3EINA

Delta class gst
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
207
structure length
207
Chain Sequence
VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGWEENWAGCLEFKKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing insect detoxification systems
rcsb
molecule keywords Glutathione S-transferase 1-1
molecule tags Transferase
source organism Drosophila melanogaster
total genus 85
structure length 207
sequence length 207
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3einA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3einA01
1YEXA 1MDIA 3M0FA 3DMLA 1SENA 4ZB8A 4KA0A 5DCHA 1YJ6A 2B1KA 3QMXA 5B6MA 2XPDA 1G6YA 3LSZA 1QMVA 1SL0B 3LQ7A 1G0TA 2F3MA 5J9BA 5G2ZA 5F8BA 3KJYA 4FIWA 2GGTA 4X0XA 2F8AA 3GL5A 1QUWA 3WGXA 1B4QA 9GSSA 3F4TA 3FKFA 2YV7A 1XW9A 3GTUA 3HA9A 3PR8A 4BL7A 4HOJA 4I6XA 2O85A 1H75A 2FGXA 2QC7A 2L59A 4X43A 4ILFA 2LS5A 2I4AA 1GL8A 1X0RA 3A2XA 4K7OA 5AIVA 2H30A 1M2AA 1MD4A 3LEFA 1XOAA 4TXOA 2HSYA 3GTUB 3CBUA 3DGQA 3PINA 3KTBA 4JR4A 5EL8A 2I81A 2X8GA 1V57A 2C3QA 5LCZA 3IDVA 1QK8A 2C1YA 5G30A 1PL1A 2BJXA 3QD9A 3VPQA 4F03A 5J41A 1G6WA 2WS2A 1U3AA 3TOTA 3UVHA 3G9BA 4JRRA 1ERWA 5BMUA 3TKRA 5H5RA 4TXOB 4CHSA 2KOKA 2IMIA 2R6KA 2JSZA 3GUSA 3LWAA 1FVKA 4RUVA 1I5GA 1XOBA 3FZ4A 3GA4A 3TRPA 4L0WA 3E9JB 4K2DA 3MAKA 4XRDA 2VL3A 4I97A 3PH9A 1XWBA 3KXOA 4IELA 2FWHA 4D73A 3A3TA 1ILOA 3VWXA 2YOIA 4XS6A 2R37A 2A2SA 2GDRA 1K0CA 3WGEA 2CAQA 3PPUA 3F63A 3M1GA 2P31A 2HRAA 3GSSA 3QFBC 2EC4A 2RUFA 3KH9A 5E59A 4IJ3A 1O8XA 1T4YA 2DMLA 1M0UA 4NHWA 1SKWB 2IJYA 3R2QA 4D73B 5H5SA 1GTUA 4G2EA 5INYA 2H1DA 1JZOA 3O76A 5IMDA 3FR6A 1M2DA 3TRQA 1ZL9A 2H0GA 1SL2B 3F3QA 3KTLA 2LSTA 4G0KA 4BWSA 1KTEA 5ECNB 2DJ3A 5CRGA 3Q19A 3GKXA 4O7HA 3VI7A 3AY8A 4F0BA 2A2RA 3HYPA 1H4OA 5JWOB 5KN2A 2V6OA 2G2QA 2XBQA 3LGCA 5DQYA 1A0FA 1TW9A 4ML6A 3ZFLA 4HS1A 4YQMA 1OKTA 2OBIA 2OBKA 2HSNB 3HVSA 5L71A 4OFNA 4ISDA 2OE0A 1B9XC 5IMFA 3LYKA 1Z6MA 2GT6A 5DVBA 2AYTA 1FVJA 5DBQA 3DEXA 2WJUA 3ED3A 2R2JA 2X64A 5G1KA 1B48A 3HCZA 2O8VB 1GSQA 1AQWA 2OJLA 2L6DA 1BYEA 1MTCA 2HRNA 3WT1A 2N5FA 3SWLA 4ULXA 4YQVA 2E0QA 4GTUA 4CDOA 5H5QA 3L4NA 2GSTA 1N8JA 4OFTA 3TKPA 2XHFA 3E0UA 2VM1A 4WKWA 4BVYA 1PGTA 1K3YA 4XHMA 1A2MA 2GTUA 3M9KA 2H76A 4TW5A 4N30A 2DJ1A 5LD0A 3RBTA 1V58A 1ERTA 1F9MA 1XW6A 4X1UA 3HZ4A 4KDYA 4HQZA 1HD2A 2JADA 1Z5YE 3CRUA 5ECMB 5ID2A 1TRSA 2F8FA 2VLUA 2PN8A 4DSQA 3L9UA 5ABRA 3F9UA 3DXBA 5J5NA 4EF0A 4PUAA 5IO0A 4FH8A 3UVTA 3M3MA 3EYTA 2M72A 4BVYB 3EE2A 1I9DA 1WE0A 3C71A 2IL3A 2JU5A 14GSA 2MMOA 3VURA 1AIUA 3ZVJA 2V6KA 4ZXGA 16GSA 1YZXA 