3EI8A

Crystal structure of k270n variant of ll-diaminopimelate aminotransferase from arabidopsis thaliana complexed with ll-dap: external aldimine form
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
411
structure length
411
Chain Sequence
EYKTKVSRNSNMSKLQAGYLFPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVAMETASFSNYAGFTGVRLGWTVIPKKLLYSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQSSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFGHRENILEACRRFKQLYKHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LL-diaminopimelate aminotransferase
publication title Mechanism of substrate recognition and PLP-induced conformational changes in LL-diaminopimelate aminotransferase from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 146
structure length 411
sequence length 411
chains with identical sequence B
ec nomenclature ec 2.6.1.83: LL-diaminopimelate aminotransferase.
pdb deposition date 2008-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3ei8A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3ei8A01
2CSTA 3HBXA 1G7XA 2OKKA 2VMQA 3K7YA 4LW4A 3NNKA 3W1HA 2EZ2A 5G09A 3RUYA 2D65A 4Q75A 4R5ZA 2VGWA 1XEYA 3BN1A 1AIAA 4WYCA 2VMYA 4XJLA 5G0AA 5BJ3A 3KKIA 4F5JA 1B5PA 4WXGA 1IAXA 4XEWA 2Z9VA 3RBLA 2DOUA 3WX9A 4DGTA 3QGUA 1PFFA 3FTBA 3EI6A 4FL0A 4TMRA 2HUFA 1ZODA 3MAFB 4H51A 3F0HA 1AX4A 4W5KA 1ASDA 3MAFA 5EUDA 2W8JA 3NU7A 2X8UA 5M49A 3WKSA 4ZAHA 4IX8A 2D7YA 2Z67A 2CY8A 3GWPA 2HUIA 4ATQA 1ECXA 1W3UA 1M6SA 2AY1A 2XH1A 1OHYA 2WK7A 3JWBA 2CINA 3NDNA 3DRDA 3BB8A 4EB5A 4WB0B 3WZFA 1C7GA 5F8VA 3Q8NA 4TV7A 5TF5A 2W7JA 5EIGA 4WB0A 1ASGA 1EJIA 4TN4A 1TARA 1IAYA 1S06A 3JWAA 2W7LA 2Q7WA 3NYUA 5G2QA 1UU1A 5G2PA 1OXOA 1H1CA 1AMAA 3ZZJA 3PIUA 2YKUA 1E5FA 2VMTA 2Z9UA 1OHVA 4CVQA 1DKAA 3F6TA 2AY7A 4ZSYA 1AHGA 4IXZA 1LC7A 4JE5A 2AY2A 1UKJA 1W23A 3B1CA 3H7FA 2AATA 2AEUA 4ADDA 4OCAA 4RKDA 2F8JA 4MQPA 2BI3A 3UAKA 3ISLA 4PIWA 2Z1YA 3DU4A 5LHAA 1SVVA 1WKHA 3HMUA 4MKKA 5K8BA 1QGNA 3COGA 4ADCA 3I16A 3FCRA 3QBOA 3JU7A 1KKJA 3P1TA 4IXSA 3USFA 5E4ZA 3NU8A 4L0OA 3FQAA 4RJYA 4F5IA 2JGTA 2VMZA 2ZUKA 4ZDOA 3AEJC 4ZDPA 3HQTA 2D63A 2Z9WA 3DC1A 3B1DA 4K2MA 2JJEA 3NTJA 1AHEA 4JEZA 3VP6A 3DODA 4A00A 2VMVA 1AY5A 3D6KA 3G8MA 1I29A 2X5DA 3MADA 3AEMC 4N0BA 1ARHA 3VAXA 3G7QA 3N0LA 4XJMA 1AAWA 4E1OA 1B5OA 4Q76A 2EPJA 2VGZA 4WYAA 2PB2A 4ZLVA 5BJ4A 4IY7A 1GC3A 4GRXA 1OHWA 1ASAA 4JEXA 4Y0IA 4GDYA 3WGCA 3BWOA 1W7MA 1AHYA 4I8AA 4JE5D 1YOOA 2YOBA 5HXXA 4JEYA 4B98A 3GZCA 1BKGA 1IBJA 2HP1A 3FZ8A 3MEBA 1D7UA 1VP4A 4RLGA 4LNLA 3VOMA 4BA4A 3DXWA 2OGAA 5LH9A 1CQ8A 2VI9A 4ZWVA 1CQ6A 1FG7A 1GBNA 4W8IA 1O69A 1LC8A 4MSOA 4F5FA 4UQVA 1FG3A 3ASAA 2W7DA 1DFOA 1X2AA 1OXPA 1FC4A 2AY9A 2AY5A 3RCHB 1AHFA 3E77A 3ELEA 4ADBA 3RCHA 5E3KA 5EUNA 4JF1A 4P7YA 4MY5A 4WXFA 2YKVA 3EI5A 2VGSA 4ITXA 1ASNA 4J5UA 1G4XA 3JZLA 3WKRA 2ZY4A 1LK9A 5EAVA 3AV7A 1U08A 5DX5A 3AEJA 5DJ9A 4O6ZA 2HP2A 5DB5A 1M0QA 4Y0HA 1ELUA 3WCNA 1BQAA 1RVUA 3NX3A 2R0TA 4OBUA 4M2KA 4R8DA 1O4SA 4W91A 2JG2A 3RQ1A 3EIBA 3AEMA 1IUGA 1IX6A 3ATHA 3GJUA 1TPLA 5AX8A 1J04A 1AMQA 1M7YA 5G4IA 2BI9A 1B4XA 3AATA 3UE8A 4PVFA 1LW4A 1D7SA 1C9CA 3PDXA 1D7VA 2BI2A 3ACZA 4R2NA 4Y0DA 3L8AA 2HOXA 2ZC0A 2E7UA 4A0RA 3M5UA 3VK4A 1GEWA 1LC5A 1QJ5A 2BKWA 2DGLA 2OQXA 3HDOA 4M2JA 3E9KA 1RVYA 4BMKA 4LNMA 3A9YA 3NUBA 4OYTA 1DGDA 2VIBA 2HOZA 4XQ2A 2W8VA 5E5IA 1BT4A 2WKAA 4HVKA 1AKCA 4UHMA 3OP7A 4CBSA 2CTZA 5DJ1A 4W1VA 1V2FA 1ASBA 2W8WA 1SZSA 2FYFA 2R5CB 2WK9A 4ADEA 4A0HA 8AATA 1P3WA 2QB3A 2QA3A 1I43A 3IHJA 4XAUA 4XJOA 1QIRA 2AY4A 2C7TA 3CBFA 3LY1A 2ZP7A 3FQ8A 2C81A 3AELA 4N0WA 3PJ0A 4W1WA 1BW0A 2Z1ZA 5FT6A 2OATA 1ASEA 2FNIA 2R2NA 2GMUA 3RI6A 4WD2A 4K2BA 3N5MA 2E7JA 3MBBA 4J8LA 3LV2A 1J32A 1MDZA 3AOWA 4RIZA 2GQNA 5D95A 3H14A 2GMSA 5FT8A 3ZRRA 4BQ0A 4K2IA 2JJFA 3EZ1A 4WLHA 1EQBA 1ZOBA 3GR9A 3EUCA 4PFFA 5HHYA 3FKDA 3FVXA 1OATA 3E2ZB 2EH6A 3A2BA 4BHDA 4MGRA 3BCBA 1H0CA 3ASBA 2BI1A 5I92A 1KL2A 1N31A 1YNUA 2DR1A 3R9AA 1IJIA 3G0TA 1G7WA 1MDOA 3ELPA 4BA5A 3HLMA 3LWSA 4U2HA 4ZSWA 1O62A 4AZJA 4RKCA 3B1EA 4U1TA 4A0GA 2CB1A 2W7IA 5EFSA 1GC2A 3HL2A 4F5LA 1YJYA 4P3MA 3ECDA 3FVUA 4LNJA 1C7OA 1UU0A 3KGWA 9AATA 5EUEA 3W1IA 1QZ9A 3DZZA 3I5TA 1MLYA 2BYLA 1IVRA 1DTYA 1M0PA 1GDEA 3PGYA 3BC8A 3NYTA 1V2DA 3BCXA 3FRKA 4GE9A 1ARTA 2R5EA 2ZY5A 1AJSB 1V72A 1PG8A 1ZC9A 2PO3A 4FFCA 4A72A 1AJSA 4A6TA 3QN6A 3EZSA 1AY4A 1W7LA 1ARSA 1QITA 2HORA 3WCOA 4EFFA 1SPAA 4WXBA 2VYCA 2VGUA 3GZDC 3PA9A 4F5KA 1GC0A 2VMWA 4F5MA 1GD9A 2JJHA 2D64A 2W7KA 1T3IA 1S0AA 1G4VA 1IX7A 2O1BA 4A6UA 1X28A 3EIAA 3NYSA 1PMMA 1JS6A 3MAUA 1C0NA 1M0OA 3TATA 3CQ6A 1GEYA 4RJ0A 1KMKA 2DKBA 4AO9A 4EB7A 1SFFA 2CFBA 1YJZA 4GSAA 4M2MA 2GSAA 1AY8A 2VMPA 4EU1A 2VLFA 1YJSA 3GETA 2NMPA 1YIYA 3FSLA 1E5EA 2VI8A 1LW5A 3BS8A 2FM1A 2V0YA 2W8TA 1S09A 1WYUB 1JG8A 3TQXA 1BJOB 3FZ6A 2VMUA 4ZASA 2JISA 4E77A 5M4BA 1CZCA 3KE3A 1BJOA 2FN6A 2W7EA 4E3QA 1DGEA 3TCMA 1CS1A 4CXQA 2E7IA 2YKYA 1X29A 1IX8A 2W7FA 4HF8A 1DJEA 1BS0A 3ZZKA 2O0RA 1D7RA 1ASLA 4Q6RA 3BWNC 2V1PA 3FDBA 3TFTA 4LW2A 2W7MA 1MLZA 4JF0A 1O61A 1AKBA 1Z3ZA 2ZSLA 3A9XA 1C4KA 2TPLA 1B8GA 1AIBA 1Z7DA 4OT8A 2X3LA 2X5FA 3KGXA 3WY7A 2VGVA 2C0RA 4WLJA 2D66A 1EG5A 4GEBA 3FFHA 1TOGA 2AY8A 4LC3A 1SZUA 3N75A 1RV3A 2VGTA 1TASA 2VMNA 2FQ6A 3EI9A 4UHOA 1MAQA 1GCKA 3BV0A 3GBXA 3WGBA 3PAAA 2QMAA 3MKJA 5M46A 3F9TA 3PD6B 3T32A 3MC6C 1BJWA 3P6KA 1SZKA 3PD6A 4JEVA 4MQQA 2JJGA 1MAPA 4JEWA 2CH2A 2DKJA 1N8PA 2YRIA 2R5CA 1B9IA 1DJ9A 3FZ7A 2BYJA 4ISYA 5D5SA 1AICA 2ZYJA 3I4JA 4IYOB 3JW9A 1TOKA 1V2EA 3UWCA 2ZY2A 4IYOA 1CL1A 1CL2A 1ORDA 1I48A 1GEXA 3LVMA 4ATPA 3E2FA 1TOJA 4KAMA 3QM2A 4ZDLA 2YCPA 1AJRA 1D2FA 1LKCA 4A0FA 4AOAA 1JS3A 3R4TA 1ARGA 4NOGA 4ITGA 2DGMA 4EMYA 2EZ1A 1KKPA 4OC9A 4OTLA 4XK1A 4KXKA 3LVLB 4Q31A 2YCTA 3VK2A 2Z9XA 2BI5A 5EIGB 1W7NA 3AENB 2CH1A 1ASMA 3E2ZA 1UU2A 3PPLA 3AENA 3B8XA 2CJGA 3BWNA 2C44A 4ZWMA 1BQDA 1M4NA 3HT4A 4A6RA 3LG0A 2VMRA 3FFRA 1PMOA 5M4DA 1WSTA 3BCAA 1M0NA 5HDMA 2BHXA 4AO4A 4F4EA 2QBTA 