3EIJA

Crystal structure of pdcd4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
296
structure length
276
Chain Sequence
EFLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKDCVQARAALDKATVLLSMSKVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 4
publication title Structural basis for translational inhibition by the tumour suppressor Pdcd4
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 103
structure length 276
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3eijA02
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3eijA01
4CRWA 4GMLA 2HM8A 4B8AA 3FEYA 1UW4B 1UG3A 2GGFA 1PAQA 2NSZA 2KZTA 3L6AA 4B89A 1N52A 4B8CB 3JUIA 2KZTB 2IOSA 2RG8A 2FULA 4JHKA 3FEXA 3EIJA 3D3MA 4CT4A 2IONA 5ANRA 2VSXE 3EIQC 1N54A 1HU3A 1H2TC 2IU1A 2IOLA 2ZU6B 1H2UA 4CEMA 2VSOE 1H6KA 4IULA 4C9BB 4JHJA 2I2OA 3RK6A 4GMJA 1H2VC 4LUNU
chains in the Genus database with same CATH superfamily
5CMYA 2X6KA 2VGXA 4K5BA 1JWGA 4HOSA 5LCWC 5HRYA 5ENTD 1FPPA 3QWPA 5CRUA 2H6GA 2XCBA 2RKKA 2V4LA 3TWSA 4JB8P 1OUVA 1HH8A 4KMOA 2YQ8A 5AJDA 1ELRA 2XCCA 2XZTG 2E0IA 2OEWA 4F7AA 1K1AA 4L2YA 4BERA 4UI9K 4U95D 5KCMA 3HRAA 5AARA 4Q69A 3UTMA 3UIPC 1YYHA 1O1RA 3AG2E 5B3SE 3R9MA 5EIDA 5FZRA 3SD5A 4GYOA 5CBNA 3L16A 3PH0C 3JQ1A 1SW6A 4HQDA 2QY7A 1P5QA 3LYAA 3AS8A 4UWLA 2GRLA 3PREA 4J8DA 2CHZA 2R02A 4J8YA 1OWMA 2WQ7A 1H6KA 3RSEG 2I1KA 3CKCA 4GYYA 3FH5A 4MS6A 3E33A 2GW1A 5EIBE 2LSUA 4KZCA 1EPUA 4I17A 2P9KG 4I43A 1ZB1A 4UWHA 1IQRA 2MRIA 5KWDA 1G3NB 1MYOA 3UM0A 3D9NA 4HRLA 2OEVA 4U0ZA 4FU3A 2LNIA 3L6AA 4BESA 2AXVA 3QAQA 3UM3A 2UWJG 4ACLA 4GTMA 1JCSA 3PE4A 1QNFA 2L9BA 2ZGGA 3ISMC 2RD0A 5LOZA 3AAAC 2Y4TA 3D9HA 3TJPA 4TV3A 3QC1A 1BD8A 4G2VA 3T5XA 2IO2C 5FQ6A 3TWWA 5AQ7A 1WAO1 1E8WA 2UY1A 3W9GA 5KNHD 3CHMA 1FCHA 1QBQA 4HB5A 5BT1A 2DIWA 5M72A 2F8XK 3ONLA 1NL4A 2IQCA 2PQNA 5IY5E 1TR4A 3C3QA 5KBAA 1D9SA 2FF4A 4A63B 1NP7A 3ABME 2ZISA 2ZGDA 3P2BA 3ZYKA 4HI9A 3MYVA 3CVYA 4FHJA 2DCPA 2FI7A 4ILGA 4LNUD 4XEIG 1BI7B 3ZXPA 3MCXA 3OAWA 3ZN3A 4M7CA 3CVNA 3FU3A 3LVRE 4CEMA 4WAFA 5FQ8A 4YDWA 5G05J 3B7SA 3UT4A 3HXDA 4LUNU 3S7BA 3LJ3A 5KJLA 2DZNA 1ZU2A 4I6JA 1E90A 1OCRE 4JVSA 3BQOA 3SO8A 1RW2A 1OWNA 3EHNA 3RAUA 4BSZB 3LPZA 4L23A 4UQYA 2AVPA 3VLDA 3ZFWA 3UI2A 1UJKA 3MX3A 3PNTB 3RRUA 1WY6A 3U4TA 3ZUVB 4OYSA 3E30A 4WNEA 1FVHA 1N4SA 2Y69E 4U7EB 1Z5SC 3LJNA 3E4BA 4Y6WA 4CT4A 1HFAA 2H6FA 1KPSB 3EHMA 3Q79A 4EBAG 5CEAA 2X38A 4A55A 4KVMA 3WG7E 1S70B 4QQIA 1PAQA 2XEEA 5AQ9A 4GU5A 1XGWA 3SFZA 4IN3B 5E75A 1IHGA 3LDZA 2IJGX 2IOLA 4RQIA 3FUDA 2QFCA 5ENOD 4QFVA 2WQHA 1H2VC 2XQ0A 3NOCD 2FO1E 3IEGA 3FUJA 3UKUG 5LP0A 2DVWA 4ATGA 3HDXA 4GTQA 4DX7D 3D9MA 3T5VA 2WXIA 3PEVB 3T8MA 3CVPA 4BX9A 3D9IA 3PZ3A 5A7DB 3Q9NC 1NFIE 4C48B 3CVLA 3ULEG 2OVFA 4N5CA 3TWUA 3SHFA 4HVBA 1MZCA 2EIKE 3RK6A 5FZSA 3QWWA 2BUGA 3PZ4A 4OAUC 3Q7FA 4KT6B 4XI9A 3ABKE 2PM6A 4ILIA 4KVOA 4R7LA 5CMWA 3GZSA 3JXIA 3ZVVA 4GA2A 4UWKA 4CGVA 1OWLA 3NF1A 4TXRA 4C9BB 4CDRA 3Q47B 1Y6IA 3V30A 3SBSA 4HOTA 4XIFA 2YINA 2X6FA 3TG5A 2CG2A 3JYSA 3I4RB 3JUEA 3BG0B 2QYJA 4JHJA 3G2UA 4JL0A 4AP2A 5ITZF 4B93B 2WVIA 4RSYA 1HX8A 3DBSA 2FULA 4YDEA 3IKOB 4CDMA 2WXFA 1HG5A 1H6OA 4ME2A 4GTOA 3UT8A 3FUNA 3CHPA 1HE8A 5KJMA 3FWVA 4Q94A 5ENQD 4YVOA 3FU0A 5FT9A 3CVQA 3D9KA 2HYZA 3GZ1A 1UN9A 3FUKA 1PC2A 2CFUA 1IKND 3FHEA 4IULA 4HOQA 3ENEA 4GZCA 1TNZA 3LS8A 1BI8B 2NSZA 3DWLG 3MKRA 4UI9J 5EX0A 4I9EA 1DCQA 2DZOA 2H6IA 2HE0A 3C3RA 4UQXA 2VQ2A 5EX3A 2CHXA 3TG4A 5JJ7A 3CLJA 2MOWA 3U66A 5JMND 2VYIA 1EYHA 4GTSA 4IRUA 2BEDA 1Y8MA 3ZW3A 1XNFA 2V4HC 1HU3A 2C0MA 3Q73A 1KLXA 1N11A 4N2QA 4CRWA 4NQ0A 1WM5A 4EHMA 3D9OA 1JWFA 2WXMA 1PY1A 4EECA 1U2VG 3IXEA 4DJAA 4JHRA 3ASHA 1MX6A 2IEJA 3ML9A 3V79K 2OOEA 4I2WA 2P9SG 2MYOA 3ASOE 4NURA 3C5RA 2EQXA 3R7RA 4UQZA 4YVQC 3G2VA 2XS8A 4EPZA 3D9JA 2Y0BG 3APDA 2ETBA 3FDHA 1H6PA 2L6JA 3FUFA 3JCKC 2E2EA 3FH8A 5BV0A 2R59A 2EIJE 1S64A 5AENA 4PH4B 4TUUA 3E34A 1LF8A 3FTUA 3R7QA 4LNGA 5DBKA 3DEPA 1N95A 2IY0C 3PVLA 4O6FA 2I9CA 4GCNA 1E8XA 4U07A 4A1GA 4AM9A 5G2NA 2JABA 3IHVA 2KATA 3HIZA 3DXMG 4PS8A 3R9AB 2WXNA 3PS6A 4L2LA 2NC9A 4GAAA 4W9RA 3QK0A 3FUIA 4BT9A 2AXZA 3EHQA 4GTTA 3LY8A 4DI3A 1NI1A 5EILA 2VSXE 4G8LA 2VSOE 3X2QE 2WXLA 2BTDA 3AG3E 2FBNA 4N3CA 1Z6TA 2IF4A 3D9LA 4ZHBA 2P9NG 4HBDA 1BU9A 4LNBA 4GZ3A 4TUMA 4N39A 2MHKA 4N3AA 3MV2B 4FP7A 5C1DA 4JA7A 2Y4UA 1DVPA 4BSXA 5ANRA 1K8KG 1MHQA 4V3IA 5FINA 4WNGA 3C98A 4ANVA 1X5BA 2P2CP 3LKUA 4EZKA 1RZ4A 3PDNA 2YHCA 5BNWA 1S63A 3UX4A 2XRZA 2LSVA 3APFA 1OCOE 4I9CA 1N4RA 1K1BA 2ZU6B 3OTNA 2WQ6A 1S0PA 4GMJA 1SA4A 4FADA 3RRNB 3HXCA 2I1JA 4L9PA 3QKYA 5T8IA 1OY3D 3NB2A 5HI7A 4AIFA 1NA3A 1EF1C 3DPDA 4HFGA 4DK5A 3CR3A 2V5QC 3MKQA 3LEWA 3B7BA 2OV8A 1JUQA 2L6BA 4FJYA 4HRNA 3DSWA 3CIAA 1E7UA 3IBEA 3CHSA 2ZXWE 3L9TA 3QB2A 3QOUA 2XPYA 2HR2A 1QYMA 2EINE 2YNQA 3Q9UC 3HXFA 5HKPA 