54 A;  4HFB A;  4TNW A;  5CO5 A;  2XQ3 A;  3U8N A;  5J5G A;  5HEJ A;  4NZB A;  4UM3 A;  4UY2 A;  3SH1 A;  5AFM B;  2BG9 A;  3U8L A;  2XQ8 A;  3EAM A;  4IL4 A;  3UUB A;  2XQA A;  4QAB A;  5HEH A;  2Y57 A;  4XHE A;  5LG3 A;  2BR7 A;  4LMJ A;  2XYT A;  3C84 A;  4QH1 A;  2XZ6 A;  2LM2 A; 
#chains in the Genus database with same CATH topology
 2X67 A;  1OED A;  3ONJ A;  3RYI E;  4P0A A;  5ABF B;  5LJM A;  2J4G A;  4O8S A;  1BR4 A;  4UF0 B;  2WP9 A;  3RI5 A;  2RA1 A;  3C51 A;  3UT5 E;  5L3B B;  2UXX B;  3K8P C;  1S35 A;  5FXW A;  1IJ6 A;  4KMC A;  3MA9 A;  4P09 A;  2FJA A;  4NXM T;  4YLH A;  3WTH A;  4PJN A;  4EZH A;  3AAE B;  5CA0 E;  3N9M A;  2N2N A;  4CN6 A;  2VL0 A;  3ZMT B;  3OTO T;  5LGN B;  5JQG E;  5AQM B;  1NEK A;  4Q25 A;  3RYF E;  4YJ3 E;  2A3D A;  5JDH A;  2XPK A;  3WIP A;  2W0G A;  5LMN T;  2YK0 A;  1KNP A;  2XQ6 A;  4GK5 E;  2UXD T;  1NAF A;  4C91 A;  4ZK4 A;  3NBX X;  4CI1 B;  4KUM B;  3UUN A;  2ODU A;  4BAY B;  4PJJ A;  4JEU B;  2JRK A;  4JUY A;  4ADZ A;  3EDV A;  4BQT A;  2GK9 A;  3LFM A;  4PFP A;  4HE8 A;  3KFW X;  2D2S A;  4DBR A;  3U8N A;  3KV6 A;  3SOL A;  4YSX A;  4TN7 B;  3ZJ1 A;  3EAM A;  3FHN A;  2H7O A;  1WFD A;  4LF8 T;  1HNX T;  3ZEF B;  3I0Q A;  5EK2 A;  5AFU L;  3IA3 A;  5DQW A;  5SYO A;  1BR0 A;  4DV0 T;  2V7L A;  1XWM A;  3WTM A;  5TAO A;  2UU9 T;  3Q5X A;  2V7J A;  3LDQ B;  2WWU A;  2VL8 A;  2V26 A;  2IHR 1;  4WYV A;  1Z0P A;  4KX6 A;  2DLR A;  1EZ3 A;  2KLQ A;  1LVK A;  4PK6 A;  2I0M A;  4AKI A;  2HHH T;  2BBJ A;  3HA4 A;  2V6X A;  2Y48 B;  2H7V C;  2V7K A;  4DMV A;  2OLT A;  5ABH A;  3T4M A;  4GKK T;  3LBX A;  4F8H A;  2W00 A;  2YDS A;  4J2C A;  2XNT A;  3A8Y C;  2KT9 A;  1VRB A;  2NW9 A;  2WAU A;  4CI3 B;  2BYQ A;  4QXH B;  1D1A A;  3C98 B;  4U2Y A;  4TWF A;  3JAF A;  1FMV A;  4IHJ E;  3JAE A;  3ZT6 A;  3HKC E;  2XAS B;  2BYN A;  4NUV A;  3KVB A;  3CIR A;  5HXS A;  5JDN A;  5J0Z A;  3VU7 H;  1UX5 A;  5GON E;  3RGL A;  5LXB A;  3ONL C;  3PUX F;  2WB5 A;  1WCR A;  