3EICA

X-ray structure of acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with udp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 40
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3eicA00
4C6AA 1W7WA 4EK2A 1XIQA 4ANDA 2ZUAA 3ZTPA 1F3FA 3ENAA 3BBBA 4W98A 3FBEA 1XQIA 1NB2A 2B8QA 3G2XA 1NDKA 3BBFA 4HR2A 4F4AA 4ENOA 3EVMA 2DXEA 1VYAA 3ZTRA 3Q83A 3JS9A 2AZ1A 1HIYA 3NGTA 1NDLA 1UCNA 3Q8VA 1NDCA 5IOLA 3VGSA 3WX8A 1B4SA 2HVEA 4DI6A 1KDNA 1ZS6A 3L7UA 1NLKL 3Q8UA 1B99A 1NHKL 3ZTQA 3EVOA 3VGTA 1NSKL 5C7PA 1K44A 3FKBA 1HHQA 3EICA 1HLWA 3Q89A 4ANCA 3Q8YA 2BX6A 2HVDA 3BBCA 3NGUA 1WKKA 1LEOA 2BEFA 1S5ZA 4UOGA 3VGVA 1NCLA 3FBBA 3FCWA 3VVUA 4FKXA 3NGSA 3ZTOA 4ANEA 1BE4A 2DXFA 1NUEA 3EM1A 4DZ6A 3DKDA 3EVWA 5CAAA 1WKLA 3EE3A 3ELHA 2AZ3A 1EHWA 4WBFA 3BH6B 4UOHA 2DXDA 2B8PA 3ETMA 3EMTA 1PAEX 3Q86A 3B54A 3PJ9A 3NGRA 4UOFA 1NDPA 1S57A 2NCKL 3MPDA 3FBCA 1NSQA 1BUXA 2DY9A 3VVTA 4S0MA 3FC9A 3B6BA 3EJMA 1LWXA 2HURA 4F36A 3VGUA 2CWKA 4DUTA 1U8WA 3FBFA 2DYAA 3GP9A 3PRVA 4FKYA 1S59A 5BXIA 4CP5A 4KPCA 3DDIA 1PKUA 4O0NA 1JXVA 1MN7A 1BHNA 1NSPA 1F6TA 1MN9A 5CABA 1WKJA 3BH7B 3FCVA 2VU5A 3R9LA 3GPAA 3ZTSA 1NPKA
chains in the Genus database with same CATH superfamily
2OUGA 5A2QY 3J7YU 3KG4A 1WHXA 3KLFB 2E66A 5T7LB 4NLOA 1C4AA 4B3TF 3Q2TC 5KOWA 1GH8A 2UUAF 4J9OA 4DV3J 1RT1A 3LANA 1FDNA 1Q1KA 2RF2B 3GE9A 3MPVA 4LVOP 1JLBB 3UR3C 4DEZA 4DN9A 4W98A 2JSXA 3N6NA 4BS2A 1G7CB 3TO8A 3G87A 2DNMA 2E7XA 2OLWA 3VAIA 2ZH9A 2MPUA 2KT3A 2DEIA 3C6UB 3LH2S 4DV1J 3GJRB 2WSFC 3M32B 2HS3A 4WYWA 1TAUA 1FF2A 2EPIA 3G86A 3QJPA 3GWCA 4FXVA 4XO0A 1K47A 3PO5A 4HYKA 1Q8IA 2DR6A 4RBTA 3LOUA 1X8DA 3NGTA 5F41A 2UXBJ 3W62A 2R7UA 1HNZJ 3VGSA 2DNPA 1S7IA 3N4WA 3MM6B 4FN5A 3DXBA 2JVOA 3PHEA 4MTPA 2R2RA 1A9NB 4JOUA 3MTKA 3OSPA 4U6PA 2QX0A 3C16A 2HS0A 4LREA 5KFFA 3DLKB 5BR8F 5HP1B 1QAIA 1EETA 3H20A 2HK2A 4ED6A 2N3LA 1J5OB 4N5SA 2JEJA 3RR7A 2FVCA 1HHQA 2L48A 1YK9A 2DNKA 2ZH5A 4IFYB 1RU2A 3GYGA 4L73A 1LWFB 2D3ZA 5J1EB 1HI1A 3IGVA 3KLHA 1P6TA 2D1CA 2VBXA 3GIRA 1NMEB 4ZP8A 9RUBA 1YJ9S 4P7TA 1M5OC 2UUCF 4X4NA 3AODA 1EB0A 2ATCB 3BZQA 5E0OA 1MMDA 2MQLA 4LF8J 2WVDA 4HH0A 4USTA 1R6VA 2YNIB 2DJWA 4ES3A 4X66J 3V2UC 1Q8LA 2EK6A 3HHKA 4NLSA 4OHXA 1YBUA 7FD1A 2YKMB 2J9EA 1RAHB 4LSNA 1WELA 1D9AA 3B8HA 4JUZA 4DSIA 2RKIB 4YB5A 1G1XA 1T9XA 3CMAS 1FKPA 3G82A 3LUYA 3BM7A 4CLKA 3OFFA 1SV5B 2CADA 3MCOA 3VHQA 2AZ3A 2ZM6J 2ZH8A 4P52A 3G6ES 1N36F 4K4TA 3IN5A 3EGZA 1ZAVA 2B8PA 1SV5A 3EMTA 4WU3A 2KKHA 3TRGA 1KHWA 3VTIA 2CNOB 1RHMB 2RRAA 1PYOB 3NKYA 3M8SA 1S0MA 3T9ZA 5L9XA 1S4FA 2DGTA 3D5MA 3SEOA 2YNIA 4DPTA 3FBCA 5AE1A 2J6TA 1GXUA 2WVBA 3OR2B 4L72B 4TN2A 4KQZA 2ZH6A 2XB2D 1S7HA 1N5VA 5ETQA 1MNEA 3B78A 1KLNA 3RTVA 4OI1A 1K8AT 2VFRA 1TFYA 2DB1A 2DCUB 2L3MA 5E3CA 2CWKA 2CVIA 5C42A 3UCZP 2AJ0A 2VD3A 2J7WA 1JMTA 2KVQE 3VV2B 1VOMA 2OPSA 4N47A 5BXIA 5LMUJ 1C0TA 2V5HG 3CJTA 2JFDA 2VUGA 3M05A 3MTJA 4AL6A 3GYNA 2E9RX 1TAQA 2J8AA 4K59A 5KT4A 2OTJS 2XLIA 2ZOFA 2ASYA 3CJ4A 3RGIA 5T14A 2ALYB 2ZBRA 2ZZMA 1TKXB 3UR0A 2QL9B 4OI4A 5C25A 5AXNA 5MAOA 3AAWB 3BN7A 4Y2CA 5CABA 1L3VA 3RW7A 1F5CA 1VMBA 4JI4F 3QGHA 4LQ9A 5E3PA 3OQ2A 4RO0A 3GJSB 3P5TL 3PDNA 4IRCA 4PWUA 3RR8A 1TL3B 2JDJA 2UU9F 3V6KA 3Q8SB 2ZH2A 2B3TB 5D0RA 4MFBB 5E3QA 4J7CA 4AXIA 2J5AA 4WWSA 1S1UA 1WI6A 4C6AA 1JXEA 4CO2A 1IKVA 1ZZNA 4A8XA 1LWFA 2IAJB 2O01C 3CJ2A 4X62J 3KDOA 4CDIA 5CZXA 1RWOB 5HMYA 2FDNA 3W9JA 3KLEB 1GTEA 3NS7B 1RTDA 1F2HA 1NDKA 5AXMA 1RT5A 3BBFA 1FXDA 1SQEA 1TL1A 2UXBF 2KFZA 3IP0A 2FY8A 2VQFJ 5GAEU 2DO0A 1Y9OA 1RAAB 3I87A 3NS6A 4CLTA 1T11A 3TAMB 4Q0BB 2YNGB 1P1LA 4GVBB 4I6AA 5L8RC 2BYCA 1H2VZ 5GAHI 1H7XA 4QPTA 5D15A 4QW9A 4A8QA 4EWTA 2YPYA 1NLKL 3T9NA 4J9MA 1B99A 1RTHA 3MEDA 1MU2B 3GILA 3M2RA 3PX6A 1U1RA 5DS7A 2JX2A 3R1HA 1YI2S 2HWIA 5K9FA 2XO6A 3CCSS 1EP4B 1R0CB 4DCOB 3J80Y 1UW9A 1RTHB 2VF3A 2XMJA 3GFXA 4TNOA 1UMJA 2RJZA 5KT6A 2RRNA 1OPZA 1R31A 2A2DA 1XMBA 1KWMA 2B7CB 2PD1A 2V67A 2Z4PA 3TJ9A 1S0OA 1IBMJ 3CO0P 4M5HA 3SCJE 2E9TA 1N6QB 2C3MA 1RAFB 3FJ2A 2DTJA 3FEZA 2BKOA 3FZBA 3PRBA 1K73T 2KT5A 3U1MA 2BE2A 3LA0A 4Y00A 1SJ1A 3P4UB 1TZ0A 2KXHA 5KFKA 4DQSA 3TR5A 1N33F 2HQCA 2AYBA 3DM2B 4DZ6A 5HSPA 4A4JA 3M8PA 1RHQB 1K1QA 1WKLA 3GSDA 2ERRA 2CA9A 2JHEA 4DOZA 3A1YG 1S9GA 1FFSB 3BDEA 3QPIA 2QN6B 1FWLA 3QT5A 1C4CA 1RT4B 2CWXA 4U7CA 3CCQS 4Q43A 5LMUF 4U96A 1H74A 1R8BA 1RP5A 3OFEA 4MK9A 3ILLA 5E3RA 3ENQA 3FFIA 3CC7S 2W2OP 1G4CA 3Q23A 1R0AA 4OYZA 4UY8T 4JV2A 1X4CA 1FDDA 1EZZB 4N77A 3QAEA 2KFNA 3BREA 4BBYA 3H59A 1A7GE 3AT1B 1CPZA 3NOCA 4LMZA 4CH0S 2D9PA 3VVTA 2XWXA 3K7RA 2LDYA 4OZ5A 4C97A 4DS4A 2DR7A 1FXRA 4I6YA 2DH8A 4PXDA 3H90A 3PY8A 1C2PA 2OAUA 5HBMB 4PEOA 5KFMA 4DMZA 1X4GA 3LWLA 3PW4A 3LALA 5K14A 2IJFA 4A8MP 2AD9A 2C1EB 3BO3A 4YDDB 4X65J 1VCTA 2JL9A 3MAQA 3MPUB 4JV5F 1RT4A 5IFMA 2VOPA 3OR1B 1SL1A 4CP5A 1VLYA 3DOLB 1VRUB 3GYXB 2Z2MA 3EZ5A 1RWXB 2IVFB 3GJQB 1Q7LB 3NS5A 1VIXA 4YR0A 3NP5A 2MZRA 4KJIA 2YNGA 4GVBA 2UU9J 2CQ2A 2GGPA 1SUQB 4UW2A 3QZ8A 3RRHA 3CCVS 4HTJA 1SL2A 3PYEA 4PR6A 2W2QP 5KFWA 4JI0J 3ZTSA 4USKA 2ATLA 2YKNB 2JLEA 2YNFB 4OV6A 4RR5A 1NK7A 5KFCA 2A0FB 2GQQA 4YHHF 1RAGB 3QIPA 4UF4A 5F3ZA 2B43A 2W7PA 4DV6J 4PRFA 4O44A 4DUZJ 4TU7A 1C1BB 1VRUA 2G2OA 5LSLA 4ILMA 2FD2A 4ZVEA 2QC3A 5BYSA 2NXCA 3H40A 1N36J 5D0EA 5AJ3F 3OSNA 3K59A 2UUAJ 3GV8B 1TKZB 3HHLB 3HFVA 1EQMA 3UWTA 1GXLA 2DHHA 4FXDA 2J7KA 3V6HA 1FRJA 2CQCA 2Q3PA 4UZCA 4ENOA 5GAGU 2U2FA 3MR3A 2DXEA 2VG7A 4OYPA 1HNWF 4M95A 3ZNUA 1NJZA 5DGAA 2L9NA 2AZ1A 2KZMA 4LF9J 2EFOA 1EQ0A 2MQMA 1VRTA 3R7BB 1Y00A 1TU0B 1MROA 2RIJA 2QA2A 4HI2A 1S10A 3I55S 1SJFA 4MH8A 3W5XA 3N79A 2IM1A 3KK2B 2VONA 4NI2A 5HQ8A 2E5LJ 4WKYA 1JJCB 1LWEA 3PHTA 1M5KC 5SUHA 2FZGB 2ZD1B 1HLWA 3LP0A 1V5IB 1S99A 2VG5B 2XMWA 1D3WA 3DU5A 4ATNA 3EX7B 1FKOB 4ECRA 4MKYA 4URQU 1UVLA 3KOAA 1OIAA 1K9MT 5ETRA 6FDRA 4H4MB 4LF9F 2M8DB 4UUWA 1SKUB 2NUHA 4DV2J 2JZ5A 7FDRA 4F4ZA 2OD4A 3MOZA 2YWEA 3UFCX 4OI3A 5GMEA 5EHHA 3RJMB 4GKKJ 3BN4A 3OL8A 4NA2A 2G1HA 2FVSA 2VG7B 4NLGA 2RB7A 3F41A 1JLGB 1WC5A 1BE4A 5KFHA 4EBEA 4X4PA 1U6ZA 4WP9A 2XSJA 3S1TA 4AUKA 4ED2A 2Q66A 3DI6A 4PQUB 2W4DA 3EVWA 1GAOA 2PGCA 1EKSA 2H51B 1VR6A 4L3KA 3H2VE 1RYRA 2AWZA 4WBFA 4ZJOA 3CUNA 2CJKA 4GO5X 2ZH7A 5F8JA 2OI2A 2OMLA 3IR6B 3UI3A 3M8QA 2LQ9A 2QSWA 2ZJRQ 3AA8A 3C8YA 4Q2LA 5LXRA 1NEEA 1VQ5S 2V4JB 1Q5YA 2ZZTA 1JLAB 2EFNA 2FVPA 1RDRA 2HFNA 1XR5A 1FTCA 1SL0A 2HHSA 2C2KB 4MJKA 3P5BP 4C3MA 2M5YA 2BE2B 2VKZG 2YWKA 2DHSA 4WFAQ 2LQ8A 3MMBA 2BW2A 2IM3A 3O6QA 4S0MA 5KFDA 2A2CA 3DRXA 3PM9A 4FYYB 4PAAA 3GV5B 3M30B 3ITHB 4C11A 3BQ2A 2XY5A 2UUCJ 4J5OA 3NGKA 2UVUA 3MMAA 5J1EA 1R0BG 1WG5A 1V3ZA 4NZ6A 4PYDA 3OLAA 2DNYA 4O3NA 2DYAA 3OTOF 2HQGA 4X4RA 1P27B 5E3AA 2E1MC 5DZ6A 5B0GA 4N7TA 1HBMB 1CJTA 3E01A 3FRYA 3BSCA 1I94F 5D4PA 3VAGA 2CKWA 4EFAC 2VC0A 3K5OA 1JXVA 3CDEA 1KS2A 4ZVTB 2Z2LA 1YJTA 2AT1B 3BH7B 4DSFA 2HYIB 2W24A 3FEYB 2G4BA 5HI7A 2FGCA 2B4VA 3AJDA 3D3CJ 5F8LA 2GO8A 2V8PA 3CW2C 3PG9A 4RW4B 2BOAA 3KDNA 1FFGB 2HHWA 2MY7A 4KYZA 2MQ8A 1X4BA 4ZDNA 1VFJA 4WCEQ 2VG5A 1HWIA 2MZQA 1XN9A 4DFPA 2UUTA 2GAHC 1BWVA 4IG3B 3W64A 1U47A 1S9GB 2GVDB 2CQHA 4LF6J 2KYZA 2JH3A 4I1TA 1MW7A 2ZNYA 4AL7A 2ZEJA 2DISA 1EETB 1MMNA 2JC1A 3CDWA 4O4GA 1GMVA 3SSQA 1U4BA 1JLFB 1OWXA 1U02A 3DRPA 1FT8A 2P8IA 4DZDA 2UXDF 3IM8A 4KAIA 1FVSA 2KTQA 2MSTA 1Z2LA 3CJ8A 3MZIA 1TL3A 3KWMA 5ETSA 2M52A 5K20B 3C2PA 1FK9A 3MAAA 4NMXA 3UDCA 3D1QA 4B9TA 3OLBA 1RHUB 1YLXA 4IOCQ 3W66A 5KFGA 2DR9A 3PW0A 5D3GA 2UXDJ 2YX7A 3FK4A 2EEYA 5EN1A 2CPJA 1ROFA 4I2QA 2NSBA 1QD1A 3K58A 2VQEF 2IDLA 1PIEA 3MM5A 1JLQB 2EG2A 4IDKB 4QIEA 3THVA 1ZOTA 3EVOA 2DNHA 3KFWX 2VODA 4DV6F 3CCTA 4KC5A 2Q6BA 1TTHB 4A46A 1Q86T 3EYZA 1B64A 2N7CA 2MKYA 1RQ0A 4F2SA 3BBCA 1J27A 2Y3YA 5A6WA 2XMVA 2X1BA 1RACB 5CYQA 3TZYA 5T7LA 4DR4F 1R27B 1R3NA 4ELTA 5FJ4A 3D4JA 4QZVB 4PXEA 3DRSA 1U0HA 2RHQB 1O0PA 2NPIA 3KNAA 3ET6A 3UO0A 1G6BA 2OP5A 2H5EA 5GMDA 2O66A 3W5YA 3H5XA 3ADAC 3ZTOA 1R8AA 3TUZC 3EGVA 3OTBA 4WIIA 5DLFA 2DXFA 4M1KA 1N88A 3JAMY 3J81U 1S6OA 4MT1A 1FXLA 2ZITA 5A8WA 4DR6F 1B70B 1LFPA 1JB0C 1RT3A 1LXNA 3O44A 3OBIA 4JV1A 4OYBA 1HQEA 3MFIA 4K5SA 2PMZD 3ZZTA 4P72A 4LF7J 4JI6F 4KTQA 4KRWA 4YMEA 1RT6B 1S6PB 2MKHA 1XR7A 2BMBA 5IT9Y 3HHEA 4CLYA 3G6VA 2M2BA 2ZVSA 3IBCB 4CLLA 1BQNA 5F8GA 3HK2A 4UOFA 1W25A 2J0WA 3OFHA 1YBAA 3K89A 4NZ0A 4YEAA 3TVYA 2WSCC 2J0QD 2JEIA 4UQGA 2BM1A 3I0SA 3W5ZA 2HW3A 2Q1LA 2CFXA 2MZJA 3MM8A 4DV2F 3UD4P 5DLGA 4J91A 2A18A 2XYPB 4RW6B 3KLVA 1X9WA 4Q8EA 1ZAXA 1OYEA 2QSFA 4FYXB 1Q82T 2QGFB 4I64A 2HHHF 1YDLA 4NMLA 5H9EJ 1L3UA 2RE1A 2C3PA 4M5NA 4LF4J 4Q45A 4OL8A 3C14B 1AROP 1NO8A 2LA6A 3JTNA 3MM7B 1ULRA 3B4DA 3WZ0A 4B3RF 3AY0A 5L46A 2QYGA 5CYMB 3DRRA 1UWBA 3GIJA 1QJHA 1S1VB 2NSCA 3A3OB 3GG1A 2VBWA 5C42B 4DV1F 1REVB 2AYMA 4PXBA 1NK6A 2AF6A 4LRBA 3GCXP 1RWPB 1Q79A 2EKYA 1WKJA 3BV8A 3LGMA 3G9CA 4YUDA 3UPFA 3K5PA 1JWWA 1HHTP 2JNJA 1RBAA 4OV1A 3QT8A 3QFWA 1KR4A 2BANA 3P3DA 4NCGA 4ZP9A 1XC9A 1HQUA 4QW8A 4FYDA 1YX2A 3M6UA 1HNVA 2B56A 2PO4A 1HNZF 2JEGA 1W7WA 5GADU 3QBCA 2ZKUA 2LDIA 2XNRA 3D0HE 4J9RA 5FDLB 3SI8A 4KR0B 4LIRA 4KFBA 4A48A 5I3UA 3HZEA 4LFAF 2B8QA 3A13A 3RAQA 2UUBF 1TL7B 4U8YA 3QT6A 2W9BA 2XCPA 4OHVA 1HARA 4LSZB 2H1YA 1O51A 2CQ3A 4YHHJ 2W9AA 4USUA 1XTZA 2CQBA 3Q83A 3JS9A 3TX0A 1HIYA 3QLHB 3KYLA 3RBEA 3BDPA 4PWDA 2ZVIA 4MKBA 4JV0A 3OXFA 2JVRA 1ZA1B 1IUJA 3CGIA 1SKSA 2H65B 2FVRA 4TYBA 1B4SA 5LOQA 2J76E 3AD9C 1PO6A 1SH3A 4WZMA 2PT0A 3JQKA 1HQ2A 1OMSA 3GLJA 2B51A 2DGSA 5B0DA 5EUHA 2MQOA 1K44A 2YX4A 3KMSA 3HJVA 4WJBA 5D6GA 3GV7B 3HFZB 4U7UD 1IBCB 2LECA 1HKAA 4DSEA 2F40A 5FLXY 5DG7A 4JI6J 5HVHA 2C2MB 3T41A 3FEXB 2VL1A 5GAHU 3DOKB 3TX8A 4DL2A 4KHMA 4A8OA 4NYPA 4X2BA 2E1CA 2G2YA 2KJVA 2HHPA 1GX5A 5IZHA 1OSDA 4I2PA 4B17A 2CDQA 2HWTA 4OYOA 1CQNA 2P9CA 3MWBA 4FBTA 1P9YA 3V4IB 3MXHP 3C6TB 2W9CA 1RLCL 2B4UA 1Q78A 3DKDA 5JUMA 4N76A 2RSQA 5FD1A 2CIMA 3RAMA 4NYZA 2LXUA 3T5KA 2XYHB 3V81B 3NCQA 3WBZA 1UVJA 2CPEA 2E5HA 2LQJA 5HO4A 4DFKA 2XEXA 2IMWP 1RAIB 4ECYA 3KHLA 2Y1JA 4PKDB 1U48A 1RA7A 3JSBA 5LM7E 2E7WA 2H54B 4FDFA 2B6AB 4U7UK 3M4XA 1H3DA 4YR3A 3VALA 1JKHA 1TL5A 3EZUA 4OJ1A 4ED3A 4ERDA 1HW9A 3IG1B 4J9QA 4DQIA 4I2PB 1RT2A 2W8KA 5F0UA 1MLAA 4FF3A 3G96A 3LPEA 3QRQA 2KXNB 4MYUA 4XTTA 1SVDA 4NEZA 2Z57B 2GIRA 2X51A 4M8LA 2DNGA 3OXGA 3MAHA 1FO1A 1RXOB 5F8MA 2IA6A 3QO9B 2HQ3A 2XLKA 2AYEA 4M5KA 4DSKA 2ZOGA 2FHOB 3U1LA 1U1QA 1FX2A 2BUNA 3FZ2A 1CLFA 4C8YA 2FLPA 1N34F 2I2YA 5L1LA 1EJ7L 1FKAF 1DLOB 4KPCA 2GVDA 3W65A 2G9OA 3PNIA 4ETXA 3MR5A 1C1CB 3HT3A 2IHR1 1UTAA 1MWYA 3DLGB 3TJ8A 2ZE2A 4JI3J 1ITPA 