1JF9A 2VLHA 3B46A 4GE7A 1AMRA 1AHXA 1VEFA 2D61A 2OGEA 3DYDA 1N2TA 4WBTA 1ASFA 1BJ4A 4F5GA 2G6WA 3LVKA 1B9HA 2YRRA 3QHXA 1QJ3A 1WYVB 2XBNA 2HOYA 3A8UX 2W7GA 4F5HA 1WYVA 1WYTB 1QISA 2Z20A 4RM1A 3QI6A 2E54A 2AEVA 1WYTA 1CQ7A 1VJOA 3MC6A 4PFNA 2W7HA 3DR4A 2VIAA 4WYFA 4WYEA 3FVSA 1GC4A 1TOEA 2YKXA 1X0MA 2ZSMA 3LVJA 2AY6A 3AEPA 4WYGA 5F9SA 1AKAA 2YHKA 2ZY3A 3NUIA 3L44A 5C6UA 4XJPA 1WKGA 2GB3A 2CJDA 2BWPA 2ZJGA 2CJHA 3II0A 4IXOA 4QGRA 4RAEA 4WP0A 5EQCA 4WYDA 3WLXA 3CQ5A 3DXVA 1TATA 4B9BA 2RFVA 1C7NA 2BWOA 2ORDA 3NRAA 1LS3A 2BWNA 3VK3A 2DGKA 2HUUA 1ARIA 5JAYA 3EI8A 4GE4A 1ELQA 2FNUA 1YIZA 2D5YA 3A9ZA 3CAIA 3GSBA 4RITA 4AZKA 4R5FA 5FT5A 5EAAA 3QPGA 1TOIA 1AAMA 1SF2A 1I41A 4IW7A 1KL1A 1MGVA 2YCNA 3FD0A 3IF2A 3PDBB 2OKJA 1BJNA 1WYUA 1ASCA 7AATA 5G4JA 4UOYA 4UHNA 3ZRPA 2VMOA 3PDBA 2Z61A 1RV4A 4MKJA 1AMSA 2HZPA 1M32A 1S08A 3W1JA 4ZM4A 2BIGA 2QB2A 3JTXA 5IWQA 2AY3A 1S07A 4KYOA 2VMSA 2VMXA 2BIAA 2EO5A 3E2YA 4MQRA 4DQ6A 4OMAA 2PB0A 3ZRQA 3TFUA 1CZEA 1Y4IA 4DBCA 2WK8A 4E3RA 5FT4A 1DJUA 2CANA 2O7CA 3K40A 5J8QA 4CXRA 1CJ0A 3GZDA 1XI9A 4CBRA 3DR7A 3OKSA 2D7ZA 1KMJA 3E6GA 4AH3A 2BIEA 3HVYA 3K28A 1MDXA 2QLRA 3CQ4A 3FDDA 4W1XA 3EI7A 3FQ7A 3AOVA 2W8UA 4OBVA 3AEOA 2EGYA 3RBFA 4ZM3A 1YAAA
chains in the Genus database with same CATH superfamily
2CSTA 3HBXA 1G7XA 2OKKA 2VMQA 3K7YA 4LW4A 3NNKA 3W1HA 2EZ2A 5G09A 3RUYA 2D65A 4Q75A 4R5ZA 2VGWA 1XEYA 3BN1A 1AIAA 4WYCA 2VMYA 4XJLA 5G0AA 5BJ3A 3KKIA 4F5JA 1B5PA 4WXGA 1IAXA 4XEWA 2Z9VA 3RBLA 2DOUA 3WX9A 4DGTA 3QGUA 1PFFA 3FTBA 3EI6A 4FL0A 4TMRA 2HUFA 1ZODA 3MAFB 4H51A 3F0HA 1AX4A 4W5KA 1ASDA 3MAFA 5EUDA 2W8JA 3NU7A 2X8UA 5M49A 3WKSA 4ZAHA 4IX8A 2D7YA 2Z67A 2CY8A 3GWPA 2HUIA 4ATQA 1ECXA 1W3UA 1M6SA 2AY1A 2XH1A 1OHYA 2WK7A 3JWBA 2CINA 3NDNA 3DRDA 3BB8A 4EB5A 4WB0B 3WZFA 1C7GA 5F8VA 3Q8NA 4TV7A 5TF5A 2W7JA 5EIGA 4WB0A 1ASGA 1EJIA 4TN4A 1TARA 1IAYA 1S06A 3JWAA 2W7LA 2Q7WA 3NYUA 2G7JA 5G2QA 1UU1A 5G2PA 1OXOA 1H1CA 1AMAA 3ZZJA 3PIUA 2YKUA 1E5FA 2VMTA 2Z9UA 1OHVA 4CVQA 1DKAA 3F6TA 2AY7A 4ZSYA 1AHGA 4IXZA 1LC7A 4JE5A 2AY2A 1UKJA 1W23A 3B1CA 3H7FA 2AATA 2AEUA 4ADDA 4OCAA 4RKDA 2F8JA 4MQPA 2BI3A 3UAKA 3ISLA 4PIWA 2Z1YA 3DU4A 5LHAA 1SVVA 1WKHA 3HMUA 4MKKA 5K8BA 1QGNA 3COGA 4ADCA 3I16A 3FCRA 3QBOA 3JU7A 1KKJA 3P1TA 4IXSA 3USFA 5E4ZA 3NU8A 4L0OA 3FQAA 4RJYA 4F5IA 2JGTA 2VMZA 2ZUKA 4ZDOA 3AEJC 4ZDPA 3HQTA 2D63A 2Z9WA 3DC1A 3B1DA 4K2MA 2JJEA 3NTJA 1AHEA 4JEZA 3VP6A 3DODA 4A00A 2VMVA 1AY5A 3D6KA 3G8MA 1I29A 2X5DA 3MADA 3AEMC 4N0BA 1ARHA 3VAXA 3N4RA 3G7QA 3N0LA 4XJMA 1AAWA 4E1OA 1B5OA 4Q76A 2EPJA 2VGZA 4WYAA 2PB2A 4ZLVA 5BJ4A 4IY7A 1GC3A 4GRXA 1OHWA 1ASAA 4JEXA 4Y0IA 4GDYA 3WGCA 3BWOA 1W7MA 1AHYA 4I8AA 4JE5D 1YOOA 2YOBA 5HXXA 4JEYA 4B98A 3GZCA 1BKGA 1IBJA 2HP1A 3FZ8A 3MEBA 1D7UA 1VP4A 4RLGA 4LNLA 3VOMA 4BA4A 3DXWA 2OGAA 5LH9A 1CQ8A 2VI9A 4ZWVA 1CQ6A 1FG7A 1GBNA 4W8IA 1O69A 1LC8A 4MSOA 4F5FA 4UQVA 1FG3A 3ASAA 2W7DA 1DFOA 1X2AA 1OXPA 1FC4A 2AY9A 2AY5A 3RCHB 1AHFA 3E77A 3ELEA 4ADBA 3RCHA 5E3KA 5EUNA 4JF1A 4P7YA 4MY5A 4WXFA 2YKVA 3EI5A 2VGSA 4ITXA 1ASNA 4J5UA 1G4XA 3JZLA 3WKRA 2ZY4A 1LK9A 5EAVA 3AV7A 1U08A 5DX5A 3AEJA 5DJ9A 2KFPA 4O6ZA 2HP2A 5DB5A 1M0QA 4Y0HA 1ELUA 3WCNA 1BQAA 1RVUA 3NX3A 2R0TA 4OBUA 4M2KA 4R8DA 1O4SA 4W91A 2JG2A 3RQ1A 3EIBA 3AEMA 3N4XA 1IUGA 1IX6A 3ATHA 3GJUA 1TPLA 5AX8A 1J04A 1AMQA 1M7YA 5G4IA 2BI9A 1B4XA 3AATA 3UE8A 4PVFA 1LW4A 1D7SA 1C9CA 3PDXA 1D7VA 2BI2A 3ACZA 4R2NA 4Y0DA 3L8AA 2HOXA 2ZC0A 2E7UA 4A0RA 3M5UA 3VK4A 1GEWA 1LC5A 1QJ5A 2BKWA 2DGLA 2OQXA 3HDOA 4M2JA 3E9KA 1RVYA 4BMKA 4LNMA 3A9YA 3NUBA 4OYTA 1DGDA 2VIBA 2HOZA 4XQ2A 2W8VA 5E5IA 1BT4A 2WKAA 4HVKA 1AKCA 4UHMA 3OP7A 4CBSA 2CTZA 5DJ1A 4W1VA 1V2FA 1ASBA 2W8WA 1SZSA 2FYFA 2R5CB 2WK9A 4ADEA 4A0HA 8AATA 1P3WA 2QB3A 2QA3A 1I43A 3IHJA 4XAUA 4XJOA 1QIRA 2AY4A 2C7TA 3CBFA 3LY1A 2ZP7A 3FQ8A 2C81A 3AELA 4N0WA 3PJ0A 4W1WA 1BW0A 2Z1ZA 5FT6A 2OATA 1ASEA 2FNIA 2R2NA 2GMUA 3RI6A 4WD2A 4K2BA 3N5MA 2E7JA 3MBBA 4J8LA 3LV2A 1J32A 1MDZA 3AOWA 4RIZA 2GQNA 5D95A 3H14A 2GMSA 5FT8A 3ZRRA 4BQ0A 4K2IA 2JJFA 3EZ1A 4WLHA 1EQBA 1ZOBA 3GR9A 3EUCA 4PFFA 5HHYA 3FKDA 3N4SA 3FVXA 1OATA 3E2ZB 2EH6A 3A2BA 4BHDA 4MGRA 3BCBA 1H0CA 3ASBA 2BI1A 5I92A 1KL2A 1N31A 1YNUA 2DR1A 3R9AA 1IJIA 3G0TA 1G7WA 1MDOA 3ELPA 4BA5A 3HLMA 3LWSA 4U2HA 4ZSWA 1O62A 4AZJA 4RKCA 3B1EA 4U1TA 4A0GA 2CB1A 2W7IA 5EFSA 1GC2A 3HL2A 4F5LA 1YJYA 4P3MA 3ECDA 3FVUA 4LNJA 1C7OA 1UU0A 3KGWA 9AATA 5EUEA 3W1IA 1QZ9A 3DZZA 3I5TA 1MLYA 2WB6A 2BYLA 1IVRA 1DTYA 1M0PA 1GDEA 3PGYA 3BC8A 3NYTA 1V2DA 3BCXA 3FRKA 4GE9A 1ARTA 2R5EA 2ZY5A 1AJSB 1V72A 1PG8A 1ZC9A 2PO3A 4FFCA 4A72A 1AJSA 4A6TA 3QN6A 3EZSA 1AY4A 1W7LA 1ARSA 1QITA 2HORA 3WCOA 4EFFA 1SPAA 4WXBA 2VYCA 2VGUA 3GZDC 3PA9A 4F5KA 1GC0A 2VMWA 4F5MA 1GD9A 2JJHA 2D64A 2W7KA 1T3IA 1S0AA 1G4VA 1IX7A 2O1BA 4A6UA 1X28A 3EIAA 3NYSA 1PMMA 1JS6A 3MAUA 1C0NA 1M0OA 3TATA 3CQ6A 1GEYA 4RJ0A 1KMKA 2DKBA 4AO9A 4EB7A 2FKIA 1SFFA 2CFBA 1YJZA 4GSAA 4M2MA 2GSAA 1AY8A 2VMPA 4EU1A 2VLFA 1YJSA 3GETA 2NMPA 1YIYA 3FSLA 1E5EA 2VI8A 1LW5A 3BS8A 2FM1A 2V0YA 2W8TA 1S09A 1WYUB 1JG8A 3TQXA 1BJOB 3FZ6A 2VMUA 4ZASA 2JISA 4E77A 5M4BA 1CZCA 3KE3A 1BJOA 2FN6A 2W7EA 4E3QA 1DGEA 3TCMA 1CS1A 4CXQA 2E7IA 2YKYA 1X29A 1IX8A 2W7FA 4HF8A 1DJEA 1BS0A 3ZZKA 2O0RA 1D7RA 1ASLA 4Q6RA 3BWNC 2V1PA 3FDBA 3TFTA 4K05A 4LW2A 2W7MA 1MLZA 4JF0A 1O61A 1AKBA 1Z3ZA 2ZSLA 3A9XA 1C4KA 2TPLA 1B8GA 1AIBA 1Z7DA 4OT8A 2X3LA 2X5FA 3KGXA 3WY7A 2VGVA 2C0RA 4WLJA 2D66A 1EG5A 4GEBA 3FFHA 1TOGA 2AY8A 2A1VA 4LC3A 1SZUA 3N75A 1RV3A 2VGTA 2EYQA 1TASA 2VMNA 1KAFA 2FQ6A 3EI9A 4UHOA 1MAQA 1GCKA 3BV0A 3GBXA 3WGBA 3PAAA 2QMAA 3MKJA 5M46A 3F9TA 3PD6B 3T32A 3MC6C 1BJWA 3P6KA 1SZKA 3PD6A 4JEVA 4MQQA 2JJGA 1MAPA 4JEWA 2CH2A 2DKJA 1N8PA 2YRIA 2R5CA 1B9IA 1DJ9A 3FZ7A 2BYJA 4ISYA 5D5SA 1AICA 2ZYJA 3I4JA 4IYOB 3JW9A 1TOKA 1V2EA 3UWCA 2ZY2A 5KTBA 4IYOA 1CL1A 1CL2A 1ORDA 1I48A 1GEXA 3LVMA 4ATPA 3E2FA 1TOJA 4KAMA 3QM2A 4ZDLA 2YCPA 1AJRA 1D2FA 1LKCA 4A0FA 4AOAA 1JS3A 3R4TA 1ARGA 4NOGA 4ITGA 2DGMA 4EMYA 