3BQI A;  4P0B A;  2X0L B;  1KNZ A;  5AFM B;  3UUB A;  3IBP A;  3HKB E;  3SFE A;  1UGO A;  1IBM T;  3C84 A;  5AQF B;  3UU5 A;  2WZH A;  2DI4 A;  4O4I E;  3AA7 B;  4QXC B;  4QX7 B;  5JR9 A;  2BR8 A;  4NXN T;  5IYZ E;  5LJN A;  2WNC A;  4TUY E;  3DTO A;  4ZRU A;  4YXD A;  5EZY E;  3T8O A;  5JDM A;  3RYC E;  1N33 T;  3BQK A;  3RYH E;  2FJE A;  3RLF F;  2X51 A;  4JI2 T;  1J5E T;  1HF8 A;  4O2B E;  2MAW A;  1YXR A;  2XQ9 A;  3ZDH A;  3GA8 A;  3AED A;  5FYM A;  1X79 A;  5LXT E;  2SPC A;  5DJQ C;  3O1I A;  2DWG A;  5LHH B;  2XM2 A;  1UW6 A;  4OYJ A;  3EAB A;  3KIN B;  1MMD A;  3ZT5 A;  3L39 A;  2NR4 A;  2BYP A;  4CXW A;  1WR6 A;  2LHN A;  5KDM C;  2YDR A;  3QB5 K;  2YIN A;  4Z91 A;  4KHP T;  3CVR A;  1HS7 A;  2QA7 A;  3TLV A;  2E2A A;  3RRC A;  4PNI A;  3O1J A;  3WTN A;  1X9B A;  2YME A;  3AVS A;  3KV9 A;  4LF4 T;  2QVA A;  1U5P A;  5HCJ A;  1G73 A;  3CQC B;  3J7Y q;  3IF8 B;  2BG9 A;  3U8L A;  4DV1 T;  2WDR A;  3WAJ A;  3QNU A;  3JC6 D;  2XZ6 A;  3R84 B;  3EI0 A;  2IC6 A;  3NRY A;  5FXV A;  2A2F X;  2BZB A;  4KBM B;  3JCF A;  3ZJ2 A;  1JNZ A;  2LM9 A;  2C5K T;  3RQU A;  3I9W A;  5AQG B;  3NVO A;  5LGU B;  3TLT A;  2VUR A;  3D0T A;  3WTI A;  2QGS A;  4H9P C;  1ZV4 X;  4UEM A;  4HFC A;  2VAS A;  2CRB A;  1WR0 A;  3RIF A;  4U2Z A;  3MK7 C;  3PV0 F;  3O1H A;  1XNQ T;  2XAJ B;  2LEH A;  3RX6 A;  4HQP A;  2CHN A;  3Q5E A;  2X0Y A;  3IEE A;  3RIU A;  2BVL A;  5LMU T;  1SE7 A;  2V5C A;  5LYJ E;  4ALX A;  4B3M T;  3GWH A;  3CQX C;  4HWH A;  2WS3 A;  5KE4 A;  2IDO B;  1IJ5 A;  5TVC A;  4ZJT A;  5FJV A;  2WDV A;  3JC6 C;  4MFR A;  3O9X A;  1YKH B;  3WTO A;  3CPZ A;  5BRX A;  4QXB B;  5AFL A;  2E8I A;  2I6H A;  2ZM8 A;  3AAA B;  3VHL A;  5JDQ A;  3L09 A;  2V6Y B;  5FL1 A;  4QH1 A;  4U31 A;  3RIA A;  3ZYM A;  5F3J A;  4B3R T;  4YY3 T;  2JPF A;  2H3R A;  2ZLY A;  4ZEY A;  4DV4 T;  1NEN A;  2ODV A;  4QAA A;  3AEA A;  2M6B A;  3PMZ A;  3MAC A;  2EHO D;  4ILA A;  3ZN0 B;  4DO0 A;  1KNR A;  1IBL T;  5JRC B;  3P50 