3SY2A 3N71A 4XX5A 4BFRA 4DLQA 4HI8A 4BEPA 2A5UA 3TAXA 4BETA 3U3WA 2Y3AA 3GW4A 2KM4A 3SZ7A 3FEXA 5FIOA 3L82A 4AXHA 3FY4A 2J08A 4FLBA 4XKCA 4YDYA 4ANUA 5FQ7A 4LRZA 1FVFA 2J07A 2GRNB 4K5CA 2R05A 3HVEA 3Q75A 5EKQD 4JD2G 4WUYA 1N0QA 3U64A 4GPMA 1AP7A 3DEOA 3HHMA 5ENPD 3FTZA 3CHRA 3TL5A 2RG8A 1Q2ZA 3Q7AA 3CQGB 4UWFA 3UXGA 2IU1A 3LY9A 4BX8A 4DLOA 5D0OD 4O1PA 5BXUA 3V2XA 5AQAA 1O1SA 3G2SA 5FJYA 5CBOA 4I6EA 4WWNA 2ZIRA 4XE0A 4URKA 2EIME 4XZ4A 2KXPC 3ZRHA 2WXPA 1TJFA 3J5QB 5CCLA 1MJ0A 5BV1A 3Q49B 2KZTB 4ATZD 4CT0A 5JHBA 2WXOA 2DYSE 5JJ6A 2BKKB 3ESLA 4O1OA 3LCAA 4G1TA 1TN7A 2WXHA 2DYRE 2IO3C 3FTXA 4WWPA 4Z68A 3FEYA 2OVBA 2QZAA 3HYMB 3TGOA 3O48A 1KZOA 3CK8A 3C3OA 3SNXA 2LO6A 1U3CA 2RFAA 1KT0A 4WWOA 3ZHEA 4LSZE 1H2TC 3AG1E 4GPKA 4U0UA 4EQFA 3PE3A 3RIBA 2GRQB 3HXBA 3BU8A 1DNPA 4KYOB 5CEDB 4CZ2D 3FP3A 3PNLB 1D8DA 2XGOA 1E8YA 4PS3A 3WXXA 1H2UA 1Z3XA 3E37A 1DC2A 4U8HA 2XPIA 5B1BE 4U0SA 4RG6A 2I6HA 4DX2A 2QC9A 5FZQA 4A1SA 3ULYA 4AJWA 1GW6A 4HXIA 5G55A 5AN8A 1WG0A 3CQCB 3DXKG 5C2YA 3CVWA 5AAOA 4CGWA 4BTAA 2BF0X 3EIJA 5LX8A 3FTWA 2GRMA 3RKVA 2QYUA 2L0IA 5BUZA 2IFUA 2WXKA 5CERB 3OXFA 1VDYA 3MKQB 4N3BA 3QJZA 4J6IA 2L0TB 4RVBA 4U96D 2KCKA 4I6GA 3JXJA 2XHEA 4LERA 2Q7FA 3OXLA 2P9IG 3AU5A 4B0ZA 4B8AA 4NIKA 4K5AB 5CCMA 1N52A 4APFA 3FTYA 3AU4A 2V5FA 4G24A 3VLFA 3ASGA 1JPLA 4J8EA 3PUJA 1H0AA 3AG4E 3DSXA 4HOUA 2CG3A 1LTXA 2WMOA 4AY5A 5ARFA 1UN8A 4DX6D 5LFAA 4B94A 1E96B 5EN5D 3DSVA 1V54E 3UKRG 3PZ2A 3JUIA 5J08A 3SFXA 5G04C 2PZIA 2GRRB 4GMRA 3L17A 2B6CA 3HVEB 4BTBA 4JA9A 3QNKA 4EBAA 1QQEA 3B7RL 3RU0A 1HXIA 4M3OA 2HM8A 1UG3A 1IQUA 3CKBA 3URZA 1N4PA 5EYPF 2J9QA 3NZSA 4DUIA 3APCA 3B95A 1H19A 2CFZA 2B0OE 4CDNA 3SI5A 4GZ5A 3MV3B 4JZYA 3FU6A 3LXUX 3K9IA 2R03A 2DWZA 1ZBPA 4JEHA 1N4QA 2DBAA 4JHKA 4U8VD 4J8FA 5E76A 2J8SD 4GZ6A 3IHYA 2X6IA 3CK9A 2RFMA 3MZLB 4GB9A 4WNDA 5DIZA 3DPYA 3ZYLA 2P58C 2ILRA 4YNDA 3FTVA 3Q78A 3TXNA 4ACKA 4CYMD 4NRHB 2XGMA 4UWGA 5JHAA 4PUCA 1FT1A 5B1AE 2Y1LE 2VSNA 2KZTA 1KZPA 4E6HA 3VLEA 1TN8A 1BPOA 3MGBA 4K0RA 4Y6CA 1AWCB 1LD7A 2KCLA 4HRMB 3ZHEB 1SZAA 1TYQG 1UJJA 1SZ9A 4G25A 4BT8A 2WMNA 4G8KA 2AJAA 2XPZA 2NXPA 4LG6A 3RRMB 1E7VA 1HF8A 1L5JA 3Q4AB 5AJLA 2WB2A 2R17C 4ABNA 3SFYA 4FLHA 1U3DA 2FEZA 4J7WA 3CSTA 5ENRD 2AXUA 4MRUA 1A5EA 2R2LA 4EZLA 2EILE 1OWOA 3KS2A 4A3VA 5D0QD 4HORA 3KEAA 1INZA 1ELWA 3W9FA 4JW1A 2VGYA 1JCQA 4GTPA 4PDXA 2YHEA 2XS1A 1OWPA 3QDNA 3ESKA 3CVUA 3MEKA 2C2LA 4KBQA 3TWXA 4FC8A 4ILHB 2X6HA 3I4GA 3VTYA 1O5MA 5J90A 5HQ8A 1N94A 4APOA 4F3VA 2LXLA 3HG0D 2WXJA 4GYWA 1BLXB 2XEVA 5CHEE 3EU5A 1V55E 3ZPJA 4L7TA 4TXQA 3ASDA 1KT1A 1IHBA 2P9LG 1TNYA 2P9PG 4AY6A 4U04A 3FFLA 3UUXA 4N2SA 3T9KA 4AEZC 1TNBA 3AS4A 1YCSB 3OXGA 3UMVA 3ULQA 4P29A 5ARGA 1OCCE 2GRPB 2I2OA 3ZXSA 5EYLA 4U8YD 4LCTA 4HS2A 3AS5A 3EIQC 4G23A 4EZJA 1O1TA 3VTXA 3FUMA 2ETAA 1B89A 3D9PA 1UOHA 2WXQA 2V8SE 4LEUA 3G2WA 5A23A 3S2AA 3SBTB 1YMPA 3UINC 3FULA 4D10C 2HO1A 3PEUB 2J49A 3PRZA 5T4YA 3ZIMA 3PZDA 3B7UX 4GTVA 4XI0A 1HO8A 1TJCA 3BG1B 1WDYA 4HLLA 2PM7A 2JEKA 3U9WA 3B7TA 3J5PA 4JC8A 2IOSA 3GZ2A 4DX1A 5JJTA 4GA0A 4TRQA 2KCVA 4C0EA 2VTBB 4XKBA 5FTPA 3V2OA 1NA0A 2F0YA 3LVQE 3ML8A 4JXTA 5JA4D 2OCCE 4U63A 3QARA 3KSLA 2F37A 2J4DA 2CHWA 2NYJA 2FO7A 4GTRA 4B89A 5AYWD 4MBGA 3TWQA 5ENSD 3PUKA 2H6HA 2LAHA 1EDUA 5CECB 3UPVA 3S7FA 3NOGD 4AVXA 5G05C 1MQSA 1MX2A 1SVXA 3CVVA 2PNNA 2PQRA 2LXMA 4BWRA 5KJKA 5A6CA 4AV7A 3LY7A 1UW4B 4B8CB 2VGXB 1NZNA 4TXPA 4RG9A 3EDTB 4J0UA 4HLEA 4ZFHA 4G26A 2GROB 2P9UG 3DSSA 3KD7A 1SA5A 4F6RD 2KC7A 3FUEA 1OT8A 2WXRA 5FQ4A 2XZDG 4E85A 1A17A 3Q15A 4L1BA 3QWVA 3CHQA 4GMLA 1DCEA 3EHRA 4OVVA 2LAIA 3BUAA 1TNOA 2J4BA 1FT2A 3ZNGA 3D3MA 3FH7A 5BXOA 2X3MA 4G11A 5CRVA 3DSTA 3P1UA 3B13A 1JCRA 3KEZA 3C72A 2XRYA 3IV0A 5BW8C 2AW6A 4A3TA 1HZ4A 5H7PA 3PZ1A 2VSYA 4K03A 1IXVA 2V0PA 3RJVA 3ONKA 3NZUA 4F1PA 4DPRA 3BEEA 4OVUA 4I1OB 3NBNB 4WNFA 4I1AA 4X8QA 5EDSA 1TN6A 4MLPA 3EU9A 3L08A 1TEZA 3MA5A 1N54A 1HG2A 3L54A 1TNUA 3JQ0A 4ANXA 1OXJA 5T3RA 2ONDA 4FA6A 5AIJA 4AOFA 3CK7A 4FJZA 3G2TA 3RO2A 1N9AA 4JEUA 1K3ZD 2VJ8A 1OCZE 3HXEA 4NACA 4H7XA 3FTSA 5AQBA 3KAEA 1N0RA 1YA0A 2X6JA 5D2MC 3FUHA 4DX5D 2J09A 5KNGA 2WXGA 3ZKJA 3CEQA 2LUHA 2AWIA 2XGSA 3TWTA 4C0MA 3MJWA 4OAVB 3DSUA 3V31A 3EUVA 4ANWA 4F53A 4RLYA 4FHKA 3DRAA 4O60A 4IYPA 3RO3A 4MKTA 4F1SA 2GGFA 3I3NA 3ZGQA 3ZYMA 5G04J 3FU5A 4JPSA 4KXKB 4DRXE 1LD8A 3S7DA 4YDOA 3TWRA 3ZYQA 2VGEA 4HNAD 2PL2A 3L13A 4BY6A 2UY1B 3UT7A 3ASNE 2XEHA 2A4ZA 3E32A 3F6QA 2F8YA 3SF4A 4CCAA 3ASFA 4Q96A 5BPPA 5FWQA 2IONA 3TWVA 4J8SA 3ABLE 1MX4A 3CGHA 3GYZA 3S7JA 3UIOC 1Z3YA 4FULA 2R5SA 3CV0A 5HS0A 3AJIA 4KZ0A 4UI9C 4I1MA 3CSFA 3TXMA 3I5PA 4GZDA 2C0LA 3UM2A 3T8KA 4H7YA 4UUCA 1X81A 5D66A 5ANLA 3SGHA 2A5EA 2KBXA 1SQMA 3Q5MA 2JLBA 3UM1A 1E8ZA 1IYGA 2VTBA 5KJNA 1QZ2A 1W3BA 2M63A 3O4ZA 2WPVA 4GA1A 3CVXA 3ZEFA 1ELKA 3L22A 3UQ3A 1D8EA 4PS7A 2WM9A 5LCWJ 3NAWA 2ETCA 4I2ZA 4N5QA 3EJNA 3SQVA 5ENNA 4GCOA 3ZU7B 3CHOA 2XENA 2BKGA 3NQPA 4DI4A 3KSQA 1HS6A