2EZ1A 1KKPA 4OC9A 4OTLA 4XK1A 4KXKA 3LVLB 4Q31A 2YCTA 3VK2A 2Z9XA 2BI5A 5EIGB 1W7NA 3AENB 2CH1A 1ASMA 3E2ZA 1UU2A 3PPLA 3AENA 3B8XA 2CJGA 3BWNA 2C44A 4ZWMA 1BQDA 1M4NA 3HT4A 4A6RA 3LG0A 2VMRA 3FFRA 1PMOA 3H9XA 5M4DA 1WSTA 3BCAA 1M0NA 5HDMA 2BHXA 4AO4A 4F4EA 2QBTA 1JF9A 2VLHA 3B46A 4GE7A 1AMRA 1AHXA 1VEFA 2D61A 2OGEA 3DYDA 1N2TA 4WBTA 1ASFA 1BJ4A 4F5GA 2G6WA 3LVKA 1B9HA 2YRRA 3QHXA 1QJ3A 1WYVB 2XBNA 2HOYA 3A8UX 2W7GA 4F5HA 1WYVA 1WYTB 1QISA 2Z20A 4RM1A 3QI6A 2E54A 2AEVA 1WYTA 1CQ7A 1VJOA 3MC6A 4PFNA 2W7HA 3DR4A 2VIAA 4WYFA 4WYEA 3FVSA 1GC4A 1TOEA 2YKXA 3N7NA 1X0MA 2ZSMA 3LVJA 2AY6A 3AEPA 4WYGA 5F9SA 1AKAA 2YHKA 2ZY3A 3NUIA 3L44A 5C6UA 4XJPA 1WKGA 2GB3A 2CJDA 2BWPA 2ZJGA 2CJHA 3II0A 4IXOA 4QGRA 4RAEA 4WP0A 5EQCA 4WYDA 3WLXA 2QSRA 3CQ5A 3DXVA 1TATA 4B9BA 2RFVA 1C7NA 2BWOA 2ORDA 3NRAA 1LS3A 2BWNA 3VK3A 2DGKA 2HUUA 1ARIA 5JAYA 3EI8A 4GE4A 1ELQA 2FNUA 1YIZA 2D5YA 3A9ZA 3CAIA 3GSBA 4RITA 4AZKA 4R5FA 5FT5A 5EAAA 3QPGA 1TOIA 1AAMA 1SF2A 1I41A 4IW7A 1KL1A 1MGVA 2YCNA 3FD0A 3IF2A 3PDBB 2OKJA 1BJNA 1WYUA 1ASCA 7AATA 5G4JA 4UOYA 4UHNA 3ZRPA 2VMOA 3PDBA 2Z61A 1RV4A 4MKJA 1AMSA 2HZPA 1M32A 1S08A 3W1JA 4ZM4A 2BIGA 2QB2A 3JTXA 5IWQA 2AY3A 1S07A 4KYOA 2VMSA 2VMXA 2BIAA 2EO5A 3E2YA 4MQRA 4DQ6A 4OMAA 2PB0A 3ZRQA 3TFUA 1CZEA 1Y4IA 4DBCA 2WK8A 4E3RA 5FT4A 1DJUA 2CANA 2O7CA 3K40A 5J8QA 4CXRA 1CJ0A 3GZDA 1XI9A 4CBRA 3DR7A 3OKSA 2D7ZA 4H63Q 1KMJA 3E6GA 4AH3A 2BIEA 3HVYA 3K28A 1MDXA 2QLRA 3CQ4A 3FDDA 4W1XA 3EI7A 3FQ7A 3AOVA 2W8UA 4OBVA 3AEOA 2EGYA 3RBFA 4ZM3A 1YAAA
chains in the Genus database with same CATH topology
2CSTA 3HBXA 1G7XA 2OKKA 2VMQA 3K7YA 4LW4A 3NNKA 3W1HA 2EZ2A 5G09A 3RUYA 2D65A 4Q75A 4R5ZA 2VGWA 1XEYA 3BN1A 1AIAA 4WYCA 2VMYA 4XJLA 5G0AA 5BJ3A 3KKIA 4F5JA 1B5PA 4WXGA 1IAXA 4XEWA 2Z9VA 3RBLA 2DOUA 3WX9A 4DGTA 3QGUA 1PFFA 3FTBA 3EI6A 4FL0A 4TMRA 2HUFA 1ZODA 3MAFB 4H51A 3F0HA 1AX4A 4W5KA 1ASDA 3MAFA 5EUDA 2W8JA 3NU7A 2X8UA 5M49A 3WKSA 4ZAHA 4IX8A 2D7YA 2Z67A 2CY8A 3GWPA 2HUIA 4ATQA 1ECXA 1W3UA 1M6SA 2AY1A 2XH1A 1OHYA 2WK7A 3JWBA 2CINA 3NDNA 3DRDA 3BB8A 4EB5A 4WB0B 3WZFA 1C7GA 5F8VA 3Q8NA 4TV7A 5TF5A 2W7JA 5EIGA 4WB0A 1ASGA 1EJIA 4TN4A 1TARA 1IAYA 1S06A 3JWAA 2W7LA 2Q7WA 3NYUA 2G7JA 5G2QA 1UU1A 5G2PA 1OXOA 1H1CA 1AMAA 3ZZJA 3PIUA 2YKUA 1E5FA 2VMTA 2Z9UA 1OHVA 4CVQA 1DKAA 3F6TA 2AY7A 4ZSYA 1AHGA 4IXZA 1LC7A 4JE5A 2AY2A 1UKJA 1W23A 3B1CA 3H7FA 2AATA 2AEUA 4ADDA 4OCAA 4RKDA 2F8JA 4MQPA 2BI3A 3UAKA 3ISLA 4PIWA 2Z1YA 3DU4A 5LHAA 1SVVA 1WKHA 3HMUA 4MKKA 5K8BA 1QGNA 3COGA 4ADCA 3I16A 3FCRA 3QBOA 3JU7A 1KKJA 3P1TA 4IXSA 3USFA 5E4ZA 3NU8A 4L0OA 3FQAA 4RJYA 4F5IA 2JGTA 2VMZA 2ZUKA 4ZDOA 3AEJC 4ZDPA 3HQTA 2D63A 2Z9WA 3DC1A 3B1DA 4K2MA 2JJEA 3NTJA 1AHEA 4JEZA 3VP6A 3DODA 4A00A 2VMVA 1AY5A 3D6KA 3G8MA 1I29A 2X5DA 3MADA 3AEMC 4N0BA 1ARHA 3VAXA 3N4RA 3G7QA 3N0LA 4XJMA 1AAWA 4E1OA 1B5OA 4Q76A 2EPJA 2VGZA 4WYAA 2PB2A 4ZLVA 5BJ4A 4IY7A 1GC3A 4GRXA 1OHWA 1ASAA 4JEXA 4Y0IA 4GDYA 3WGCA 3BWOA 1W7MA 1AHYA 4I8AA 4JE5D 1YOOA 2YOBA 5HXXA 4JEYA 4B98A 3GZCA 1BKGA 1IBJA 2HP1A 3FZ8A 3MEBA 1D7UA 1VP4A 4RLGA 4LNLA 3VOMA 4BA4A 3DXWA 2OGAA 5LH9A 1CQ8A 2VI9A 4ZWVA 1CQ6A 1FG7A 1GBNA 4W8IA 1O69A 1LC8A 4MSOA 4F5FA 4UQVA 1FG3A 3ASAA 2W7DA 1DFOA 1X2AA 1OXPA 1FC4A 2AY9A 2AY5A 3RCHB 1AHFA 3E77A 3ELEA 4ADBA 3RCHA 5E3KA 5EUNA 4JF1A 4P7YA 4MY5A 4WXFA 2YKVA 3EI5A 2VGSA 4ITXA 1ASNA 4J5UA 1G4XA 3JZLA 3WKRA 2ZY4A 1LK9A 5EAVA 3AV7A 1U08A 5DX5A 3AEJA 5DJ9A 2KFPA 4O6ZA 2HP2A 5DB5A 1M0QA 4Y0HA 1ELUA 3WCNA 1BQAA 1RVUA 3NX3A 2R0TA 4OBUA 4M2KA 4R8DA 1O4SA 4W91A 2JG2A 3RQ1A 3EIBA 3AEMA 3N4XA 1IUGA 1IX6A 3ATHA 3GJUA 1TPLA 5AX8A 1J04A 1AMQA 1M7YA 5G4IA 2BI9A 1B4XA 3AATA 3UE8A 4PVFA 1LW4A 1D7SA 1C9CA 3PDXA 1D7VA 2BI2A 3ACZA 4R2NA 4Y0DA 3L8AA 2HOXA 2ZC0A 2E7UA 4A0RA 3M5UA 3VK4A 1GEWA 1LC5A 1QJ5A 2BKWA 2DGLA 2OQXA 3HDOA 4M2JA 3E9KA 1RVYA 4BMKA 4LNMA 3A9YA 3NUBA 4OYTA 1DGDA 2VIBA 2HOZA 4XQ2A 2W8VA 5E5IA 1BT4A 2WKAA 4HVKA 1AKCA 4UHMA 3OP7A 4CBSA 2CTZA 5DJ1A 4W1VA 1V2FA 1ASBA 2W8WA 1SZSA 2FYFA 2R5CB 2WK9A 4ADEA 4A0HA 8AATA 1P3WA 2QB3A 2QA3A 1I43A 3IHJA 4XAUA 4XJOA 1QIRA 2AY4A 2C7TA 3CBFA 3LY1A 2ZP7A 3FQ8A 2C81A 3AELA 4N0WA 3PJ0A 4W1WA 1BW0A 2Z1ZA 5FT6A 2OATA 1ASEA 2FNIA 2R2NA 2GMUA 3RI6A 4WD2A 4K2BA 3N5MA 2E7JA 3MBBA 4J8LA 3LV2A 1J32A 1MDZA 3AOWA 4RIZA 2GQNA 5D95A 3H14A 2GMSA 5FT8A 3ZRRA 4BQ0A 4K2IA 2JJFA 3EZ1A 4WLHA 1EQBA 1ZOBA 3GR9A 3EUCA 4PFFA 5HHYA 3FKDA 3N4SA 3FVXA 1OATA 3E2ZB 2EH6A 3A2BA 4BHDA 4MGRA 3BCBA 1H0CA 3ASBA 2BI1A 5I92A 1KL2A 1N31A 1YNUA 2DR1A 3R9AA 1IJIA 3G0TA 1G7WA 1MDOA 3ELPA 4BA5A 3HLMA 3LWSA 4U2HA 4ZSWA 1O62A 4AZJA 4RKCA 3B1EA 4U1TA 4A0GA 2CB1A 2W7IA 5EFSA 1GC2A 3HL2A 4F5LA 1YJYA 4P3MA 3ECDA 3FVUA 4LNJA 1C7OA 1UU0A 3KGWA 9AATA 5EUEA 3W1IA 1QZ9A 3DZZA 3I5TA 1MLYA 2WB6A 2BYLA 1IVRA 1DTYA 1M0PA 1GDEA 3PGYA 3BC8A 3NYTA 1V2DA 3BCXA 3FRKA 4GE9A 1ARTA 2R5EA 2ZY5A 1AJSB 1V72A 1PG8A 1ZC9A 2PO3A 4FFCA 4A72A 1AJSA 4A6TA 3QN6A 3EZSA 1AY4A 1W7LA 1ARSA 1QITA 2HORA 3WCOA 4EFFA 1SPAA 4WXBA 2VYCA 2VGUA 3GZDC 3PA9A 4F5KA 1GC0A 2VMWA 4F5MA 1GD9A 2JJHA 2D64A 2W7KA 1T3IA 1S0AA 1G4VA 1IX7A 2O1BA 4A6UA 1X28A 3EIAA 3NYSA 1PMMA 1JS6A 3MAUA 1C0NA 1M0OA 3TATA 3CQ6A 1GEYA 4RJ0A 1KMKA 2DKBA 4AO9A 4EB7A 2FKIA 1SFFA 2CFBA 1YJZA 4GSAA 4M2MA 2GSAA 1AY8A 2VMPA 4EU1A 2VLFA 1YJSA 3GETA 2NMPA 1YIYA 3FSLA 1E5EA 2VI8A 1LW5A 3BS8A 2FM1A 2V0YA 2W8TA 1S09A 1WYUB 1JG8A 3TQXA 1BJOB 3FZ6A 2VMUA 4ZASA 2JISA 4E77A 5M4BA 1CZCA 3KE3A 1BJOA 2FN6A 2W7EA 4E3QA 1DGEA 3TCMA 1CS1A 4CXQA 2E7IA 2YKYA 1X29A 1IX8A 2W7FA 4HF8A 1DJEA 1BS0A 3ZZKA 2O0RA 1D7RA 1ASLA 4Q6RA 3BWNC 2V1PA 3FDBA 3TFTA 4K05A 4LW2A 2W7MA 1MLZA 4JF0A 1O61A 1AKBA 1Z3ZA 2ZSLA 3A9XA 1C4KA 2TPLA 1B8GA 1AIBA 1Z7DA 4OT8A 2X3LA 2X5FA 3KGXA 3WY7A 2VGVA 2C0RA 4WLJA 2D66A 1EG5A 4GEBA 3FFHA 1TOGA 2AY8A 2A1VA 4LC3A 1SZUA 3N75A 1RV3A 2VGTA 2EYQA 1TASA 2VMNA 2FQ6A 3EI9A 4UHOA 1MAQA 1GCKA 3BV0A 3GBXA 3WGBA 3PAAA 2QMAA 3MKJA 5M46A 3F9TA 3PD6B 3T32A 3MC6C 1BJWA 3P6KA 1SZKA 3PD6A 4JEVA 4MQQA 2JJGA 1MAPA 4JEWA 2CH2A 