A;  4IDQ A;  5J2T E;  4X1I E;  1LVF A;  3QUJ A;  4UXU A;  3ZT7 A;  1T72 A;  4EB6 E;  2D5U A;  3AE6 A;  4COF A;  5H6R B;  3ABV A;  4AQF C;  4U72 A;  4K0U A;  1N34 T;  4AIS A;  2XZE A;  3P4P A;  2YU1 A;  1CUN A;  2Y56 A;  1HG2 A;  2EHO B;  3LK4 2;  1U4Q A;  2X9H A;  1HX1 B;  3UUM A;  2ZM2 A;  3FBL A;  2JQ9 A;  2HN2 A;  5LNK A;  2BKN A;  4X65 T;  5C2T A;  4HWD A;  4LF7 T;  3OKQ A;  3RC3 A;  4WBN E;  1XDP A;  2DL1 A;  4WZX A;  2XHE B;  4YHH T;  4ILU A;  2MOZ A;  1KEY A;  4IIJ E;  2EHO C;  4QHO A;  2XQ8 A;  4EIW A;  5AQO B;  4HGA A;  3ETV A;  3E22 E;  2W2U A;  2LM2 A;  1L0V A;  1OWA A;  2LRK A;  4IDP A;  1ZOY A;  4CI2 B;  5BW2 A;  4YFS A;  2BJ0 A;  3DP7 A;  2K5B B;  1OED E;  2KND A;  4PJM A;  4UM3 S;  3UUL A;  4ZI7 E;  2CMR A;  4CN4 A;  4AKG A;  4O2A E;  5AQP B;  4ZK1 A;  4WW0 A;  4IE4 A;  5C8Y E;  5JDL A;  4IRE A;  2M67 A;  1W09 A;  4HFE A;  4LFB T;  3RPU A;  4UIG A;  3N9N A;  4BJN A;  3SIO A;  1OED B;  4QH5 A;  2XAQ B;  4UM1 A;  1V9D A;  4L9I A;  2YEV C;  3AVR A;  1BR2 A;  2LE8 A;  5LHG B;  3P4W A;  5JTG A;  4BA9 A;  4FRR A;  3NKZ A;  2LKG A;  5AQJ B;  4DV6 T;  2XQ7 A;  4HFD A;  3TLS A;  4OX9 T;  4M1P A;  4Z90 A;  3NZP A;  3CWZ B;  4ZR6 A;  1VCT A;  1MMN A;  2CBI A;  1OED C;  3P7I A;  4JLE A;  3AE4 A;  3RRW A;  2D0T A;  2XQA A;  1LKX A;  3ZPO A;  4QAB A;  2Y57 A;  1UK5 A;  4XHE A;  2BR7 A;  4LF6 T;  5F8P A;  4ZI3 D;  5FY1 A;  4ERR A;  5LOV E;  4K0K T;  4X64 T;  2NW7 A;  1XNR T;  2Q9Q A;  3C50 A;  2P9B A;  4GIW A;  3W15 B;  3AE3 A;  4UEL A;  3UU8 A;  3PUR A;  4JI6 T;  4HKA A;  3UQ4 A;  4H9Q C;  4IT4 A;  2IUB A;  4DR1 T;  2WMO A;  3ZC0 A;  2NP9 A;  4AKL A;  1UX2 A;  4ZZC A;  3NRX A;  4DR2 T;  5HEG A;  4E7Z A;  4D01 A;  3MXZ A;  5L4H A;  4C90 A;  5HXC A;  4H63 H;  1IAP A;  2CA5 A;  3KV4 A;  2W63 A;  1KF6 A;  3U3I A;  3WTJ A;  3AA1 B;  4GKJ T;  4JV5 T;  2Y8D A;  3C4Z A;  1G8X A;  1UUS A;  2VKD A;  2V5D A;  3LSV A;  2MYS A;  1QUU A;  3P4R A;  4FI5 A;  3ZMS B;  4ZI3 C;  4DBQ A;  4JYA T;  3FB2 A;  