1NPRA 2B4OA 4O0NA 4O3PA 3SQGB 5J2QB 4LSNB 3W8GA 1JQGA 3W1YC 5H1SV 4K4YA 2CPIA 3B4MA 3BR9A 3EXYA 2QE5A 4DUYF 1IKWB 3C15B 2AU0A 4DV7J 3BYPA 3JSRA 2AGOA 1ZZFA 3GPAA 4ILRA 3DN9A 3RRGA 2MSSA 1PJ6A 4I69A 2LEBA 2HRUA 3GFYA 4HI1A 3CDAA 1TKDA 1IKWA 3C15A 4ICLB 1ZM9A 1YKWA 4K8RA 4KGZB 4USHA 1SH2A 5EX0A 5HN0A 5DDOC 4IFYA 4NXMJ 1YRUA 4ANDA 4Y6IA 2XWYA 3NEKA 5B09A 2L9DA 3GFHA 1DLOA 2GMJA 3GQCA 1KTVA 3KUHA 2BJ1A 5AE2A 1JLCB 1PJ5A 3IS9A 1RE1B 1HWLA 2YQ0A 3CD7A 3L09A 4IFVA 3CIMA 3MMAB 4O3RA 4KB7A 2KM8C 2FTRA 1L3TA 1H73A 5IS2A 4G65A 3G8TA 2CPXA 2FPHX 2V2VA 4DR3J 4NOHA 4HDGA 4ZN3A 3R5GA 4TLRA 5KT7A 2A10A 2ZHBA 2FJDB 3DRSB 3DLLQ 3Q8VA 4DUYJ 3HKZD 1J5EF 3NMRA 2Y1RI 3MDFA 3KLGA 4ZVUB 3A3PB 2OFHX 2HBZB 3DMJB 4PG4A 2RS2A 2XS7A 3TVKA 2VV5A 1ELOA 4C0BA 5HROA 1K0VA 2N4DA 4ZJLA 1VC5A 4GKJJ 1NHKL 3VF0B 3ZTQA 3HJFA 1YTYA 1VI7A 1WF2A 2UZAA 5E7OB 1NSKL 2B4PA 2GQ2A 3EGNA 4KFBB 4YS2A 1U1LA 2VOOA 3EDQB 1M90T 2WVCA 4PPDA 3M8RA 4QYZK 1FFWB 4K2XA 4X62F 2MZSA 5KFVA 1N32F 2OEKA 4U95A 3EUNA 2VKRA 2HVDA 3V6DB 4WK3A 5J2PB 4ZLPA 3L4BC 5ETNA 1HNIA 2I9SA 3TEGA 1NU4A 1W2BR 3LP2A 3R6GB 5KG7A 4OI0A 1F9EB 1X31C 4USMA 3CE8A 3J7Z5 3D6TB 6FD1A 4DR1F 1KQGB 1OSCA 1EARA 2KFYA 4KHPJ 3HLUA 3R5AA 1FK9B 3MAAB 1FRKA 2KDOA 5FIIA 4RW9B 3UCGA 4B9NA 1SXLA 3D68A 4ILLA 5ETTA 4DV0F 1L3SA 2PEBA 3R7SB 4TLQA 1C0UB 1GX6A 4ZK7M 4ECXA 1H0HB 1YITS 4A47A 1M1HA 1RTJA 2AJ2A 1U25A 3EE3A 3LAKA 5JXSA 4EMDA 2IRUA 1S4EA 3RYLA 1VQ6S 5J2NB 1HYSA 3BF4A 4NLYA 2MKCA 1GMWA 5F3TA 2PN6A 3OVSA 4LRCA 2BJ7A 2K7KA 2VG6B 1RTJB 4CYUA 5E41A 4CIOA 3POTA 1JJ4A 1EX8A 5F8NA 1IVZA 5G4DA 3U1NA 4ED7A 4TU9A 1NAQA 2KG0A 1XK8A 2QA4G 3C19A 4X84A 4DV5F 4CLPA 2YWHA 1X0PA 2DITA 1RA6A 4ICLA 4OZ3A 3CC2S 4RW4A 1B3TA 2J6UA 3ET6B 1VBXA 5DO2A 1VQPS 1HD1A 4NA1A 4F3QA 1BUXA 4RL1A 1Z2ZA 2I6WA 3A3NB 1QTNB 5DQIA 4KPYA 4F0MA 2JOQA 3BEGB 4LT6A 2LFVA 2HSEB 2DH7A 2OPPA 2D7SA 3MR7A 3I5AA 2C22A 2ZJPQ 1BLUA 1VRQC 2GVZA 2D3OR 4DUTA 4V19J 1ICEB 3HHLA 3IM9A 3PRVA 1C1CA 4DPWA 5HJYA 1AW0A 1EKRA 2CDRB 2A6MA 1JK9B 1T02A 4UQTA 1HNWJ 2YKQA 2ZC4A 2YKPA 5J2MA 5D8HB 2APOA 4R0JA 5C24B 4RU2A 3NBPA 4L3NA 5I42B 2OH2A 2F4FA 2FHJA 2CNKB 2FZCB 2PA8D 3DLEA 5GAGI 1QVFR 3H5SA 2Y0SD 1NSPA 4NZ7A 4P2SA 4E8UA 3T5HA 3QIPB 2XNQA 1FNOA 3PFEA 4DFMA 4V1Ak 2K3IA 3SDEA 3M6VA 3W3SA 1T9YA 3HD1A 5IC6B 3CEDA 2X7IA 3A12A 1XJWB 2HS4A 2B7BB 1UA1A 1DQ8A 1HBUA 1WC0A 2C2ZB 5KG0A 5J2MB 3V6DA 4NRTA 2XS2A 1H2UX 2DIVA 2WONB 2N3OA 4J9LA 4PUOB 3H8YA 3NAIA 2E5JA 3DOLA 3PR5B 2NREA 4DX5A 4L6V3 3IWNC 1GFWB 2DNRA 3AH6A 4TYAA 4LF1A 2CNNB 1N52B 2GX8A 1NZ8A 5D77A 2N82B 2L41A 3GIMA 4J9VA 4O3SA 1NK8A 3GG0A 1RISA 4Q5VA 4ED1A 3CC4S 3G71S 4BWJA 3FSXA 4CTAA 3OTDA 2IM0A 2KHDA 3S8SA 1UAWA 3LP1B 4M5MA 2KO1A 1KQSR 3D1HA 2EFVA 4EYIB 2FHMA 2QMUB 1ZBTA 2BANB 3JQJA 1S77D 1D1UA 2BV3A 2K1RB 2MLXA 3E8OA 5ETLA 1F5AA 3QMQA 5I3QA 1UL3A 3PEJA 1HR0J 3D67A 1GMWD 4DSLA 4JI4J 1VQSA 4R25A 2VIHA 2R7VA 1LFWA 1URRA 2HFVA 2DNLA 4PABA 2XY6A 3DOKA 4GKKF 1W26A 1M5VC 3ETOA 4Y3CA 3H4BA 2JLFA 1KDNA 3J7AN 3POTB 1S6PA 1N0UA 1M0SA 3M2VB 3PCOB 3QGIA 5LJ5Y 2WBRA 3IO1A 2CZ9A 2EK1A 3LP0B 1JLCA 4YFUA 4IQXA 2HKEA 1Q0NA 4LRFA 3PYGA 3MCMA 4RW8A 1FDAA 1FERA 1P8GA 2QL7B 2YKAA 4CLFA 4Z37A 3KK3A 1IKXA 3G8QA 1RWUA 2DHAA 3DDKA 3JYTA 2Q43A 5CHCB 4DJBA 4W90B 2DHGA 2MQPA 2RUGA 4TY8A 4PWDB 2K1RA 4KBIA 8AT1B 2W01A 4LBPA 5HAOA 2GHWA 4X4OA 2DO4A 5B0EA 3LQVA 3C46A 1VK3A 2RRBA 4WK1A 3M8YA 2BRKA 4G1QB 1NUEA 4OZ2A 1HHSA 2BW7A 2ZOMA 1SC1B 3EM1A 5CYQB 2W9BB 4HH1A 1F5BA 4OZ1A 2V9WA 4IQMA 2HNYB 4M5DB 4E98A 3CT9A 1G3OA 3AB4B 4TY9A 4ES1A 1WD6A 3WDOA 1YJNS 2KYXA 3R5DA 4ZITA 2VG6A 1T03A 2E1PA 4B9LA 2BQ3A 1VQMS 3UVJB 3H5YA 2V68A 3HO1A 3RB3A 3W61A 2M8HA 3ZZPA 2ADCA 1LWCB 1HI8A 2PMHA 2HMIB 1TKTA 1N33J 1UP1A 2RU3A 2QZ8A 1LV5A 1YWXA 4NWBA 2WVFA 2BR0A 2XMTA 2Q79A 1FJGJ 1IKYB 4ID8A 3G8SA 2KRRA 1Q81T 2NCKL 3MPDA 2AYGA 1D9FA 2XZWA 4DLEA 4RW9A 1NSQA 4X64F 4RNMA 1JXLA 5D78A 2IJNA 1DQ9A 5HANA 2LCWA 1IQZA 3EWGA 4D3GA 3PO4A 1JLEA 1VGYA 1GNKA 3IR7B 4MK8A 4NEYA 2Y1IA 1WACA 3CJQA 4XDCA 3SBMA 2VQFF 2HRYA 1X60A 1WEYA 1Y5IB 4A8KA 4DL4A 2WBMA 4RBUA 3UVJA 5KFNA 2O3DA 2PI4A 2BOPA 4OX6A 3L7PA 1JJ2R 1QSLA 1CBKA 2HNYA 3C14A 2CJ9A 4M5DA 3TNVA 3W8PA 2W7OA 2W8LA 2RNEA 4B02A 1IKVB 2P6SA 4UTGA 5ETKA 4LSLA 4FS1A 1OJ4A 3H98A 2CYYA 1MN7A 1N8RT 1NSAA 1MSWD 2WK4A 2Z8QA 3AHPA 2DPIA 1IWAA 1QAYA 3QGGA 2VU5A 1UJ6A 4F25A 4F02A 4KKOB 4DV5J 1N5SA 2MQNA 3I5BA 2FY1A 1FI4A 2X1AA 3U27A 2RU9A 2Y8YA 4I67A 2ZH1A 2ASDA 4N41A 4LFCF 2XYGB 1EAYC 4RJVA 2ZE2B 1X5PA 1F9FA 3R2CJ 1HWJA 1BQNB 3OW2R 1K1SA 2NYHA 4IH7A 5F8HA 4P2FA 4J90A 4O4GB 4ECVA 1F3VA 4F04B 5LT5A 3BGUA 2DHXA 1VDHA 1OQ6A 2ZWPA 2ZBIA 1NB2A 2M7SA 4EYHB 2D74B 1VBKA 1BMQB 1HNXJ 3HHDA 1X4EA 1AFIA 3M8PB 4N8NA 5KG2A 4NE9C 3OVBA 2VFUA 1N34J 3CCES 2MKSA 3HD2A 2AV5A 3R5CA 1DBDA 4IR1A 3D9BA 3I0RA 1FESA 1RHJB 2OPQB 5LSOA 2MY8A 2JFKA 4ED8A 1FEEA 3DOMA 4LQ3A 4R8UB 1KLMB 1ZPVA 3D6MB 4OHWA 1TK0A 3HDSA 3C66A 3CO9A 4KE5A 1KBRA 1MWQA 2FJBB 2XBPA 4CM2A 1HNIB 2A6OA 2KL8A 1XMQJ 3H0PA 4KHPF 1N4LA 2DGVA 2NUUG 4K2JA 1UKUA 3AQOA 4DG1A 1RTIB 1X4FA 3DGVA 1REVA 2QMWA 2NXUA 3HI9A 3Q8UA 4JI7J 4K0KF 1FWPA 4HACA 2DGWA 3BKUA 2YTCA 2D41A 3TA1A 4DUZF 5RUBA 4AT1B 3BKTA 4RU9A 2ADBA 3AD7C 3O5TB 2BE9B 2HAFA 5HMWA 2PFFB 1U1PA 1F60B 3CJ5A 4DF8A 1I6JA 1FKPB 2H5IB 1YJ7A 3ZFVA 4DL6A 1HNVB 1KC8T 4JI0F 3BKFA 1T9VA 3R5BA 3ITHA 1TL4A 1VQLS 2ZNZA 3W60A 3PIOQ 2W7AA 1JNZB 3FCWA 3UN3A 2YWFA 3NGSA 4NX9A 5I3PA 3S01A 4OQJA 2GGPB 1WSRA 2P5VA 3SFUA 3KHGA 1FX4A 1RYSA 1QTMA 2CPFA 4DR3F 2QIFA 4XIUA 5CAAA 2VB6A 1WEXA 4ER8A 4A8WA 1B7FA 3M8QB 3RBZA 2XI3A 3BH6B 2PMWA 4C8KA 4BWMA 4ZHRA 3M2UA 1KVIA 3AOAA 3QYYA 4WFZA 5CD4A 2RQ4A 2WOMA 2KM8B 3UDVA 2VASA 4QOTA 4HHJA 5ITHA 1IWGA 1GXTA 1SJ4P 4X4UA 2OSQA 5EWEA 3RBDA 3KHHA 4DR2J 2R2TA 2Y8WA 3G6XA 4WIQA 2HLUA 2BZ2A 1KNZA 4QU7A 1FA0A 2YKOA 1WDDA 2H9ZA 3MPYA 2ILZA 1T95A 1YIJS 2UP1A 4NLPA 4Y2AA 4WTOB 4DN0A 2EVZA 3JQMA 1DFDA 1ZH5A 3ZZZA 4DBQA 1CC7A 2DR8A 5IT0A 1CJTB 4PQAA 2R8GA 1S9FA 2HPUA 4K5RA 1KFDA 2LVWA 3AFGA 2H3EB 1QY7A 2HIQA 5KFXA 2MTLA 3HSDA 1APSA 2KZZA 4QJVA 3QRPA 2F7VA 1U6FA 4OYIA 4MIAA 4Q0BA 1HWKA 3H5UA 3M9NB 3KG0A 2JEFA 1BGXT 2I38A 3DGPB 3PYFA 2MHNA 1J2VA 3MR2A 2Z2ZA 1TR0A 3NWRA 3DLJA 3JXOA 2QMXA 2V8GA 5B08A 4ZLJA 2R8HA 4J9NA 1FD8A 1GTHA 3KUGA 1TL1B 3PTWA 1RWNB 4TQSA 2B6AA 5E5NA 2XMMA 3OHAA 4A8SA 4LUBA 2VBYA 5ADZA 4CT9A 1IR0A 1FRMA 3D66A 3VQSA 4DCPB 5B0FA 3QAUA 5KG6A 2NXJA 3OTOJ 3MM7A 1RTZA 3K8WA 3CB4A 3I82A 4F4KA 1R8CA 1H7WA 2K3KA 1UVMA 4F4AA 2EBGA 2LXIA 2DKOB 1BQXA 2VZ9A 2KRBA 1LW2A 1UZDA 4RW6A 1SJQA 5KFPA 2VICA 4P2MA 2YKMA 3NCRA 1Q7YT 3JSYA 4RZRA 2FJVA 4TQRA 1GQEA 1UCNA 2Y1LB 2YNFA 4NL5A 5F9LA 4EO8A 2HGMA 5IV3A 2HHTA 4W4MA 4ZPCA 4DQQA 2CQ0A 4H4MA 1NKBA 2M9KA 2V63A 3AXMA 2NQPA 2ZBPA 4FVMA 1JLFA 3D54A 2HLTA 3DRPB 4QBUA 1BD6A 2LYVA 2WSEC 5BYQA 4J37A 2DNQA 2FJEB 4XK8C 1FJ7A 1I94J 4ZPVR 3SCLE 3THPA 1N5YB 4CRJA 2KXFA 1GMUA 2MLYA 2QLBB 2NYIA 4EGLA 2D3UA 1I1GA 3TUJC 4KV8A 5IM0B 2CJQA 1YHQS 4JI2F 4GC7A 3NNAA 2G0IA 3LGHA 3QZ7A 3L3CA 4UY85 1WHVA 1S5ZA 2HIYA 2QT7A 4UOGA 2VH7A 1VC6A 3GR0A 1DRZA 5IXUA 2OD6A 4ZMMA 4ID5A 3BR8A 1Y5NB 1PGZA 3K8VA 4OX7A 3W2VB 5CH7B 3VAJA 3W2WA 2E5GA 2OO4A 2ROGA 3PJXA 2V4JA 1T05B 2AEJA 1BWEA 1TV6B 3RB4A 4C8MA 1O6XA 2QO3A 3ILOA 5KFLA 5HATA 2G0JA 3UN5A 1TL7A 2RAQA 5KG5A 5EX3A 4Y28C 4KT0C 2MQQA 2R2UA 3JTPA 1O8BA 3OXLA 1HMVB 4ZCKA 3ISNC 1X7VA 3DNCA 4N8OA 1RT6A 1ZM3A 2BVZA 4QIGA 3CTRA 3PFOA 4LR7A 1URNA 3CMQA 3FMBA 3HSJA 1MU2A 5AE3A 1TFWA 2CG8A 3ILJA 2XM3A 4V19X 4QU6A 1RT7B 2KHCA 3LPYA 2DNZA 4NASA 2DRAA 4DR7J 2ZJQQ 4NCGB 5A0YA 4PPZA 2FZKB 2R4FA 2ZWOA 2DGQA 2WW8A 4OJ3A 1KLMA 3CVKA 4I4BA 3PZPA 2XY7A 3P96A 2XGQA 1TUWA 8RUCA 2UUWA 2CPYA 5A0YB 3AJ2A 3SCIE 4DU8A 3JB9k 4HT5A 3MCSA 1QE1A 1Q5VA 2V8HA 3LTOA 4I56A 1FKOA 5G0RB 4F36A 4Q44A 3T3FA 4B9MA 2RQKA 4IYQA 3K57A 4QQBA 3UNYA 1RT5B 1XNQF 3GP9A 3DRRB 3R97A 3FQLA 1R8PA 4A8FA 1CULA 2CQGA 1TK5A 3OJSA 2UV8A 1PKUA 1RWWB 4KSEB 2DRDA 2FJXA 2GIFA 5HBMA 4F3MA 2Z2YB 1R6YA 1WC1A 4PQUA 2RKIA 2HFUA 1JLGA 2RDDA 2PDAA 3ENVA 2L9WA 1GEHA 3HZGA 4OZLA 1YRTA 2LU1A 2OFGX 2MLZA 5BYRA 1Y4ZB 2LA4A 4QCLA 3TP2A 3TAQA 2DY1A 3G6YA 1RWVB 2QJ3A 4MAKA 1M5PC 4K0KJ 4HDHA 1FHTA 2HHUA 2X3DA 4LR8A 1IBMF 3M32A 3O1LA 1N56A 3K0JA 2KU7A 1RWKB 4LSLB 4OX9F 2K7JA 2O5DA 4JI1F 3NL0A 3LGNA 2OPRA 5D4NA 2MZTA 4IRKA 3IGNA 2GFFA 3KLEA 3T6BA 1LWEB 2C3UA 3PW2A 1WSVA 5GAEI 1RAJA 1VQYA 2NPFA 2WHOA 4GC6A 5DDQC 2OKQA 2OPSB 1PAUB 3FRZA 2OPRB 1H98A 2MKIA 3R1LA 4NXMF 1LNQA 2B9XA 4GRSA 2G0CA 4GKJF 3CDBA 2X1GA 4RNNA 4LFBF 2ZBQA 1TK8A 1YJWS 1CVJA 1LK5A 3ZC4A 4MMOA 1U09A 4E2FB 2OIHA 3BGRA 1UFWA 3CDUA 4E0DA 4CNZA 1UVNA 3DYAA 3CCUS 4HVZA 2LQBA 1SUQA 3VWSA 3Q2SC 2DT9A 3M9MB 3MMJA 3TEHB 4MYTA 5IQ6A 2HVEA 5IC4B 3MUTP 2PEHA 1TKZA 2B9WA 2COLA 2O67A 2BXJA 2XG8A 5D4OA 3I4HX 3K5MA 2V6AA 1H6KX 4JI7F 1EP4A 3FKBA 1WTFA 5H9EK 4ZPWR 5ETMA 3EICA 2R2SA 3M2RB 5ETOA 2CQDA 1Q95G 4RUAA 2HFZA 3HHNB 2XSJB 1S0NA 1TELA 5D3GB 1AA1B 4PZVA 5THWA 1TUVA 2BEFA 1HBNB 3DRYA 1TVRA 4C0OC 4LBHA 1YJVA 1QSYA 1T9UA 1T05A 1A6LA 3DYAB 1V3SA 2SXLA 2PC6A 3RB0A 2GZOA 2HFSA 2YNHA 3DOMB 4WFBQ 2C2DA 4ETZA 2RS8A 3FBBA 1LOUA 2ZZNA 4AE5A 2FHKA 5K8NA 2Z0GA 4B3SJ 4TY8B 2EFGA 1AYEA 2BKPA 1F1BB 1RGVA 1ZA2B 2EFQA 3LO3A 4RX6A 2MXYA 2AW0A 3CJSA 3NWGA 1OY6A 4EU0A 2KG1A 2EC0A 3OL6A 1S1XB 2ZFHA 3M6WA 3L9ZA 5F9NA 2A1BA 2JRSA 4QIWD 4IUFA 2NXEA 1U0SA 1KQFB 5B0AA 1OS5A 4XDDA 4F0KA 4ZCMA 4F50A 4LF4F 3GIIA 2ZUGA 5IT9U 1JNRB 2CPZA 3C16B 4M94A 3MD3A 3DLKA 1S1UB 1VK8A 3B54A 4UOCA 4EBCA 1VBZA 2AEFA 1FNXH 4OX8A 4DCJB 1NXIA 1BC6A 1S48A 1Q53A 2IIHA 4Y2MA 1MROB 3D0IE 3CJKA 3J7YI 3W9IA 1PJ7A 4DQRA 1S57A 1WORA 1H38A 2R7RA 3KXDA 4NLUA 5EGYA 5M2PA 4DV0J 4H4KA 2YNHB 4DR2F 3W2VA 2WCXA 3I56S 4K4SA 2EG1A 2POKA 2J0XA 2OMOA 1XWLA 1M5HA 2X3GA 4Y65A 1N6QA 1RWMB 3PVXA 1TVRB 3FC9A 3B6BA 2R7QA 2AX0A 1U7LA 3KK3B 3PW7A 4DR7F 1LW0B 4B08A 4R5PA 1KOOA 1VS3A 3KK1A 3VAMA 3BPDA 3MD1A 1XEZA 5C25B 4ECSA 1VQ9S 1QDUB 3VZHA 2IJRA 3SCKE 1NB7A 2ZDOA 3BYRA 1S59A 3ZZOA 1WOPA 4RBVA 1JLBA 2IRYA 2O1PA 2BBEA 4ZHRB 5KFQA 2ILYA 4K4WA 4NA3A 1S6UA 2WONA 3DDIA 4P10A 4USVA 3J80U 4NCBA 4J9SA 3TW0A 1N5QA 3ZNJ1 1MWZA 2CAJA 4GO7X 1R8HA 4TXSA 3M30A 1T3OA 1TUGB 4NLQA 3BSAA 1MN9A 1T0TV 3GMGA 3TAMA 3VAFA 1JJHA 2WW4A 4CO4A 1CC8A 2HG4A 3NG8A 2XMAA 1U1OA 1VHFA 1FJGF 4OYWA 1X4HA 3H42A 1NPKA 5AXLA 3OV7A 3WHIA 2QA4S 4KH1B 1SIZA 1I51B 4K4ZA 3HM9A 2FLNA 1VQ4S 1MMLA 3WIVA 3MOJB 2GS8A 1WHYA 4C7QA 4X4QA 4CWBA 5U47A 5DGBA 4X4SA 2UUBJ 2M3DA 2HHVA 1B0PA 4XAKA 4OMFG 3CIZA 3IWLA 2HZAA 1F3FA 1LXJA 4WXWA 2HVHA 1AXQA 1X5TA 3FBEA 4J9UE 1JLQA 