2DKJA 1N8PA 2YRIA 2R5CA 1B9IA 1DJ9A 3FZ7A 2BYJA 4ISYA 5D5SA 1AICA 2ZYJA 3I4JA 4IYOB 3JW9A 1TOKA 1V2EA 3UWCA 2ZY2A 5KTBA 4IYOA 1CL1A 1CL2A 1ORDA 1I48A 1GEXA 3LVMA 4ATPA 3E2FA 1TOJA 4KAMA 3QM2A 4ZDLA 2YCPA 1AJRA 1D2FA 1LKCA 4A0FA 4AOAA 1JS3A 3R4TA 1ARGA 4NOGA 4ITGA 2DGMA 4EMYA 2EZ1A 1KKPA 4OC9A 4OTLA 4XK1A 4KXKA 3LVLB 4Q31A 2YCTA 3VK2A 2Z9XA 2BI5A 5EIGB 1W7NA 3AENB 2CH1A 1ASMA 3E2ZA 1UU2A 3PPLA 3AENA 3B8XA 2CJGA 3BWNA 2C44A 4ZWMA 1BQDA 1M4NA 3HT4A 4A6RA 3LG0A 2VMRA 3FFRA 1PMOA 3H9XA 5M4DA 1WSTA 3BCAA 1M0NA 5HDMA 2BHXA 4AO4A 4F4EA 2QBTA 1JF9A 2VLHA 3B46A 4GE7A 1AMRA 1AHXA 1VEFA 2D61A 2OGEA 3DYDA 1N2TA 4WBTA 1ASFA 1BJ4A 4F5GA 2G6WA 3LVKA 1B9HA 2YRRA 3QHXA 1QJ3A 1WYVB 2XBNA 2HOYA 3A8UX 2W7GA 4F5HA 1WYVA 1WYTB 1QISA 2Z20A 4RM1A 3QI6A 2E54A 2AEVA 1WYTA 1CQ7A 1VJOA 3MC6A 4PFNA 2W7HA 3DR4A 2VIAA 4WYFA 4WYEA 3FVSA 1GC4A 1TOEA 2YKXA 3N7NA 1X0MA 2ZSMA 3LVJA 2AY6A 3AEPA 4WYGA 5F9SA 1AKAA 2YHKA 2ZY3A 3NUIA 3L44A 5C6UA 4XJPA 1WKGA 2GB3A 2CJDA 2BWPA 2ZJGA 2CJHA 3II0A 4IXOA 4QGRA 4RAEA 4WP0A 5EQCA 4WYDA 3WLXA 2QSRA 3CQ5A 3DXVA 1TATA 4B9BA 2RFVA 1C7NA 2BWOA 2ORDA 3NRAA 1LS3A 2BWNA 3VK3A 2DGKA 2HUUA 1ARIA 5JAYA 3EI8A 4GE4A 1ELQA 2FNUA 1YIZA 2D5YA 3A9ZA 3CAIA 3GSBA 4RITA 4AZKA 4R5FA 5FT5A 5EAAA 3QPGA 1TOIA 1AAMA 1SF2A 1I41A 4IW7A 1KL1A 1MGVA 2YCNA 3FD0A 3IF2A 3PDBB 2OKJA 1BJNA 1WYUA 1ASCA 7AATA 5G4JA 4UOYA 4UHNA 3ZRPA 2VMOA 3PDBA 2Z61A 1RV4A 4MKJA 1AMSA 2HZPA 1M32A 1S08A 3W1JA 4ZM4A 2BIGA 2QB2A 3JTXA 5IWQA 2AY3A 1S07A 4KYOA 2VMSA 2VMXA 2BIAA 2EO5A 3E2YA 4MQRA 4DQ6A 4OMAA 2PB0A 3ZRQA 3TFUA 1CZEA 1Y4IA 4DBCA 2WK8A 4E3RA 5FT4A 1DJUA 2CANA 2O7CA 3K40A 5J8QA 4CXRA 1CJ0A 3GZDA 1XI9A 4CBRA 3DR7A 3OKSA 2D7ZA 4H63Q 1KMJA 3E6GA 4AH3A 2BIEA 3HVYA 3K28A 1MDXA 2QLRA 3CQ4A 3FDDA 4W1XA 3EI7A 3FQ7A 3AOVA 2W8UA 4OBVA 3AEOA 2EGYA 3RBFA 4ZM3A 1YAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CST A;  3HBX A;  1G7X A;  2OKK A;  2VMQ A;  3K7Y A;  4LW4 A;  3NNK A;  3W1H A;  2EZ2 A;  5G09 A;  3RUY A;  2D65 A;  4Q75 A;  4R5Z A;  2VGW A;  1XEY A;  3BN1 A;  1AIA A;  4WYC A;  2VMY A;  4XJL A;  5G0A A;  5BJ3 A;  3KKI A;  4F5J A;  1B5P A;  4WXG A;  1IAX A;  4XEW A;  2Z9V A;  3RBL A;  2DOU A;  3WX9 A;  4DGT A;  3QGU A;  1PFF A;  3FTB A;  3EI6 A;  4FL0 A;  4TMR A;  2HUF A;  1ZOD A;  3MAF B;  4H51 A;  3F0H A;  1AX4 A;  4W5K A;  1ASD A;  3MAF A;  5EUD A;  2W8J A;  3NU7 A;  2X8U A;  5M49 A;  3WKS A;  4ZAH A;  4IX8 A;  2D7Y A;  2Z67 A;  2CY8 A;  3GWP A;  2HUI A;  4ATQ A;  1ECX A;  1W3U A;  1M6S A;  2AY1 A;  2XH1 A;  1OHY A;  2WK7 A;  3JWB A;  2CIN A;  3NDN A;  3DRD A;  3BB8 A;  4EB5 A;  4WB0 B;  3WZF A;  1C7G A;  5F8V A;  3Q8N A;  4TV7 A;  5TF5 A;  2W7J A;  5EIG A;  4WB0 A;  1ASG A;  1EJI A;  4TN4 A;  1TAR A;  1IAY A;  1S06 A;  3JWA A;  2W7L A;  2Q7W A;  3NYU A;  5G2Q A;  1UU1 A;  5G2P A;  1OXO A;  1H1C A;  1AMA A;  3ZZJ A;  3PIU A;  2YKU A;  1E5F A;  2VMT A;  2Z9U A;  1OHV A;  4CVQ A;  1DKA A;  3F6T A;  2AY7 A;  4ZSY A;  1AHG A;  4IXZ A;  1LC7 A;  4JE5 A;  2AY2 A;  1UKJ A;  1W23 A;  3B1C A;  3H7F A;  2AAT A;  2AEU A;  4ADD A;  4OCA A;  4RKD A;  2F8J A;  4MQP A;  2BI3 A;  3UAK A;  3ISL A;  4PIW A;  2Z1Y A;  3DU4 A;  5LHA A;  1SVV A;  1WKH A;  3HMU A;  4MKK A;  5K8B A;  1QGN A;  3COG A;  4ADC A;  3I16 A;  3FCR A;  3QBO A;  3JU7 A;  1KKJ A;  3P1T A;  4IXS A;  3USF A;  5E4Z A;  3NU8 A;  4L0O A;  3FQA A;  4RJY A;  4F5I A;  2JGT A;  2VMZ A;  2ZUK A;  4ZDO A;  3AEJ C;  4ZDP A;  3HQT A;  2D63 A;  2Z9W A;  3DC1 A;  3B1D A;  4K2M A;  2JJE A;  3NTJ A;  1AHE A;  4JEZ A;  3VP6 A;  3DOD A;  4A00 A;  2VMV A;  1AY5 A;  3D6K A;  3G8M A;  1I29 A;  2X5D A;  3MAD A;  3AEM C;  4N0B A;  1ARH A;  3VAX A;  3G7Q A;  3N0L A;  4XJM A;  1AAW A;  4E1O A;  1B5O A;  4Q76 A;  2EPJ A;  2VGZ A;  4WYA A;  2PB2 A;  4ZLV A;  5BJ4 A;  4IY7 A;  1GC3 A;  4GRX A;  1OHW A;  1ASA A;  4JEX A;  4Y0I A;  4GDY A;  3WGC A;  3BWO A;  1W7M A;  1AHY A;  4I8A A;  4JE5 D;  1YOO A;  2YOB A;  5HXX A;  4JEY A;  4B98 A;  3GZC A;  1BKG A;  1IBJ A;  2HP1 A;  3FZ8 A;  3MEB A;  1D7U A;  1VP4 A;  4RLG A;  4LNL A;  3VOM A;  4BA4 A;  3DXW A;  2OGA A;  5LH9 A;  1CQ8 A;  2VI9 A;  4ZWV A;  1CQ6 A;  1FG7 A;  1GBN A;  4W8I A;  1O69 A;  1LC8 A;  4MSO A;  4F5F A;  4UQV A;  1FG3 A;  3ASA A;  2W7D A;  1DFO A;  1X2A A;  1OXP A;  1FC4 A;  2AY9 A;  2AY5 A;  3RCH B;  1AHF A;  3E77 A;  3ELE A;  4ADB A;  3RCH A;  5E3K A;  5EUN A;  4JF1 A;  4P7Y A;  4MY5 A;  4WXF A;  2YKV A;  3EI5 A;  2VGS A;  4ITX A;  1ASN A;  4J5U A;  1G4X A;  3JZL A;  3WKR A;  2ZY4 A;  1LK9 A;  5EAV A;  3AV7 A;  1U08 A;  5DX5 A;  3AEJ A;  5DJ9 A;  4O6Z A;  2HP2 A;  5DB5 A;  1M0Q A;  4Y0H A;  1ELU A;  3WCN A;  1BQA A;  1RVU A;  3NX3 A;  2R0T A;  4OBU A;  4M2K A;  4R8D A;  1O4S A;  4W91 A;  2JG2 A;  3RQ1 A;  3EIB A;  3AEM A;  1IUG A;  1IX6 A;  3ATH A;  3GJU A;  1TPL A;  5AX8 A;  1J04 A;  1AMQ A;  1M7Y A;  5G4I A;  2BI9 A;  1B4X A;  3AAT A;  3UE8 A;  4PVF A;  1LW4 A;  1D7S A;  1C9C A;  3PDX A;  1D7V A;  2BI2 A;  3ACZ A;  4R2N A;  4Y0D A;  3L8A A;  2HOX A;  2ZC0 A;  2E7U A;  4A0R A;  3M5U A;  3VK4 A;  1GEW A;  1LC5 A;  1QJ5 A;  2BKW A;  2DGL A;  2OQX A;  3HDO A;  4M2J A;  3E9K A;  1RVY A;  4BMK A;  4LNM A;  3A9Y A;  3NUB A;  4OYT A;  1DGD A;  2VIB A;  2HOZ A;  4XQ2 A;  2W8V A;  5E5I A;  1BT4 A;  2WKA A;  4HVK A;  1AKC A;  4UHM A;  3OP7 A;  4CBS A;  2CTZ A;  5DJ1 A;  4W1V A;  1V2F A;  1ASB A;  2W8W A;  1SZS A;  2FYF A;  2R5C B;  2WK9 A;  4ADE A;  4A0H A;  8AAT A;  1P3W A;  2QB3 A;  2QA3 A;  1I43 A;  3IHJ A;  4XAU A;  4XJO A;  1QIR A;  2AY4 A;  2C7T A;  3CBF A;  3LY1 A;  2ZP7 A;  3FQ8 A;  2C81 A;  3AEL A;  4N0W A;  3PJ0 A;  4W1W A;  1BW0 A;  2Z1Z A;  5FT6 A;  2OAT A;  1ASE A;  2FNI A;  2R2N A;  2GMU A;  3RI6 A;  4WD2 A;  4K2B A;  3N5M A;  2E7J A;  3MBB A;  4J8L A;  3LV2 A;  1J32 A;  1MDZ A;  3AOW A;  4RIZ A;  2GQN A;  5D95 A;  3H14 A;  2GMS A;  5FT8 A;  3ZRR A;  4BQ0 A;  4K2I A;  2JJF A;  3EZ1 A;  4WLH A;  1EQB