4HFH A;  3KBT A;  5FMN A;  3F31 A;  3TKL B;  4O4H E;  1T8B A;  5CO5 A;  2XQ3 A;  3B13 A;  2ACZ A;  3FZM B;  3SH1 A;  5HEH A;  4AFT A;  3E08 A;  3FZF B;  3ZCJ A;  3AAI A;  3AE1 A;  4HFI A;  3H3M A;  4AFH A;  4XAX B;  4EED A;  3PJA J;  5DAB A;  2C5J A;  4QWN B;  1I94 T;  4PAG A;  4H9O C;  3ZC1 A;  3ANW A;  2E9X A;  2IML A;  4EZ4 A;  2K24 A;  2XSB A;  4A98 A;  3KDS E;  2IW5 B;  3TLW A;  5LGT B;  4OYK A;  1CHU A;  2XNV A;  3U8M A;  2K3W A;  5JR9 B;  1J1J A;  1VCS A;  4QH4 A;  4TWH A;  3OVU A;  4IE6 A;  3S4U A;  4GK0 E;  2ACX A;  4A97 A;  4TZ4 C;  5AQI B;  5AFK A;  1I6Z A;  2BS2 A;  3VKH A;  4EGW A;  2BBH A;  4PW8 A;  5J1G A;  5AQS B;  3N9P A;  5HCM A;  4DBM A;  2JQK A;  3ESL A;  3SWH A;  4JI7 T;  3RH3 A;  4HWI B;  5JR9 C;  4UVA B;  2F4V T;  5HEJ A;  2V7I A;  2VKO A;  4I0U A;  4CN1 A;  1E2A A;  4PK5 A;  5KX5 E;  4JEH B;  1YD8 G;  5LG4 A;  4YTM A;  3ZMV B;  4QKN A;  5CFB A;  1KFY A;  3AEB A;  4JI8 T;  4I43 B;  2WU2 A;  5AFN A;  2BG9 E;  3VR8 A;  3PUG A;  3NZQ A;  4AI6 A;  1HTJ F;  1NWM X;  5FXZ A;  3N5L A;  1YW0 A;  5L2L A;  1HFA A;  2KWH A;  2DCF A;  1R8I A;  3NWI A;  3ZLI A;  5CB4 E;  1US7 B;  2LT3 A;  3GN5 A;  4X20 E;  1ZP0 A;  2OA5 A;  3MKD A;  2BG9 B;  2XQ4 A;  3HR0 A;  3RF1 A;  4EXT A;  3EVY A;  4JI0 T;  3UTK A;  4UV9 B;  2CM0 A;  5AFH A;  4IGU A;  3HKD E;  4TWD A;  5HXR A;  3SQ9 A;  4HWC A;  2X9Y A;  4NUU A;  5JDG A;  2ZMA A;  3B57 A;  2CHO A;  4TX5 A;  3PE0 A;  1I9B A;  4ZS3 A;  3WTK A;  4AFG A;  4EV6 A;  4H63 V;  4AQY T;  4Z8X A;  3SS1 A;  2LOS A;  2W8F A;  2XNU A;  3AE2 A;  2FJD A;  2BG9 C;  2R6G F;  2WY2 A;  3MJX A;  2PG8 A;  3OYZ A;  5AQV B;  4DVD A;  4DUZ T;  2YOE A;  3G06 A;  2PFV A;  5HXH A;  4GOU A;  5FKY A;  4EYU A;  4DV2 T;  2BYS A;  4XZC A;  3BK9 A;  5J5G A;  2LSI A;  5L3E B;  3PUS A;  4IL4 A;  5AQK B;  4KHZ F;  4YHJ A;  4AQG A;  2UUB T;  2HH7 A;  2WCA A;  1WLX A;  2PJQ A;  4V1A v;  5JME A;  3ZST A;  3FZK B;  4JI1 T;  3PUW F;  2RP4 A;  5AQR B;  3LJC A;  2CWO A;  4H9N C;  2ES0 A;  