4IDKA 1KONA 2AKWB 3UW1A 1S49A 3HVRA 5DQHA 3DI6B 2IMOA 3GCWP 4JI1J 5GMKa 5DZ7A 3G82B 4HR2A 5HMXA 4QWBA 1AT1B 2MKKA 2VPXB 2ASJA 2OPPB 1XR6A 1SB6A 5HK4A 5HJXA 1SJ3P 4CNYA 1WUUA 3JTOA 4XPEA 1M5SA 5H9FJ 5LMNF 1NDLA 2ZBCA 4IOBA 4OZ0A 4JYAJ 3OL9A 1DARA 1F2GA 4OYAA 3KLIA 1NPPA 1U1MA 4G6VB 4Y2IA 2D69A 3I0RB 1QAJA 4HHHA 2PA3A 3AOBA 1PBAA 4WFNQ 2UVWA 3KHRA 3KLHB 1U2CA 1ZS6A 4OLOA 4DSJA 1BQMB 2WOMB 3N01A 1WG1A 1IKXB 4NLRA 2IVYA 2M4MA 1WF1A 3AXKA 2R7OA 5LSRA 1L3KA 1RABB 1X0FA 1CSJA 2AGQA 4NI2B 2DH9A 3RZAA 1UFLA 1NH8A 2WZ1A 1U49A 2JC0A 2BRLA 4BLGA 2RT3A 3BPSP 5K14B 2LQ5A 1LEOA 3MM6A 3ZZ0A 2LU2A 3HVTA 5LMNJ 3S6EA 1JLEB 3HVAA 3HX9A 2WB1D 3NGDA 2VDIA 4ZVPB 1T9WA 1VQKS 3VZIA 4B9VA 2MDAA 4PXCA 3ZZUA 2CPDA 1RKIA 3MF5A 4OIXA 4Z2XA 4DV4J 3X3UA 3SMZA 4ECUA 3ENWA 3CULA 3TWZA 3GR1A 2F9JA 3ILIA 2XULA 4MK7A 4CQ1A 1Y10A 3BSOA 2YY3A 2XSFA 3ELHA 3NY0A 4TKTA 3HT0A 2ACMA 3V4MA 3CCJS 2GV1A 3E51A 2OJ3A 4B3RJ 1REGX 4FVCA 4AFFA 1GT8A 1YBTA 1ZPWX 2ACYA 2J7UA 1NBEB 3Q86A 4P9SA 2V4RA 3I4PA 5L1JA 2C2NA 1TV6A 3O3LA 1Z1ZA 2EXUA 3K17A 5KFIA 1IR1A 5E33A 1VJQA 3MMBB 2R9LA 2OEJA 2GQCA 2ZH3A 5KG4A 4CM0A 1LKZA 3R7NB 3FUYA 5KTQA 4F3OA 2IYIA 4F4YA 1SKRA 4OLPA 2GAGC 3I6PA 1WI8A 2VFVA 4QWAA 2NZCA 1RT7A 1VQ7S 4EUVA 6AT1B 3T1HJ 3BGLA 3NXZA 1TP7A 2MHEA 2R3VA 3OTEA 1QSSA 2KVIA 3MGJA 2DNOA 2EWHA 2RDJA 4FF4A 1FE0A 1UZHA 1T03B 1PC5A 1V6HA 2YQ3A 4USJC 5BR8J 2AMCB 3N0VA 1M1KT 2NS1B 4OI6A 2HBQB 1RCOB 4MFBA 5KFEA 4XPCA 2R7WA 3HSGA 1B0TA 4BDPA 2AJ4A 4ZVOB 2VJUA 2BQRA 4F2RA 2V0NA 1HA1A 5DDPC 3FSIA 3AQPA 2C42A 4ID5B 3LW5C 3KG1A 2IA0A 1VQNS 4M5GA 3BGRB 1YJUA 4FBUA 2UV8G 4J9KA 2Y9HA 4CTAB 2HGNA 4Q8FA 3HVTB 2C2EA 4F8RA 4WKRA 2NXNA 1RBLA 1TKXA 3ZO7A 3R2DJ 2DEJA 1Y0HA 2FHJD 1CJUB 3QNWB 1YSJA 2C2OB 4QWEA 5EWGA 1XIQA 4ZKAA 3PKYA 2H4WB 1Q8BA 2Z30B 1IR2A 3D1OA 4KV8B 1KKHA 2BA9A 4EO6A 5IM0A 5JVGQ 1FTRA 1CULB 2I5JA 1J5OA 1AUSL 1OQ3A 1N5YA 4JI3F 4NXNF 1PYTA 3UN2A 1U6BA 3CCMS 2F8EX 1FVQA 1NRKA 1U24A 3A8JA 1Y5LB 4RW7B 4WTYA 3T1AA 3ZZRA 2XCAA 3A8KA 2V94A 3A8EA 1DTQA 1OPIA 3CF5Q 2UXCF 1RZMA 1UEUA 4JI5J 3TZWA 3KLIB 1ZYQA 2R7SA 1RSCA 3SDEB 4FNIA 2F8MA 3M1VB 3OR2A 3MEKA 2H48B 2EKNA 2CZVC 3CJRA 3HVWA 4A8YA 1I5OB 4DXLA 5E2QA 1TQLA 2BE7D 3FQKA 4G1PA 1RHRB 1R7IA 5IOLA 1IXKA 3US5A 3WX8A 2D3O1 2HQIA 3WC0A 1P1TA 1F9HA 1CJVA 1WJ9A 2QLFB 3C6UA 4LF5F 1Y7PA 1KD1T 5IV4A 1KVJA 2ZDPA 2E9ZA 1V5VA 5JVHQ 2CQIA 4ES2A 3VGTA 1VLOA 2AQ4A 1S76D 3CJ0A 1JIHA 2IVMA 4L75A 1RB0A 4JBCA 2GNKA 3Q89A 2BM0A 3BSNA 1NK5A 4JP8A 1Q16B 1SH0A 1WG4A 2QFIA 2FC9A 4R0EA 4ZPTR 2HBYB 3PRDA 1WKKA 1A0OB 3EPGA 4LRAA 4ZS6A 3WX4A 3J81Y 4DL5A 3KLFA 2GMLA 1XNQJ 1UEKA 3PKMA 4P73A 1B0VA 2XMUA 3MPWA 1HI0P 1F0XA 2ROPA 4ITSA 3AA9A 5CZVA 2BKNA 3CPWR 2OPQA 3MEGB 2E5IA 5JJBA 4MIBA 1YJRA 2QV6A 4HLBA 1KP6A 5HMZA 3LF0A 3A8IA 4USWA 5I4MA 1RTDB 2QLXA 4U8VA 1UVIA 2V8VA 2FC8A 3ZXWA 2R7TA 5J1PA 4UT4A 3M2UB 3QT7A 5K8MA 1EHWA 3PX0A 1KRPA 4YR2A 5HP1A 3X1LB 3ETMA 4DR5J 2GJ2A 2WTFA 4ALZA 3NGRA 5F0WA 2IFXA 1XMQF 2FB0A 4JB8B 1SI9A 2XC9A 1BXNA 3N28A 4KGKA 1CQMA 5EDWA 2CG4A 4I6WA 5KT3A 3Q8QB 3G4SS 4ZP6A 2NR0A 3UQSA 3KTQA 3D6HB 4YP3A 4GMKA 2HNZA 1FCAA 3GONA 3MMCB 1AB8A 5A8RA 4YB7A 5IWAJ 2XO7A 2DPJA 2H5JB 2XZTB 4CCHA 7AT1B 3BQ1A 3V6JA 4AD6A 5EWFA 3FFIB 3IBFB 2DK2A 2HRTA 1HD0A 2VC1A 2FYXA 2PFDA 4Y0FA 3D2WA 3UD3P 1U8WA 2GC8A 3FBFA 1DAXA 4AYBD 5B7WA 3DC2A 4C48A 4C8OA 1XNRJ 4KGXB 3K5NA 2ZH4A 4ELUA 5IT4A 1VQ8S 2RF2A 3I31A 2GA7A 3EXCX 3J81j 1M1GA 1KFSA 2EFPA 4QR2A 4CLZA 4DWIA 4NPOA 1IN0A 5BJRA 1RTIA 2LMIA 2DD8S 2Y0BB 1CG2A 3HSZA 3M2VA 2MGZA 3TAPA 1QE1B 2HMIA 2XS5A 2B9YA 3F0NA 2A3JA 1U26A 2IPOB 1F6TA 1VISA 1Z4UA 3J7A1 1P9QC 4HL9A 4P75A 1NK4A 5C2GA 1DJ0A 3OUYA 4C8ZA 4UUXA 3PACA 4MKVA 5A8KB 5K8OA 4DDFA 3PX4A 3CCWA 2IY5B 2B5JB 3OUYB 1SQGA 5CXTA 3SV4A 3MECB 2G13A 2I1RA 1DHMA 5I42A 3HP6A 3DCAA 1NJWA 3DLEB 3TUPA 2Q6CA 2K2PA 1N48A 4I0WA 1LK7A 1NM2A 2QL5B 4FPRA 3UDLA 1H72C 4URGA 3HHLC 5F8IA 3ENAA 2IC3B 5C2CA 3CMES 3MEDB 3FDSA 3UD5A 3HMJG 3KJVB 1RT1B 1WEZA 4DG1B 2FLLA 1KHVA 1S1TB 2FLOA 3R27A 4F4XA 2FVQA 2PI5A 3CD5A 2ZM6F 4PG5A 2BQUA 2HHQA 3W2WB 2DGXA 3Q8RB 4K4XA 1VYAA 4TU8A 2V4QA 3K5LA 2CXEA 4NLTA 2HNDA 3E3XA 4LVNP 2YWWA 4TVAB 4FYWB 4YDXA 4ZVQB 4R8UA 1L5UA 2HHHJ 2W4CA 3FMWA 4CO5A 3BO4A 1NJXA 3U7JA 1U1NA 4B3MF 4CLWA 3SFGA 4KIAA 4D3HA 5GADI 2RQMA 3M8ZA 4IG0B 3OL7A 3JYTB 1QUVA 3MHYA 2JJ4D 4LF2A 2OEMA 2IDEA 2MKJA 3M8WA 3MURP 1SQFA 3BGOP 1PG5B 2G2ZA 4CYUB 4Y2KA 3OJUA 1VQOS 1PCAA 2J9DA 4P6QA 4K4UA 5C7PA 4KO0B 3H25A 2HGLA 5J2NA 1HYSB 2XTJP 5HQLA 5SZTA 3IBWA 4X65F 5B0CA 2IAJA 2BJ3A 3MEEA 4URSA 1CJKA 2HQDA 4OZNA 4YB6A 1S1WA 4WE1B 2B9EA 3T1HF 2ASLA 4LF7F 2AP6A 1RUSA 5DM7Q 3RU0A 1VBYA 2R8JA 2K8GA 4IH6A 1VHIA 3D3BJ 3M6XA 3ONQA 2C3YA 4CO0A 2QRRA 1NCLA 4UZBA 4ED4A 2MJUA 1UVKA 4KKOA 1PC4A 2VPZB 4QWCA 5HLFA 3NRBA 1PSDA 1IKYA 4CLUA 3UCUP 3KNGA 4ANEA 2CJXB 4IRDA 2JWNA 2OGUA 2QFJA 3OPKA 5L38A 3UE2A 2AIRB 3WIUA 1D8ZA 1RAOA 2GJFA 3ICLA 4H4KC 1XBWA 1T8EA 3JSMB 4WFXA 4P71A 1ZM4A 1U45A 4QWDA 4IKAA 1HPZA 4F0HA 1QAXA 1GK8A 4YOEA 5DM6Q 3T5JA 3V81A 2W1BA 1E6VA 3RRKA 4FS2A 1PAEX 3NAHA 2W2MP 3R8YA 3KKFA 3VQTA 3J7ZT 1PILA 2E44A 2F3JA 4ECQA 2FUG9 2GMHA 2OHDA 3GSIA 3KLGB 2HK3A 2XHCA 4CH7A 1NDPA 1RU1A 4PYAA 4DLGA 4HHUA 3TVZA 3WQPA 4O0IA 3EPIA 2HFOA 4DV4F 1HQUB 1E6YB 4L76A 2AJ1A 2E29A 3AD8C 1KTQA 1UJ5A 4ZVGA 5KFYA 1D9DA 3NMAA 2XGPA 4ZVHA 5D4LA 2DIUA 1FRHA 2PE8A 3QRRA 2V50A 3D0GE 4KGVB 3TA0A 3W63A 4FNHA 3DLHA 3P49B 2I8EA 4EZ9A 3IS9B 4FP9A 4CO1A 3I5CA 4OHZA 4ECWA 5J2PA 1XNRF 5AJ3J 4W92B 1S6QB 3SXLA 2CQPA 2W2NP 3IC1A 1DURA 2C3OA 1DTTB 2OELA 3PJWA 2KJWA 5LJ3Y 1X9MA 4DL7A 4LJMA 1HMVA 1RI7A 2I5JB 2N7YA 4ZVRB 1KEKA 4U67Q 4NLDA 3UDEA 2J6SA 1CEZA 2XI2A 4DX6A 2J0SD 2H4YB 2Z58B 2LKZA 3FGVA 3QSIA 4G1QA 5ETPA 2VDHA 5L1IA 4CO3A 5CYJA 4LF8F 1QLNA 1IJFB 2L08A 2KB2A 2IYGA 1HW8A 4OZJA 4QPXA 4N56A 2J9CA 1QM9A 2XHWA 3MMCA 4PG8A 2HNZB 3MM9A 4BC7A 1FJEB 4JI2J 1NKEA 4Q2MA 3ZZYA 4LFBJ 2LEPA 4BCAA 3D7SB 5ETVA 5CCLA 2HQFA 3MUVP 2BJDA 1SCJB 2AGPA 3H2UB 3IFEA 2MB0B 4Y34A 8ATCB 3KJFB 2HAIA 3ZTPA 3IRWP 1UFKA 1VIOA 4KY3A 3H2LA 4LIWA 2WRMA 4K4VA 1HWUA 3D28A 3D6FB 1YG0A 4DPUA 5KG1A 3P8BB 1ZAWA 3KJNB 1FRXA 5DRKA 5LL6d 3QWUA 2W25A 5M2UA 4FYVB 4OX9J 4FF2A 3RBXA 2EC2A 1KOHA 5A8WB 3DDNA 1KQKA 2HVIA 4WZQA 1N54B 3TOQA 4NLVA 1IM6A 1S12A 4C11B 1Y11A 1WOSA 4QIVA 5LXYA 2WB4A 3SSSA 1FDBA 4DU7A 4EI2A 4ZIVA 5A8KA 1KSPA 4B3OA 2RVJA 1KVKA 1AZSB 2HHXA 1S9EA 1QUPA 2HEKA 3NNHA 3IRXA 3R5JB 1FRLA 1NHVA 3S7RA 3QWPA 4LRDA 5KFJA 3IG1A 2NZ4A 4L74A 2VA3A 3NBPB 5C24A 1UEVA 4C3KA 5KFOA 1LWCA 1D09B 2F8HA 3O8WA 1T94A 2GW8A 3PYDA 4DR4J 3KJVA 3TZZA 4B3TJ 4HT7A 4WU2A 1V9OA 3AOCA 1W2IA 5KT5A 4PUOA 3DU6A 2GVZB 2YH0A 2ABYA 2GCFA 2J9DE 2V8DA 4QR0A 2R8KA 1OY9A 2V34A 2AJFE 1CS4A 4AXJA 5A6PA 2UVRA 5HLFB 1WDTA 5KT2A 3E2EA 3TA2A 4KHRA 4CI0B 1IBLF 1D8YA 1X5SA 4M5IA 4C2MA 1WNEA 2RH3A 1SBRA 2YXLA 1SKWA 4WPAA 3Q0AA 1IM4A 1ZTWA 2CQ4A 2DVIA 3F73A 3CXCR 2V2QA 4G1IA 1JKHB 5A76A 3JAMU 1DTQB 3PEHA 3Q24A 1RKJA 3L7OA 4C8LA 2OSRA 4PCQA 4O3OA 1E6VB 3MEEB 5D0HA 2LP4A 3OTCA 1BY9A 2YQ1A 4UOHA 2GIQA 1HNXF 3KK2A 4I7FA 4LF6F 1OO0B 4I68A 4WP3A 2F9DA 2CJBA 3C6TA 3PV8A 3ISND 3HFKA 2E7VA 4B3SF 4FPIA 1RBOB 3K2YA 4RNOA 1S0VA 2M0GB 4NRUA 2F5GA 2HZVA 3C3LA 3T1YF 2IBKA 3CJ3A 1WC3A 4RWWA 4DR1J 3PW5A 3EZOA 1X5OA 2K06A 4H4OA 3BGFA 1TMMA 4NLWA 5DJBA 2QLJB 3SQGA 4WF9Q 4ECZA 1HL6A 3F44A 4X4VA 2RILA 3N9UC 3R3TA 2D9OA 1N32J 3I9ZA 4AQYF 4DS5A 2ZHOA 4QIFA 3PR4A 4IH5A 1N0VC 4RLEA 1R89A 3F56A 4O23A 4OI2A 3GIKA 3CD0A 3FVYA 5HROB 1RLDA 4JI8F 3GU0A 3N5FA 1Y3KA 4NYOA 2YVSA 1RCXB 4CZCA 2CNLB 2PIIA 1Q4RA 3QO9A 2QLWA 3GTYX 2I0XA 3IRXB 1C0UA 3NCPA 4QR1A 3T19A 2R42A 4C3LA 4IOAQ 1IJEB 3QFHA 4ED0A 1J5EJ 3N6LA 4DPYA 4WYLA 4CLSA 1YQHA 1WF0A 3HXMA 1DZ5A 2FJWA 3M1VA 3N6MA 2F63A 2QA1A 3FCHA 3LAMA 5KAKA 1FWKA 1SC4B 1YGYA 5KFBA 3MFHA 4DV7F 3MCNA 1RT2B 2FJAB 2YBVA 4WP8A 1CS4B 3GB0A 2P6TA 3LP2B 5KFTA 4X64J 2QEXS 4LR9A 9ATCB 3GFZA 4YN3B 3TJAA 4EK2A 1TKTB 3BJYA 3IAS9 3MUMP 1O5JA 1NK9A 1NJIT 4DPXA 1SC3B 3ULHA 2OTLS 3MR6A 5HL7Q 3CD6S 2AX1A 1HPZB 4YY3J 4HACB 1IQTA 2VPWB 4RPFA 3GZ7A 4CT8A 2DNNA 3QQCD 2KT2A 1U2RA 3NOGA 4M5JA 2W9CB 3DMJA 4F7VA 3QJLA 2U1AA 3I96A 2F4VJ 4KGMA 2G1DA 2QG9B 2YPZA 2YWGA 3EVMA 1LW0A 5CQGA 4R5PB 3ZTRA 2IM2A 3HULA 5DQGA 5MLCV 5GVQA 1AZSA 3M7VA 3MM9B 5L9NA 2BJ9A 1SJRA 1S9EB 4OYMA 4WXOA 5AXKA 3MM8B 3NLCA 2BABA 3IR5B 3OFGA 1HBOB 2WVEA 4HTIA 1U8SA 3W9HA 2UXCJ 2E1RA 1NDCA 3FSYA 1DQAA 1RJJA 3OVAA 5H9FK 2RDIA 3H4DA 4RKUC 3QATA 4C9DA 3L7UA 4IFVB 2W2PP 2JLGA 2PSZA 1UJ4A 3QGPA 1OY8A 3EDRB 4J9PA 1S72S 1FJCA 3QJJA 1FE4A 1U2FA 1UWBB 3RAXA 1UWAA 2YH1A 1ACMB 1HQEB 4FZVA 3Q8YA 5CCMA 3R6LB 1S1XA 2P9EA 4IG0A 3DM2A 4M5LA 2V69A 5KFZA 3N5BA 4ZVSB 5IWAF 2CVEA 3EGWB 4H4OB 3A4TA 3CCLS 4X66F 1VRTB 1WOOA 2GHPA 3AB2B 4DR6J 3OT9A 2F4VF 2EBEA 3T6JA 2RD5C 2LXFA 2DRBA 1SC6A 3LP1A 1Y3JA 3CSKA 3I0SB 3M9OB 4EBDA 4JYAF 2B0GA 1MG7A 1K0TA 3DFEA 2DR5A 2R7XA 1B7YB 4WFYA 4ECTA 3KJQB 2RHSB 2C2RA 1EIYB 2BDPA 1KN6A 4F26A 2RMLA 5IQQA 4BC9A 4QYRA 5I3UB 2IC3A 4M63A 2GO9A 1ZM2A 1S6QA 1HFEL 3NNCA 5KG3A 3P6YC 3QIDA 3IMQJ 4F4WA 2CJAA 3SSRA 2J8SA 3IAM9 1C1BA 1V3RA 4Z7YA 4YY3F 3PJ9A 2XLJA 3KMQA 4O44B 4LF5J 2NLWA 4X4TA 4YB1P 4G3IA 2ALZA 4BHQA 1DY3A 3TYTA 1D0EA 2EI5A 4Q7AA 4B3MJ 2KH9A 4ZCIA 2DCLA 4MKAA 3SV3A 1XERA 4HEA9 4B3OB 4KH0B 4NCAA 2DY9A 2V2KA 4P2XA 2VHGA 4PG6A 1LWXA 3EJMA 4OYXA 5DG8A 1SIWB 4ZPBA 3Q22A 4EEYA 2GJIA 5D0GA 3TARA 1UW4A 2P2CB 1TMJA 2AHOB 4K7QA 1RHKB 2QYCA 4RW7A 3VGUA 2CQ1A 3OHBA 3VAHA 1U1KA 1XMOJ 4LFAJ 1NNDA 3O2IA 1JX4A 1AUDA 3FNNA 3I9V9 4B9UA 5T41A 5L39A 4C4WA 1NK0A 2BACA 4O3QA 5KFSA 3PXGa 1ZETA 4JI8J 1ZTTA 1RAEB 3ISZA 4PG7A 3BO2A 2W4PA 2MMYA 4IO1A 2VQEJ 4IO9Q 4RUHA 4FXWA 5AT1B 4CH1A 4F67A 1QVGR 2BJ8A 3DHXA 3DXSX 3RUBL 4C0HA 3T1YJ 4AQYJ 4Z7CA 3KK1B 5HVGA 2CRLA 1YZ6A 3QSYB 4ZLNA 1G2EA 5C5JA 4C8NA 3H7HB 2F1FA 1UPMB 3TQEA 3SIPB 1IBKF 3VCDA 5DETA 3IXQA 2HVZA 3P45B 1WTBA 4OJGA 5J1NA 5B0BA 2LLZA 4DHVA 1PBUA 3DLGA 4IR9A 1CJKB 2F65A 2C28A 2ZUAA 1HBMA 1S1WB 4RW8B 4WE1A 3DHWC 5M2RA 3WC2A 4NXNJ 1WC6A 2X1FA 2N4CA 3BBBA 1OYDA 5KFRA 3KUEA 3TANA 1T9TA 2V2ZA 3IA0A 1XQIA 2CUYA 4KO0A 4PWWA 2VA2A 3G2XA 1NZAA 1VJWA 1WWHA 4ZOSA 4IG3A 4DV3F 3W7BA 4DX8H 1BQMA 1R43A 2YX1A 2ZKTA 4ZIWA 1HR0F 2MZ1A 4ELVA 2MEWA 1RK8A 3MEGA 2R8IA 4DL3A 1PYSB 4RUCA 2AEMA 1HBOA 4ZJQA 2ROEA 3SYZA 2YKNA 1VC0A 4U9RA 3HF5A 2FGOA 1U0HB 2DBBA 2XZDB 3VAKA 2BJEA 2HNDB 2RUSA 4DFJA 1JLAA 3CCRS 1HBNA 4OFZA 1S1TA 4DI6A 4ZP7A 1WC4A 5FLXU 5CD4H 1UA0A 4K50A 4O4RA 4AL5A 1NHUA 5DG9A 4P7VA 4ZLLA 1YRXA 3TI0A 3BQ0A 2QTWA 5KFUA 3LWMA 4ZPAA 3AJ1A 4C98A 5L1KA 3CNQP 1I3OB 1DTTA 3JSMA 2DGOA 4HKQA 4ANCA 3MM5B 1HBUB 4LBIA 4ED5A 5DDRC 4USIA 2BX6A 3NGUA 1T7PA 3RW6A 3CCZA 2E1AA 1X9SA 1AFJA 3OD2A 4ZA1A 3GJTB 3MECA 3VGVA 4RWXA 2CJYB 1RADB 3BS9A 1NJYA 3L95X 3VVUA 1E6YA 4FKXA 3RG6A 3CJKB 4DF4A 1R0AB 3T5LA 3HCXA 2ZHAA 5HVFA 4QYZJ 2KI2A 4JV5J 2XMKA 3RB6A 2MGZB 1S1VA 4DR5F 2AJQA 1WHWA 3TUIC 3B82A 4ZN1A 2ZD1A 2P9GA 4LFCJ 3OR1A 2VBZA 5CYMA 3PIPQ 2DXDA 2VPYB 4GVLA 1RT3B 2M70A 3VR1A 5K8PA 2GHVC 4DQPA 4NLXA 5HQMA 1CJUA 3SZ2A 4ZPDA 4RNHA 3I32A 1XMOF 4DX7A 4DPOA 1YVFA 3DLBA 1FD2A 3V5RA 5CA5A 2MYFA 3V4IA 1X4DA 1SPBP 5A8RB 3HPOA 4B9SA 4MIWA 3TZXA 3HHLD 2EW9A 1S79A 2XQCA 1T3NA 4EZ6A 3IWXA 2V9KA 3Q8PB 2HURA 4ZCLA 4JI5F 1LW2B 3SQOP 4YQWA 4P74A 2UVVA 2WAQD 3CWJA 4I7FB 3U02A 2Z56B 4OHYA 1NH7A 3HKWA 3E01B 4FKYA 1FNMA 1FRIA 4FF1A 4OJHA 4DL0C 5JMNA 3TQ1A 1H2TZ 5FDLA 1S97A 2E5LF 2IBOA 4ZVFA 1C0TB 1LQ9A 4I2QB 1CJVB 1X4AA 2FIUA 5K5MA 2HBRB 2M88A 2RQCA 1FEHA 2HWHA 2LEAA 1NKCA 2CZ4A 2IRXA 2HZCA 1BHNA 3MI7X 5J2QA 5G0RA 2FQQB 1IBLJ 2B5JA 1N5TA 2VFSA 1IBKJ 4H54A 2KN4A 3UNGC 5KFAA 3FCVA 4RNFA 1YZ7A 2DGUA 2MJNA 2ZC3A 4RUBA 3R9LA 3THTA 2VJVA 1Q8KA 3BB5A 1UPPA 2VFTA 5KOXA 3QLHA 3DGPA 1UETA 5A2QU 2CPHA