chains in the Genus database with same CATH topology
4ME2A 4U04A 2WXPA 3UT8A 5CMYA 1TJFA 2X6KA 3FFLA 2VGXA 3UUXA 5CCLA 1JWGA 3FUNA 5BV1A 3CHPA 3Q49B 4N2SA 4AEZC 1HE8A 3AS4A 5KJMA 3FWVA 3OXGA 4Q94A 4HOSA 5LCWC 2KZTB 3UMVA 4YVOA 3FU0A 5FT9A 4CT0A 5JHBA 2WXOA 3CVQA 3D9KA 5JJ6A 2HYZA 3GZ1A 3ESLA 1UN9A 3LCAA 4G1TA 3ULQA 3FUKA 3QWPA 4P29A 1PC2A 2CFUA 2XCBA 3FHEA 4IULA 5ARGA 2WXHA 2I2OA 4HOQA 3ENEA 2V4LA 4GZCA 3FTXA 3ZXSA 4WWPA 3LS8A 3FEYA 2OVBA 3HYMB 3TGOA 3O48A 1OUVA 2NSZA 1HH8A 3MKRA 3CK8A 4UI9J 4KMOA 3SNXA 5EX0A 2LO6A 1U3CA 2YQ8A 4I9EA 4LCTA 5AJDA 1KT0A 4HS2A 4WWOA 3AS5A 3ZHEA 4UQXA 1ELRA 2VQ2A 3EIQC 4G23A 1H2TC 2XCCA 5EX3A 4EZJA 2CHXA 3TG4A 5JJ7A 2E0IA 3CLJA 3FUMA 3VTXA 4GPKA 4U0UA 1B89A 3D9PA 2MOWA 4EQFA 3PE3A 3RIBA 4F7AA 4L2YA 3U66A 2WXQA 4UI9K 2V8SE 4LEUA 5KCMA 3G2WA 2VYIA 5A23A 1DNPA 4KYOB 3S2AA 3SBTB 4Q69A 1EYHA 4IRUA 3FULA 1Y8MA 4D10C 2HO1A 3FP3A 3PEUB 3PNLB 2XGOA 3ZW3A 1XNFA 2J49A 3PRZA 1E8YA 1HU3A 4PS3A 5FZRA 5T4YA 3WXXA 1H2UA 2C0MA 3PZDA 4GYOA 3SD5A 3ZIMA 1KLXA 3L16A 1Z3XA 3PH0C 3B7UX 3JQ1A 4XI0A 1HO8A 4N2QA 4CRWA 4NQ0A 1WM5A 4U8HA 1TJCA 2QY7A 1P5QA 3BG1B 3LYAA 3D9OA 2XPIA 2PM7A 1JWFA 2JEKA 3U9WA 2WXMA 3AS8A 3B7TA 4U0SA 1PY1A 4UWLA 4EECA 2GRLA 4JC8A 4RG6A 2IOSA 3GZ2A 3PREA 4J8DA 4DJAA 2I6HA 5JJTA 5FZQA 4GA0A 4JHRA 4A1SA 2CHZA 4TRQA 2KCVA 3ASHA 4C0EA 4XKBA 5FTPA 2VTBB 1NA0A 3ML9A 3LVQE 3ML8A 1OWMA 2OOEA 2WQ7A 1H6KA 4JXTA 4I2WA 4AJWA 2I1KA 4NURA 3CKCA 4U63A 3QARA 1GW6A 4GYYA 2EQXA 4HXIA 5G55A 2J4DA 3R7RA 4UQZA 2CHWA 3FH5A 4MS6A 2FO7A 2GW1A 3CQCB 5C2YA 4B89A 4YVQC 3CVWA 5AYWD 4CGWA 3G2VA 4BTAA 2BF0X 2LSUA 4KZCA 1EPUA 4I17A 4EPZA 3D9JA 3EIJA 3PUKA 3FTWA 5LX8A 2LAHA 1EDUA 3APDA 4I43A 3UPVA 2GRMA 3FDHA 2L6JA 3JCKC 3FUFA 4UWHA 3S7FA 1IQRA 3RKVA 2E2EA 3FH8A 4AVXA 2MRIA 5G05C 1MQSA 5BV0A 3CVVA 2L0IA 2R59A 5BUZA 2IFUA 2PQRA 2WXKA 3OXFA 4BWRA 1VDYA 3MKQB 4N3BA 5A6CA 5KJKA 3D9NA 5AENA 4AV7A 3QJZA 4PH4B 4U0ZA 3LY7A 4FU3A 1UW4B 2LNIA 3L6AA 4J6IA 2VGXB 4B8CB 2L0TB 4RVBA 1NZNA 2AXVA 3QAQA 2UWJG 4ACLA 4RG9A 3EDTB 4J0UA 2KCKA 4I6GA 3PE4A 4HLEA 4G26A 1QNFA 4TUUA 1LF8A 2L9BA 3KD7A 2XHEA 3FTUA 2KC7A 4LERA 3FUEA 2WXRA 2Q7FA 3OXLA 3R7QA 5FQ4A 3AU5A 2RD0A 5LOZA 5DBKA 4E85A 1A17A 2Y4TA 3Q15A 3QWVA 4L1BA 4B0ZA 3CHQA 3TJPA 4TV3A 4GMLA 3PVLA 4O6FA 2I9CA 3QC1A 4B8AA 4GCNA 5CCMA 1E8XA 4U07A 1N52A 4A1GA 4AM9A 4OVVA 4G2VA 2LAIA 3T5XA 4APFA 3FTYA 3AU4A 2V5FA 2J4BA 4G24A 5G2NA 3VLFA 3IHVA 3D3MA 3ASGA 2KATA 3FH7A 1JPLA 3HIZA 4J8EA 4PS8A 5FQ6A 3R9AB 3PUJA 1H0AA 2WXNA 4HOUA 3PS6A 4L2LA 2CG3A 2NC9A 2WMOA 2X3MA 5ARFA 4AY5A 4G11A 1WAO1 1E8WA 2UY1A 1UN8A 4GAAA 3P1UA 5LFAA 3CHMA 1FCHA 4B94A 1E96B 4W9RA 3B13A 3QK0A 3FUIA 4BT9A 5BT1A 2AXZA 3KEZA 2DIWA 3JUIA 2XRYA 5J08A 5M72A 5G04C 3IV0A 3ONLA 3LY8A 5BW8C 2IQCA 2PZIA 2AW6A 4DI3A 2PQNA 3L17A 2VSXE 4A3TA 1HZ4A 3HVEB 4BTBA 2VSYA 3QNKA 4JA9A 2VSOE 4K03A 2FF4A 2V0PA 3RJVA 4EBAA 1NP7A 1QQEA 2WXLA 3NZUA 3ONKA 3B7RL 4DPRA 3BEEA 2BTDA 3P2BA 3ZYKA 2FBNA 3MYVA 4N3CA 3RU0A 1Z6TA 4OVUA 4I1OB 1HXIA 3CVYA 2IF4A 4M3OA 3D9LA 2HM8A 4FHJA 4WNFA 4I1AA 2DCPA 5EDSA 1UG3A 2FI7A 4GZ3A 4N39A 1IQUA 4ILGA 2MHKA 4N3AA 3MV2B 4FP7A 5C1DA 3CKBA 4JA7A 4MLPA 3URZA 2Y4UA 1DVPA 3L08A 3MCXA 3OAWA 1TEZA 4BSXA 3ZN3A 5ANRA 3CVNA 3FU3A 3MA5A 1MHQA 1N54A 2J9QA 3LVRE 1HG2A 4V3IA 3NZSA 4CEMA 3APCA 3C98A 4WNGA 4WAFA 5FQ8A 5G05J 3L54A 1H19A 3JQ0A 2CFZA 4ANXA 3B7SA 3UT4A 4ANVA 3SI5A 1X5BA 4CDNA 3LKUA 4LUNU 4GZ5A 3MV3B 5T3RA 3S7BA 4JZYA 3LJ3A 4EZKA 2ONDA 4FA6A 5KJLA 5AIJA 3FU6A 1ZU2A 4I6JA 3LXUX 1E90A 3PDNA 2YHCA 3K9IA 4AOFA 4JVSA 5BNWA 1ZBPA 4JEHA 1OWNA 3UX4A 2XRZA 2LSVA 3CK7A 4FJZA 3G2TA 2DBAA 3EHNA 3RO2A 4JHKA 3APFA 4J8FA 3LPZA 4JEUA 5E76A 4I9CA 4L23A 4UQYA 2AVPA 3VLDA 4GZ6A 2VJ8A 2ZU6B 3IHYA 2X6IA 3ZFWA 1UJKA 3CK9A 3MX3A 3PNTB 3OTNA 3MZLB 4NACA 4H7XA 4GB9A 3RRUA 4WNDA 2WQ6A 3FTSA 1S0PA 4GMJA 1WY6A 5DIZA 3KAEA 1YA0A 4FADA 2X6JA 3RRNB 3U4TA 3ZYLA 2I1JA 3FUHA 4OYSA 2P58C 3QKYA 2ILRA 2J09A 1FVHA 4WNEA 5T8IA 2WXGA 4YNDA 3CEQA 2AWIA 2XGSA 5HI7A 1NA3A 4AIFA 3FTVA 3E4BA 4C0MA 4Y6WA 3MJWA 1EF1C 3TXNA 4CT4A 4ACKA 1HFAA 3DPDA 4HFGA 4DK5A 3EHMA 4ANWA 4EBAG 3CR3A 4F53A 3MKQA 4NRHB 2XGMA 2X38A 3LEWA 4FHKA 4KVMA 4UWGA 4A55A 5JHAA 2OV8A 4PUCA 1JUQA 4IYPA 3RO3A 4MKTA 2VSNA 4F1SA 2GGFA 1PAQA 4FJYA 2KZTA 3I3NA 3ZGQA 3ZYMA 5G04J 3CIAA 4E6HA 1E7UA 3FU5A 3IBEA 4JPSA 3VLEA 3CHSA 4KXKB 4GU5A 1BPOA 3S7DA 1XGWA 3MGBA 4K0RA 4IN3B 4Y6CA 5E75A 3SFZA 1IHGA 2KCLA 3LDZA 3ZYQA 2IJGX 2IOLA 3FUDA 3QB2A 2QFCA 3ZHEB 3QOUA 2PL2A 2XPYA 3L13A 4QFVA 2WQHA 2HR2A 1SZAA 4BY6A 2XQ0A 1H2VC 2YNQA 2UY1B 3UT7A 1UJJA 3IEGA 3N71A 4XX5A 4BFRA 4DLQA 3FUJA 2A4ZA 1SZ9A 4G25A 5LP0A 2A5UA 4ATGA 3SF4A 3HDXA 3TAXA 3D9MA 2Y3AA 3U3WA 3T5VA 