A;  1ZOB A;  3GR9 A;  3EUC A;  4PFF A;  5HHY A;  3FKD A;  3FVX A;  1OAT A;  3E2Z B;  2EH6 A;  3A2B A;  4BHD A;  4MGR A;  3BCB A;  1H0C A;  3ASB A;  2BI1 A;  5I92 A;  1KL2 A;  1N31 A;  1YNU A;  2DR1 A;  3R9A A;  1IJI A;  3G0T A;  1G7W A;  1MDO A;  3ELP A;  4BA5 A;  3HLM A;  3LWS A;  4U2H A;  4ZSW A;  1O62 A;  4AZJ A;  4RKC A;  3B1E A;  4U1T A;  4A0G A;  2CB1 A;  2W7I A;  5EFS A;  1GC2 A;  3HL2 A;  4F5L A;  1YJY A;  4P3M A;  3ECD A;  3FVU A;  4LNJ A;  1C7O A;  1UU0 A;  3KGW A;  9AAT A;  5EUE A;  3W1I A;  1QZ9 A;  3DZZ A;  3I5T A;  1MLY A;  2BYL A;  1IVR A;  1DTY A;  1M0P A;  1GDE A;  3PGY A;  3BC8 A;  3NYT A;  1V2D A;  3BCX A;  3FRK A;  4GE9 A;  1ART A;  2R5E A;  2ZY5 A;  1AJS B;  1V72 A;  1PG8 A;  1ZC9 A;  2PO3 A;  4FFC A;  4A72 A;  1AJS A;  4A6T A;  3QN6 A;  3EZS A;  1AY4 A;  1W7L A;  1ARS A;  1QIT A;  2HOR A;  3WCO A;  4EFF A;  1SPA A;  4WXB A;  2VYC A;  2VGU A;  3GZD C;  3PA9 A;  4F5K A;  1GC0 A;  2VMW A;  4F5M A;  1GD9 A;  2JJH A;  2D64 A;  2W7K A;  1T3I A;  1S0A A;  1G4V A;  1IX7 A;  2O1B A;  4A6U A;  1X28 A;  3EIA A;  3NYS A;  1PMM A;  1JS6 A;  3MAU A;  1C0N A;  1M0O A;  3TAT A;  3CQ6 A;  1GEY A;  4RJ0 A;  1KMK A;  2DKB A;  4AO9 A;  4EB7 A;  1SFF A;  2CFB A;  1YJZ A;  4GSA A;  4M2M A;  2GSA A;  1AY8 A;  2VMP A;  4EU1 A;  2VLF A;  1YJS A;  3GET A;  2NMP A;  1YIY A;  3FSL A;  1E5E A;  2VI8 A;  1LW5 A;  3BS8 A;  2FM1 A;  2V0Y A;  2W8T A;  1S09 A;  1WYU B;  1JG8 A;  3TQX A;  1BJO B;  3FZ6 A;  2VMU A;  4ZAS A;  2JIS A;  4E77 A;  5M4B A;  1CZC A;  3KE3 A;  1BJO A;  2FN6 A;  2W7E A;  4E3Q A;  1DGE A;  3TCM A;  1CS1 A;  4CXQ A;  2E7I A;  2YKY A;  1X29 A;  1IX8 A;  2W7F A;  4HF8 A;  1DJE A;  1BS0 A;  3ZZK A;  2O0R A;  1D7R A;  1ASL A;  4Q6R A;  3BWN C;  2V1P A;  3FDB A;  3TFT A;  4LW2 A;  2W7M A;  1MLZ A;  4JF0 A;  1O61 A;  1AKB A;  1Z3Z A;  2ZSL A;  3A9X A;  1C4K A;  2TPL A;  1B8G A;  1AIB A;  1Z7D A;  4OT8 A;  2X3L A;  2X5F A;  3KGX A;  3WY7 A;  2VGV A;  2C0R A;  4WLJ A;  2D66 A;  1EG5 A;  4GEB A;  3FFH A;  1TOG A;  2AY8 A;  4LC3 A;  1SZU A;  3N75 A;  1RV3 A;  2VGT A;  1TAS A;  2VMN A;  2FQ6 A;  3EI9 A;  4UHO A;  1MAQ A;  1GCK A;  3BV0 A;  3GBX A;  3WGB A;  3PAA A;  2QMA A;  3MKJ A;  5M46 A;  3F9T A;  3PD6 B;  3T32 A;  3MC6 C;  1BJW A;  3P6K A;  1SZK A;  3PD6 A;  4JEV A;  4MQQ A;  2JJG A;  1MAP A;  4JEW A;  2CH2 A;  2DKJ A;  1N8P A;  2YRI A;  2R5C A;  1B9I A;  1DJ9 A;  3FZ7 A;  2BYJ A;  4ISY A;  5D5S A;  1AIC A;  2ZYJ A;  3I4J A;  4IYO B;  3JW9 A;  1TOK A;  1V2E A;  3UWC A;  2ZY2 A;  4IYO A;  1CL1 A;  1CL2 A;  1ORD A;  1I48 A;  1GEX A;  3LVM A;  4ATP A;  3E2F A;  1TOJ A;  4KAM A;  3QM2 A;  4ZDL A;  2YCP A;  1AJR A;  1D2F A;  1LKC A;  4A0F A;  4AOA A;  1JS3 A;  3R4T A;  1ARG A;  4NOG A;  4ITG A;  2DGM A;  4EMY A;  2EZ1 A;  1KKP A;  4OC9 A;  4OTL A;  4XK1 A;  4KXK A;  3LVL B;  4Q31 A;  2YCT A;  3VK2 A;  2Z9X A;  2BI5 A;  5EIG B;  1W7N A;  3AEN B;  2CH1 A;  1ASM A;  3E2Z A;  1UU2 A;  3PPL A;  3AEN A;  3B8X A;  2CJG A;  3BWN A;  2C44 A;  4ZWM A;  1BQD A;  1M4N A;  3HT4 A;  4A6R A;  3LG0 A;  2VMR A;  3FFR A;  1PMO A;  5M4D A;  1WST A;  3BCA A;  1M0N A;  5HDM A;  2BHX A;  4AO4 A;  4F4E A;  2QBT A;  1JF9 A;  2VLH A;  3B46 A;  4GE7 A;  1AMR A;  1AHX A;  1VEF A;  2D61 A;  2OGE A;  3DYD A;  1N2T A;  4WBT A;  1ASF A;  1BJ4 A;  4F5G A;  2G6W A;  3LVK A;  1B9H A;  2YRR A;  3QHX A;  1QJ3 A;  1WYV B;  2XBN A;  2HOY A;  3A8U X;  2W7G A;  4F5H A;  1WYV A;  1WYT B;  1QIS A;  2Z20 A;  4RM1 A;  3QI6 A;  2E54 A;  2AEV A;  1WYT A;  1CQ7 A;  1VJO A;  3MC6 A;  4PFN A;  2W7H A;  3DR4 A;  2VIA A;  4WYF A;  4WYE A;  3FVS A;  1GC4 A;  1TOE A;  2YKX A;  1X0M A;  2ZSM A;  3LVJ A;  2AY6 A;  3AEP A;  4WYG A;  5F9S A;  1AKA A;  2YHK A;  2ZY3 A;  3NUI A;  3L44 A;  5C6U A;  4XJP A;  1WKG A;  2GB3 A;  2CJD A;  2BWP A;  2ZJG A;  2CJH A;  3II0 A;  4IXO A;  4QGR A;  4RAE A;  4WP0 A;  5EQC A;  4WYD A;  3WLX A;  3CQ5 A;  3DXV A;  1TAT A;  4B9B A;  2RFV A;  1C7N A;  2BWO A;  2ORD A;  3NRA A;  1LS3 A;  2BWN A;  3VK3 A;  2DGK A;  2HUU A;  1ARI A;  5JAY A;  3EI8 A;  4GE4 A;  1ELQ A;  2FNU A;  1YIZ A;  2D5Y A;  3A9Z A;  3CAI A;  3GSB A;  4RIT A;  4AZK A;  4R5F A;  5FT5 A;  5EAA A;  3QPG A;  1TOI A;  1AAM A;  1SF2 A;  1I41 A;  4IW7 A;  1KL1 A;  1MGV A;  2YCN A;  3FD0 A;  3IF2 A;  3PDB B;  2OKJ A;  1BJN A;  1WYU A;  1ASC A;  7AAT A;  5G4J A;  4UOY A;  4UHN A;  3ZRP A;  2VMO A;  3PDB A;  2Z61 A;  1RV4 A;  4MKJ A;  1AMS A;  2HZP A;  1M32 A;  1S08 A;  3W1J A;  4ZM4 A;  2BIG A;  2QB2 A;  3JTX A;  5IWQ A;  2AY3 A;  1S07 A;  4KYO A;  2VMS A;  2VMX A;  2BIA A;  2EO5 A;  3E2Y A;  4MQR A;  4DQ6 A;  4OMA A;  2PB0 A;  3ZRQ A;  3TFU A;  1CZE A;  1Y4I A;  4DBC A;  2WK8 A;  4E3R A;  5FT4 A;  1DJU A;  2CAN A;  2O7C A;  3K40 A;  5J8Q A;  4CXR A;  1CJ0 A;  3GZD A;  1XI9 A;  4CBR A;  3DR7 A;  3OKS A;  2D7Z A;  1KMJ A;  3E6G A;  4AH3 A;  2BIE A;  3HVY A;  3K28 A;  1MDX A;  2QLR A;  3CQ4 A;  3FDD A;  4W1X A;  3EI7 A;  3FQ7 A;  3AOV A;  2W8U A;  4OBV A;  3AEO A;  2EGY A;  3RBF A;  4ZM3 A;  1YAA A; 
#chains in the Genus database with same CATH topology