2A9U A;  3FXE B;  4YTN A;  2X00 D;  4ZXL A;  3B5M A;  4WV9 A;  2N9D A;  1T7S A;  4EZ1 A;  2UUA T;  3IGQ A;  1MIV A;  3QOF A;  4UR9 A;  2KZ7 B;  2VVS A;  1IZN B;  4QX8 B;  2IC9 A;  3FZH B;  4HEA A;  3RQW A;  2DWK A;  4YSZ A;  2G0U A;  4AKR B;  2X9W A;  5L3D B;  4B6X A;  5KZU A;  1H7C A;  3X1D A;  3PTR B;  2YDQ A;  4H9S E;  3U8K A;  4FJO A;  3P8C D;  3V5S A;  4O4J E;  3JAD A;  2XYS A;  2WNJ A;  4DV3 T;  2B76 A;  1J5W A;  1WRD A;  4LFC T;  3AXJ B;  2WBL A;  2KMF A;  1HNZ T;  3HI2 A;  1D1B A;  2H88 A;  2V8S V;  4DUY T;  1BR1 A;  1ZHC A;  2CXF A;  2PTF A;  3Q5W A;  3AEG A;  5EK3 A;  4O4L E;  5LCY A;  3H3A A;  2UXC T;  3AEF A;  2HN1 A;  4B3T T;  4LMJ A;  5L4E A;  2HPL A;  3KV5 A;  5L47 A;  4IDN A;  2BVM A;  4DID B;  1N36 T;  2E5V A;  3M3Z B;  5JH7 E;  5FVK A;  1T98 A;  4U33 A;  1AJ3 A;  1W9R A;  1XMO T;  4GYS A;  2CXD A;  3N9O A;  2OV9 A;  2WNL A;  2KIN B;  2ZM0 A;  3ZMZ B;  2YN6 A;  5C3J A;  5F5W A;  4A56 A;  4TV8 E;  3OPC A;  2YKS A;  1Z8U A;  4TNV A;  2AE9 A;  1Y64 B;  2NTY A;  5FXX A;  3EUH A;  4G2A A;  4U7Y A;  4EEB A;  4LF5 T;  5IWA T;  5J5I A;  2NOX A;  3R6N A;  3HL6 A;  1MMA A;  3U8J A;  5L3F B;  4GYR A;  3N9Q A;  3N2K E;  5ABF A;  3PJA A;  4U74 A;  4ZZB A;  1MMG A;  3C79 A;  3ZDG A;  4X1K E;  4UF0 A;  3QK6 A;  2AXD S;  3FXD B;  2LSG A;  3VR9 A;  1VOM A;  2Y58 A;  2C9T A;  2Y54 A;  5JRE A;  4MHC A;  2CBJ A;  3WI3 A;  4TV9 E;  4CQI A;  5FVL A;  2W67 A;  4EOZ B;  1YQ4 A;  2VQF T;  4DR5 T;  4B5D A;  4DR6 T;  3M65 A;  5EK4 A;  1WYC A;  3UU4 A;  2XSA A;  3P4S A;  2JQQ A;  4IE7 A;  2BKO A;  2WMN A;  4JI5 T;  4DND A;  2RPA A;  2X9X A;  3HKE E;  3AA6 B;  4XBF B;  5J5F A;  3L3P A;  4YT0 A;  2XTL A;  2W62 A;  2VKH A;  2A72 A;  1MIW A;  4JI3 T;  2Q9Q D;  2J62 A;  1WYB A;  5ABG A;  1LRZ A;  2WDQ A;  3AB3 B;  4XK9 A;  2KSR A;  4HFV A;  1DU2 A;  3WTL A;  3RKG A;  2YU2 A;  5AQU B;  2MPK A;  2IAK A;  2UXB T;  3BQL A;  5H6Q B;  2Q9Q B;  5IHY A;  5AQN B;  5ABE A;  1QLB A;  5JVD E;  2NW8 A;  3Q5D A;  1UUR