2WXIA 3GW4A 4BT8A 4CCAA 3PEVB 2KM4A 3CVPA 3ASFA 3SZ7A 3D9IA 3FEXA 3T8MA 4BX9A 4Q96A 4AXHA 3FY4A 2WMNA 5A7DB 5BPPA 5FWQA 2XPZA 2IONA 3CVLA 2NXPA 2OVFA 4J8SA 4N5CA 3CGHA 3GYZA 3S7JA 3RRMB 1Z3YA 3SHFA 4HVBA 2J08A 4FULA 1E7VA 1HF8A 3RK6A 1L5JA 2R5SA 5FZSA 3QWWA 3CV0A 3Q4AB 5AJLA 2BUGA 4FLBA 2WB2A 2R17C 4ABNA 4XKCA 4ANUA 5FQ7A 4KT6B 4LRZA 4XI9A 4KZ0A 4FLHA 1FVFA 4UI9C 1U3DA 3CSFA 4I1MA 3TXMA 2J07A 2FEZA 3I5PA 4GZDA 2C0LA 2PM6A 3HVEA 5EKQD 4ILIA 4KVOA 4R7LA 5CMWA 3GZSA 4H7YA 3ZVVA 3CSTA 4GA2A 4UWKA 2AXUA 4MRUA 4WUYA 4CGVA 5ANLA 1OWLA 3NF1A 3SGHA 4C9BB 3U64A 4EZLA 4CDRA 1OWOA 3Q47B 1Y6IA 3KS2A 1SQMA 3HHMA 4A3VA 3FTZA 3Q5MA 5D0QD 4HORA 3SBSA 2JLBA 3CHRA 4HOTA 4XIFA 2YINA 1INZA 1E8ZA 1ELWA 1IYGA 3TL5A 2RG8A 4JW1A 2X6FA 3TG5A 2CG2A 2VGYA 3JYSA 2VTBA 3CQGB 3I4RB 3BG0B 4UWFA 4PDXA 2YHEA 1OWPA 5KJNA 3QDNA 1QZ2A 2IU1A 3ESKA 3LY9A 3MEKA 4BX8A 1W3BA 3CVUA 2C2LA 4DLOA 2M63A 3O4ZA 5D0OD 4KBQA 4JHJA 2WPVA 4FC8A 3G2UA 4GA1A 4ILHB 4JL0A 3CVXA 3ZEFA 1ELKA 2X6HA 4AP2A 3I4GA 3L22A 3UQ3A 3VTYA 4PS7A 5J90A 2WVIA 4RSYA 2WM9A 5HQ8A 5LCWJ 1HX8A 3DBSA 3G2SA 4APOA 4F3VA 2WXJA 4I2ZA 2FULA 4GYWA 5FJYA 2XEVA 3EJNA 4I6EA 5CHEE 5ENNA 4GCOA 4WWNA 3CHOA 3ZPJA 4L7TA 3NQPA 3ASDA 3IKOB 4XE0A 1KT1A 4URKA 4CDMA 4XZ4A 2WXFA 4DI4A 1HS6A 1HG5A 3ZRHA 4AY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CRW A;  4GML A;  2HM8 A;  4B8A A;  3FEY A;  1UW4 B;  1UG3 A;  2GGF A;  1PAQ A;  2NSZ A;  2KZT A;  3L6A A;  4B89 A;  1N52 A;  4B8C B;  3JUI A;  2KZT B;  2IOS A;  2RG8 A;  2FUL A;  4JHK A;  3FEX A;  3EIJ A;  3D3M A;  4CT4 A;  2ION A;  5ANR A;  2VSX E;  3EIQ C;  1N54 A;  1HU3 A;  1H2T C;  2IU1 A;  2IOL A;  2ZU6 B;  1H2U A;  4CEM A;  2VSO E;  1H6K A;  4IUL A;  4C9B B;  4JHJ A;  2I2O A;  3RK6 A;  4GMJ A;  1H2V C;  4LUN U; 
#chains in the Genus database with same CATH topology
 5CMY A;  2X6K A;  2VGX A;  4K5B A;  1JWG A;  4HOS A;  5LCW C;  5HRY A;  5ENT D;  1FPP A;  3QWP A;  5CRU A;  2H6G A;  2XCB A;  2RKK A;  2V4L A;  3TWS A;  4JB8 P;  1OUV A;  1HH8 A;  4KMO A;  2YQ8 A;  5AJD A;  1ELR A;  2XCC A;  2XZT G;  2E0I A;  2OEW A;  4F7A A;  1K1A A;  4L2Y A;  4BER A;  4UI9 K;  4U95 D;  5KCM A;  3HRA A;  5AAR A;  4Q69 A;  3UTM A;  3UIP C;  1YYH A;  1O1R A;  3AG2 E;  5B3S E;  3R9M A;  5EID A;  5FZR A;  3SD5 A;  4GYO A;  5CBN A;  3L16 A;  3PH0 C;  3JQ1 A;  1SW6 A;  4HQD A;  2QY7 A;  1P5Q A;  3LYA A;  3AS8 A;  4UWL A;  2GRL A;  3PRE A;  4J8D A;  2CHZ A;  2R02 A;  4J8Y A;  1OWM A;  2WQ7 A;  1H6K A;  3RSE G;  2I1K A;  3CKC A;  4GYY A;  3FH5 A;  4MS6 A;  3E33 A;  2GW1 A;  5EIB E;  2LSU A;  4KZC A;  1EPU A;  4I17 A;  2P9K G;  4I43 A;  1ZB1 A;  4UWH A;  1IQR A;  2MRI A;  5KWD A;  1G3N B;  1MYO A;  3UM0 A;  3D9N A;  4HRL A;  2OEV A;  4U0Z A;  4FU3 A;  2LNI A;  3L6A A;  4BES A;  2AXV A;  3QAQ A;  3UM3 A;  2UWJ G;  4ACL A;  4GTM A;  1JCS A;  3PE4 A;  1QNF A;  2L9B A;  2ZGG A;  3ISM C;  2RD0 A;  5LOZ A;  3AAA C;  2Y4T A;  3D9H A;  3TJP A;  4TV3 A;  3QC1 A;  1BD8 A;  4G2V A;  3T5X A;  2IO2 C;  5FQ6 A;  3TWW A;  5AQ7 A;  1WAO 1;  1E8W A;  2UY1 A;  3W9G A;  5KNH D;  3CHM A;  1FCH A;  1QBQ A;  4HB5 A;  5BT1 A;  2DIW A;  5M72 A;  2F8X K;  3ONL A;  1NL4 A;  2IQC A;  2PQN A;  5IY5 E;  1TR4 A;  3C3Q A;  5KBA A;  1D9S A;  2FF4 A;  4A63 B;  1NP7 A;  3ABM E;  2ZIS A;  2ZGD A;  3P2B A;  3ZYK A;  4HI9 A;  3MYV A;  3CVY A;  4FHJ A;  2DCP A;  2FI7 A;  4ILG A;  4LNU D;  4XEI G;  1BI7 B;  3ZXP A;  3MCX A;  3OAW A;  3ZN3 A;  4M7C A;  3CVN A;  3FU3 A;  3LVR E;  4CEM A;  4WAF A;  5FQ8 A;  4YDW A;  5G05 J;  3B7S A;  3UT4 A;  3HXD A;  4LUN U;  3S7B A;  3LJ3 A;  5KJL A;  2DZN A;  1ZU2 A;  4I6J A;  1E90 A;  1OCR E;  4JVS A;  3BQO A;  3SO8 A;  1RW2 A;  1OWN A;  3EHN A;  3RAU A;  4BSZ B;  3LPZ A;  4L23 A;  4UQY A;  2AVP A;  3VLD A;  3ZFW A;  3UI2 A;  1UJK A;  3MX3 A;  3PNT B;  3RRU A;  1WY6 A;  3U4T A;  3ZUV B;  4OYS A;  3E30 A;  4WNE A;  1FVH A;  1N4S A;  2Y69 E;  4U7E B;  1Z5S C;  3LJN A;  3E4B A;  4Y6W A;  4CT4 A;  1HFA A;  2H6F A;  1KPS B;  3EHM A;  3Q79 A;  4EBA G;  5CEA A;  2X38 A;  4A55 A;  4KVM A;  3WG7 E;  1S70 B;  4QQI A;  1PAQ A;  2XEE A;  5AQ9 A;  4GU5 A;  1XGW A;  3SFZ A;  4IN3 B;  5E75 A;  1IHG A;  3LDZ A;  2IJG X;  2IOL A;  4RQI A;  3FUD A;  2QFC A;  5ENO D;  4QFV A;  2WQH A;  1H2V C;  2XQ0 A;  3NOC D;  2FO1 E;  3IEG A;  3FUJ A;  3UKU G;  5LP0 A;  2DVW A;  4ATG A;  3HDX A;  4GTQ A;  4DX7 D;  3D9M A;  3T5V A;  2WXI A;  3PEV B;  3T8M A;  3CVP A;  4BX9 A;  3D9I A;  3PZ3 A;  5A7D B;  3Q9N C;  1NFI E;  4C48 B;  3CVL A;  3ULE G;  2OVF A;  4N5C A;  3TWU A;  3SHF A;  4HVB A;  1MZC A;  2EIK E;  3RK6 A;  5FZS A;  3QWW A;  2BUG A;  3PZ4 A;  4OAU C;  3Q7F A;  4KT6 B;  4XI9 A;  3ABK E;  2PM6 A;  4ILI A;  4KVO A;  4R7L A;  5CMW A;  3GZS A;  3JXI A;  3ZVV A;  4GA2 A;  4UWK