 2CST A;  3HBX A;  1G7X A;  2OKK A;  2VMQ A;  3K7Y A;  4LW4 A;  3NNK A;  3W1H A;  2EZ2 A;  5G09 A;  3RUY A;  2D65 A;  4Q75 A;  4R5Z A;  2VGW A;  1XEY A;  3BN1 A;  1AIA A;  4WYC A;  2VMY A;  4XJL A;  5G0A A;  5BJ3 A;  3KKI A;  4F5J A;  1B5P A;  4WXG A;  1IAX A;  4XEW A;  2Z9V A;  3RBL A;  2DOU A;  3WX9 A;  4DGT A;  3QGU A;  1PFF A;  3FTB A;  3EI6 A;  4FL0 A;  4TMR A;  2HUF A;  1ZOD A;  3MAF B;  4H51 A;  3F0H A;  1AX4 A;  4W5K A;  1ASD A;  3MAF A;  5EUD A;  2W8J A;  3NU7 A;  2X8U A;  5M49 A;  3WKS A;  4ZAH A;  4IX8 A;  2D7Y A;  2Z67 A;  2CY8 A;  3GWP A;  2HUI A;  4ATQ A;  1ECX A;  1W3U A;  1M6S A;  2AY1 A;  2XH1 A;  1OHY A;  2WK7 A;  3JWB A;  2CIN A;  3NDN A;  3DRD A;  3BB8 A;  4EB5 A;  4WB0 B;  3WZF A;  1C7G A;  5F8V A;  3Q8N A;  4TV7 A;  5TF5 A;  2W7J A;  5EIG A;  4WB0 A;  1ASG A;  1EJI A;  4TN4 A;  1TAR A;  1IAY A;  1S06 A;  3JWA A;  2W7L A;  2Q7W A;  3NYU A;  2G7J A;  5G2Q A;  1UU1 A;  5G2P A;  1OXO A;  1H1C A;  1AMA A;  3ZZJ A;  3PIU A;  2YKU A;  1E5F A;  2VMT A;  2Z9U A;  1OHV A;  4CVQ A;  1DKA A;  3F6T A;  2AY7 A;  4ZSY A;  1AHG A;  4IXZ A;  1LC7 A;  4JE5 A;  2AY2 A;  1UKJ A;  1W23 A;  3B1C A;  3H7F A;  2AAT A;  2AEU A;  4ADD A;  4OCA A;  4RKD A;  2F8J A;  4MQP A;  2BI3 A;  3UAK A;  3ISL A;  4PIW A;  2Z1Y A;  3DU4 A;  5LHA A;  1SVV A;  1WKH A;  3HMU A;  4MKK A;  5K8B A;  1QGN A;  3COG A;  4ADC A;  3I16 A;  3FCR A;  3QBO A;  3JU7 A;  1KKJ A;  3P1T A;  4IXS A;  3USF A;  5E4Z A;  3NU8 A;  4L0O A;  3FQA A;  4RJY A;  4F5I A;  2JGT A;  2VMZ A;  2ZUK A;  4ZDO A;  3AEJ C;  4ZDP A;  3HQT A;  2D63 A;  2Z9W A;  3DC1 A;  3B1D A;  4K2M A;  2JJE A;  3NTJ A;  1AHE A;  4JEZ A;  3VP6 A;  3DOD A;  4A00 A;  2VMV A;  1AY5 A;  3D6K A;  3G8M A;  1I29 A;  2X5D A;  3MAD A;  3AEM C;  4N0B A;  1ARH A;  3VAX A;  3N4R A;  3G7Q A;  3N0L A;  4XJM A;  1AAW A;  4E1O A;  1B5O A;  4Q76 A;  2EPJ A;  2VGZ A;  4WYA A;  2PB2 A;  4ZLV A;  5BJ4 A;  4IY7 A;  1GC3 A;  4GRX A;  1OHW A;  1ASA A;  4JEX A;  4Y0I A;  4GDY A;  3WGC A;  3BWO A;  1W7M A;  1AHY A;  4I8A A;  4JE5 D;  1YOO A;  2YOB A;  5HXX A;  4JEY A;  4B98 A;  3GZC A;  1BKG A;  1IBJ A;  2HP1 A;  3FZ8 A;  3MEB A;  1D7U A;  1VP4 A;  4RLG A;  4LNL A;  3VOM A;  4BA4 A;  3DXW A;  2OGA A;  5LH9 A;  1CQ8 A;  2VI9 A;  4ZWV A;  1CQ6 A;  1FG7 A;  1GBN A;  4W8I A;  1O69 A;  1LC8 A;  4MSO A;  4F5F A;  4UQV A;  1FG3 A;  3ASA A;  2W7D A;  1DFO A;  1X2A A;  1OXP A;  1FC4 A;  2AY9 A;  2AY5 A;  3RCH B;  1AHF A;  3E77 A;  3ELE A;  4ADB A;  3RCH A;  5E3K A;  5EUN A;  4JF1 A;  4P7Y A;  4MY5 A;  4WXF A;  2YKV A;  3EI5 A;  2VGS A;  4ITX A;  1ASN A;  4J5U A;  1G4X A;  3JZL A;  3WKR A;  2ZY4 A;  1LK9 A;  5EAV A;  3AV7 A;  1U08 A;  5DX5 A;  3AEJ A;  5DJ9 A;  2KFP A;  4O6Z A;  2HP2 A;  5DB5 A;  1M0Q A;  4Y0H A;  1ELU A;  3WCN A;  1BQA A;  1RVU A;  3NX3 A;  2R0T A;  4OBU A;  4M2K A;  4R8D A;  1O4S A;  4W91 A;  2JG2 A;  3RQ1 A;  3EIB A;  3AEM A;  3N4X A;  1IUG A;  1IX6 A;  3ATH A;  3GJU A;  1TPL A;  5AX8 A;  1J04 A;  1AMQ A;  1M7Y A;  5G4I A;  2BI9 A;  1B4X A;  3AAT A;  3UE8 A;  4PVF A;  1LW4 A;  1D7S A;  1C9C A;  3PDX A;  1D7V A;  2BI2 A;  3ACZ A;  4R2N A;  4Y0D A;  3L8A A;  2HOX A;  2ZC0 A;  2E7U A;  4A0R A;  3M5U A;  3VK4 A;  1GEW A;  1LC5 A;  1QJ5 A;  2BKW A;  2DGL A;  2OQX A;  3HDO A;  4M2J A;  3E9K A;  1RVY A;  4BMK A;  4LNM A;  3A9Y A;  3NUB A;  4OYT A;  1DGD A;  2VIB A;  2HOZ A;  4XQ2 A;  2W8V A;  5E5I A;  1BT4 A;  2WKA A;  4HVK A;  1AKC A;  4UHM A;  3OP7 A;  4CBS A;  2CTZ A;  5DJ1 A;  4W1V A;  1V2F A;  1ASB A;  2W8W A;  1SZS A;  2FYF A;  2R5C B;  2WK9 A;  4ADE A;  4A0H A;  8AAT A;  1P3W A;  2QB3 A;  2QA3 A;  1I43 A;  3IHJ A;  4XAU A;  4XJO A;  1QIR A;  2AY4 A;  2C7T A;  3CBF A;  3LY1 A;  2ZP7 A;  3FQ8 A;  2C81 A;  3AEL A;  4N0W A;  3PJ0 A;  4W1W A;  1BW0 A;  2Z1Z A;  5FT6 A;  2OAT A;  1ASE A;  2FNI A;  2R2N A;  2GMU A;  3RI6 A;  4WD2 A;  4K2B A;  3N5M A;  2E7J A;  3MBB A;  4J8L A;  3LV2 A;  1J32 A;  1MDZ A;  3AOW A;  4RIZ A;  2GQN A;  5D95 A;  3H14 A;  2GMS A;  5FT8 A;  3ZRR A;  4BQ0 A;  4K2I A;  2JJF A;  3EZ1 A;  4WLH A;  1EQB A;  1ZOB A;  3GR9 A;  3EUC A;  4PFF A;  5HHY A;  3FKD A;  3N4S A;  3FVX A;  1OAT A;  3E2Z B;  2EH6 A;  3A2B A;  4BHD A;  4MGR A;  3BCB A;  1H0C A;  3ASB A;  2BI1 A;  5I92 A;  1KL2 A;  1N31 A;  1YNU A;  2DR1 A;  3R9A A;  1IJI A;  3G0T A;  1G7W A;  1MDO A;  3ELP A;  4BA5 A;  3HLM A;  3LWS A;  4U2H A;  4ZSW A;  1O62 A;  4AZJ A;  4RKC A;  3B1E A;  4U1T A;  4A0G A;  2CB1 A;  2W7I A;  5EFS A;  1GC2 A;  3HL2 A;  4F5L A;  1YJY A;  4P3M A;  3ECD A;  3FVU A;  4LNJ A;  1C7O A;  1UU0 A;  3KGW A;  9AAT A;  5EUE A;  3W1I A;  1QZ9 A;  3DZZ A;  3I5T A;  1MLY A;  2WB6 A;  2BYL A;  1IVR A;  1DTY A;  1M0P A;  1GDE A;  3PGY A;  3BC8 A;  3NYT A;  1V2D A;  3BCX A;  3FRK A;  4GE9 A;  1ART A;  2R5E A;  2ZY5 A;  1AJS B;  1V72 A;  1PG8 A;  1ZC9 A;  2PO3 A;  4FFC A;  4A72 A;  1AJS A;  4A6T A;  3QN6 A;  3EZS A;  1AY4 A;  1W7L A;  1ARS A;  1QIT A;  2HOR A;  3WCO A;  4EFF A;  1SPA A;  4WXB A;  2VYC A;  2VGU A;  3GZD C;  3PA9 A;  4F5K A;  1GC0 A;  2VMW A;  4F5M A;  1GD9 A;  2JJH A;  2D64 A;  2W7K A;  1T3I A;  1S0A A;  1G4V A;  1IX7 A;  2O1B A;  4A6U A;  1X28 A;  3EIA A;  3NYS A;  1PMM A;  1JS6 A;  3MAU A;  1C0N A;  1M0O A;  3TAT A;  3CQ6 A;  1GEY A;  4RJ0 A;  1KMK A;  2DKB A;  4AO9 A;  4EB7 A;  2FKI A;  1SFF A;  2CFB A;  1YJZ A;  4GSA A;  4M2M A;  2GSA A;  1AY8 A;  2VMP A;  4EU1 A;  2VLF A;  1YJS A;  3GET A;  2NMP A;  1YIY A;  3FSL A;  1E5E A;  2VI8 A;  1LW5 A;  3BS8 A;  2FM1 A;  2V0Y A;  2W8T A;  1S09 A;  1WYU B;  1JG8 A;  3TQX A;  1BJO B;  3FZ6 A;  2VMU A;  4ZAS A;  2JIS A;  4E77 A;  5M4B A;  1CZC A;  3KE3 A;  1BJO A;  2FN6 A;  2W7E A;  4E3Q A;  1DGE A;  3TCM A;  1CS1 A;  4CXQ A;  2E7I A;  2YKY A;  1X29 A;  1IX8 A;  2W7F A;  4HF8 A;  1DJE A;  1BS0 A;  3ZZK A;  2O0R A;  1D7R A;  1ASL A;  4Q6R A;  3BWN C;  2V1P A;  3FDB A;  3TFT A;  4K05 A;  4LW2 A;  2W7M A;  1MLZ A;  4JF0 A;  1O61 A;  1AKB A;  1Z3Z A;  2ZSL A;  3A9X A;  1C4K A;  2TPL A;  1B8G A;  1AIB A;  1Z7D A;  4OT8 A;  2X3L A;  2X5F A;  3KGX A;  3WY7 A;  2VGV A;  2C0R A;  4WLJ A;  2D66 A;  1EG5 A;  4GEB A;  3FFH A;  1TOG A;  2AY8 A;  2A1V A;  4LC3 A;  1SZU A;  3N75 A;  1RV3 A;  2VGT A;  2EYQ A;  1TAS A;  2VMN A;  1KAF A;  2FQ6 A;  3EI9 A;  4UHO A;  1MAQ A;  1GCK A;  3BV0 A;  3GBX A;  3WGB A;  3PAA A;  2QMA A;  3MKJ A;  5M46 A;  3F9T A;  3PD6 B;  3T32 A;  3MC6 C;  1BJW A;  3P6K A;  1SZK A;  3PD6 A;  4JEV A;  4MQQ A;  2JJG A;  1MAP A;  4JEW A;  2CH2 A;  2DKJ A;  1N8P A;  2YRI A;  2R5C A;  1B9I A;  1DJ9 A;  3FZ7 A;  2BYJ A;  4ISY A;  5D5S A;  1AIC A;  2ZYJ A;  3I4J A;  4IYO B;  3JW9 A;  1TOK A;  1V2E A;  3UWC A;  2ZY2 A;  5KTB A;  4IYO A;  1CL1 A;  1CL2 A;  1ORD A;  1I48 