A;  3QC9 A;  2LHR A;  3N2G E;  3WAK A;  3UU6 A;  2Y7Y A;  4U7I A;  2CE7 A;  2LKH A;  2J1D G;  2W61 A;  3T1H T;  3DJB A;  1W0A A;  2Z6E A;  5FNV E;  4L5G A;  2LLY A;  3EDU A;  3J9X 1;  3PU3 A;  5LBM A;  2XQ5 A;  3Q2M A;  3LG7 A;  1OXZ A;  2JIW A;  3OJA A;  5L3C B;  4P1N A;  2Q9Q C;  4E7S A;  3ETU A;  2MBG A;  2CWY A;  3ZKR A;  2XUE A;  2MTQ A;  2PH9 A;  5LP6 E;  1MND A;  2VB6 A;  4IE0 A;  1D1C A;  3FBZ A;  4UV8 B;  3Q9D A;  2C0S A;  3LBX B;  2YMD A;  3VKG A;  4ZJS A;  1D0Y A;  4ZI2 D;  4KP3 C;  4EAH A;  3OYX A;  4HWF A;  2FBW A;  4OHF A;  4LMK A;  1N32 T;  4UM3 P;  2IIU A;  4YSY A;  3CKD A;  4PFO A;  3F57 A;  2E9X D;  2WZI A;  2M6I A;  1D0Z A;  4AKH A;  1D0X A;  3PUV F;  2NWB A;  4I4T E;  1E1H B;  2VQE T;  5KXJ A;  5AFM A;  3N2O A;  2D0U A;  2B1E A;  2CEA A;  3L8R A;  3UFG A;  5M4Y A;  2LSK A;  2CCQ A;  5CJ5 A;  4HTE A;  2I59 A;  1JNR A;  1ZKE A;  5LHI B;  3CQG B;  4OFZ A;  5AQT B;  2JQH A;  3ANW B;  2BYR A;  2E9X B;  3CX8 B;  5CA1 E;  2XY8 B;  3LK3 B;  4BFQ A;  5DQV A;  2W4X A;  2J47 A;  3CX6 B;  4ILB A;  2C5I T;  5BMV E;  4HFB A;  3F2E A;  4TNW A;  4X62 T;  2WWV A;  3V5U A;  1M62 A;  2XM1 A;  2CLY B;  4ISS A;  4EYY R;  5CGM A;  3KBU A;  5KMG P;  4ZI2 C;  4A5X A;  2XYT A;  2UUC T;  2WN9 A;  2LSY A;  4PK4 A;  4BJM A;  3FZL B;  4IST A;  2WQY A;  4IE5 A;  2XAG B;  3A5X A;  4N78 D;  3E0Z A;  4YTP A;  1YKE B;  2E9X C;  4IDO A;  4ZHQ E;  4UVC B;  3LK2 B;  4PIR A;  1S94 A;  5IUX A;  2N1G A;  4DR4 T;  2PGZ A;  3SQ6 A;  2W8G A;  3RHW A;  2CLY C;  3H37 A;  3UU3 A;  3AEC A;  2Y6X A;  4LML A;  2LRL A;  3PU8 A;  2QC1 B;  2XZ5 A;  2CPT A;  3SRZ A;  2X0H A;  3K3N A;  1SHZ C;  3PDY A;  2ZJU A;  2JJ9 A;  2V7M A;  3SFD A;  3PUQ A;  1SUM B;  5AQH B;  3I1A A;  5FY7 A;  3GN5 B;  4F6R C;  2VWA A;  5FP3 A;  2XAF B;  5J5H A;  2XJ7 A;  5JDF A;  3ZYK A;  2DHR A;  2D9D A;  5HXE A;  5L3G B;  2E5L T;  2LJL A;  2VK9 A;  4LFA T;  3QB5 A;  3RC8 A;  1FIO A;  2PBI A;  3AE7 A;  4WBO A;  1HNW T;  2WZY A;  3UFE A;  4B3S T;  