A;  4CGV A;  1OWL A;  3NF1 A;  4TXR A;  4C9B B;  4CDR A;  3Q47 B;  1Y6I A;  3V30 A;  3SBS A;  4HOT A;  4XIF A;  2YIN A;  2X6F A;  3TG5 A;  2CG2 A;  3JYS A;  3I4R B;  3JUE A;  3BG0 B;  2QYJ A;  4JHJ A;  3G2U A;  4JL0 A;  4AP2 A;  5ITZ F;  4B93 B;  2WVI A;  4RSY A;  1HX8 A;  3DBS A;  2FUL A;  4YDE A;  3IKO B;  4CDM A;  2WXF A;  1HG5 A;  1H6O A;  4ME2 A;  4GTO A;  3UT8 A;  3FUN A;  3CHP A;  1HE8 A;  5KJM A;  3FWV A;  4Q94 A;  5ENQ D;  4YVO A;  3FU0 A;  5FT9 A;  3CVQ A;  3D9K A;  2HYZ A;  3GZ1 A;  1UN9 A;  3FUK A;  1PC2 A;  2CFU A;  1IKN D;  3FHE A;  4IUL A;  4HOQ A;  3ENE A;  4GZC A;  1TNZ A;  3LS8 A;  1BI8 B;  2NSZ A;  3DWL G;  3MKR A;  4UI9 J;  5EX0 A;  4I9E A;  1DCQ A;  2DZO A;  2H6I A;  2HE0 A;  3C3R A;  4UQX A;  2VQ2 A;  5EX3 A;  2CHX A;  3TG4 A;  5JJ7 A;  3CLJ A;  2MOW A;  3U66 A;  5JMN D;  2VYI A;  1EYH A;  4GTS A;  4IRU A;  2BED A;  1Y8M A;  3ZW3 A;  1XNF A;  2V4H C;  1HU3 A;  2C0M A;  3Q73 A;  1KLX A;  1N11 A;  4N2Q A;  4CRW A;  4NQ0 A;  1WM5 A;  4EHM A;  3D9O A;  1JWF A;  2WXM A;  1PY1 A;  4EEC A;  1U2V G;  3IXE A;  4DJA A;  4JHR A;  3ASH A;  1MX6 A;  2IEJ A;  3ML9 A;  3V79 K;  2OOE A;  4I2W A;  2P9S G;  2MYO A;  3ASO E;  4NUR A;  3C5R A;  2EQX A;  3R7R A;  4UQZ A;  4YVQ C;  3G2V A;  2XS8 A;  4EPZ A;  3D9J A;  2Y0B G;  3APD A;  2ETB A;  3FDH A;  1H6P A;  2L6J A;  3FUF A;  3JCK C;  2E2E A;  3FH8 A;  5BV0 A;  2R59 A;  2EIJ E;  1S64 A;  5AEN A;  4PH4 B;  4TUU A;  3E34 A;  1LF8 A;  3FTU A;  3R7Q A;  4LNG A;  5DBK A;  3DEP A;  1N95 A;  2IY0 C;  3PVL A;  4O6F A;  2I9C A;  4GCN A;  1E8X A;  4U07 A;  4A1G A;  4AM9 A;  5G2N A;  2JAB A;  3IHV A;  2KAT A;  3HIZ A;  3DXM G;  4PS8 A;  3R9A B;  2WXN A;  3PS6 A;  4L2L A;  2NC9 A;  4GAA A;  4W9R A;  3QK0 A;  3FUI A;  4BT9 A;  2AXZ A;  3EHQ A;  4GTT A;  3LY8 A;  4DI3 A;  1NI1 A;  5EIL A;  2VSX E;  4G8L A;  2VSO E;  3X2Q E;  2WXL A;  2BTD A;  3AG3 E;  2FBN A;  4N3C A;  1Z6T A;  2IF4 A;  3D9L A;  4ZHB A;  2P9N G;  4HBD A;  1BU9 A;  4LNB A;  4GZ3 A;  4TUM A;  4N39 A;  2MHK A;  4N3A A;  3MV2 B;  4FP7 A;  5C1D A;  4JA7 A;  2Y4U A;  1DVP A;  4BSX A;  5ANR A;  1K8K G;  1MHQ A;  4V3I A;  5FIN A;  4WNG A;  3C98 A;  4ANV A;  1X5B A;  2P2C P;  3LKU A;  4EZK A;  1RZ4 A;  3PDN A;  2YHC A;  5BNW A;  1S63 A;  3UX4 A;  2XRZ A;  2LSV A;  3APF A;  1OCO E;  4I9C A;  1N4R A;  1K1B A;  2ZU6 B;  3OTN A;  2WQ6 A;  1S0P A;  4GMJ A;  1SA4 A;  4FAD A;  3RRN B;  3HXC A;  2I1J A;  4L9P A;  3QKY A;  5T8I A;  1OY3 D;  3NB2 A;  5HI7 A;  4AIF A;  1NA3 A;  1EF1 C;  3DPD A;  4HFG A;  4DK5 A;  3CR3 A;  2V5Q C;  3MKQ A;  3LEW A;  3B7B A;  2OV8 A;  1JUQ A;  2L6B A;  4FJY A;  4HRN A;  3DSW A;  3CIA A;  1E7U A;  3IBE A;  3CHS A;  2ZXW E;  3L9T A;  3QB2 A;  3QOU A;  2XPY A;  2HR2 A;  1QYM A;  2EIN E;  2YNQ A;  3Q9U C;  3HXF A;  5HKP A;  3SY2 A;  3N71 A;  4XX5 A;  4BFR A;  4DLQ A;  4HI8 A;  4BEP A;  2A5U A;  3TAX A;  4BET A;  3U3W A;  2Y3A A;  3GW4 A;  2KM4 A;  3SZ7 A;  3FEX A;  5FIO A;  3L82 A;  4AXH A;  3FY4 A;  2J08 A;  4FLB A;  4XKC A;  4YDY A;  4ANU A;  5FQ7 A;  4LRZ A;  1FVF A;  2J07 A;  2GRN B;  4K5C A;  2R05 A;  3HVE A;  3Q75 A;  5EKQ D;  4JD2 G;  4WUY A;  1N0Q A;  3U64 A;  4GPM A;  1AP7 A;  3DEO A;  3HHM A;  5ENP D;  3FTZ A;  3CHR A;  3TL5 A;  2RG8 A;  1Q2Z A;  3Q7A A;  3CQG B;  4UWF A;  3UXG A;  2IU1 A;  3LY9 A;  4BX8 A;  4DLO A;  5D0O D;  4O1P A;  5BXU A;  3V2X A;  5AQA A;  1O1S A;  3G2S A;  5FJY A;  5CBO A;  4I6E A;  4WWN A;  2ZIR A;  4XE0 A;  4URK A;  2EIM E;  4XZ4 A;  2KXP C;  3ZRH A;  2WXP A;  1TJF A;  3J5Q B;  5CCL A;  1MJ0 A;  5BV1 A;  3Q49 B;  2KZT B;  4ATZ D;  4CT0 A;  5JHB A;  2WXO A;  2DYS E;  5JJ6 A;  2BKK B;  3ESL A;  4O1O A;  3LCA A;  4G1T A;  1TN7 A;  2WXH A;  2DYR E;  2IO3 C;  3FTX A;  4WWP A;  4Z68 A;  3FEY A;  2OVB A;  2QZA A;  3HYM B;  3TGO A;  3O48 A;  1KZO A;  3CK8 A;  3C3O A;  3SNX A;  2LO6 A;  1U3C A;  2RFA A;  1KT0 A;  4WWO A;  3ZHE A;  4LSZ E;  1H2T C;  3AG1 E;  4GPK A;  4U0U A;  4EQF A;  3PE3 A;  3RIB A;  2GRQ B;  3HXB A;  3BU8 A;  1DNP A;  4KYO B;  5CED B;  4CZ2 D;  3FP3 A;  3PNL B;  1D8D A;  2XGO A;  1E8Y A;  4PS3 A;  3WXX A;  1H2U A;  1Z3X A;  3E37 A;  1DC2 A;  4U8H A;  2XPI A;  5B1B E;  4U0S A;  4RG6 A;  2I6H A;  4DX2 A;  2QC9 A;  5FZQ A;  4A1S A;  3ULY A;  4AJW A;  1GW6 A;  4HXI A;  5G55 A;  5AN8 A;  1WG0 A;  3CQC B;  3DXK G;  5C2Y A;  3CVW A;  5AAO A;  4CGW A;  4BTA A;  2BF0 X;  3EIJ A;  5LX8 A;  3FTW A;  2GRM A;  3RKV A;  2QYU A;  2L0I A;  5BUZ A;  2IFU A;  2WXK A;  5CER B;  3OXF A;  1VDY A;  3MKQ B;  4N3B A;  3QJZ A;  4J6I A;  2L0T B;  4RVB A;  4U96 D;  2KCK A;  4I6G A;  3JXJ A;  2XHE A;  4LER A;  2Q7F A;  3OXL A;  2P9I G;  3AU5 A;  4B0Z A;  4B8A A;  4NIK A;  4K5A B;  5CCM A;  1N52 A;  4APF A;  3FTY A;  3AU4 A;  2V5F A;  4G24 