chains in the Genus database with same CATH topology
4C6AA 1W7WA 4EK2A 1XIQA 4ANDA 2ZUAA 3ZTPA 1F3FA 3ENAA 3BBBA 4W98A 3FBEA 1XQIA 1NB2A 2B8QA 3G2XA 1NDKA 3BBFA 4HR2A 4F4AA 4ENOA 3EVMA 2DXEA 1VYAA 3ZTRA 3Q83A 3JS9A 2AZ1A 1HIYA 3NGTA 1NDLA 1UCNA 3Q8VA 1NDCA 5IOLA 3VGSA 3WX8A 1B4SA 2HVEA 4DI6A 1KDNA 1ZS6A 3L7UA 1NLKL 3Q8UA 1B99A 1NHKL 3ZTQA 3EVOA 3VGTA 1NSKL 5C7PA 1K44A 3FKBA 1HHQA 3EICA 1HLWA 3Q89A 4ANCA 3Q8YA 2BX6A 2HVDA 3BBCA 3NGUA 1WKKA 1LEOA 2BEFA 1S5ZA 4UOGA 3VGVA 1NCLA 3FBBA 3FCWA 3VVUA 4FKXA 3NGSA 3ZTOA 4ANEA 1BE4A 2DXFA 1NUEA 3EM1A 4DZ6A 3DKDA 3EVWA 5CAAA 1WKLA 3EE3A 3ELHA 2AZ3A 1EHWA 4WBFA 3BH6B 4UOHA 2DXDA 2B8PA 3ETMA 3EMTA 1PAEX 3Q86A 3B54A 3PJ9A 3NGRA 4UOFA 1NDPA 1S57A 2NCKL 3MPDA 3FBCA 1NSQA 1BUXA 2DY9A 3VVTA 4S0MA 3FC9A 3B6BA 3EJMA 1LWXA 2HURA 4F36A 3VGUA 2CWKA 4DUTA 1U8WA 3FBFA 2DYAA 3GP9A 3PRVA 4FKYA 1S59A 5BXIA 4CP5A 4KPCA 3DDIA 1PKUA 4O0NA 1JXVA 1MN7A 1BHNA 1NSPA 1F6TA 1MN9A 5CABA 1WKJA 3BH7B 3FCVA 2VU5A 3R9LA 3GPAA 3ZTSA 1NPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C6A A;  1W7W A;  4EK2 A;  1XIQ A;  4AND A;  2ZUA A;  3ZTP A;  1F3F A;  3ENA A;  3BBB A;  4W98 A;  3FBE A;  1XQI A;  1NB2 A;  2B8Q A;  3G2X A;  1NDK A;  3BBF A;  4HR2 A;  4F4A A;  4ENO A;  3EVM A;  2DXE A;  1VYA A;  3ZTR A;  3Q83 A;  3JS9 A;  2AZ1 A;  1HIY A;  3NGT A;  1NDL A;  1UCN A;  3Q8V A;  1NDC A;  5IOL A;  3VGS A;  3WX8 A;  1B4S A;  2HVE A;  4DI6 A;  1KDN A;  1ZS6 A;  3L7U A;  1NLK L;  3Q8U A;  1B99 A;  1NHK L;  3ZTQ A;  3EVO A;  3VGT A;  1NSK L;  5C7P A;  1K44 A;  3FKB A;  1HHQ A;  3EIC A;  1HLW A;  3Q89 A;  4ANC A;  3Q8Y A;  2BX6 A;  2HVD A;  3BBC A;  3NGU A;  1WKK A;  1LEO A;  2BEF A;  1S5Z A;  4UOG A;  3VGV A;  1NCL A;  3FBB A;  3FCW A;  3VVU A;  4FKX A;  3NGS A;  3ZTO A;  4ANE A;  1BE4 A;  2DXF A;  1NUE A;  3EM1 A;  4DZ6 A;  3DKD A;  3EVW A;  5CAA A;  1WKL A;  3EE3 A;  3ELH A;  2AZ3 A;  1EHW A;  4WBF A;  3BH6 B;  4UOH A;  2DXD A;  2B8P A;  3ETM A;  3EMT A;  1PAE X;  3Q86 A;  3B54 A;  3PJ9 A;  3NGR A;  4UOF A;  1NDP A;  1S57 A;  2NCK L;  3MPD A;  3FBC A;  1NSQ A;  1BUX A;  2DY9 A;  3VVT A;  4S0M A;  3FC9 A;  3B6B A;  3EJM A;  1LWX A;  2HUR A;  4F36 A;  3VGU A;  2CWK A;  4DUT A;  1U8W A;  3FBF A;  2DYA A;  3GP9 A;  3PRV A;  4FKY A;  1S59 A;  5BXI A;  4CP5 A;  4KPC A;  3DDI A;  1PKU A;  4O0N A;  1JXV A;  1MN7 A;  1BHN A;  1NSP A;  1F6T A;  1MN9 A;  5CAB A;  1WKJ A;  3BH7 B;  3FCV A;  2VU5 A;  3R9L A;  3GPA A;  3ZTS A;  1NPK A; 
#chains in the Genus database with same CATH topology
 2OUG A;  5A2Q Y;  3J7Y U;  3KG4 A;  1WHX A;  3KLF B;  2E66 A;  5T7L B;  4NLO A;  1C4A A;  4B3T F;  3Q2T C;  5KOW A;  1GH8 A;  2UUA F;  4J9O A;  4DV3 J;  1RT1 A;  3LAN A;  1FDN A;  1Q1K A;  2RF2 B;  3GE9 A;  3MPV A;  4LVO P;  1JLB B;  3UR3 C;  4DEZ A;  4DN9 A;  4W98 A;  2JSX A;  3N6N A;  4BS2 A;  1G7C B;  3TO8 A;  3G87 A;  2DNM A;  2E7X A;  2OLW A;  3VAI A;  2ZH9 A;  2MPU A;  2KT3 A;  2DEI A;  3C6U B;  3LH2 S;  4DV1 J;  3GJR B;  2WSF C;  3M32 B;  2HS3 A;  4WYW A;  1TAU A;  1FF2 A;  2EPI A;  3G86 A;  3QJP A;  3GWC A;  4FXV A;  4XO0 A;  1K47 A;  3PO5 A;  4HYK A;  1Q8I A;  2DR6 A;  4RBT A;  3LOU A;  1X8D A;  3NGT A;  5F41 A;  2UXB J;  3W62 A;  2R7U A;  1HNZ J;  3VGS A;  2DNP A;  1S7I A;  3N4W A;  3MM6 B;  4FN5 A;  3DXB A;  2JVO A;  3PHE A;  4MTP A;  2R2R A;  1A9N B;  4JOU A;  3MTK A;  3OSP A;  4U6P A;  2QX0 A;  3C16 A;  2HS0 A;  4LRE A;  5KFF A;  3DLK B;  5BR8 F;  5HP1 B;  1QAI A;  1EET A;  3H20 A;  2HK2 A;  4ED6 A;  2N3L A;  1J5O B;  4N5S A;  2JEJ A;  3RR7 A;  2FVC A;  1HHQ A;  2L48 A;  1YK9 A;  2DNK A;  2ZH5 A;  4IFY B;  1RU2 A;  3GYG A;  4L73 A;  1LWF B;  2D3Z A;  5J1E B;  1HI1 A;  3IGV A;  3KLH A;  1P6T A;  2D1C A;  2VBX A;  3GIR A;  1NME B;  4ZP8 A;  9RUB A;  1YJ9 S;  4P7T A;  1M5O C;  2UUC F;  4X4N A;  3AOD A;  1EB0 A;  2ATC B;  3BZQ A;  5E0O A;  1MMD A;  2MQL A;  4LF8 J;  2WVD A;  4HH0 A;  4UST A;  1R6V A;  2YNI B;  2DJW A;  4ES3 A;  4X66 J;  3V2U C;  1Q8L A;  2EK6 A;  3HHK A;  4NLS A;  4OHX A;  1YBU A;  7FD1 A;  2YKM B;  2J9E A;  1RAH B;  4LSN A;  1WEL A;  1D9A A;  3B8H A;  4JUZ A;  4DSI A;  2RKI B;  4YB5 A;  1G1X A;  1T9X A;  3CMA S;  1FKP A;  3G82 A;  3LUY A;  3BM7 A;  4CLK A;  3OFF A;  1SV5 B;  2CAD A;  3MCO A;  3VHQ A;  2AZ3 A;  2ZM6 J;  2ZH8 A;  4P52 A;  3G6E S;  1N36 F;  4K4T A;  3IN5 A;  3EGZ A;  1ZAV A;  2B8P A;  1SV5 A;  3EMT A;  4WU3 A;  2KKH A;  3TRG A;  1KHW A;  3VTI A;  2CNO B;  1RHM B;  2RRA A;  1PYO B;  3NKY A;  3M8S A;  1S0M A;  3T9Z A;  5L9X A;  1S4F A;  2DGT A;  3D5M A;  3SEO A;  2YNI A;  4DPT A;  3FBC A;  5AE1 A;  2J6T A;  1GXU A;  2WVB A;  3OR2 B;  4L72 B;  4TN2 A;  4KQZ A;  2ZH6 A;  2XB2 D;  1S7H A;  1N5V A;  5ETQ A;  1MNE A;  3B78 A;  1KLN A;  3RTV A;  4OI1 A;  1K8A T;  2VFR A;  1TFY A;  2DB1 A;  2DCU B;  2L3M A;  5E3C A;  2CWK A;  2CVI A;  5C42 A;  3UCZ P;  2AJ0 A;  2VD3 A;  2J7W A;  1JMT A;  2KVQ E;  3VV2 B;  1VOM A;  2OPS A;  4N47 A;  5BXI A;  5LMU J;  1C0T A;  2V5H G;  3CJT A;  2JFD A;  2VUG A;  3M05 A;  3MTJ A;  4AL6 A;  3GYN A;  2E9R X;  1TAQ A;  2J8A A;  4K59 A;  5KT4 A;  2OTJ S;  2XLI A;  2ZOF A;  2ASY A;  3CJ4 A;  3RGI A;  5T14 A;  2ALY B;  2ZBR A;  2ZZM A;  1TKX B;  3UR0 A;  2QL9 B;  4OI4 A;  5C25 A;  5AXN A;  5MAO A;  3AAW B;  3BN7 A;  4Y2C A;  5CAB A;  1L3V A;  3RW7 A;  1F5C A;  1VMB A;  4JI4 F;  3QGH A;  4LQ9 A;  5E3P A;  3OQ2 A;  4RO0 A;  3GJS B;  3P5T L;  3PDN A;  4IRC A;  4PWU A;  3RR8 A;  1TL3 B;  2JDJ A;  2UU9 F;  3V6K A;  3Q8S B;  2ZH2 A;  2B3T B;  5D0R A;  4MFB B;  5E3Q A;  4J7C A;  4AXI A;  2J5A A;  4WWS A;  1S1U A;  1WI6 A;  4C6A A;  1JXE A;  4CO2 A;  1IKV A;  1ZZN A;  4A8X A;  1LWF A;  2IAJ B;  2O01 C;  3CJ2 A;  4X62 J;  3KDO A;  4CDI A;  5CZX A;  1RWO B;  5HMY A;  2FDN A;  3W9J A;  3KLE B;  1GTE A;  3NS7 B;  1RTD A;  1F2H A;  1NDK A;  5AXM A;  1RT5 A;  3BBF A;  1FXD A;  1SQE A;  1TL1 A;  2UXB F;  2KFZ A;  3IP0 A;  2FY8 A;  2VQF J;  5GAE U;  2DO0 A;  1Y9O A;  1RAA B;  3I87 A;  3NS6 A;  4CLT A;  1T11 A;  3TAM B;  4Q0B B;  2YNG B;  1P1L A;  4GVB B;  4I6A A;  5L8R C;  2BYC A;  1H2V Z;  5GAH I;  1H7X A;  4QPT A;  5D15 A;  4QW9 A;  4A8Q A;  4EWT A;  2YPY A;  1NLK L;  3T9N A;  4J9M A;  1B99 A;  1RTH A;  3MED A;  1MU2 B;  3GIL A;  3M2R A;  3PX6 A;  1U1R A;  5DS7 A;  2JX2 A;  3R1H A;  1YI2 S;  2HWI A;  5K9F A;  2XO6 A;  3CCS S;  1EP4 B;  1R0C B;  4DCO B;  3J80 Y;  1UW9 A;  1RTH B;  2VF3 A;  2XMJ A;  3GFX A;  4TNO A;  1UMJ A;  2RJZ A;  5KT6 A;  2RRN A;  1OPZ A;  1R31 A;  2A2D A;  1XMB A;  1KWM A;  2B7C B;  2PD1 A;  2V67 A;  2Z4P A;  3TJ9 A;  1S0O A;  1IBM J;  3CO0 P;  4M5H A;  3SCJ E;  2E9T A;  1N6Q B;  2C3M A;  1RAF B;  3FJ2 A;  2DTJ A;  3FEZ A;  2BKO A;  3FZB A;  3PRB A;  1K73 T;  2KT5 A;  3U1M A;  2BE2 A;  3LA0 A;  4Y00 A;  1SJ1 A;  3P4U B;  1TZ0 A;  2KXH A;  5KFK A;  4DQS A;  3TR5 A;  1N33 F;  2HQC A;  2AYB A;  3DM2 B;  4DZ6 A;  5HSP A;  4A4J A;  3M8P A;  1RHQ B;  1K1Q A;  1WKL A;  3GSD A;  2ERR A;  2CA9 A;  2JHE A;  4DOZ A;  3A1Y G;  1S9G A;  1FFS B;  3BDE A;  3QPI A;  2QN6 B;  1FWL A;  3QT5 A;  1C4C A;  1RT4 B;  2CWX A;  4U7C A;  3CCQ S;  4Q43 A;  5LMU F;  4U96 A;  1H74 A;  1R8B A;  1RP5 A;  3OFE A;  4MK9 A;  3ILL A;  5E3R A;  3ENQ A;  3FFI A;  3CC7 S;  2W2O P;  1G4C A;  3Q23 A;  1R0A A;  4OYZ A;  4UY8 T;  4JV2 A;  1X4C A;  1FDD A;  1EZZ B;  4N77 A;  3QAE A;  2KFN A;  3BRE A;  4BBY A;  3H59 A;  1A7G E;  3AT1 B;  1CPZ A;  3NOC A;  4LMZ A;  4CH0 S;  2D9P A;  3VVT A;  2XWX A;  3K7R A;  2LDY A;  4OZ5 A;  4C97 A;  4DS4 A;  2DR7 A;  1FXR A;  4I6Y A;  2DH8 A;  4PXD A;  3H90 A;  3PY8 A;  1C2P A;  2OAU A;  5HBM B;  4PEO A;  5KFM A;  4DMZ A;  1X4G A;  3LWL A;  3PW4 A;  3LAL A;  5K14 A;  2IJF A;  4A8M P;  2AD9 A;  2C1E B;  3BO3 A;  4YDD B;  4X65 J;  1VCT A;  2JL9 A;  3MAQ A;  3MPU B;  4JV5 F;  1RT4 A;  5IFM A;  2VOP A;  3OR1 B;  1SL1 A;  4CP5 A;  1VLY A;  3DOL B;  1VRU B;  3GYX B;  2Z2M A;  3EZ5 A;  1RWX B;  2IVF B;  3GJQ B;  1Q7L B;  3NS5 A;  1VIX A;  4YR0 A;  3NP5 A;  2MZR A;  4KJI A;  2YNG A;  4GVB A;  2UU9 J;  2CQ2 A;  2GGP A;  1SUQ B;  4UW2 A;  3QZ8 A;  3RRH A;  3CCV S;  4HTJ A;  1SL2 A;  3PYE A;  4PR6 A;  2W2Q P;  5KFW A;  4JI0 J;  3ZTS A;  4USK A;  2ATL A;  2YKN B;  2JLE A;  2YNF B;  4OV6 A;  4RR5 A;  1NK7 A;  5KFC A;  2A0F B;  2GQQ A;  4YHH F;  1RAG B;  3QIP A;  4UF4 A;  5F3Z A;  2B43 A;  2W7P A;  4DV6 J;  4PRF A;  4O44 A;  4DUZ J;  4TU7 A;  1C1B B;  1VRU A;  2G2O A;  5LSL A;  4ILM A;  2FD2 A;  4ZVE A;  2QC3 A;  5BYS A;  2NXC A;  3H40 A;  1N36 J;  5D0E A;  5AJ3 F;  3OSN A;  3K59 A;  2UUA J;  3GV8 B;  1TKZ B;  3HHL B;  3HFV A;  1EQM A;  3UWT A;  1GXL A;  2DHH A;  4FXD A;  2J7K A;  3V6H A;  1FRJ A;  2CQC A;  2Q3P A;  4UZC A;  4ENO A;  5GAG U;  2U2F A;  3MR3 A;  2DXE A;  2VG7 A;  4OYP A;  1HNW F;  4M95 A;  3ZNU A;  1NJZ A;  5DGA A;  2L9N A;  2AZ1 A;  2KZM A;  4LF9 J;  2EFO A;  1EQ0 A;  2MQM A;  1VRT A;  3R7B B;  1Y00 A;  1TU0 B;  1MRO A;  2RIJ A;  2QA2 A;  4HI2 A;  1S10 A;  3I55 S;  1SJF A;  4MH8 A;  3W5X A;  3N79 A;  2IM1 A;  3KK2 B;  2VON A;  4NI2 A;  5HQ8 A;  2E5L J;  4WKY A;  1JJC B;  1LWE A;  3PHT A;  1M5K C;  5SUH A;  2FZG B;  2ZD1 B;  1HLW A;  3LP0 A;  1V5I B;  1S99 A;  2VG5 B;  2XMW A;  1D3W A;  