2V1D B;  2KWI B;  1MNE A;  1QSD A;  1W0B A;  2K9A A;  3N9L A;  4DR7 T;  2WSS V;  5ETW A;  1O3X A;  1HG5 A;  3CX7 B;  3PUA A;  3O4X E;  3AE8 A;  2WU5 A;  1HCI A;  1M7K A;  4HN9 A;  1XZY A;  2NTX A;  2QYW A;  1IBK T;  2BS3 A;  4G63 A;  4PJL A;  1ZEE A;  3CK6 A;  3ZN1 B;  2LOP A;  4I50 E;  4IL9 A;  4DR3 T;  1E7P A;  3PEO A;  2XAH B;  3AE9 A;  3KVA A;  5HEU A;  4L0R A;  5E0O A;  5HWX A;  4JI4 T;  4H9R C;  3TLU A;  5HAX A;  4DV5 T;  2UZ6 A;  3I9Y A;  2BDE A;  3CML A;  1UX4 A;  3UQ7 A;  4ASK A;  3T1Y T;  4MBQ A;  4IDZ A;  2W66 A;  2V6Y A;  4AQF A;  3RIU C;  5A1L A;  5HEO A;  3K3O A;  4U3C A;  4ANJ A;  1XDO A;  3C4W A;  3I0O A;  3GMI A;  1B7T A;  1Y01 A;  5BP0 A;  4KI0 F;  3C64 A;  5FY0 A;  2X66 A;  4ZS2 A;  4NPP A;  4AXP A;  1XMQ T;  5JRC A;  2X00 A;  3ZSS A;  3C4X A;  2LSJ A;  2ZJV A;  3P4Q A;  3RKO A;  4CZZ B;  3ZCI A;  4UM3 A;  4ZOL E;  1HX8 A;  3VRA A;  3PUY F;  3A7M A;  2UXN B;  5HWY A;  2KXP B;  2K48 A;  3K1S A;  2X68 A;  3AXJ A;  2L8K A;  3AE5 A;  4CXY A;  5AFJ A;  3ZMU B;  2EHO A;  1UV6 A;  1FEW A;  2FJB A;  3AEE A;  3EHZ A;  4CXX A;  4X5T A;  3ZYL A;  2L3L A;  1YQ3 A;  4MAL A;  4UVB B;  1UCU A;  2JMK A;  4OK0 A;  4QAC A;  3OBV E;  1FJG T;  2DNX A;  2VKJ A;  3K3Q C;  5ADX L;  1HR0 T;  3MZK B;  5AQL B;  1GQE A;  4LF9 T;  3IHR A;  1SA0 E;  2ZM6 T;  2XQY A;  2WM9 A;  4JBW F;  3VRB A;  1MIY A;  5LA6 E;  1KK7 A;  2CXL A;  4DV7 T;  4X66 T;  5HYA A;  4YJ2 E;  5AIN A;  5BR8 T;  4X1Y E;  3GUA A;  2FUP A;  2BS4 A;  4MLK A;  5LBQ B;  4DMW A;  2JMH A;  3AA0 B;  4NIQ A;  3U78 A;  4ILC A;  4WNK A;  2VVN A;  2HPJ A;  5AQQ B;  2QRX A;  3UUX B;  5J2U E;  5LB7 B;  4NZB A;  2L9Q A;  4UY2 A;  5FL0 A;  4AIU A;  3ONX A;  4UXN B;  3PUZ F;  5LG3 A;  2H89 A;  4I55 E;  2BKP A;  1FMW A; 
#chains in the Genus database with same CATH homology
 3UU5 A;  2WN9 A;  5L47 A;  4B5D A;  1OED A;  3RIA A;  3EI0 A;  3ZKR A;  5JME A;  3UU4 A;  5CFB A;  2BR8 A;  5SYO A;  5AFN A;  5AFJ A;  2BG9 E;  2PH9 A;  3WTM A;  4HFI A;  2WNC A;  1UV6 A;  4AFH A;  5BW2 A;  4ZRU A;  2BJ0 A;  5J5F A;  3RI5 A;  3EHZ A;  4AFT A;  1OED E;  4X5T A;  4QAA A;  3RQU A;  2M6B A;  2X00 D;  3PMZ A;  4PIR A;  4ILA A;  2YMD A;  4UM3 S;  2WNL A;  5IUX A;  4WV9 A;  4IL9 A;  4EZ1 A;  3P50 A;  2MAW A;  3IGQ A;  4ZJS A;  2YN6 A;  3TLT A;  3UU8 A;  5L4E A;  3WTI A;  2PGZ A;  4UXU A;  3PEO A;  2XQ9 A;  2YKS A;  3ZDH A;  3SQ6 A;  4QAC A;  4TNV A;  4ZK1 A;  4HFC A;  5HEU A;  3UQ4 A;  4A98 A;  4COF A;  2BG9 B;  2XQ4 A;  4XK9 A;  3RIF A;  4IRE A;  3TLW A;  2W8G A;  3RHW A;  4HFE A;  3WTH A;  4LMK A;  2KSR A;  4UM3 P;  3TLU A;  2XNV A;  3UU3 A;  3U8M A;  1UW6 A;  3WTL A;  2UZ6 A;  1UX2 A;  2M6I A;  4LML A;  4HQP A;  3SIO A;  3RQW A;  1OED B;  4ZZC A;  4QH5 A;  5AFH A;  2VL0 A;  5HEG A;  4UM1 A;  3UQ7 A;  4D01 A;  4QH4 A;  2QC1 B;  4TWH A;  5L4H A;  4TWD A;  2XZ5 A;  2BYP A;  3SQ9 A;  2Y56 A;  3T4M A;  5KZU A;  5AFM A;  4A97 A;  3U8K A;  4ALX A;  5J5I A;  4F8H A;  5AFK A;  5HEO A;  3WIP A;  3JAD A;  5KE4 A;  2ZJU A;  2XNT A;  2XYS A;  3P4W A;  3WTJ A;  3U8J A;  4Z91 A;  4FRR A;  2WNJ A;  2XQ6 A;  5AIN A;  3TLV A;  1I9B A;  2BYQ A;  3WTK A;  4AFG A;  3GUA A;  5BP0 A;  3UU6 A;  2LKG A;  2Y7Y A;  4ZK4 A;  5TVC A;  4ZJT A;  4TWF A;  4ZZB A;  2LKH A;  2XQ7 A;  3JAF A;  2BYR A;  3C79 A;  3LSV A;  5FJV A;  4HFD A;  3ZDG A;  2W8F A;  2XNU A;  3TLS A;  4BFQ A;  5J5H A;  5HCM A;  4DBM A;  3JAE A;  4Z90 A;  2BG9 C;  3WTO A;  3WTN A;  2BYN A;  2YME A;  5BRX A;  4NPP A;  5J0Z A;  2YOE A;  4HFH A;  4ILC A;  4BQT A;  4ZR6 A;  5AFL A;  2LLY A;  4ILB A;  2X00 A;  2Y58 A;  5LXB A;  5HCJ A;  1OED C;  2ZJV A;  2C9T A;  2BYS A;  2XQ5 A;  2WZY A;  2Y54 A;  4HFB A;  4TNW A;  5CO5 A;  2XQ3 A;  3U8N A;  5J5G A;  5HEJ A;  4NZB A;  4UM3 A;  4UY2 A;  3SH1 A;  5AFM B;  2BG9 A;  3U8L A;  2XQ8 A;  3EAM A;  4IL4 A;  3UUB A;  2XQA A;  4QAB A;  5HEH A;  2Y57 A;  4XHE A;  5LG3 A;  2BR7 A;  4LMJ A;  2XYT A;  3C84 A;  4QH1 A;  2XZ6 A;  2LM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...