A;  3VLF A;  3ASG A;  1JPL A;  4J8E A;  3PUJ A;  1H0A A;  3AG4 E;  3DSX A;  4HOU A;  2CG3 A;  1LTX A;  2WMO A;  4AY5 A;  5ARF A;  1UN8 A;  4DX6 D;  5LFA A;  4B94 A;  1E96 B;  5EN5 D;  3DSV A;  1V54 E;  3UKR G;  3PZ2 A;  3JUI A;  5J08 A;  3SFX A;  5G04 C;  2PZI A;  2GRR B;  4GMR A;  3L17 A;  2B6C A;  3HVE B;  4BTB A;  4JA9 A;  3QNK A;  4EBA A;  1QQE A;  3B7R L;  3RU0 A;  1HXI A;  4M3O A;  2HM8 A;  1UG3 A;  1IQU A;  3CKB A;  3URZ A;  1N4P A;  5EYP F;  2J9Q A;  3NZS A;  4DUI A;  3APC A;  3B95 A;  1H19 A;  2CFZ A;  2B0O E;  4CDN A;  3SI5 A;  4GZ5 A;  3MV3 B;  4JZY A;  3FU6 A;  3LXU X;  3K9I A;  2R03 A;  2DWZ A;  1ZBP A;  4JEH A;  1N4Q A;  2DBA A;  4JHK A;  4U8V D;  4J8F A;  5E76 A;  2J8S D;  4GZ6 A;  3IHY A;  2X6I A;  3CK9 A;  2RFM A;  3MZL B;  4GB9 A;  4WND A;  5DIZ A;  3DPY A;  3ZYL A;  2P58 C;  2ILR A;  4YND A;  3FTV A;  3Q78 A;  3TXN A;  4ACK A;  4CYM D;  4NRH B;  2XGM A;  4UWG A;  5JHA A;  4PUC A;  1FT1 A;  5B1A E;  2Y1L E;  2VSN A;  2KZT A;  1KZP A;  4E6H A;  3VLE A;  1TN8 A;  1BPO A;  3MGB A;  4K0R A;  4Y6C A;  1AWC B;  1LD7 A;  2KCL A;  4HRM B;  3ZHE B;  1SZA A;  1TYQ G;  1UJJ A;  1SZ9 A;  4G25 A;  4BT8 A;  2WMN A;  4G8K A;  2AJA A;  2XPZ A;  2NXP A;  4LG6 A;  3RRM B;  1E7V A;  1HF8 A;  1L5J A;  3Q4A B;  5AJL A;  2WB2 A;  2R17 C;  4ABN A;  3SFY A;  4FLH A;  1U3D A;  2FEZ A;  4J7W A;  3CST A;  5ENR D;  2AXU A;  4MRU A;  1A5E A;  2R2L A;  4EZL A;  2EIL E;  1OWO A;  3KS2 A;  4A3V A;  5D0Q D;  4HOR A;  3KEA A;  1INZ A;  1ELW A;  3W9F A;  4JW1 A;  2VGY A;  1JCQ A;  4GTP A;  4PDX A;  2YHE A;  2XS1 A;  1OWP A;  3QDN A;  3ESK A;  3CVU A;  3MEK A;  2C2L A;  4KBQ A;  3TWX A;  4FC8 A;  4ILH B;  2X6H A;  3I4G A;  3VTY A;  1O5M A;  5J90 A;  5HQ8 A;  1N94 A;  4APO A;  4F3V A;  2LXL A;  3HG0 D;  2WXJ A;  4GYW A;  1BLX B;  2XEV A;  5CHE E;  3EU5 A;  1V55 E;  3ZPJ A;  4L7T A;  4TXQ A;  3ASD A;  1KT1 A;  1IHB A;  2P9L G;  1TNY A;  2P9P G;  4AY6 A;  4U04 A;  3FFL A;  3UUX A;  4N2S A;  3T9K A;  4AEZ C;  1TNB A;  3AS4 A;  1YCS B;  3OXG A;  3UMV A;  3ULQ A;  4P29 A;  5ARG A;  1OCC E;  2GRP B;  2I2O A;  3ZXS A;  5EYL A;  4U8Y D;  4LCT A;  4HS2 A;  3AS5 A;  3EIQ C;  4G23 A;  4EZJ A;  1O1T A;  3VTX A;  3FUM A;  2ETA A;  1B89 A;  3D9P A;  1UOH A;  2WXQ A;  2V8S E;  4LEU A;  3G2W A;  5A23 A;  3S2A A;  3SBT B;  1YMP A;  3UIN C;  3FUL A;  4D10 C;  2HO1 A;  3PEU B;  2J49 A;  3PRZ A;  5T4Y A;  3ZIM A;  3PZD A;  3B7U X;  4GTV A;  4XI0 A;  1HO8 A;  1TJC A;  3BG1 B;  1WDY A;  4HLL A;  2PM7 A;  2JEK A;  3U9W A;  3B7T A;  3J5P A;  4JC8 A;  2IOS A;  3GZ2 A;  4DX1 A;  5JJT A;  4GA0 A;  4TRQ A;  2KCV A;  4C0E A;  2VTB B;  4XKB A;  5FTP A;  3V2O A;  1NA0 A;  2F0Y A;  3LVQ E;  3ML8 A;  4JXT A;  5JA4 D;  2OCC E;  4U63 A;  3QAR A;  3KSL A;  2F37 A;  2J4D A;  2CHW A;  2NYJ A;  2FO7 A;  4GTR A;  4B89 A;  5AYW D;  4MBG A;  3TWQ A;  5ENS D;  3PUK A;  2H6H A;  2LAH A;  1EDU A;  5CEC B;  3UPV A;  3S7F A;  3NOG D;  4AVX A;  5G05 C;  1MQS A;  1MX2 A;  1SVX A;  3CVV A;  2PNN A;  2PQR A;  2LXM A;  4BWR A;  5KJK A;  5A6C A;  4AV7 A;  3LY7 A;  1UW4 B;  4B8C B;  2VGX B;  1NZN A;  4TXP A;  4RG9 A;  3EDT B;  4J0U A;  4HLE A;  4ZFH A;  4G26 A;  2GRO B;  2P9U G;  3DSS A;  3KD7 A;  1SA5 A;  4F6R D;  2KC7 A;  3FUE A;  1OT8 A;  2WXR A;  5FQ4 A;  2XZD G;  4E85 A;  1A17 A;  3Q15 A;  4L1B A;  3QWV A;  3CHQ A;  4GML A;  1DCE A;  3EHR A;  4OVV A;  2LAI A;  3BUA A;  1TNO A;  2J4B A;  1FT2 A;  3ZNG A;  3D3M A;  3FH7 A;  5BXO A;  2X3M A;  4G11 A;  5CRV A;  3DST A;  3P1U A;  3B13 A;  1JCR A;  3KEZ A;  3C72 A;  2XRY A;  3IV0 A;  5BW8 C;  2AW6 A;  4A3T A;  1HZ4 A;  5H7P A;  3PZ1 A;  2VSY A;  4K03 A;  1IXV A;  2V0P A;  3RJV A;  3ONK A;  3NZU A;  4F1P A;  4DPR A;  3BEE A;  4OVU A;  4I1O B;  3NBN B;  4WNF A;  4I1A A;  4X8Q A;  5EDS A;  1TN6 A;  4MLP A;  3EU9 A;  3L08 A;  1TEZ A;  3MA5 A;  1N54 A;  1HG2 A;  3L54 A;  1TNU A;  3JQ0 A;  4ANX A;  1OXJ A;  5T3R A;  2OND A;  4FA6 A;  5AIJ A;  4AOF A;  3CK7 A;  4FJZ A;  3G2T A;  3RO2 A;  1N9A A;  4JEU A;  1K3Z D;  2VJ8 A;  1OCZ E;  3HXE A;  4NAC A;  4H7X A;  3FTS A;  5AQB A;  3KAE A;  1N0R A;  1YA0 A;  2X6J A;  5D2M C;  3FUH A;  4DX5 D;  2J09 A;  5KNG A;  2WXG A;  3ZKJ A;  3CEQ A;  2LUH A;  2AWI A;  2XGS A;  3TWT A;  4C0M A;  3MJW A;  4OAV B;  3DSU A;  3V31 A;  3EUV A;  4ANW A;  4F53 A;  4RLY A;  4FHK A;  3DRA A;  4O60 A;  4IYP A;  3RO3 A;  4MKT A;  4F1S A;  2GGF A;  3I3N A;  3ZGQ A;  3ZYM A;  5G04 J;  3FU5 A;  4JPS A;  4KXK B;  4DRX E;  1LD8 A;  3S7D A;  4YDO A;  3TWR A;  3ZYQ A;  2VGE A;  4HNA D;  2PL2 A;  3L13 A;  4BY6 A;  2UY1 B;  3UT7 A;  3ASN E;  2XEH A;  2A4Z A;  3E32 A;  3F6Q A;  2F8Y A;  3SF4 A;  4CCA A;  3ASF A;  4Q96 A;  5BPP A;  5FWQ A;  2ION A;  3TWV A;  4J8S A;  3ABL E;  1MX4 A;  3CGH A;  3GYZ A;  3S7J A;  3UIO C;  1Z3Y A;  4FUL A;  2R5S A;  3CV0 A;  5HS0 A;  3AJI A;  4KZ0 A;  4UI9 C;  4I1M A;  3CSF A;  3TXM A;  3I5P A;  4GZD A;  2C0L A;  3UM2 A;  3T8K A;  4H7Y A;  4UUC A;  1X81 A;  5D66 A;  5ANL A;  3SGH A;  2A5E A;  2KBX A;  1SQM A;  3Q5M A;  2JLB A;  3UM1 A;  1E8Z A;  1IYG A;  2VTB A;  5KJN A;  1QZ2 A;  1W3B A;  2M63 A;  3O4Z A;  2WPV A;  4GA1 A;  3CVX A;  3ZEF A;  1ELK A;  3L22 A;  3UQ3 A;  1D8E A;  4PS7 A;  2WM9 A;  5LCW J;  3NAW A;  2ETC A;  4I2Z A;  4N5Q A;  3EJN A;  3SQV A;  5ENN A;  4GCO A;  3ZU7 B;  3CHO A;  2XEN A;  2BKG A;  3NQP A;  4DI4 A;  3KSQ A;  1HS6 A; 