3DU5 A;  4ATN A;  3EX7 B;  1FKO B;  4ECR A;  4MKY A;  4URQ U;  1UVL A;  3KOA A;  1OIA A;  1K9M T;  5ETR A;  6FDR A;  4H4M B;  4LF9 F;  2M8D B;  4UUW A;  1SKU B;  2NUH A;  4DV2 J;  2JZ5 A;  7FDR A;  4F4Z A;  2OD4 A;  3MOZ A;  2YWE A;  3UFC X;  4OI3 A;  5GME A;  5EHH A;  3RJM B;  4GKK J;  3BN4 A;  3OL8 A;  4NA2 A;  2G1H A;  2FVS A;  2VG7 B;  4NLG A;  2RB7 A;  3F41 A;  1JLG B;  1WC5 A;  1BE4 A;  5KFH A;  4EBE A;  4X4P A;  1U6Z A;  4WP9 A;  2XSJ A;  3S1T A;  4AUK A;  4ED2 A;  2Q66 A;  3DI6 A;  4PQU B;  2W4D A;  3EVW A;  1GAO A;  2PGC A;  1EKS A;  2H51 B;  1VR6 A;  4L3K A;  3H2V E;  1RYR A;  2AWZ A;  4WBF A;  4ZJO A;  3CUN A;  2CJK A;  4GO5 X;  2ZH7 A;  5F8J A;  2OI2 A;  2OML A;  3IR6 B;  3UI3 A;  3M8Q A;  2LQ9 A;  2QSW A;  2ZJR Q;  3AA8 A;  3C8Y A;  4Q2L A;  5LXR A;  1NEE A;  1VQ5 S;  2V4J B;  1Q5Y A;  2ZZT A;  1JLA B;  2EFN A;  2FVP A;  1RDR A;  2HFN A;  1XR5 A;  1FTC A;  1SL0 A;  2HHS A;  2C2K B;  4MJK A;  3P5B P;  4C3M A;  2M5Y A;  2BE2 B;  2VKZ G;  2YWK A;  2DHS A;  4WFA Q;  2LQ8 A;  3MMB A;  2BW2 A;  2IM3 A;  3O6Q A;  4S0M A;  5KFD A;  2A2C A;  3DRX A;  3PM9 A;  4FYY B;  4PAA A;  3GV5 B;  3M30 B;  3ITH B;  4C11 A;  3BQ2 A;  2XY5 A;  2UUC J;  4J5O A;  3NGK A;  2UVU A;  3MMA A;  5J1E A;  1R0B G;  1WG5 A;  1V3Z A;  4NZ6 A;  4PYD A;  3OLA A;  2DNY A;  4O3N A;  2DYA A;  3OTO F;  2HQG A;  4X4R A;  1P27 B;  5E3A A;  2E1M C;  5DZ6 A;  5B0G A;  4N7T A;  1HBM B;  1CJT A;  3E01 A;  3FRY A;  3BSC A;  1I94 F;  5D4P A;  3VAG A;  2CKW A;  4EFA C;  2VC0 A;  3K5O A;  1JXV A;  3CDE A;  1KS2 A;  4ZVT B;  2Z2L A;  1YJT A;  2AT1 B;  3BH7 B;  4DSF A;  2HYI B;  2W24 A;  3FEY B;  2G4B A;  5HI7 A;  2FGC A;  2B4V A;  3AJD A;  3D3C J;  5F8L A;  2GO8 A;  2V8P A;  3CW2 C;  3PG9 A;  4RW4 B;  2BOA A;  3KDN A;  1FFG B;  2HHW A;  2MY7 A;  4KYZ A;  2MQ8 A;  1X4B A;  4ZDN A;  1VFJ A;  4WCE Q;  2VG5 A;  1HWI A;  2MZQ A;  1XN9 A;  4DFP A;  2UUT A;  2GAH C;  1BWV A;  4IG3 B;  3W64 A;  1U47 A;  1S9G B;  2GVD B;  2CQH A;  4LF6 J;  2KYZ A;  2JH3 A;  4I1T A;  1MW7 A;  2ZNY A;  4AL7 A;  2ZEJ A;  2DIS A;  1EET B;  1MMN A;  2JC1 A;  3CDW A;  4O4G A;  1GMV A;  3SSQ A;  1U4B A;  1JLF B;  1OWX A;  1U02 A;  3DRP A;  1FT8 A;  2P8I A;  4DZD A;  2UXD F;  3IM8 A;  4KAI A;  1FVS A;  2KTQ A;  2MST A;  1Z2L A;  3CJ8 A;  3MZI A;  1TL3 A;  3KWM A;  5ETS A;  2M52 A;  5K20 B;  3C2P A;  1FK9 A;  3MAA A;  4NMX A;  3UDC A;  3D1Q A;  4B9T A;  3OLB A;  1RHU B;  1YLX A;  4IOC Q;  3W66 A;  5KFG A;  2DR9 A;  3PW0 A;  5D3G A;  2UXD J;  2YX7 A;  3FK4 A;  2EEY A;  5EN1 A;  2CPJ A;  1ROF A;  4I2Q A;  2NSB A;  1QD1 A;  3K58 A;  2VQE F;  2IDL A;  1PIE A;  3MM5 A;  1JLQ B;  2EG2 A;  4IDK B;  4QIE A;  3THV A;  1ZOT A;  3EVO A;  2DNH A;  3KFW X;  2VOD A;  4DV6 F;  3CCT A;  4KC5 A;  2Q6B A;  1TTH B;  4A46 A;  1Q86 T;  3EYZ A;  1B64 A;  2N7C A;  2MKY A;  1RQ0 A;  4F2S A;  3BBC A;  1J27 A;  2Y3Y A;  5A6W A;  2XMV A;  2X1B A;  1RAC B;  5CYQ A;  3TZY A;  5T7L A;  4DR4 F;  1R27 B;  1R3N A;  4ELT A;  5FJ4 A;  3D4J A;  4QZV B;  4PXE A;  3DRS A;  1U0H A;  2RHQ B;  1O0P A;  2NPI A;  3KNA A;  3ET6 A;  3UO0 A;  1G6B A;  2OP5 A;  2H5E A;  5GMD A;  2O66 A;  3W5Y A;  3H5X A;  3ADA C;  3ZTO A;  1R8A A;  3TUZ C;  3EGV A;  3OTB A;  4WII A;  5DLF A;  2DXF A;  4M1K A;  1N88 A;  3JAM Y;  3J81 U;  1S6O A;  4MT1 A;  1FXL A;  2ZIT A;  5A8W A;  4DR6 F;  1B70 B;  1LFP A;  1JB0 C;  1RT3 A;  1LXN A;  3O44 A;  3OBI A;  4JV1 A;  4OYB A;  1HQE A;  3MFI A;  4K5S A;  2PMZ D;  3ZZT A;  4P72 A;  4LF7 J;  4JI6 F;  4KTQ A;  4KRW A;  4YME A;  1RT6 B;  1S6P B;  2MKH A;  1XR7 A;  2BMB A;  5IT9 Y;  3HHE A;  4CLY A;  3G6V A;  2M2B A;  2ZVS A;  3IBC B;  4CLL A;  1BQN A;  5F8G A;  3HK2 A;  4UOF A;  1W25 A;  2J0W A;  3OFH A;  1YBA A;  3K89 A;  4NZ0 A;  4YEA A;  3TVY A;  2WSC C;  2J0Q D;  2JEI A;  4UQG A;  2BM1 A;  3I0S A;  3W5Z A;  2HW3 A;  2Q1L A;  2CFX A;  2MZJ A;  3MM8 A;  4DV2 F;  3UD4 P;  5DLG A;  4J91 A;  2A18 A;  2XYP B;  4RW6 B;  3KLV A;  1X9W A;  4Q8E A;  1ZAX A;  1OYE A;  2QSF A;  4FYX B;  1Q82 T;  2QGF B;  4I64 A;  2HHH F;  1YDL A;  4NML A;  5H9E J;  1L3U A;  2RE1 A;  2C3P A;  4M5N A;  4LF4 J;  4Q45 A;  4OL8 A;  3C14 B;  1ARO P;  1NO8 A;  2LA6 A;  3JTN A;  3MM7 B;  1ULR A;  3B4D A;  3WZ0 A;  4B3R F;  3AY0 A;  5L46 A;  2QYG A;  5CYM B;  3DRR A;  1UWB A;  3GIJ A;  1QJH A;  1S1V B;  2NSC A;  3A3O B;  3GG1 A;  2VBW A;  5C42 B;  4DV1 F;  1REV B;  2AYM A;  4PXB A;  1NK6 A;  2AF6 A;  4LRB A;  3GCX P;  1RWP B;  1Q79 A;  2EKY A;  1WKJ A;  3BV8 A;  3LGM A;  3G9C A;  4YUD A;  3UPF A;  3K5P A;  1JWW A;  1HHT P;  2JNJ A;  1RBA A;  4OV1 A;  3QT8 A;  3QFW A;  1KR4 A;  2BAN A;  3P3D A;  4NCG A;  4ZP9 A;  1XC9 A;  1HQU A;  4QW8 A;  4FYD A;  1YX2 A;  3M6U A;  1HNV A;  2B56 A;  2PO4 A;  1HNZ F;  2JEG A;  1W7W A;  5GAD U;  3QBC A;  2ZKU A;  2LDI A;  2XNR A;  3D0H E;  4J9R A;  5FDL B;  3SI8 A;  4KR0 B;  4LIR A;  4KFB A;  4A48 A;  5I3U A;  3HZE A;  4LFA F;  2B8Q A;  3A13 A;  3RAQ A;  2UUB F;  1TL7 B;  4U8Y A;  3QT6 A;  2W9B A;  2XCP A;  4OHV A;  1HAR A;  4LSZ B;  2H1Y A;  1O51 A;  2CQ3 A;  4YHH J;  2W9A A;  4USU A;  1XTZ A;  2CQB A;  3Q83 A;  3JS9 A;  3TX0 A;  1HIY A;  3QLH B;  3KYL A;  3RBE A;  3BDP A;  4PWD A;  2ZVI A;  4MKB A;  4JV0 A;  3OXF A;  2JVR A;  1ZA1 B;  1IUJ A;  3CGI A;  1SKS A;  2H65 B;  2FVR A;  4TYB A;  1B4S A;  5LOQ A;  2J76 E;  3AD9 C;  1PO6 A;  1SH3 A;  4WZM A;  2PT0 A;  3JQK A;  1HQ2 A;  1OMS A;  3GLJ A;  2B51 A;  2DGS A;  5B0D A;  5EUH A;  2MQO A;  1K44 A;  2YX4 A;  3KMS A;  3HJV A;  4WJB A;  5D6G A;  3GV7 B;  3HFZ B;  4U7U D;  1IBC B;  2LEC A;  1HKA A;  4DSE A;  2F40 A;  5FLX Y;  5DG7 A;  4JI6 J;  5HVH A;  2C2M B;  3T41 A;  3FEX B;  2VL1 A;  5GAH U;  3DOK B;  3TX8 A;  4DL2 A;  4KHM A;  4A8O A;  4NYP A;  4X2B A;  2E1C A;  2G2Y A;  2KJV A;  2HHP A;  1GX5 A;  5IZH A;  1OSD A;  4I2P A;  4B17 A;  2CDQ A;  2HWT A;  4OYO A;  1CQN A;  2P9C A;  3MWB A;  4FBT A;  1P9Y A;  3V4I B;  3MXH P;  3C6T B;  2W9C A;  1RLC L;  2B4U A;  1Q78 A;  3DKD A;  5JUM A;  4N76 A;  2RSQ A;  5FD1 A;  2CIM A;  3RAM A;  4NYZ A;  2LXU A;  3T5K A;  2XYH B;  3V81 B;  3NCQ A;  3WBZ A;  1UVJ A;  2CPE A;  2E5H A;  2LQJ A;  5HO4 A;  4DFK A;  2XEX A;  2IMW P;  1RAI B;  4ECY A;  3KHL A;  2Y1J A;  4PKD B;  1U48 A;  1RA7 A;  3JSB A;  5LM7 E;  2E7W A;  2H54 B;  4FDF A;  2B6A B;  4U7U K;  3M4X A;  1H3D A;  4YR3 A;  3VAL A;  1JKH A;  1TL5 A;  3EZU A;  4OJ1 A;  4ED3 A;  4ERD A;  1HW9 A;  3IG1 B;  4J9Q A;  4DQI A;  4I2P B;  1RT2 A;  2W8K A;  5F0U A;  1MLA A;  4FF3 A;  3G96 A;  3LPE A;  3QRQ A;  2KXN B;  4MYU A;  4XTT A;  1SVD A;  4NEZ A;  2Z57 B;  2GIR A;  2X51 A;  4M8L A;  2DNG A;  3OXG A;  3MAH A;  1FO1 A;  1RXO B;  5F8M A;  2IA6 A;  3QO9 B;  2HQ3 A;  2XLK A;  2AYE A;  4M5K A;  4DSK A;  2ZOG A;  2FHO B;  3U1L A;  1U1Q A;  1FX2 A;  2BUN A;  3FZ2 A;  1CLF A;  4C8Y A;  2FLP A;  1N34 F;  2I2Y A;  5L1L A;  1EJ7 L;  1FKA F;  1DLO B;  4KPC A;  2GVD A;  3W65 A;  2G9O A;  3PNI A;  4ETX A;  3MR5 A;  1C1C B;  3HT3 A;  2IHR 1;  1UTA A;  1MWY A;  3DLG B;  3TJ8 A;  2ZE2 A;  4JI3 J;  1ITP A;  1NPR A;  2B4O A;  4O0N A;  4O3P A;  3SQG B;  5J2Q B;  4LSN B;  3W8G A;  1JQG A;  3W1Y C;  5H1S V;  4K4Y A;  2CPI A;  3B4M A;  3BR9 A;  3EXY A;  2QE5 A;  4DUY F;  1IKW B;  3C15 B;  2AU0 A;  4DV7 J;  3BYP A;  3JSR A;  2AGO A;  1ZZF A;  3GPA A;  4ILR A;  3DN9 A;  3RRG A;  2MSS A;  1PJ6 A;  4I69 A;  2LEB A;  2HRU A;  3GFY A;  4HI1 A;  3CDA A;  1TKD A;  1IKW A;  3C15 A;  4ICL B;  1ZM9 A;  1YKW A;  4K8R A;  4KGZ B;  4USH A;  1SH2 A;  5EX0 A;  5HN0 A;  5DDO C;  4IFY A;  4NXM J;  1YRU A;  4AND A;  4Y6I A;  2XWY A;  3NEK A;  5B09 A;  2L9D A;  3GFH A;  1DLO A;  2GMJ A;  3GQC A;  1KTV A;  3KUH A;  2BJ1 A;  5AE2 A;  1JLC B;  1PJ5 A;  3IS9 A;  1RE1 B;  1HWL A;  2YQ0 A;  3CD7 A;  3L09 A;  4IFV A;  3CIM A;  3MMA B;  4O3R A;  4KB7 A;  2KM8 C;  2FTR A;  1L3T A;  1H73 A;  5IS2 A;  4G65 A;  3G8T A;  2CPX A;  2FPH X;  2V2V A;  4DR3 J;  4NOH A;  4HDG A;  4ZN3 A;  3R5G A;  4TLR A;  5KT7 A;  2A10 A;  2ZHB A;  2FJD B;  3DRS B;  3DLL Q;  3Q8V A;  4DUY J;  3HKZ D;  1J5E F;  3NMR A;  2Y1R I;  3MDF A;  3KLG A;  4ZVU B;  3A3P B;  2OFH X;  2HBZ B;  3DMJ B;  4PG4 A;  2RS2 A;  2XS7 A;  3TVK A;  2VV5 A;  1ELO A;  4C0B A;  5HRO A;  1K0V A;  2N4D A;  4ZJL A;  1VC5 A;  4GKJ J;  1NHK L;  3VF0 B;  3ZTQ A;  3HJF A;  1YTY A;  1VI7 A;  1WF2 A;  2UZA A;  5E7O B;  1NSK L;  2B4P A;  2GQ2 A;  3EGN A;  4KFB B;  4YS2 A;  1U1L A;  2VOO A;  3EDQ B;  1M90 T;  2WVC A;  4PPD A;  3M8R A;  4QYZ K;  1FFW B;  4K2X A;  4X62 F;  2MZS A;  5KFV A;  1N32 F;  2OEK A;  4U95 A;  3EUN A;  2VKR A;  2HVD A;  3V6D B;  4WK3 A;  5J2P B;  4ZLP A;  3L4B C;  5ETN A;  1HNI A;  2I9S A;  3TEG A;  1NU4 A;  1W2B R;  3LP2 A;  3R6G B;  5KG7 A;  4OI0 A;  1F9E B;  1X31 C;  4USM A;  3CE8 A;  3J7Z 5;  3D6T B;  6FD1 A;  4DR1 F;  1KQG B;  1OSC A;  1EAR A;  2KFY A;  4KHP J;  3HLU A;  3R5A A;  1FK9 B;  3MAA B;  1FRK A;  2KDO A;  5FII A;  4RW9 B;  3UCG A;  4B9N A;  1SXL A;  3D68 A;  4ILL A;  5ETT A;  4DV0 F;  1L3S A;  2PEB A;  3R7S B;  4TLQ A;  1C0U B;  1GX6 A;  4ZK7 M;  4ECX A;  1H0H B;  1YIT S;  4A47 A;  1M1H A;  1RTJ A;  2AJ2 A;  1U25 A;  3EE3 A;  3LAK A;  5JXS A;  4EMD A;  2IRU A;  1S4E A;  3RYL A;  1VQ6 S;  5J2N B;  1HYS A;  3BF4 A;  4NLY A;  2MKC A;  1GMW A;  5F3T A;  2PN6 A;  3OVS A;  4LRC A;  2BJ7 A;  2K7K A;  2VG6 B;  1RTJ B;  4CYU A;  5E41 A;  4CIO A;  3POT A;  1JJ4 A;  1EX8 A;  5F8N A;  1IVZ A;  5G4D A;  3U1N A;  4ED7 A;  4TU9 A;  1NAQ A;  2KG0 A;  1XK8 A;  2QA4 G;  3C19 A;  4X84 A;  4DV5 F;  4CLP A;  2YWH A;  1X0P A;  2DIT A;  1RA6 A;  4ICL A;  4OZ3 A;  3CC2 S;  4RW4 A;  1B3T A;  2J6U A;  3ET6 B;  1VBX A;  5DO2 A;  1VQP S;  1HD1 A;  4NA1 A;  4F3Q A;  1BUX A;  4RL1 A;  1Z2Z A;  2I6W A;  3A3N B;  1QTN B;  5DQI A;  4KPY A;  4F0M A;  2JOQ A;  3BEG B;  4LT6 A;  2LFV A;  2HSE B;  2DH7 A;  2OPP A;  2D7S A;  3MR7 A;  3I5A A;  2C22 A;  2ZJP Q;  1BLU A;  1VRQ C;  2GVZ A;  2D3O R;  4DUT A;  4V19 J;  1ICE B;  3HHL A;  3IM9 A;  3PRV A;  1C1C A;  4DPW A;  5HJY A;  1AW0 A;  1EKR A;  2CDR B;  2A6M A;  1JK9 B;  1T02 A;  4UQT A;  1HNW J;  2YKQ A;  2ZC4 A;  2YKP A;  5J2M A;  5D8H B;  2APO A;  4R0J A;  5C24 B;  4RU2 A;  3NBP A;  4L3N A;  5I42 B;  2OH2 A;  2F4F A;  2FHJ A;  2CNK B;  2FZC B;  2PA8 D;  3DLE A;  5GAG I;  1QVF R;  3H5S A;  2Y0S D;  1NSP A;  4NZ7 A;  4P2S A;  4E8U A;  3T5H A;  3QIP B;  2XNQ A;  1FNO A;  3PFE A;  4DFM A;  4V1A k;  2K3I A;  3SDE A;  3M6V A;  3W3S A;  1T9Y A;  3HD1 A;  5IC6 B;  3CED A;  2X7I A;  3A12 A;  1XJW B;  2HS4 A;  2B7B B;  1UA1 A;  1DQ8 A;  1HBU A;  1WC0 A;  2C2Z B;  5KG0 A;  5J2M B;  3V6D A;  4NRT A;  2XS2 A;  1H2U X;  2DIV A;  2WON B;  2N3O A;  4J9L A;  4PUO B;  3H8Y A;  3NAI A;  2E5J A;  3DOL A;  3PR5 B;  2NRE A;  4DX5 A;  4L6V 3;  3IWN C;  1GFW B;  2DNR A;  3AH6 A;  4TYA A;  4LF1 A;  2CNN B;  1N52 B;  2GX8 A;  1NZ8 A;  5D77 A;  2N82 B;  2L41 A;  3GIM A;  4J9V A;  4O3S A;  1NK8 A;  3GG0 A;  1RIS A;  4Q5V A;  4ED1 A;  3CC4 S;  3G71 S;  4BWJ A;  3FSX A;  4CTA A;  3OTD A;  2IM0 A;  2KHD A;  3S8S A;  1UAW A;  3LP1 B;  4M5M A;  2KO1 A;  1KQS R;  3D1H A;  2EFV A;  4EYI B;  2FHM A;  2QMU B;  1ZBT A;  2BAN B;  3JQJ A;  1S77 D;  1D1U A;  2BV3 A;  2K1R B;  2MLX A;  3E8O A;  5ETL A;  1F5A A;  3QMQ A;  5I3Q A;  1UL3 A;  3PEJ A;  1HR0 J;  3D67 A;  1GMW D;  4DSL A;  4JI4 J;  1VQS A;  4R25 A;  2VIH A;  2R7V A;  1LFW A;  1URR A;  2HFV A;  2DNL A;  4PAB A;  2XY6 A;  3DOK A;  4GKK F;  1W26 A;  1M5V C;  3ETO A;  4Y3C A;  3H4B A;  2JLF A;  1KDN A;  3J7A N;  3POT B;  1S6P A;  1N0U A;  1M0S A;  3M2V B;  3PCO B;  3QGI A;  5LJ5 Y;  2WBR A;  3IO1 A;  2CZ9 A;  2EK1 A;  3LP0 B;  1JLC A;  4YFU A;  4IQX A;  2HKE A;  1Q0N A;  4LRF A;  3PYG A;  3MCM A;  4RW8 A;  1FDA A;  1FER A;  1P8G A;  2QL7 B;  2YKA A;  4CLF A;  4Z37 A;  3KK3 A;  1IKX A;  3G8Q A;  1RWU A;  2DHA A;  3DDK A;  3JYT A;  2Q43 A;  5CHC B;  4DJB A;  4W90 B;  2DHG A;  2MQP A;  2RUG A;  4TY8 A;  4PWD B;  2K1R A;  4KBI A;  8AT1 B;  2W01 A;  4LBP A;  5HAO A;  2GHW A;  4X4O A;  2DO4 A;  5B0E A;  3LQV A;  3C46 A;  1VK3 A;  2RRB A;  4WK1 A;  3M8Y A;  2BRK A;  4G1Q B;  1NUE A;  4OZ2 A;  1HHS A;  2BW7 A;  2ZOM A;  1SC1 B;  3EM1 A;  5CYQ B;  2W9B B;  4HH1 A;  1F5B A;  4OZ1 A;  2V9W A;  4IQM A;  2HNY B;  4M5D B;  4E98 A;  3CT9 A;  1G3O A;  3AB4 B;  4TY9 A;  4ES1 A;  1WD6 A;  3WDO A;  1YJN S;  2KYX A;  3R5D A;  4ZIT A;  2VG6 A;  1T03 A;  2E1P A;  4B9L A;  2BQ3 A;  1VQM S;  3UVJ B;  3H5Y A;  2V68 A;  3HO1 A;  3RB3 A;  3W61 A;  2M8H A;  3ZZP A;  2ADC A;  1LWC B;  1HI8 A;  2PMH A;  2HMI B;  1TKT A;  1N33 J;  1UP1 A;  2RU3 A;  2QZ8 A;  1LV5 A;  1YWX A;  4NWB A;  2WVF A;  2BR0 A;  2XMT A;  2Q79 A;  1FJG J;  1IKY B;  4ID8 A;  3G8S A;  2KRR A;  1Q81 T;  2NCK L;  3MPD A;  2AYG A;  1D9F A;  2XZW A;  4DLE A;  4RW9 A;  1NSQ A;  4X64 F;  4RNM A;  1JXL A;  5D78 A;  2IJN A;  1DQ9 A;  5HAN A;  2LCW A;  1IQZ A;  3EWG A;  4D3G A;  3PO4 A;  1JLE A;  1VGY A;  1GNK A;  3IR7 B;  4MK8 A;  4NEY A;  2Y1I A;  1WAC A;  3CJQ A;  4XDC A;  3SBM A;  2VQF F;  2HRY A;  1X60 A;  1WEY A;  1Y5I B;  4A8K A;  4DL4 A;  2WBM A;  4RBU A;  3UVJ A;  5KFN A;  2O3D A;  2PI4 A;  2BOP A;  4OX6 A;  3L7P A;  1JJ2 R;  1QSL A;  1CBK A;  2HNY A;  3C14 A;  2CJ9 A;  4M5D A;  3TNV A;  3W8P A;  2W7O A;  2W8L A;  2RNE A;  4B02 A;  1IKV B;  2P6S A;  4UTG A;  5ETK A;  4LSL A;  4FS1 A;  1OJ4 A;  3H98 A;  2CYY A;  1MN7 A;  1N8R T;  1NSA A;  1MSW D;  2WK4 A;  2Z8Q A;  3AHP A;  2DPI A;  1IWA A;  1QAY A;  3QGG A;  2VU5 A;  1UJ6 A;  4F25 A;  4F02 A;  4KKO B;  4DV5 J;  1N5S A;  2MQN A;  3I5B A;  2FY1 A;  1FI4 A;  2X1A A;  3U27 A;  2RU9 A;  2Y8Y A;  4I67 A;  2ZH1 A;  2ASD A;  4N41 A;  4LFC F;  2XYG B;  1EAY C;  4RJV A;  2ZE2 B;  1X5P A;  1F9F A;  3R2C J;  1HWJ A;  1BQN B;  3OW2 R;  1K1S A;  2NYH A;  4IH7 A;  5F8H A;  4P2F A;  4J90 A;  4O4G B;  4ECV A;  1F3V A;  4F04 B;  5LT5 A;  3BGU A;  2DHX A;  1VDH A;  1OQ6 A;  2ZWP A;  2ZBI A;  1NB2 A;  2M7S A;  4EYH B;  2D74 B;  1VBK A;  1BMQ B;  1HNX J;  3HHD A;  1X4E A;  1AFI A;  3M8P B;  4N8N A;  5KG2 A;  4NE9 C;  3OVB A;  2VFU A;  1N34 J;  3CCE S;  2MKS A;  3HD2 A;  2AV5 A;  3R5C A;  1DBD A;  4IR1 A;  3D9B A;  3I0R A;  1FES A;  1RHJ B;  2OPQ B;  5LSO A;  2MY8 A;  2JFK A;  4ED8 A;  1FEE A;  3DOM A;  4LQ3 A;  4R8U B;  1KLM B;  1ZPV A;  3D6M B;  4OHW A;  1TK0 A;  3HDS A;  3C66 A;  3CO9 A;  4KE5 A;  1KBR A;  1MWQ A;  2FJB B;  2XBP A;  4CM2 A;  1HNI B;  2A6O A;  2KL8 A;  1XMQ J;  3H0P A;  4KHP F;  1N4L A;  2DGV A;  2NUU G;  4K2J A;  1UKU A;  3AQO A;  4DG1 A;  1RTI B;  1X4F A;  3DGV A;  1REV A;  2QMW A;  2NXU A;  3HI9 A;  3Q8U A;  4JI7 J;  4K0K F;  1FWP A;  4HAC A;  2DGW A;  3BKU A;  2YTC A;  2D41 A;  3TA1 A;  4DUZ F;  5RUB A;  4AT1 B;  3BKT A;  4RU9 A;  2ADB A;  3AD7 C;  3O5T B;  2BE9 B;  2HAF A;  5HMW A;  2PFF B;  1U1P A;  1F60 B;  3CJ5 A;  4DF8 A;  1I6J A;  1FKP B;  2H5I B;  1YJ7 A;  3ZFV A;  4DL6 A;  1HNV B;  1KC8 T;  4JI0 F;  3BKF A;  1T9V A;  3R5B A;  3ITH A;  1TL4 A;  1VQL S;  2ZNZ A;  3W60 A;  3PIO Q;  2W7A A;  1JNZ B;  3FCW A;  3UN3 A;  2YWF A;  3NGS A;  4NX9 A;  5I3P A;  3S01 A;  4OQJ A;  2GGP B;  1WSR A;  2P5V A;  3SFU A;  3KHG A;  1FX4 A;  1RYS A;  1QTM A;  2CPF A;  4DR3 F;  2QIF A;  4XIU A;  5CAA A;  2VB6 A;  1WEX A;  4ER8 A;  4A8W A;  1B7F A;  3M8Q B;  3RBZ A;  2XI3 A;  3BH6 B;  2PMW A;  4C8K A;  4BWM A;  4ZHR A;  3M2U A;  1KVI A;  3AOA A;  3QYY A;  4WFZ A;  5CD4 A;  2RQ4 A;  2WOM A;  2KM8 B;  3UDV A;  2VAS A;  4QOT A;  4HHJ A;  5ITH A;  1IWG A;  1GXT A;  1SJ4 P;  4X4U A;  2OSQ A;  5EWE A;  3RBD A;  3KHH A;  4DR2 J;  2R2T A;  2Y8W A;  3G6X A;  4WIQ A;  2HLU A;  2BZ2 A;  1KNZ A;  4QU7 A;  1FA0 A;  2YKO A;  1WDD A;  2H9Z A;  3MPY A;  2ILZ A;  1T95 A;  1YIJ S;  2UP1 A;  4NLP A;  4Y2A A;  4WTO B;  4DN0 A;  2EVZ A;  3JQM A;  1DFD A;  1ZH5 A;  3ZZZ A;  4DBQ A;  1CC7 A;  2DR8 A;  5IT0 A;  1CJT B;  4PQA A;  2R8G A;  1S9F A;  2HPU A;  4K5R A;  1KFD A;  2LVW A;  3AFG A;  2H3E B;  1QY7 A;  2HIQ A;  5KFX A;  2MTL A;  3HSD A;  1APS A;  2KZZ A;  4QJV A;  3QRP A;  2F7V A;  1U6F A;  4OYI A;  4MIA A;  4Q0B A;  1HWK A;  3H5U A;  3M9N B;  3KG0 A;  2JEF A;  1BGX T;  2I38 A;  3DGP B;  3PYF A;  2MHN A;  1J2V A;  3MR2 A;  2Z2Z A;  1TR0 A;  3NWR A;  3DLJ A;  3JXO A;  2QMX A;  2V8G A;  5B08 A;  4ZLJ A;  2R8H A;  4J9N A;  1FD8 A;  1GTH A;  3KUG A;  1TL1 B;  3PTW A;  1RWN B;  4TQS A;  2B6A A;  5E5N A;  2XMM A;  3OHA A;  4A8S A;  4LUB A;  2VBY A;  5ADZ A;  4CT9 A;  1IR0 A;  1FRM A;  3D66 A;  3VQS A;  4DCP B;  5B0F A;  3QAU A;  5KG6 A;  2NXJ A;  3OTO J;  3MM7 A;  1RTZ A;  3K8W A;  3CB4 A;  3I82 A;  4F4K A;  1R8C A;  1H7W A;  2K3K A;  1UVM A;  4F4A A;  2EBG A;  2LXI A;  2DKO B;  1BQX A;  2VZ9 A;  2KRB A;  1LW2 A;  1UZD A;  4RW6 A;  1SJQ A;  5KFP A;  2VIC A;  4P2M A;  2YKM A;  3NCR A;  1Q7Y T;  3JSY A;  4RZR A;  2FJV A;  4TQR A;  1GQE A;  1UCN A;  2Y1L B;  2YNF A;  4NL5 A;  5F9L A;  4EO8 A;  2HGM A;  5IV3 A;  2HHT A;  4W4M A;  4ZPC A;  4DQQ A;  2CQ0 A;  4H4M A;  1NKB A;  2M9K A;  2V63 A;  3AXM A;  2NQP A;  2ZBP A;  4FVM A;  1JLF A;  3D54 A;  2HLT A;  3DRP B;  4QBU A;  1BD6 A;  2LYV A;  2WSE C;  5BYQ A;  4J37 A;  2DNQ A;  2FJE B;  4XK8 C;  1FJ7 A;  1I94 J;  4ZPV R;  3SCL E;  3THP A;  1N5Y B;  4CRJ A;  2KXF A;  1GMU A;  2MLY A;  2QLB B;  2NYI A;  4EGL A;  2D3U A;  1I1G A;  3TUJ C;  4KV8 A;  5IM0 B;  2CJQ A;  1YHQ S;  4JI2 F;  4GC7 A;  3NNA A;  2G0I A;  3LGH A;  3QZ7 A;  3L3C A;  4UY8 5;  1WHV A;  1S5Z A;  2HIY A;  2QT7 A;  4UOG A;  2VH7 A;  1VC6 A;  3GR0 A;  1DRZ A;  5IXU A;  2OD6 A;  4ZMM A;  4ID5 A;  3BR8 A;  1Y5N B;  1PGZ A;  3K8V A;  4OX7 A;  3W2V B;  5CH7 B;  3VAJ A;  3W2W A;  2E5G A;  2OO4 A;  2ROG A;  3PJX A;  2V4J A;  1T05 B;  2AEJ A;  1BWE A;  1TV6 B;  3RB4 A;  4C8M A;  1O6X A;  2QO3 A;  3ILO A;  5KFL A;  5HAT A;  2G0J A;  3UN5 A;  1TL7 A;  2RAQ A;  5KG5 A;  5EX3 A;  4Y28 C;  4KT0 C;  2MQQ A;  2R2U A;  3JTP A;  1O8B A;  3OXL A;  1HMV B;  4ZCK A;  3ISN C;  1X7V A;  3DNC A;  4N8O A;  1RT6 A;  1ZM3 A;  2BVZ A;  4QIG A;  3CTR A;  3PFO A;  4LR7 A;  1URN A;  3CMQ A;  3FMB A;  3HSJ A;  1MU2 A;  5AE3 A;  1TFW A;  2CG8 A;  3ILJ A;  2XM3 A;  4V19 X;  4QU6 A;  1RT7 B;  2KHC A;  3LPY A;  2DNZ A;  4NAS A;  2DRA A;  4DR7 J;  2ZJQ Q;  4NCG B;  5A0Y A;  4PPZ A;  2FZK B;  2R4F A;  2ZWO A;  2DGQ A;  2WW8 A;  4OJ3 A;  1KLM A;  3CVK A;  4I4B A;  3PZP A;  2XY7 A;  3P96 A;  2XGQ A;  1TUW A;  8RUC A;  2UUW A;  2CPY A;  5A0Y B;  3AJ2 A;  3SCI E;  4DU8 A;  3JB9 k;  4HT5 A;  3MCS A;  1QE1 A;  1Q5V A;  2V8H A;  3LTO A;  4I56 A;  1FKO A;  5G0R B;  4F36 A;  4Q44 A;  3T3F A;  4B9M A;  2RQK A;  4IYQ A;  3K57 A;  4QQB A;  3UNY A;  1RT5 B;  1XNQ F;  3GP9 A;  3DRR B;  3R97 A;  3FQL A;  1R8P A;  4A8F A;  1CUL A;  2CQG A;  1TK5 A;  3OJS A;  2UV8 A;  1PKU A;  1RWW B;  4KSE B;  2DRD A;  2FJX A;  2GIF A;  5HBM A;  4F3M A;  2Z2Y B;  1R6Y A;  1WC1 A;  4PQU A;  2RKI A;  2HFU A;  1JLG A;  2RDD A;  2PDA A;  3ENV A;  2L9W A;  1GEH A;  3HZG A;  4OZL A;  1YRT A;  2LU1 A;  2OFG X;  2MLZ A;  5BYR A;  1Y4Z B;  2LA4 A;  4QCL A;  3TP2 A;  3TAQ A;  2DY1 A;  3G6Y A;  1RWV B;  2QJ3 A;  4MAK A;  1M5P C;  4K0K J;  4HDH A;  1FHT A;  2HHU A;  2X3D A;  4LR8 A;  1IBM F;  3M32 A;  3O1L A;  1N56 A;  3K0J A;  2KU7 A;  1RWK B;  4LSL B;  4OX9 F;  2K7J A;  2O5D A;  4JI1 F;  3NL0 A;  3LGN A;  2OPR A;  5D4N A;  2MZT A;  4IRK A;  3IGN A;  2GFF A;  3KLE A;  3T6B A;  1LWE B;  2C3U A;  3PW2 A;  1WSV A;  5GAE I;  1RAJ A;  1VQY A;  2NPF A;  2WHO A;  4GC6 A;  5DDQ C;  2OKQ A;  2OPS B;  1PAU B;  3FRZ A;  2OPR B;  1H98 A;  2MKI A;  3R1L A;  4NXM F;  1LNQ A;  2B9X A;  4GRS A;  2G0C A;  4GKJ F;  3CDB A;  2X1G A;  4RNN A;  4LFB F;  2ZBQ A;  1TK8 A;  1YJW S;  1CVJ A;  1LK5 A;  3ZC4 A;  4MMO A;  1U09 A;  4E2F B;  2OIH A;  3BGR A;  1UFW A;  3CDU A;  4E0D A;  4CNZ A;  1UVN A;  3DYA A;  3CCU S;  4HVZ A;  2LQB A;  1SUQ A;  3VWS A;  3Q2S C;  2DT9 A;  3M9M B;  3MMJ A;  3TEH B;  4MYT A;  5IQ6 A;  2HVE A;  5IC4 B;  3MUT P;  2PEH A;  1TKZ A;  2B9W A;  2COL A;  2O67 A;  2BXJ A;  2XG8 A;  5D4O A;  3I4H X;  3K5M A;  2V6A A;  1H6K X;  4JI7 F;  1EP4 A;  3FKB A;  1WTF A;  5H9E K;  4ZPW R;  5ETM A;  3EIC A;  2R2S A;  3M2R B;  5ETO A;  2CQD A;  1Q95 G;  4RUA A;  2HFZ A;  3HHN B;  2XSJ B;  1S0N A;  1TEL A;  5D3G B;  1AA1 B;  4PZV A;  5THW A;  1TUV A;  2BEF A;  1HBN B;  3DRY A;  1TVR A;  4C0O C;  4LBH A;  1YJV A;  1QSY A;  1T9U A;  1T05 A;  1A6L A;  3DYA B;  1V3S A;  2SXL A;  2PC6 A;  3RB0 A;  2GZO A;  2HFS A;  2YNH A;  3DOM B;  4WFB Q;  2C2D A;  4ETZ A;  2RS8 A;  3FBB A;  1LOU A;  2ZZN A;  4AE5 A;  2FHK A;  5K8N A;  2Z0G A;  4B3S J;  4TY8 B;  2EFG A;  1AYE A;  2BKP A;  1F1B B;  1RGV A;  1ZA2 B;  2EFQ A;  3LO3 A;  4RX6 A;  2MXY A;  2AW0 A;  3CJS A;  3NWG A;  1OY6 A;  4EU0 A;  2KG1 A;  2EC0 A;  3OL6 