A;  1GEX A;  3LVM A;  4ATP A;  3E2F A;  1TOJ A;  4KAM A;  3QM2 A;  4ZDL A;  2YCP A;  1AJR A;  1D2F A;  1LKC A;  4A0F A;  4AOA A;  1JS3 A;  3R4T A;  1ARG A;  4NOG A;  4ITG A;  2DGM A;  4EMY A;  2EZ1 A;  1KKP A;  4OC9 A;  4OTL A;  4XK1 A;  4KXK A;  3LVL B;  4Q31 A;  2YCT A;  3VK2 A;  2Z9X A;  2BI5 A;  5EIG B;  1W7N A;  3AEN B;  2CH1 A;  1ASM A;  3E2Z A;  1UU2 A;  3PPL A;  3AEN A;  3B8X A;  2CJG A;  3BWN A;  2C44 A;  4ZWM A;  1BQD A;  1M4N A;  3HT4 A;  4A6R A;  3LG0 A;  2VMR A;  3FFR A;  1PMO A;  3H9X A;  5M4D A;  1WST A;  3BCA A;  1M0N A;  5HDM A;  2BHX A;  4AO4 A;  4F4E A;  2QBT A;  1JF9 A;  2VLH A;  3B46 A;  4GE7 A;  1AMR A;  1AHX A;  1VEF A;  2D61 A;  2OGE A;  3DYD A;  1N2T A;  4WBT A;  1ASF A;  1BJ4 A;  4F5G A;  2G6W A;  3LVK A;  1B9H A;  2YRR A;  3QHX A;  1QJ3 A;  1WYV B;  2XBN A;  2HOY A;  3A8U X;  2W7G A;  4F5H A;  1WYV A;  1WYT B;  1QIS A;  2Z20 A;  4RM1 A;  3QI6 A;  2E54 A;  2AEV A;  1WYT A;  1CQ7 A;  1VJO A;  3MC6 A;  4PFN A;  2W7H A;  3DR4 A;  2VIA A;  4WYF A;  4WYE A;  3FVS A;  1GC4 A;  1TOE A;  2YKX A;  3N7N A;  1X0M A;  2ZSM A;  3LVJ A;  2AY6 A;  3AEP A;  4WYG A;  5F9S A;  1AKA A;  2YHK A;  2ZY3 A;  3NUI A;  3L44 A;  5C6U A;  4XJP A;  1WKG A;  2GB3 A;  2CJD A;  2BWP A;  2ZJG A;  2CJH A;  3II0 A;  4IXO A;  4QGR A;  4RAE A;  4WP0 A;  5EQC A;  4WYD A;  3WLX A;  2QSR A;  3CQ5 A;  3DXV A;  1TAT A;  4B9B A;  2RFV A;  1C7N A;  2BWO A;  2ORD A;  3NRA A;  1LS3 A;  2BWN A;  3VK3 A;  2DGK A;  2HUU A;  1ARI A;  5JAY A;  3EI8 A;  4GE4 A;  1ELQ A;  2FNU A;  1YIZ A;  2D5Y A;  3A9Z A;  3CAI A;  3GSB A;  4RIT A;  4AZK A;  4R5F A;  5FT5 A;  5EAA A;  3QPG A;  1TOI A;  1AAM A;  1SF2 A;  1I41 A;  4IW7 A;  1KL1 A;  1MGV A;  2YCN A;  3FD0 A;  3IF2 A;  3PDB B;  2OKJ A;  1BJN A;  1WYU A;  1ASC A;  7AAT A;  5G4J A;  4UOY A;  4UHN A;  3ZRP A;  2VMO A;  3PDB A;  2Z61 A;  1RV4 A;  4MKJ A;  1AMS A;  2HZP A;  1M32 A;  1S08 A;  3W1J A;  4ZM4 A;  2BIG A;  2QB2 A;  3JTX A;  5IWQ A;  2AY3 A;  1S07 A;  4KYO A;  2VMS A;  2VMX A;  2BIA A;  2EO5 A;  3E2Y A;  4MQR A;  4DQ6 A;  4OMA A;  2PB0 A;  3ZRQ A;  3TFU A;  1CZE A;  1Y4I A;  4DBC A;  2WK8 A;  4E3R A;  5FT4 A;  1DJU A;  2CAN A;  2O7C A;  3K40 A;  5J8Q A;  4CXR A;  1CJ0 A;  3GZD A;  1XI9 A;  4CBR A;  3DR7 A;  3OKS A;  2D7Z A;  4H63 Q;  1KMJ A;  3E6G A;  4AH3 A;  2BIE A;  3HVY A;  3K28 A;  1MDX A;  2QLR A;  3CQ4 A;  3FDD A;  4W1X A;  3EI7 A;  3FQ7 A;  3AOV A;  2W8U A;  4OBV A;  3AEO A;  2EGY A;  3RBF A;  4ZM3 A;  1YAA A; 
#chains in the Genus database with same CATH homology
 2CST A;  3HBX A;  1G7X A;  2OKK A;  2VMQ A;  3K7Y A;  4LW4 A;  3NNK A;  3W1H A;  2EZ2 A;  5G09 A;  3RUY A;  2D65 A;  4Q75 A;  4R5Z A;  2VGW A;  1XEY A;  3BN1 A;  1AIA A;  4WYC A;  2VMY A;  4XJL A;  5G0A A;  5BJ3 A;  3KKI A;  4F5J A;  1B5P A;  4WXG A;  1IAX A;  4XEW A;  2Z9V A;  3RBL A;  2DOU A;  3WX9 A;  4DGT A;  3QGU A;  1PFF A;  3FTB A;  3EI6 A;  4FL0 A;  4TMR A;  2HUF A;  1ZOD A;  3MAF B;  4H51 A;  3F0H A;  1AX4 A;  4W5K A;  1ASD A;  3MAF A;  5EUD A;  2W8J A;  3NU7 A;  2X8U A;  5M49 A;  3WKS A;  4ZAH A;  4IX8 A;  2D7Y A;  2Z67 A;  2CY8 A;  3GWP A;  2HUI A;  4ATQ A;  1ECX A;  1W3U A;  1M6S A;  2AY1 A;  2XH1 A;  1OHY A;  2WK7 A;  3JWB A;  2CIN A;  3NDN A;  3DRD A;  3BB8 A;  4EB5 A;  4WB0 B;  3WZF A;  1C7G A;  5F8V A;  3Q8N A;  4TV7 A;  5TF5 A;  2W7J A;  5EIG A;  4WB0 A;  1ASG A;  1EJI A;  4TN4 A;  1TAR A;  1IAY A;  1S06 A;  3JWA A;  2W7L A;  2Q7W A;  3NYU A;  2G7J A;  5G2Q A;  1UU1 A;  5G2P A;  1OXO A;  1H1C A;  1AMA A;  3ZZJ A;  3PIU A;  2YKU A;  1E5F A;  2VMT A;  2Z9U A;  1OHV A;  4CVQ A;  1DKA A;  3F6T A;  2AY7 A;  4ZSY A;  1AHG A;  4IXZ A;  1LC7 A;  4JE5 A;  2AY2 A;  1UKJ A;  1W23 A;  3B1C A;  3H7F A;  2AAT A;  2AEU A;  4ADD A;  4OCA A;  4RKD A;  2F8J A;  4MQP A;  2BI3 A;  3UAK A;  3ISL A;  4PIW A;  2Z1Y A;  3DU4 A;  5LHA A;  1SVV A;  1WKH A;  3HMU A;  4MKK A;  5K8B A;  1QGN A;  3COG A;  4ADC A;  3I16 A;  3FCR A;  3QBO A;  3JU7 A;  1KKJ A;  3P1T A;  4IXS A;  3USF A;  5E4Z A;  3NU8 A;  4L0O A;  3FQA A;  4RJY A;  4F5I A;  2JGT A;  2VMZ A;  2ZUK A;  4ZDO A;  3AEJ C;  4ZDP A;  3HQT A;  2D63 A;  2Z9W A;  3DC1 A;  3B1D A;  4K2M A;  2JJE A;  3NTJ A;  1AHE A;  4JEZ A;  3VP6 A;  3DOD A;  4A00 A;  2VMV A;  1AY5 A;  3D6K A;  3G8M A;  1I29 A;  2X5D A;  3MAD A;  3AEM C;  4N0B A;  1ARH A;  3VAX A;  3N4R A;  3G7Q A;  3N0L A;  4XJM A;  1AAW A;  4E1O A;  1B5O A;  4Q76 A;  2EPJ A;  2VGZ A;  4WYA A;  2PB2 A;  4ZLV A;  5BJ4 A;  4IY7 A;  1GC3 A;  4GRX A;  1OHW A;  1ASA A;  4JEX A;  4Y0I A;  4GDY A;  3WGC A;  3BWO A;  1W7M A;  1AHY A;  4I8A A;  4JE5 D;  1YOO A;  2YOB A;  5HXX A;  4JEY A;  4B98 A;  3GZC A;  1BKG A;  1IBJ A;  2HP1 A;  3FZ8 A;  3MEB A;  1D7U A;  1VP4 A;  4RLG A;  4LNL A;  3VOM A;  4BA4 A;  3DXW A;  2OGA A;  5LH9 A;  1CQ8 A;  2VI9 A;  4ZWV A;  1CQ6 A;  1FG7 A;  1GBN A;  4W8I A;  1O69 A;  1LC8 A;  4MSO A;  4F5F A;  4UQV A;  1FG3 A;  3ASA A;  2W7D A;  1DFO A;  1X2A A;  1OXP A;  1FC4 A;  2AY9 A;  2AY5 A;  3RCH B;  1AHF A;  3E77 A;  3ELE A;  4ADB A;  3RCH A;  5E3K A;  5EUN A;  4JF1 A;  4P7Y A;  4MY5 A;  4WXF A;  2YKV A;  3EI5 A;  2VGS A;  4ITX A;  1ASN A;  4J5U A;  1G4X A;  3JZL A;  3WKR A;  2ZY4 A;  1LK9 A;  5EAV A;  3AV7 A;  1U08 A;  5DX5 A;  3AEJ A;  5DJ9 A;  2KFP A;  4O6Z A;  2HP2 A;  5DB5 A;  1M0Q A;  4Y0H A;  1ELU A;  3WCN A;  1BQA A;  1RVU A;  3NX3 A;  2R0T A;  4OBU A;  4M2K A;  4R8D A;  1O4S A;  4W91 A;  2JG2 A;  3RQ1 A;  3EIB A;  3AEM A;  3N4X A;  1IUG A;  1IX6 A;  3ATH A;  3GJU A;  1TPL A;  5AX8 A;  1J04 A;  1AMQ A;  1M7Y A;  5G4I A;  2BI9 A;  1B4X A;  3AAT A;  3UE8 A;  4PVF A;  1LW4 A;  1D7S A;  1C9C A;  3PDX A;  1D7V A;  2BI2 A;  3ACZ A;  4R2N A;  4Y0D A;  3L8A A;  2HOX A;  2ZC0 A;  2E7U A;  4A0R A;  3M5U A;  3VK4 A;  1GEW A;  1LC5 A;  1QJ5 A;  2BKW A;  2DGL A;  2OQX A;  3HDO A;  4M2J A;  3E9K A;  1RVY A;  4BMK A;  4LNM A;  3A9Y A;  3NUB A;  4OYT A;  