#chains in the Genus database with same CATH homology
 4ME2 A;  4U04 A;  2WXP A;  3UT8 A;  5CMY A;  1TJF A;  2X6K A;  3FFL A;  2VGX A;  3UUX A;  5CCL A;  1JWG A;  3FUN A;  5BV1 A;  3CHP A;  3Q49 B;  4N2S A;  4AEZ C;  1HE8 A;  3AS4 A;  5KJM A;  3FWV A;  3OXG A;  4Q94 A;  4HOS A;  5LCW C;  2KZT B;  3UMV A;  4YVO A;  3FU0 A;  5FT9 A;  4CT0 A;  5JHB A;  2WXO A;  3CVQ A;  3D9K A;  5JJ6 A;  2HYZ A;  3GZ1 A;  3ESL A;  1UN9 A;  3LCA A;  4G1T A;  3ULQ A;  3FUK A;  3QWP A;  4P29 A;  1PC2 A;  2CFU A;  2XCB A;  3FHE A;  4IUL A;  5ARG A;  2WXH A;  2I2O A;  4HOQ A;  3ENE A;  2V4L A;  4GZC A;  3FTX A;  3ZXS A;  4WWP A;  3LS8 A;  3FEY A;  2OVB A;  3HYM B;  3TGO A;  3O48 A;  1OUV A;  2NSZ A;  1HH8 A;  3MKR A;  3CK8 A;  4UI9 J;  4KMO A;  3SNX A;  5EX0 A;  2LO6 A;  1U3C A;  2YQ8 A;  4I9E A;  4LCT A;  5AJD A;  1KT0 A;  4HS2 A;  4WWO A;  3AS5 A;  3ZHE A;  4UQX A;  1ELR A;  2VQ2 A;  3EIQ C;  4G23 A;  1H2T C;  2XCC A;  5EX3 A;  4EZJ A;  2CHX A;  3TG4 A;  5JJ7 A;  2E0I A;  3CLJ A;  3FUM A;  3VTX A;  4GPK A;  4U0U A;  1B89 A;  3D9P A;  2MOW A;  4EQF A;  3PE3 A;  3RIB A;  4F7A A;  4L2Y A;  3U66 A;  2WXQ A;  4UI9 K;  2V8S E;  4LEU A;  5KCM A;  3G2W A;  2VYI A;  5A23 A;  1DNP A;  4KYO B;  3S2A A;  3SBT B;  4Q69 A;  1EYH A;  4IRU A;  3FUL A;  1Y8M A;  4D10 C;  2HO1 A;  3FP3 A;  3PEU B;  3PNL B;  2XGO A;  3ZW3 A;  1XNF A;  2J49 A;  3PRZ A;  1E8Y A;  1HU3 A;  4PS3 A;  5FZR A;  5T4Y A;  3WXX A;  1H2U A;  2C0M A;  3PZD A;  4GYO A;  3SD5 A;  3ZIM A;  1KLX A;  3L16 A;  1Z3X A;  3PH0 C;  3B7U X;  3JQ1 A;  4XI0 A;  1HO8 A;  4N2Q A;  4CRW A;  4NQ0 A;  1WM5 A;  4U8H A;  1TJC A;  2QY7 A;  1P5Q A;  3BG1 B;  3LYA A;  3D9O A;  2XPI A;  2PM7 A;  1JWF A;  2JEK A;  3U9W A;  2WXM A;  3AS8 A;  3B7T A;  4U0S A;  1PY1 A;  4UWL A;  4EEC A;  2GRL A;  4JC8 A;  4RG6 A;  2IOS A;  3GZ2 A;  3PRE A;  4J8D A;  4DJA A;  2I6H A;  5JJT A;  5FZQ A;  4GA0 A;  4JHR A;  4A1S A;  2CHZ A;  4TRQ A;  2KCV A;  3ASH A;  4C0E A;  4XKB A;  5FTP A;  2VTB B;  1NA0 A;  3ML9 A;  3LVQ E;  3ML8 A;  1OWM A;  2OOE A;  2WQ7 A;  1H6K A;  4JXT A;  4I2W A;  4AJW A;  2I1K A;  4NUR A;  3CKC A;  4U63 A;  3QAR A;  1GW6 A;  4GYY A;  2EQX A;  4HXI A;  5G55 A;  2J4D A;  3R7R A;  4UQZ A;  2CHW A;  3FH5 A;  4MS6 A;  2FO7 A;  2GW1 A;  3CQC B;  5C2Y A;  4B89 A;  4YVQ C;  3CVW A;  5AYW D;  4CGW A;  3G2V A;  4BTA A;  2BF0 X;  2LSU A;  4KZC A;  1EPU A;  4I17 A;  4EPZ A;  3D9J A;  3EIJ A;  3PUK A;  3FTW A;  5LX8 A;  2LAH A;  1EDU A;  3APD A;  4I43 A;  3UPV A;  2GRM A;  3FDH A;  2L6J A;  3JCK C;  3FUF A;  4UWH A;  3S7F A;  1IQR A;  3RKV A;  2E2E A;  3FH8 A;  4AVX A;  2MRI A;  5G05 C;  1MQS A;  5BV0 A;  3CVV A;  2L0I A;  2R59 A;  5BUZ A;  2IFU A;  2PQR A;  2WXK A;  3OXF A;  4BWR A;  1VDY A;  3MKQ B;  4N3B A;  5A6C A;  5KJK A;  3D9N A;  5AEN A;  4AV7 A;  3QJZ A;  4PH4 B;  4U0Z A;  3LY7 A;  4FU3 A;  1UW4 B;  2LNI A;  3L6A A;  4J6I A;  2VGX B;  4B8C B;  2L0T B;  4RVB A;  1NZN A;  2AXV A;  3QAQ A;  2UWJ G;  4ACL A;  4RG9 A;  3EDT B;  4J0U A;  2KCK A;  4I6G A;  3PE4 A;  4HLE A;  4G26 A;  1QNF A;  4TUU A;  1LF8 A;  2L9B A;  3KD7 A;  2XHE A;  3FTU A;  2KC7 A;  4LER A;  3FUE A;  2WXR A;  2Q7F A;  3OXL A;  3R7Q A;  5FQ4 A;  3AU5 A;  2RD0 A;  5LOZ A;  5DBK A;  4E85 A;  1A17 A;  2Y4T A;  3Q15 A;  3QWV A;  4L1B A;  4B0Z A;  3CHQ A;  3TJP A;  4TV3 A;  4GML A;  3PVL A;  4O6F A;  2I9C A;  3QC1 A;  4B8A A;  4GCN A;  5CCM A;  1E8X A;  4U07 A;  1N52 A;  4A1G A;  4AM9 A;  4OVV A;  4G2V A;  2LAI A;  3T5X A;  4APF A;  3FTY A;  3AU4 A;  2V5F A;  2J4B A;  4G24 A;  5G2N A;  3VLF A;  3IHV A;  3D3M A;  3ASG A;  2KAT A;  3FH7 A;  1JPL A;  3HIZ A;  4J8E A;  4PS8 A;  5FQ6 A;  3R9A B;  3PUJ A;  1H0A A;  2WXN A;  4HOU A;  3PS6 A;  4L2L A;  2CG3 A;  2NC9 A;  2WMO A;  2X3M A;  5ARF A;  4AY5 A;  4G11 A;  1WAO 1;  1E8W A;  2UY1 A;  1UN8 A;  4GAA A;  3P1U A;  5LFA A;  3CHM A;  1FCH A;  4B94 A;  1E96 B;  4W9R A;  3B13 A;  3QK0 A;  3FUI A;  4BT9 A;  5BT1 A;  2AXZ A;  3KEZ A;  2DIW A;  3JUI A;  2XRY A;  5J08 A;  5M72 A;  5G04 C;  3IV0 A;  3ONL A;  3LY8 A;  5BW8 C;  2IQC A;  2PZI A;  2AW6 A;  4DI3 A;  2PQN A;  3L17 A;  2VSX E;  