A;  1S1X B;  2ZFH A;  3M6W A;  3L9Z A;  5F9N A;  2A1B A;  2JRS A;  4QIW D;  4IUF A;  2NXE A;  1U0S A;  1KQF B;  5B0A A;  1OS5 A;  4XDD A;  4F0K A;  4ZCM A;  4F50 A;  4LF4 F;  3GII A;  2ZUG A;  5IT9 U;  1JNR B;  2CPZ A;  3C16 B;  4M94 A;  3MD3 A;  3DLK A;  1S1U B;  1VK8 A;  3B54 A;  4UOC A;  4EBC A;  1VBZ A;  2AEF A;  1FNX H;  4OX8 A;  4DCJ B;  1NXI A;  1BC6 A;  1S48 A;  1Q53 A;  2IIH A;  4Y2M A;  1MRO B;  3D0I E;  3CJK A;  3J7Y I;  3W9I A;  1PJ7 A;  4DQR A;  1S57 A;  1WOR A;  1H38 A;  2R7R A;  3KXD A;  4NLU A;  5EGY A;  5M2P A;  4DV0 J;  4H4K A;  2YNH B;  4DR2 F;  3W2V A;  2WCX A;  3I56 S;  4K4S A;  2EG1 A;  2POK A;  2J0X A;  2OMO A;  1XWL A;  1M5H A;  2X3G A;  4Y65 A;  1N6Q A;  1RWM B;  3PVX A;  1TVR B;  3FC9 A;  3B6B A;  2R7Q A;  2AX0 A;  1U7L A;  3KK3 B;  3PW7 A;  4DR7 F;  1LW0 B;  4B08 A;  4R5P A;  1KOO A;  1VS3 A;  3KK1 A;  3VAM A;  3BPD A;  3MD1 A;  1XEZ A;  5C25 B;  4ECS A;  1VQ9 S;  1QDU B;  3VZH A;  2IJR A;  3SCK E;  1NB7 A;  2ZDO A;  3BYR A;  1S59 A;  3ZZO A;  1WOP A;  4RBV A;  1JLB A;  2IRY A;  2O1P A;  2BBE A;  4ZHR B;  5KFQ A;  2ILY A;  4K4W A;  4NA3 A;  1S6U A;  2WON A;  3DDI A;  4P10 A;  4USV A;  3J80 U;  4NCB A;  4J9S A;  3TW0 A;  1N5Q A;  3ZNJ 1;  1MWZ A;  2CAJ A;  4GO7 X;  1R8H A;  4TXS A;  3M30 A;  1T3O A;  1TUG B;  4NLQ A;  3BSA A;  1MN9 A;  1T0T V;  3GMG A;  3TAM A;  3VAF A;  1JJH A;  2WW4 A;  4CO4 A;  1CC8 A;  2HG4 A;  3NG8 A;  2XMA A;  1U1O A;  1VHF A;  1FJG F;  4OYW A;  1X4H A;  3H42 A;  1NPK A;  5AXL A;  3OV7 A;  3WHI A;  2QA4 S;  4KH1 B;  1SIZ A;  1I51 B;  4K4Z A;  3HM9 A;  2FLN A;  1VQ4 S;  1MML A;  3WIV A;  3MOJ B;  2GS8 A;  1WHY A;  4C7Q A;  4X4Q A;  4CWB A;  5U47 A;  5DGB A;  4X4S A;  2UUB J;  2M3D A;  2HHV A;  1B0P A;  4XAK A;  4OMF G;  3CIZ A;  3IWL A;  2HZA A;  1F3F A;  1LXJ A;  4WXW A;  2HVH A;  1AXQ A;  1X5T A;  3FBE A;  4J9U E;  1JLQ A;  4IDK A;  1KON A;  2AKW B;  3UW1 A;  1S49 A;  3HVR A;  5DQH A;  3DI6 B;  2IMO A;  3GCW P;  4JI1 J;  5GMK a;  5DZ7 A;  3G82 B;  4HR2 A;  5HMX A;  4QWB A;  1AT1 B;  2MKK A;  2VPX B;  2ASJ A;  2OPP B;  1XR6 A;  1SB6 A;  5HK4 A;  5HJX A;  1SJ3 P;  4CNY A;  1WUU A;  3JTO A;  4XPE A;  1M5S A;  5H9F J;  5LMN F;  1NDL A;  2ZBC A;  4IOB A;  4OZ0 A;  4JYA J;  3OL9 A;  1DAR A;  1F2G A;  4OYA A;  3KLI A;  1NPP A;  1U1M A;  4G6V B;  4Y2I A;  2D69 A;  3I0R B;  1QAJ A;  4HHH A;  2PA3 A;  3AOB A;  1PBA A;  4WFN Q;  2UVW A;  3KHR A;  3KLH B;  1U2C A;  1ZS6 A;  4OLO A;  4DSJ A;  1BQM B;  2WOM B;  3N01 A;  1WG1 A;  1IKX B;  4NLR A;  2IVY A;  2M4M A;  1WF1 A;  3AXK A;  2R7O A;  5LSR A;  1L3K A;  1RAB B;  1X0F A;  1CSJ A;  2AGQ A;  4NI2 B;  2DH9 A;  3RZA A;  1UFL A;  1NH8 A;  2WZ1 A;  1U49 A;  2JC0 A;  2BRL A;  4BLG A;  2RT3 A;  3BPS P;  5K14 B;  2LQ5 A;  1LEO A;  3MM6 A;  3ZZ0 A;  2LU2 A;  3HVT A;  5LMN J;  3S6E A;  1JLE B;  3HVA A;  3HX9 A;  2WB1 D;  3NGD A;  2VDI A;  4ZVP B;  1T9W A;  1VQK S;  3VZI A;  4B9V A;  2MDA A;  4PXC A;  3ZZU A;  2CPD A;  1RKI A;  3MF5 A;  4OIX A;  4Z2X A;  4DV4 J;  3X3U A;  3SMZ A;  4ECU A;  3ENW A;  3CUL A;  3TWZ A;  3GR1 A;  2F9J A;  3ILI A;  2XUL A;  4MK7 A;  4CQ1 A;  1Y10 A;  3BSO A;  2YY3 A;  2XSF A;  3ELH A;  3NY0 A;  4TKT A;  3HT0 A;  2ACM A;  3V4M A;  3CCJ S;  2GV1 A;  3E51 A;  2OJ3 A;  4B3R J;  1REG X;  4FVC A;  4AFF A;  1GT8 A;  1YBT A;  1ZPW X;  2ACY A;  2J7U A;  1NBE B;  3Q86 A;  4P9S A;  2V4R A;  3I4P A;  5L1J A;  2C2N A;  1TV6 A;  3O3L A;  1Z1Z A;  2EXU A;  3K17 A;  5KFI A;  1IR1 A;  5E33 A;  1VJQ A;  3MMB B;  2R9L A;  2OEJ A;  2GQC A;  2ZH3 A;  5KG4 A;  4CM0 A;  1LKZ A;  3R7N B;  3FUY A;  5KTQ A;  4F3O A;  2IYI A;  4F4Y A;  1SKR A;  4OLP A;  2GAG C;  3I6P A;  1WI8 A;  2VFV A;  4QWA A;  2NZC A;  1RT7 A;  1VQ7 S;  4EUV A;  6AT1 B;  3T1H J;  3BGL A;  3NXZ A;  1TP7 A;  2MHE A;  2R3V A;  3OTE A;  1QSS A;  2KVI A;  3MGJ A;  2DNO A;  2EWH A;  2RDJ A;  4FF4 A;  1FE0 A;  1UZH A;  1T03 B;  1PC5 A;  1V6H A;  2YQ3 A;  4USJ C;  5BR8 J;  2AMC B;  3N0V A;  1M1K T;  2NS1 B;  4OI6 A;  2HBQ B;  1RCO B;  4MFB A;  5KFE A;  4XPC A;  2R7W A;  3HSG A;  1B0T A;  4BDP A;  2AJ4 A;  4ZVO B;  2VJU A;  2BQR A;  4F2R A;  2V0N A;  1HA1 A;  5DDP C;  3FSI A;  3AQP A;  2C42 A;  4ID5 B;  3LW5 C;  3KG1 A;  2IA0 A;  1VQN S;  4M5G A;  3BGR B;  1YJU A;  4FBU A;  2UV8 G;  4J9K A;  2Y9H A;  4CTA B;  2HGN A;  4Q8F A;  3HVT B;  2C2E A;  4F8R A;  4WKR A;  2NXN A;  1RBL A;  1TKX A;  3ZO7 A;  3R2D J;  2DEJ A;  1Y0H A;  2FHJ D;  1CJU B;  3QNW B;  1YSJ A;  2C2O B;  4QWE A;  5EWG A;  1XIQ A;  4ZKA A;  3PKY A;  2H4W B;  1Q8B A;  2Z30 B;  1IR2 A;  3D1O A;  4KV8 B;  1KKH A;  2BA9 A;  4EO6 A;  5IM0 A;  5JVG Q;  1FTR A;  1CUL B;  2I5J A;  1J5O A;  1AUS L;  1OQ3 A;  1N5Y A;  4JI3 F;  4NXN F;  1PYT A;  3UN2 A;  1U6B A;  3CCM S;  2F8E X;  1FVQ A;  1NRK A;  1U24 A;  3A8J A;  1Y5L B;  4RW7 B;  4WTY A;  3T1A A;  3ZZR A;  2XCA A;  3A8K A;  2V94 A;  3A8E A;  1DTQ A;  1OPI A;  3CF5 Q;  2UXC F;  1RZM A;  1UEU A;  4JI5 J;  3TZW A;  3KLI B;  1ZYQ A;  2R7S A;  1RSC A;  3SDE B;  4FNI A;  2F8M A;  3M1V B;  3OR2 A;  3MEK A;  2H48 B;  2EKN A;  2CZV C;  3CJR A;  3HVW A;  4A8Y A;  1I5O B;  4DXL A;  5E2Q A;  1TQL A;  2BE7 D;  3FQK A;  4G1P A;  1RHR B;  1R7I A;  5IOL A;  1IXK A;  3US5 A;  3WX8 A;  2D3O 1;  2HQI A;  3WC0 A;  1P1T A;  1F9H A;  1CJV A;  1WJ9 A;  2QLF B;  3C6U A;  4LF5 F;  1Y7P A;  1KD1 T;  5IV4 A;  1KVJ A;  2ZDP A;  2E9Z A;  1V5V A;  5JVH Q;  2CQI A;  4ES2 A;  3VGT A;  1VLO A;  2AQ4 A;  1S76 D;  3CJ0 A;  1JIH A;  2IVM A;  4L75 A;  1RB0 A;  4JBC A;  2GNK A;  3Q89 A;  2BM0 A;  3BSN A;  1NK5 A;  4JP8 A;  1Q16 B;  1SH0 A;  1WG4 A;  2QFI A;  2FC9 A;  4R0E A;  4ZPT R;  2HBY B;  3PRD A;  1WKK A;  1A0O B;  3EPG A;  4LRA A;  4ZS6 A;  3WX4 A;  3J81 Y;  4DL5 A;  3KLF A;  2GML A;  1XNQ J;  1UEK A;  3PKM A;  4P73 A;  1B0V A;  2XMU A;  3MPW A;  1HI0 P;  1F0X A;  2ROP A;  4ITS A;  3AA9 A;  5CZV A;  2BKN A;  3CPW R;  2OPQ A;  3MEG B;  2E5I A;  5JJB A;  4MIB A;  1YJR A;  2QV6 A;  4HLB A;  1KP6 A;  5HMZ A;  3LF0 A;  3A8I A;  4USW A;  5I4M A;  1RTD B;  2QLX A;  4U8V A;  1UVI A;  2V8V A;  2FC8 A;  3ZXW A;  2R7T A;  5J1P A;  4UT4 A;  3M2U B;  3QT7 A;  5K8M A;  1EHW A;  3PX0 A;  1KRP A;  4YR2 A;  5HP1 A;  3X1L B;  3ETM A;  4DR5 J;  2GJ2 A;  2WTF A;  4ALZ A;  3NGR A;  5F0W A;  2IFX A;  1XMQ F;  2FB0 A;  4JB8 B;  1SI9 A;  2XC9 A;  1BXN A;  3N28 A;  4KGK A;  1CQM A;  5EDW A;  2CG4 A;  4I6W A;  5KT3 A;  3Q8Q B;  3G4S S;  4ZP6 A;  2NR0 A;  3UQS A;  3KTQ A;  3D6H B;  4YP3 A;  4GMK A;  2HNZ A;  1FCA A;  3GON A;  3MMC B;  1AB8 A;  5A8R A;  4YB7 A;  5IWA J;  2XO7 A;  2DPJ A;  2H5J B;  2XZT B;  4CCH A;  7AT1 B;  3BQ1 A;  3V6J A;  4AD6 A;  5EWF A;  3FFI B;  3IBF B;  2DK2 A;  2HRT A;  1HD0 A;  2VC1 A;  2FYX A;  2PFD A;  4Y0F A;  3D2W A;  3UD3 P;  1U8W A;  2GC8 A;  3FBF A;  1DAX A;  4AYB D;  5B7W A;  3DC2 A;  4C48 A;  4C8O A;  1XNR J;  4KGX B;  3K5N A;  2ZH4 A;  4ELU A;  5IT4 A;  1VQ8 S;  2RF2 A;  3I31 A;  2GA7 A;  3EXC X;  3J81 j;  1M1G A;  1KFS A;  2EFP A;  4QR2 A;  4CLZ A;  4DWI A;  4NPO A;  1IN0 A;  5BJR A;  1RTI A;  2LMI A;  2DD8 S;  2Y0B B;  1CG2 A;  3HSZ A;  3M2V A;  2MGZ A;  3TAP A;  1QE1 B;  2HMI A;  2XS5 A;  2B9Y A;  3F0N A;  2A3J A;  1U26 A;  2IPO B;  1F6T A;  1VIS A;  1Z4U A;  3J7A 1;  1P9Q C;  4HL9 A;  4P75 A;  1NK4 A;  5C2G A;  1DJ0 A;  3OUY A;  4C8Z A;  4UUX A;  3PAC A;  4MKV A;  5A8K B;  5K8O A;  4DDF A;  3PX4 A;  3CCW A;  2IY5 B;  2B5J B;  3OUY B;  1SQG A;  5CXT A;  3SV4 A;  3MEC B;  2G13 A;  2I1R A;  1DHM A;  5I42 A;  3HP6 A;  3DCA A;  1NJW A;  3DLE B;  3TUP A;  2Q6C A;  2K2P A;  1N48 A;  4I0W A;  1LK7 A;  1NM2 A;  2QL5 B;  4FPR A;  3UDL A;  1H72 C;  4URG A;  3HHL C;  5F8I A;  3ENA A;  2IC3 B;  5C2C A;  3CME S;  3MED B;  3FDS A;  3UD5 A;  3HMJ G;  3KJV B;  1RT1 B;  1WEZ A;  4DG1 B;  2FLL A;  1KHV A;  1S1T B;  2FLO A;  3R27 A;  4F4X A;  2FVQ A;  2PI5 A;  3CD5 A;  2ZM6 F;  4PG5 A;  2BQU A;  2HHQ A;  3W2W B;  2DGX A;  3Q8R B;  4K4X A;  1VYA A;  4TU8 A;  2V4Q A;  3K5L A;  2CXE A;  4NLT A;  2HND A;  3E3X A;  4LVN P;  2YWW A;  4TVA B;  4FYW B;  4YDX A;  4ZVQ B;  4R8U A;  1L5U A;  2HHH J;  2W4C A;  3FMW A;  4CO5 A;  3BO4 A;  1NJX A;  3U7J A;  1U1N A;  4B3M F;  4CLW A;  3SFG A;  4KIA A;  4D3H A;  5GAD I;  2RQM A;  3M8Z A;  4IG0 B;  3OL7 A;  3JYT B;  1QUV A;  3MHY A;  2JJ4 D;  4LF2 A;  2OEM A;  2IDE A;  2MKJ A;  3M8W A;  3MUR P;  1SQF A;  3BGO P;  1PG5 B;  2G2Z A;  4CYU B;  4Y2K A;  3OJU A;  1VQO S;  1PCA A;  2J9D A;  4P6Q A;  4K4U A;  5C7P A;  4KO0 B;  3H25 A;  2HGL A;  5J2N A;  1HYS B;  2XTJ P;  5HQL A;  5SZT A;  3IBW A;  4X65 F;  5B0C A;  2IAJ A;  2BJ3 A;  3MEE A;  4URS A;  1CJK A;  2HQD A;  4OZN A;  4YB6 A;  1S1W A;  4WE1 B;  2B9E A;  3T1H F;  2ASL A;  4LF7 F;  2AP6 A;  1RUS A;  5DM7 Q;  3RU0 A;  1VBY A;  2R8J A;  2K8G A;  4IH6 A;  1VHI A;  3D3B J;  3M6X A;  3ONQ A;  2C3Y A;  4CO0 A;  2QRR A;  1NCL A;  4UZB A;  4ED4 A;  2MJU A;  1UVK A;  4KKO A;  1PC4 A;  2VPZ B;  4QWC A;  5HLF A;  3NRB A;  1PSD A;  1IKY A;  4CLU A;  3UCU P;  3KNG A;  4ANE A;  2CJX B;  4IRD A;  2JWN A;  2OGU A;  2QFJ A;  3OPK A;  5L38 A;  3UE2 A;  2AIR B;  3WIU A;  1D8Z A;  1RAO A;  2GJF A;  3ICL A;  4H4K C;  1XBW A;  1T8E A;  3JSM B;  4WFX A;  4P71 A;  1ZM4 A;  1U45 A;  4QWD A;  4IKA A;  1HPZ A;  4F0H A;  1QAX A;  1GK8 A;  4YOE A;  5DM6 Q;  3T5J A;  3V81 A;  2W1B A;  1E6V A;  3RRK A;  4FS2 A;  1PAE X;  3NAH A;  2W2M P;  3R8Y A;  3KKF A;  3VQT A;  3J7Z T;  1PIL A;  2E44 A;  2F3J A;  4ECQ A;  2FUG 9;  2GMH A;  2OHD A;  3GSI A;  3KLG B;  2HK3 A;  2XHC A;  4CH7 A;  1NDP A;  1RU1 A;  4PYA A;  4DLG A;  4HHU A;  3TVZ A;  3WQP A;  4O0I A;  3EPI A;  2HFO A;  4DV4 F;  1HQU B;  1E6Y B;  4L76 A;  2AJ1 A;  2E29 A;  3AD8 C;  1KTQ A;  1UJ5 A;  4ZVG A;  5KFY A;  1D9D A;  3NMA A;  2XGP A;  4ZVH A;  5D4L A;  2DIU A;  1FRH A;  2PE8 A;  3QRR A;  2V50 A;  3D0G E;  4KGV B;  3TA0 A;  3W63 A;  4FNH A;  3DLH A;  3P49 B;  2I8E A;  4EZ9 A;  3IS9 B;  4FP9 A;  4CO1 A;  3I5C A;  4OHZ A;  4ECW A;  5J2P A;  1XNR F;  5AJ3 J;  4W92 B;  1S6Q B;  3SXL A;  2CQP A;  2W2N P;  3IC1 A;  1DUR A;  2C3O A;  1DTT B;  2OEL A;  3PJW A;  2KJW A;  5LJ3 Y;  1X9M A;  4DL7 A;  4LJM A;  1HMV A;  1RI7 A;  2I5J B;  2N7Y A;  4ZVR B;  1KEK A;  4U67 Q;  4NLD A;  3UDE A;  2J6S A;  1CEZ A;  2XI2 A;  4DX6 A;  2J0S D;  2H4Y B;  2Z58 B;  2LKZ A;  3FGV A;  3QSI A;  4G1Q A;  5ETP A;  2VDH A;  5L1I A;  4CO3 A;  