1DGD A;  2VIB A;  2HOZ A;  4XQ2 A;  2W8V A;  5E5I A;  1BT4 A;  2WKA A;  4HVK A;  1AKC A;  4UHM A;  3OP7 A;  4CBS A;  2CTZ A;  5DJ1 A;  4W1V A;  1V2F A;  1ASB A;  2W8W A;  1SZS A;  2FYF A;  2R5C B;  2WK9 A;  4ADE A;  4A0H A;  8AAT A;  1P3W A;  2QB3 A;  2QA3 A;  1I43 A;  3IHJ A;  4XAU A;  4XJO A;  1QIR A;  2AY4 A;  2C7T A;  3CBF A;  3LY1 A;  2ZP7 A;  3FQ8 A;  2C81 A;  3AEL A;  4N0W A;  3PJ0 A;  4W1W A;  1BW0 A;  2Z1Z A;  5FT6 A;  2OAT A;  1ASE A;  2FNI A;  2R2N A;  2GMU A;  3RI6 A;  4WD2 A;  4K2B A;  3N5M A;  2E7J A;  3MBB A;  4J8L A;  3LV2 A;  1J32 A;  1MDZ A;  3AOW A;  4RIZ A;  2GQN A;  5D95 A;  3H14 A;  2GMS A;  5FT8 A;  3ZRR A;  4BQ0 A;  4K2I A;  2JJF A;  3EZ1 A;  4WLH A;  1EQB A;  1ZOB A;  3GR9 A;  3EUC A;  4PFF A;  5HHY A;  3FKD A;  3N4S A;  3FVX A;  1OAT A;  3E2Z B;  2EH6 A;  3A2B A;  4BHD A;  4MGR A;  3BCB A;  1H0C A;  3ASB A;  2BI1 A;  5I92 A;  1KL2 A;  1N31 A;  1YNU A;  2DR1 A;  3R9A A;  1IJI A;  3G0T A;  1G7W A;  1MDO A;  3ELP A;  4BA5 A;  3HLM A;  3LWS A;  4U2H A;  4ZSW A;  1O62 A;  4AZJ A;  4RKC A;  3B1E A;  4U1T A;  4A0G A;  2CB1 A;  2W7I A;  5EFS A;  1GC2 A;  3HL2 A;  4F5L A;  1YJY A;  4P3M A;  3ECD A;  3FVU A;  4LNJ A;  1C7O A;  1UU0 A;  3KGW A;  9AAT A;  5EUE A;  3W1I A;  1QZ9 A;  3DZZ A;  3I5T A;  1MLY A;  2WB6 A;  2BYL A;  1IVR A;  1DTY A;  1M0P A;  1GDE A;  3PGY A;  3BC8 A;  3NYT A;  1V2D A;  3BCX A;  3FRK A;  4GE9 A;  1ART A;  2R5E A;  2ZY5 A;  1AJS B;  1V72 A;  1PG8 A;  1ZC9 A;  2PO3 A;  4FFC A;  4A72 A;  1AJS A;  4A6T A;  3QN6 A;  3EZS A;  1AY4 A;  1W7L A;  1ARS A;  1QIT A;  2HOR A;  3WCO A;  4EFF A;  1SPA A;  4WXB A;  2VYC A;  2VGU A;  3GZD C;  3PA9 A;  4F5K A;  1GC0 A;  2VMW A;  4F5M A;  1GD9 A;  2JJH A;  2D64 A;  2W7K A;  1T3I A;  1S0A A;  1G4V A;  1IX7 A;  2O1B A;  4A6U A;  1X28 A;  3EIA A;  3NYS A;  1PMM A;  1JS6 A;  3MAU A;  1C0N A;  1M0O A;  3TAT A;  3CQ6 A;  1GEY A;  4RJ0 A;  1KMK A;  2DKB A;  4AO9 A;  4EB7 A;  2FKI A;  1SFF A;  2CFB A;  1YJZ A;  4GSA A;  4M2M A;  2GSA A;  1AY8 A;  2VMP A;  4EU1 A;  2VLF A;  1YJS A;  3GET A;  2NMP A;  1YIY A;  3FSL A;  1E5E A;  2VI8 A;  1LW5 A;  3BS8 A;  2FM1 A;  2V0Y A;  2W8T A;  1S09 A;  1WYU B;  1JG8 A;  3TQX A;  1BJO B;  3FZ6 A;  2VMU A;  4ZAS A;  2JIS A;  4E77 A;  5M4B A;  1CZC A;  3KE3 A;  1BJO A;  2FN6 A;  2W7E A;  4E3Q A;  1DGE A;  3TCM A;  1CS1 A;  4CXQ A;  2E7I A;  2YKY A;  1X29 A;  1IX8 A;  2W7F A;  4HF8 A;  1DJE A;  1BS0 A;  3ZZK A;  2O0R A;  1D7R A;  1ASL A;  4Q6R A;  3BWN C;  2V1P A;  3FDB A;  3TFT A;  4K05 A;  4LW2 A;  2W7M A;  1MLZ A;  4JF0 A;  1O61 A;  1AKB A;  1Z3Z A;  2ZSL A;  3A9X A;  1C4K A;  2TPL A;  1B8G A;  1AIB A;  1Z7D A;  4OT8 A;  2X3L A;  2X5F A;  3KGX A;  3WY7 A;  2VGV A;  2C0R A;  4WLJ A;  2D66 A;  1EG5 A;  4GEB A;  3FFH A;  1TOG A;  2AY8 A;  2A1V A;  4LC3 A;  1SZU A;  3N75 A;  1RV3 A;  2VGT A;  2EYQ A;  1TAS A;  2VMN A;  2FQ6 A;  3EI9 A;  4UHO A;  1MAQ A;  1GCK A;  3BV0 A;  3GBX A;  3WGB A;  3PAA A;  2QMA A;  3MKJ A;  5M46 A;  3F9T A;  3PD6 B;  3T32 A;  3MC6 C;  1BJW A;  3P6K A;  1SZK A;  3PD6 A;  4JEV A;  4MQQ A;  2JJG A;  1MAP A;  4JEW A;  2CH2 A;  2DKJ A;  1N8P A;  2YRI A;  2R5C A;  1B9I A;  1DJ9 A;  3FZ7 A;  2BYJ A;  4ISY A;  5D5S A;  1AIC A;  2ZYJ A;  3I4J A;  4IYO B;  3JW9 A;  1TOK A;  1V2E A;  3UWC A;  2ZY2 A;  5KTB A;  4IYO A;  1CL1 A;  1CL2 A;  1ORD A;  1I48 A;  1GEX A;  3LVM A;  4ATP A;  3E2F A;  1TOJ A;  4KAM A;  3QM2 A;  4ZDL A;  2YCP A;  1AJR A;  1D2F A;  1LKC A;  4A0F A;  4AOA A;  1JS3 A;  3R4T A;  1ARG A;  4NOG A;  4ITG A;  2DGM A;  4EMY A;  2EZ1 A;  1KKP A;  4OC9 A;  4OTL A;  4XK1 A;  4KXK A;  3LVL B;  4Q31 A;  2YCT A;  3VK2 A;  2Z9X A;  2BI5 A;  5EIG B;  1W7N A;  3AEN B;  2CH1 A;  1ASM A;  3E2Z A;  1UU2 A;  3PPL A;  3AEN A;  3B8X A;  2CJG A;  3BWN A;  2C44 A;  4ZWM A;  1BQD A;  1M4N A;  3HT4 A;  4A6R A;  3LG0 A;  2VMR A;  3FFR A;  1PMO A;  3H9X A;  5M4D A;  1WST A;  3BCA A;  1M0N A;  5HDM A;  2BHX A;  4AO4 A;  4F4E A;  2QBT A;  1JF9 A;  2VLH A;  3B46 A;  4GE7 A;  1AMR A;  1AHX A;  1VEF A;  2D61 A;  2OGE A;  3DYD A;  1N2T A;  4WBT A;  1ASF A;  1BJ4 A;  4F5G A;  2G6W A;  3LVK A;  1B9H A;  2YRR A;  3QHX A;  1QJ3 A;  1WYV B;  2XBN A;  2HOY A;  3A8U X;  2W7G A;  4F5H A;  1WYV A;  1WYT B;  1QIS A;  2Z20 A;  4RM1 A;  3QI6 A;  2E54 A;  2AEV A;  1WYT A;  1CQ7 A;  1VJO A;  3MC6 A;  4PFN A;  2W7H A;  3DR4 A;  2VIA A;  4WYF A;  4WYE A;  3FVS A;  1GC4 A;  1TOE A;  2YKX A;  3N7N A;  1X0M A;  2ZSM A;  3LVJ A;  2AY6 A;  3AEP A;  4WYG A;  5F9S A;  1AKA A;  2YHK A;  2ZY3 A;  3NUI A;  3L44 A;  5C6U A;  4XJP A;  1WKG A;  2GB3 A;  2CJD A;  2BWP A;  2ZJG A;  2CJH A;  3II0 A;  4IXO A;  4QGR A;  4RAE A;  4WP0 A;  5EQC A;  4WYD A;  3WLX A;  2QSR A;  3CQ5 A;  3DXV A;  1TAT A;  4B9B A;  2RFV A;  1C7N A;  2BWO A;  2ORD A;  3NRA A;  1LS3 A;  2BWN A;  3VK3 A;  2DGK A;  2HUU A;  1ARI A;  5JAY A;  3EI8 A;  4GE4 A;  1ELQ A;  2FNU A;  1YIZ A;  2D5Y A;  3A9Z A;  3CAI A;  3GSB A;  4RIT A;  4AZK A;  4R5F A;  5FT5 A;  5EAA A;  3QPG A;  1TOI A;  1AAM A;  1SF2 A;  1I41 A;  4IW7 A;  1KL1 A;  1MGV A;  2YCN A;  3FD0 A;  3IF2 A;  3PDB B;  2OKJ A;  1BJN A;  1WYU A;  1ASC A;  7AAT A;  5G4J A;  4UOY A;  4UHN A;  3ZRP A;  2VMO A;  3PDB A;  2Z61 A;  1RV4 A;  4MKJ A;  1AMS A;  2HZP A;  1M32 A;  1S08 A;  3W1J A;  4ZM4 A;  2BIG A;  2QB2 A;  3JTX A;  5IWQ A;  2AY3 A;  1S07 A;  4KYO A;  2VMS A;  2VMX A;  2BIA A;  2EO5 A;  3E2Y A;  4MQR A;  4DQ6 A;  4OMA A;  2PB0 A;  3ZRQ A;  3TFU A;  1CZE A;  1Y4I A;  4DBC A;  2WK8 A;  4E3R A;  5FT4 A;  1DJU A;  2CAN A;  2O7C A;  3K40 A;  5J8Q A;  4CXR A;  1CJ0 A;  3GZD A;  1XI9 A;  4CBR A;  3DR7 A;  3OKS A;  2D7Z A;  4H63 Q;  1KMJ A;  3E6G A;  4AH3 A;  2BIE A;  3HVY A;  3K28 A;  1MDX A;  2QLR A;  3CQ4 A;  3FDD A;  4W1X A;  3EI7 A;  3FQ7 A;  3AOV A;  2W8U A;  4OBV A;  3AEO A;  2EGY A;  3RBF A;  4ZM3 A;  1YAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...