4A3T A;  1HZ4 A;  3HVE B;  4BTB A;  2VSY A;  3QNK A;  4JA9 A;  2VSO E;  4K03 A;  2FF4 A;  2V0P A;  3RJV A;  4EBA A;  1NP7 A;  1QQE A;  2WXL A;  3NZU A;  3ONK A;  3B7R L;  4DPR A;  3BEE A;  2BTD A;  3P2B A;  3ZYK A;  2FBN A;  3MYV A;  4N3C A;  3RU0 A;  1Z6T A;  4OVU A;  4I1O B;  1HXI A;  3CVY A;  2IF4 A;  4M3O A;  3D9L A;  2HM8 A;  4FHJ A;  4WNF A;  4I1A A;  2DCP A;  5EDS A;  1UG3 A;  2FI7 A;  4GZ3 A;  4N39 A;  1IQU A;  4ILG A;  2MHK A;  4N3A A;  3MV2 B;  4FP7 A;  5C1D A;  3CKB A;  4JA7 A;  4MLP A;  3URZ A;  2Y4U A;  1DVP A;  3L08 A;  3MCX A;  3OAW A;  1TEZ A;  4BSX A;  3ZN3 A;  5ANR A;  3CVN A;  3FU3 A;  3MA5 A;  1MHQ A;  1N54 A;  2J9Q A;  3LVR E;  1HG2 A;  4V3I A;  3NZS A;  4CEM A;  3APC A;  3C98 A;  4WNG A;  4WAF A;  5FQ8 A;  5G05 J;  3L54 A;  1H19 A;  3JQ0 A;  2CFZ A;  4ANX A;  3B7S A;  3UT4 A;  4ANV A;  3SI5 A;  1X5B A;  4CDN A;  3LKU A;  4LUN U;  4GZ5 A;  3MV3 B;  5T3R A;  3S7B A;  4JZY A;  3LJ3 A;  4EZK A;  2OND A;  4FA6 A;  5KJL A;  5AIJ A;  3FU6 A;  1ZU2 A;  4I6J A;  3LXU X;  1E90 A;  3PDN A;  2YHC A;  3K9I A;  4AOF A;  4JVS A;  5BNW A;  1ZBP A;  4JEH A;  1OWN A;  3UX4 A;  2XRZ A;  2LSV A;  3CK7 A;  4FJZ A;  3G2T A;  2DBA A;  3EHN A;  3RO2 A;  4JHK A;  3APF A;  4J8F A;  3LPZ A;  4JEU A;  5E76 A;  4I9C A;  4L23 A;  4UQY A;  2AVP A;  3VLD A;  4GZ6 A;  2VJ8 A;  2ZU6 B;  3IHY A;  2X6I A;  3ZFW A;  1UJK A;  3CK9 A;  3MX3 A;  3PNT B;  3OTN A;  3MZL B;  4NAC A;  4H7X A;  4GB9 A;  3RRU A;  4WND A;  2WQ6 A;  3FTS A;  1S0P A;  4GMJ A;  1WY6 A;  5DIZ A;  3KAE A;  1YA0 A;  4FAD A;  2X6J A;  3RRN B;  3U4T A;  3ZYL A;  2I1J A;  3FUH A;  4OYS A;  2P58 C;  3QKY A;  2ILR A;  2J09 A;  1FVH A;  4WNE A;  5T8I A;  2WXG A;  4YND A;  3CEQ A;  2AWI A;  2XGS A;  5HI7 A;  1NA3 A;  4AIF A;  3FTV A;  3E4B A;  4C0M A;  4Y6W A;  3MJW A;  1EF1 C;  3TXN A;  4CT4 A;  4ACK A;  1HFA A;  3DPD A;  4HFG A;  4DK5 A;  3EHM A;  4ANW A;  4EBA G;  3CR3 A;  4F53 A;  3MKQ A;  4NRH B;  2XGM A;  2X38 A;  3LEW A;  4FHK A;  4KVM A;  4UWG A;  4A55 A;  5JHA A;  2OV8 A;  4PUC A;  1JUQ A;  4IYP A;  3RO3 A;  4MKT A;  2VSN A;  4F1S A;  2GGF A;  1PAQ A;  4FJY A;  2KZT A;  3I3N A;  3ZGQ A;  3ZYM A;  5G04 J;  3CIA A;  4E6H A;  1E7U A;  3FU5 A;  3IBE A;  4JPS A;  3VLE A;  3CHS A;  4KXK B;  4GU5 A;  1BPO A;  3S7D A;  1XGW A;  3MGB A;  4K0R A;  4IN3 B;  4Y6C A;  5E75 A;  3SFZ A;  1IHG A;  2KCL A;  3LDZ A;  3ZYQ A;  2IJG X;  2IOL A;  3FUD A;  3QB2 A;  2QFC A;  3ZHE B;  3QOU A;  2PL2 A;  2XPY A;  3L13 A;  4QFV A;  2WQH A;  2HR2 A;  1SZA A;  4BY6 A;  2XQ0 A;  1H2V C;  2YNQ A;  2UY1 B;  3UT7 A;  1UJJ A;  3IEG A;  3N71 A;  4XX5 A;  4BFR A;  4DLQ A;  3FUJ A;  2A4Z A;  1SZ9 A;  4G25 A;  5LP0 A;  2A5U A;  4ATG A;  3SF4 A;  3HDX A;  3TAX A;  3D9M A;  2Y3A A;  3U3W A;  3T5V A;  2WXI A;  3GW4 A;  4BT8 A;  4CCA A;  3PEV B;  2KM4 A;  3CVP A;  3ASF A;  3SZ7 A;  3D9I A;  3FEX A;  3T8M A;  4BX9 A;  4Q96 A;  4AXH A;  3FY4 A;  2WMN A;  5A7D B;  5BPP A;  5FWQ A;  2XPZ A;  2ION A;  3CVL A;  2NXP A;  2OVF A;  4J8S A;  4N5C A;  3CGH A;  3GYZ A;  3S7J A;  3RRM B;  1Z3Y A;  3SHF A;  4HVB A;  2J08 A;  4FUL A;  1E7V A;  1HF8 A;  3RK6 A;  1L5J A;  2R5S A;  5FZS A;  3QWW A;  3CV0 A;  3Q4A B;  5AJL A;  2BUG A;  4FLB A;  2WB2 A;  2R17 C;  4ABN A;  4XKC A;  4ANU A;  5FQ7 A;  4KT6 B;  4LRZ A;  4XI9 A;  4KZ0 A;  4FLH A;  1FVF A;  4UI9 C;  1U3D A;  3CSF A;  4I1M A;  3TXM A;  2J07 A;  2FEZ A;  3I5P A;  4GZD A;  2C0L A;  2PM6 A;  3HVE A;  5EKQ D;  4ILI A;  4KVO A;  4R7L A;  5CMW A;  3GZS A;  4H7Y A;  3ZVV A;  3CST A;  4GA2 A;  4UWK A;  2AXU A;  4MRU A;  4WUY A;  4CGV A;  5ANL A;  1OWL A;  3NF1 A;  3SGH A;  4C9B B;  3U64 A;  4EZL A;  4CDR A;  1OWO A;  3Q47 B;  1Y6I A;  3KS2 A;  1SQM A;  3HHM A;  4A3V A;  3FTZ A;  3Q5M A;  5D0Q D;  4HOR A;  3SBS A;  2JLB A;  3CHR A;  4HOT A;  4XIF A;  2YIN A;  1INZ A;  1E8Z A;  1ELW A;  1IYG A;  3TL5 A;  2RG8 A;  4JW1 A;  2X6F A;  3TG5 A;  2CG2 A;  2VGY A;  3JYS A;  2VTB A;  3CQG B;  3I4R B;  3BG0 B;  4UWF A;  4PDX A;  2YHE A;  1OWP A;  5KJN A;  3QDN A;  1QZ2 A;  2IU1 A;  3ESK A;  3LY9 A;  3MEK A;  4BX8 A;  1W3B A;  3CVU A;  2C2L A;  4DLO A;  2M63 A;  3O4Z A;  5D0O D;  4KBQ A;  4JHJ A;  2WPV A;  4FC8 A;  3G2U A;  4GA1 A;  4ILH B;  4JL0 A;  3CVX A;  3ZEF A;  1ELK A;  2X6H A;  4AP2 A;  3I4G A;  3L22 A;  3UQ3 A;  3VTY A;  4PS7 A;  5J90 A;  2WVI A;  4RSY A;  2WM9 A;  5HQ8 A;  5LCW J;  1HX8 A;  3DBS A;  3G2S A;  4APO A;  4F3V A;  2WXJ A;  4I2Z A;  2FUL A;  4GYW A;  5FJY A;  2XEV A;  3EJN A;  4I6E A;  5CHE E;  5ENN A;  4GCO A;  4WWN A;  3CHO A;  3ZPJ A;  4L7T A;  3NQP A;  3ASD A;  3IKO B;  4XE0 A;  1KT1 A;  4URK A;  4CDM A;  4XZ4 A;  2WXF A;  4DI4 A;  1HS6 A;  1HG5 A;  3ZRH A;  4AY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...