5CYJ A;  4LF8 F;  1QLN A;  1IJF B;  2L08 A;  2KB2 A;  2IYG A;  1HW8 A;  4OZJ A;  4QPX A;  4N56 A;  2J9C A;  1QM9 A;  2XHW A;  3MMC A;  4PG8 A;  2HNZ B;  3MM9 A;  4BC7 A;  1FJE B;  4JI2 J;  1NKE A;  4Q2M A;  3ZZY A;  4LFB J;  2LEP A;  4BCA A;  3D7S B;  5ETV A;  5CCL A;  2HQF A;  3MUV P;  2BJD A;  1SCJ B;  2AGP A;  3H2U B;  3IFE A;  2MB0 B;  4Y34 A;  8ATC B;  3KJF B;  2HAI A;  3ZTP A;  3IRW P;  1UFK A;  1VIO A;  4KY3 A;  3H2L A;  4LIW A;  2WRM A;  4K4V A;  1HWU A;  3D28 A;  3D6F B;  1YG0 A;  4DPU A;  5KG1 A;  3P8B B;  1ZAW A;  3KJN B;  1FRX A;  5DRK A;  5LL6 d;  3QWU A;  2W25 A;  5M2U A;  4FYV B;  4OX9 J;  4FF2 A;  3RBX A;  2EC2 A;  1KOH A;  5A8W B;  3DDN A;  1KQK A;  2HVI A;  4WZQ A;  1N54 B;  3TOQ A;  4NLV A;  1IM6 A;  1S12 A;  4C11 B;  1Y11 A;  1WOS A;  4QIV A;  5LXY A;  2WB4 A;  3SSS A;  1FDB A;  4DU7 A;  4EI2 A;  4ZIV A;  5A8K A;  1KSP A;  4B3O A;  2RVJ A;  1KVK A;  1AZS B;  2HHX A;  1S9E A;  1QUP A;  2HEK A;  3NNH A;  3IRX A;  3R5J B;  1FRL A;  1NHV A;  3S7R A;  3QWP A;  4LRD A;  5KFJ A;  3IG1 A;  2NZ4 A;  4L74 A;  2VA3 A;  3NBP B;  5C24 A;  1UEV A;  4C3K A;  5KFO A;  1LWC A;  1D09 B;  2F8H A;  3O8W A;  1T94 A;  2GW8 A;  3PYD A;  4DR4 J;  3KJV A;  3TZZ A;  4B3T J;  4HT7 A;  4WU2 A;  1V9O A;  3AOC A;  1W2I A;  5KT5 A;  4PUO A;  3DU6 A;  2GVZ B;  2YH0 A;  2ABY A;  2GCF A;  2J9D E;  2V8D A;  4QR0 A;  2R8K A;  1OY9 A;  2V34 A;  2AJF E;  1CS4 A;  4AXJ A;  5A6P A;  2UVR A;  5HLF B;  1WDT A;  5KT2 A;  3E2E A;  3TA2 A;  4KHR A;  4CI0 B;  1IBL F;  1D8Y A;  1X5S A;  4M5I A;  4C2M A;  1WNE A;  2RH3 A;  1SBR A;  2YXL A;  1SKW A;  4WPA A;  3Q0A A;  1IM4 A;  1ZTW A;  2CQ4 A;  2DVI A;  3F73 A;  3CXC R;  2V2Q A;  4G1I A;  1JKH B;  5A76 A;  3JAM U;  1DTQ B;  3PEH A;  3Q24 A;  1RKJ A;  3L7O A;  4C8L A;  2OSR A;  4PCQ A;  4O3O A;  1E6V B;  3MEE B;  5D0H A;  2LP4 A;  3OTC A;  1BY9 A;  2YQ1 A;  4UOH A;  2GIQ A;  1HNX F;  3KK2 A;  4I7F A;  4LF6 F;  1OO0 B;  4I68 A;  4WP3 A;  2F9D A;  2CJB A;  3C6T A;  3PV8 A;  3ISN D;  3HFK A;  2E7V A;  4B3S F;  4FPI A;  1RBO B;  3K2Y A;  4RNO A;  1S0V A;  2M0G B;  4NRU A;  2F5G A;  2HZV A;  3C3L A;  3T1Y F;  2IBK A;  3CJ3 A;  1WC3 A;  4RWW A;  4DR1 J;  3PW5 A;  3EZO A;  1X5O A;  2K06 A;  4H4O A;  3BGF A;  1TMM A;  4NLW A;  5DJB A;  2QLJ B;  3SQG A;  4WF9 Q;  4ECZ A;  1HL6 A;  3F44 A;  4X4V A;  2RIL A;  3N9U C;  3R3T A;  2D9O A;  1N32 J;  3I9Z A;  4AQY F;  4DS5 A;  2ZHO A;  4QIF A;  3PR4 A;  4IH5 A;  1N0V C;  4RLE A;  1R89 A;  3F56 A;  4O23 A;  4OI2 A;  3GIK A;  3CD0 A;  3FVY A;  5HRO B;  1RLD A;  4JI8 F;  3GU0 A;  3N5F A;  1Y3K A;  4NYO A;  2YVS A;  1RCX B;  4CZC A;  2CNL B;  2PII A;  1Q4R A;  3QO9 A;  2QLW A;  3GTY X;  2I0X A;  3IRX B;  1C0U A;  3NCP A;  4QR1 A;  3T19 A;  2R42 A;  4C3L A;  4IOA Q;  1IJE B;  3QFH A;  4ED0 A;  1J5E J;  3N6L A;  4DPY A;  4WYL A;  4CLS A;  1YQH A;  1WF0 A;  3HXM A;  1DZ5 A;  2FJW A;  3M1V A;  3N6M A;  2F63 A;  2QA1 A;  3FCH A;  3LAM A;  5KAK A;  1FWK A;  1SC4 B;  1YGY A;  5KFB A;  3MFH A;  4DV7 F;  3MCN A;  1RT2 B;  2FJA B;  2YBV A;  4WP8 A;  1CS4 B;  3GB0 A;  2P6T A;  3LP2 B;  5KFT A;  4X64 J;  2QEX S;  4LR9 A;  9ATC B;  3GFZ A;  4YN3 B;  3TJA A;  4EK2 A;  1TKT B;  3BJY A;  3IAS 9;  3MUM P;  1O5J A;  1NK9 A;  1NJI T;  4DPX A;  1SC3 B;  3ULH A;  2OTL S;  3MR6 A;  5HL7 Q;  3CD6 S;  2AX1 A;  1HPZ B;  4YY3 J;  4HAC B;  1IQT A;  2VPW B;  4RPF A;  3GZ7 A;  4CT8 A;  2DNN A;  3QQC D;  2KT2 A;  1U2R A;  3NOG A;  4M5J A;  2W9C B;  3DMJ A;  4F7V A;  3QJL A;  2U1A A;  3I96 A;  2F4V J;  4KGM A;  2G1D A;  2QG9 B;  2YPZ A;  2YWG A;  3EVM A;  1LW0 A;  5CQG A;  4R5P B;  3ZTR A;  2IM2 A;  3HUL A;  5DQG A;  5MLC V;  5GVQ A;  1AZS A;  3M7V A;  3MM9 B;  5L9N A;  2BJ9 A;  1SJR A;  1S9E B;  4OYM A;  4WXO A;  5AXK A;  3MM8 B;  3NLC A;  2BAB A;  3IR5 B;  3OFG A;  1HBO B;  2WVE A;  4HTI A;  1U8S A;  3W9H A;  2UXC J;  2E1R A;  1NDC A;  3FSY A;  1DQA A;  1RJJ A;  3OVA A;  5H9F K;  2RDI A;  3H4D A;  4RKU C;  3QAT A;  4C9D A;  3L7U A;  4IFV B;  2W2P P;  2JLG A;  2PSZ A;  1UJ4 A;  3QGP A;  1OY8 A;  3EDR B;  4J9P A;  1S72 S;  1FJC A;  3QJJ A;  1FE4 A;  1U2F A;  1UWB B;  3RAX A;  1UWA A;  2YH1 A;  1ACM B;  1HQE B;  4FZV A;  3Q8Y A;  5CCM A;  3R6L B;  1S1X A;  2P9E A;  4IG0 A;  3DM2 A;  4M5L A;  2V69 A;  5KFZ A;  3N5B A;  4ZVS B;  5IWA F;  2CVE A;  3EGW B;  4H4O B;  3A4T A;  3CCL S;  4X66 F;  1VRT B;  1WOO A;  2GHP A;  3AB2 B;  4DR6 J;  3OT9 A;  2F4V F;  2EBE A;  3T6J A;  2RD5 C;  2LXF A;  2DRB A;  1SC6 A;  3LP1 A;  1Y3J A;  3CSK A;  3I0S B;  3M9O B;  4EBD A;  4JYA F;  2B0G A;  1MG7 A;  1K0T A;  3DFE A;  2DR5 A;  2R7X A;  1B7Y B;  4WFY A;  4ECT A;  3KJQ B;  2RHS B;  2C2R A;  1EIY B;  2BDP A;  1KN6 A;  4F26 A;  2RML A;  5IQQ A;  4BC9 A;  4QYR A;  5I3U B;  2IC3 A;  4M63 A;  2GO9 A;  1ZM2 A;  1S6Q A;  1HFE L;  3NNC A;  5KG3 A;  3P6Y C;  3QID A;  3IMQ J;  4F4W A;  2CJA A;  3SSR A;  2J8S A;  3IAM 9;  1C1B A;  1V3R A;  4Z7Y A;  4YY3 F;  3PJ9 A;  2XLJ A;  3KMQ A;  4O44 B;  4LF5 J;  2NLW A;  4X4T A;  4YB1 P;  4G3I A;  2ALZ A;  4BHQ A;  1DY3 A;  3TYT A;  1D0E A;  2EI5 A;  4Q7A A;  4B3M J;  2KH9 A;  4ZCI A;  2DCL A;  4MKA A;  3SV3 A;  1XER A;  4HEA 9;  4B3O B;  4KH0 B;  4NCA A;  2DY9 A;  2V2K A;  4P2X A;  2VHG A;  4PG6 A;  1LWX A;  3EJM A;  4OYX A;  5DG8 A;  1SIW B;  4ZPB A;  3Q22 A;  4EEY A;  2GJI A;  5D0G A;  3TAR A;  1UW4 A;  2P2C B;  1TMJ A;  2AHO B;  4K7Q A;  1RHK B;  2QYC A;  4RW7 A;  3VGU A;  2CQ1 A;  3OHB A;  3VAH A;  1U1K A;  1XMO J;  4LFA J;  1NND A;  3O2I A;  1JX4 A;  1AUD A;  3FNN A;  3I9V 9;  4B9U A;  5T41 A;  5L39 A;  4C4W A;  1NK0 A;  2BAC A;  4O3Q A;  5KFS A;  3PXG a;  1ZET A;  4JI8 J;  1ZTT A;  1RAE B;  3ISZ A;  4PG7 A;  3BO2 A;  2W4P A;  2MMY A;  4IO1 A;  2VQE J;  4IO9 Q;  4RUH A;  4FXW A;  5AT1 B;  4CH1 A;  4F67 A;  1QVG R;  2BJ8 A;  3DHX A;  3DXS X;  3RUB L;  4C0H A;  3T1Y J;  4AQY J;  4Z7C A;  3KK1 B;  5HVG A;  2CRL A;  1YZ6 A;  3QSY B;  4ZLN A;  1G2E A;  5C5J A;  4C8N A;  3H7H B;  2F1F A;  1UPM B;  3TQE A;  3SIP B;  1IBK F;  3VCD A;  5DET A;  3IXQ A;  2HVZ A;  3P45 B;  1WTB A;  4OJG A;  5J1N A;  5B0B A;  2LLZ A;  4DHV A;  1PBU A;  3DLG A;  4IR9 A;  1CJK B;  2F65 A;  2C28 A;  2ZUA A;  1HBM A;  1S1W B;  4RW8 B;  4WE1 A;  3DHW C;  5M2R A;  3WC2 A;  4NXN J;  1WC6 A;  2X1F A;  2N4C A;  3BBB A;  1OYD A;  5KFR A;  3KUE A;  3TAN A;  1T9T A;  2V2Z A;  3IA0 A;  1XQI A;  2CUY A;  4KO0 A;  4PWW A;  2VA2 A;  3G2X A;  1NZA A;  1VJW A;  1WWH A;  4ZOS A;  4IG3 A;  4DV3 F;  3W7B A;  4DX8 H;  1BQM A;  1R43 A;  2YX1 A;  2ZKT A;  4ZIW A;  1HR0 F;  2MZ1 A;  4ELV A;  2MEW A;  1RK8 A;  3MEG A;  2R8I A;  4DL3 A;  1PYS B;  4RUC A;  2AEM A;  1HBO A;  4ZJQ A;  2ROE A;  3SYZ A;  2YKN A;  1VC0 A;  4U9R A;  3HF5 A;  2FGO A;  1U0H B;  2DBB A;  2XZD B;  3VAK A;  2BJE A;  2HND B;  2RUS A;  4DFJ A;  1JLA A;  3CCR S;  1HBN A;  4OFZ A;  1S1T A;  4DI6 A;  4ZP7 A;  1WC4 A;  5FLX U;  5CD4 H;  1UA0 A;  4K50 A;  4O4R A;  4AL5 A;  1NHU A;  5DG9 A;  4P7V A;  4ZLL A;  1YRX A;  3TI0 A;  3BQ0 A;  2QTW A;  5KFU A;  3LWM A;  4ZPA A;  3AJ1 A;  4C98 A;  5L1K A;  3CNQ P;  1I3O B;  1DTT A;  3JSM A;  2DGO A;  4HKQ A;  4ANC A;  3MM5 B;  1HBU B;  4LBI A;  4ED5 A;  5DDR C;  4USI A;  2BX6 A;  3NGU A;  1T7P A;  3RW6 A;  3CCZ A;  2E1A A;  1X9S A;  1AFJ A;  3OD2 A;  4ZA1 A;  3GJT B;  3MEC A;  3VGV A;  4RWX A;  2CJY B;  1RAD B;  3BS9 A;  1NJY A;  3L95 X;  3VVU A;  1E6Y A;  4FKX A;  3RG6 A;  3CJK B;  4DF4 A;  1R0A B;  3T5L A;  3HCX A;  2ZHA A;  5HVF A;  4QYZ J;  2KI2 A;  4JV5 J;  2XMK A;  3RB6 A;  2MGZ B;  1S1V A;  4DR5 F;  2AJQ A;  1WHW A;  3TUI C;  3B82 A;  4ZN1 A;  2ZD1 A;  2P9G A;  4LFC J;  3OR1 A;  2VBZ A;  5CYM A;  3PIP Q;  2DXD A;  2VPY B;  4GVL A;  1RT3 B;  2M70 A;  3VR1 A;  5K8P A;  2GHV C;  4DQP A;  4NLX A;  5HQM A;  1CJU A;  3SZ2 A;  4ZPD A;  4RNH A;  3I32 A;  1XMO F;  4DX7 A;  4DPO A;  1YVF A;  3DLB A;  1FD2 A;  3V5R A;  5CA5 A;  2MYF A;  3V4I A;  1X4D A;  1SPB P;  5A8R B;  3HPO A;  4B9S A;  4MIW A;  3TZX A;  3HHL D;  2EW9 A;  1S79 A;  2XQC A;  1T3N A;  4EZ6 A;  3IWX A;  2V9K A;  3Q8P B;  2HUR A;  4ZCL A;  4JI5 F;  1LW2 B;  3SQO P;  4YQW A;  4P74 A;  2UVV A;  2WAQ D;  3CWJ A;  4I7F B;  3U02 A;  2Z56 B;  4OHY A;  1NH7 A;  3HKW A;  3E01 B;  4FKY A;  1FNM A;  1FRI A;  4FF1 A;  4OJH A;  4DL0 C;  5JMN A;  3TQ1 A;  1H2T Z;  5FDL A;  1S97 A;  2E5L F;  2IBO A;  4ZVF A;  1C0T B;  1LQ9 A;  4I2Q B;  1CJV B;  1X4A A;  2FIU A;  5K5M A;  2HBR B;  2M88 A;  2RQC A;  1FEH A;  2HWH A;  2LEA A;  1NKC A;  2CZ4 A;  2IRX A;  2HZC A;  1BHN A;  3MI7 X;  5J2Q A;  5G0R A;  2FQQ B;  1IBL J;  2B5J A;  1N5T A;  2VFS A;  1IBK J;  4H54 A;  2KN4 A;  3UNG C;  5KFA A;  3FCV A;  4RNF A;  1YZ7 A;  2DGU A;  2MJN A;  2ZC3 A;  4RUB A;  3R9L A;  3THT A;  2VJV A;  1Q8K A;  3BB5 A;  1UPP A;  2VFT A;  5KOX A;  3QLH A;  3DGP A;  1UET A;  5A2Q U;  2CPH A; 
#chains in the Genus database with same CATH homology
 4C6A A;  1W7W A;  4EK2 A;  1XIQ A;  4AND A;  2ZUA A;  3ZTP A;  1F3F A;  3ENA A;  3BBB A;  4W98 A;  3FBE A;  1XQI A;  1NB2 A;  2B8Q A;  3G2X A;  1NDK A;  3BBF A;  4HR2 A;  4F4A A;  4ENO A;  3EVM A;  2DXE A;  1VYA A;  3ZTR A;  3Q83 A;  3JS9 A;  2AZ1 A;  1HIY A;  3NGT A;  1NDL A;  1UCN A;  3Q8V A;  1NDC A;  5IOL A;  3VGS A;  3WX8 A;  1B4S A;  2HVE A;  4DI6 A;  1KDN A;  1ZS6 A;  3L7U A;  1NLK L;  3Q8U A;  1B99 A;  1NHK L;  3ZTQ A;  3EVO A;  3VGT A;  1NSK L;  5C7P A;  1K44 A;  3FKB A;  1HHQ A;  3EIC A;  1HLW A;  3Q89 A;  4ANC A;  3Q8Y A;  2BX6 A;  2HVD A;  3BBC A;  3NGU A;  1WKK A;  1LEO A;  2BEF A;  1S5Z A;  4UOG A;  3VGV A;  1NCL A;  3FBB A;  3FCW A;  3VVU A;  4FKX A;  3NGS A;  3ZTO A;  4ANE A;  1BE4 A;  2DXF A;  1NUE A;  3EM1 A;  4DZ6 A;  3DKD A;  3EVW A;  5CAA A;  1WKL A;  3EE3 A;  3ELH A;  2AZ3 A;  1EHW A;  4WBF A;  3BH6 B;  4UOH A;  2DXD A;  2B8P A;  3ETM A;  3EMT A;  1PAE X;  3Q86 A;  3B54 A;  3PJ9 A;  3NGR A;  4UOF A;  1NDP A;  1S57 A;  2NCK L;  3MPD A;  3FBC A;  1NSQ A;  1BUX A;  2DY9 A;  3VVT A;  4S0M A;  3FC9 A;  3B6B A;  3EJM A;  1LWX A;  2HUR A;  4F36 A;  3VGU A;  2CWK A;  4DUT A;  1U8W A;  3FBF A;  2DYA A;  3GP9 A;  3PRV A;  4FKY A;  1S59 A;  5BXI A;  4CP5 A;  4KPC A;  3DDI A;  1PKU A;  4O0N A;  1JXV A;  1MN7 A;  1BHN A;  1NSP A;  1F6T A;  1MN9 A;  5CAB A;  1WKJ A;  3BH7 B;  3FCV A;  2VU5 A;  3R9L A;  3GPA A;  3ZTS A;  1NPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...