3GX0A 5KN0A 2HQTA 3M9JA 5ECRB 2R3XA 3F4RA 3K8NA 2PPTA 2IWTA 1IYHA 3UL3A 2YJHA 3L0HA 1GTBA 5KN3A 3HVXA 1AW9A 1E6BA 2LRNA 1XZOA 1FB0A 1F6MC 1SL1B 4HZ2A 2LTKA 2QGVA 3S9FA 3I43A 2H73A 3GURA 1TXXA 1CQHA 2ON7A 1EP7A 1X5CA 4DSRA 1K0NA 1GWCA 2HFDA 2VO4A 2H8LA 4DSSA 5CRWA 1JZRA 1O73A 2YNXA 3C7MA 1K0MA 2HNLA 2KUCA 4IQ1A 2RM6A 1A24A 3TB2A 3QPMA 2PGTA 5FWGA 3E3EA 4V2MA 3DYRA 1BG5A 5IOXA 1XIYA 5AGYA 2F9SA 2HXKA 2MBSA 1AQVA 2H6YA 4OCEA 2HZFA 2ON5A 4PXOA 2YP6A 5IM9A 3HD5A 1O6JA 1UVZA 4KH7A 2DJ0A 4DSSB 4HU9A 2GQLA 3J7Yk 4GSTA 1TKDB 2IIYA 2UZ8A 2DMMA 1THOA 2HI7A 3BOAA 3ERFA 3QOUA 4GXZA 2H66A 3TKSE 5F07A 1SK1A 3TKQA 3ZZXA 3C1RA 1PA3A 17GSA 4MZWA 1PRXA 4V1Ag 11GSA 1SYXA 2B7JA 1JZWA 3VWVA 2LKUA 3IAS2 4I8BA 2VL2C 5COHA 1RK4A 2CVBA 1Z7PA 2I3YA 4ZL7A 4XRAA 2L5LA 3IC8A 1OKDA 4MZCA 1PQNA 3TRXA 4QL7A 2IFQA 1O81A 6GSVA 1Q98A 2H6ZA 3L9SA 4TVEA 5A5KA 3H79A 4GQFA 2B5EA 4ZILA 5B8AA 1EGRA 2PVOC 3EWLA 5EY6A 1G7EA 1SD9A 4EE0A 4PUFC 1YKCA 1MEKA 1W89A 1ZMAA 4XTSA 1T4ZA 4HUAA 5EPFA 4L8EA 2I9HA 2WB9A 2C8UA 2GT5A 1SJZA 1GTIA 1GNWA 4V2LA 4V2NA 2H75A 3G7YA 2IFQB 3G7IA 2RIIA 4NMUA 1A2LA 2KHPA 2DIZA 3TCOA 1F37A 2DSAA 5D9XA 1O8WA 1VGLA 4JZQA 1WOUA 5GSTA 4EKZA 2AHEA 5KN1A 1WIKA 4GWRA 1THXA 1XVWA 4ZL9A 1O7UA 2KP1A 3CTFA 3HJMA 4IN0A 1KBNA 5F06A 4L5LA 4MP4A 5CAXA 3HJOA 3TJKA 2MMNA 1PX6A 4OD7A 4HJMA 5IPHA 3GH6A 4TRXA 3QDNA 3MDKA 1GUHA 5DALA 1E2YA 6GSYA 5AN1A 1ZOFA 3UEMA 3HKRA 1DE2A 3KEBA 3DD3A 5J4UA 1A2JA 3P8WA 4YAPA 2FLSA 4KF9A 2GVPA 2H19A 4EXJA 2TRCP 1EOGA 2B1LA 4MPFA 3D21A 1VRSD 2IPAA 4L5OA 4MF5A 3KMOA 5HR3A 4WR4A 2OKAA 3GSTA 3GKMA 2H6XA 3D4TA 4ECBA 2B3SA 2O7KA 3GNJA 3G7JA 3FHKA 4J56E 4TR3A 2C0FA 1X9SB 2K18A 3APOA 4FYCA 4OCFA 4G19A 2JZTA 4KSMA 1W4VA 2GSSA 1TJDA 1T8EB 4ML1A 1J9BA 1XWCA 3FRCA 4N0VA 1OYJA 4GLTA 2O87A 2LNSA 4N0ZA 4NWYA 1T1VA 4PX1A 5ELGA 2IMKA 3EMPA 4AJ7A 4BL7B 4IJIA 4WR5A 1JZDA 2N5AA 1O85A 2HLSA 3A2WA 3QR6A 1ZYEA 4OO5A 1B4PA 2VIMA 2CAIA 2BTOT 3H8QA 5D9WA 1GTAA 3F3RA 1R7HA 5GZZB 4MDCA 5F05A 3ZITA 4I5QA 2LNTA 4BPYA 1ZCPA 4Z7XA 5G5FA 4L0UA 3EURA 2E2GA 3IOSA 1Z9HA 19GSA 1FG4A 1AQXA 4OWYA 4K0NA 4WF5A 1SK0A 4POLA 10GSA 1MD3A 1VF3A 1XWGA 5EVOA 1JLWA 2N5BA 2MMAA 4EO3A 5B6NA 5HR0A 5HR1A 2RLIA 1SYRA 3W6GA 5IMVA 2CV4A 2OE3A 4G0LA 2WRTA 5B8BA 3TOUA 3FK8A 2X99A 2HZEA 2K8VA 1AAZA 2AB6A 1WJKA 3TGZA 6GSXA 1ERVA 1TRVA 2PU9C 4NV5A 1X9MB 3UBLA 2V41A 2H72A 5GAND 4PTSA 3ISOA 2VCTA 2VLVA 1PSQA 4KCEA 5A4WA 1C72A 2JSYA 3NIVA 1X5DA 4Q5FA 3BBYA 2GQKA 3ZMLA 2JACA 4ZIJA 3P2AA 2WCIA 2YV9A 1QQ2A 1MDKA 4E8EA 4PGTA 2J9HA 2F51A 4RQXA 1PKWA 2WGRA 4AF2A 3LXZA 4MCUA 3VWUA 3VFIA 4JR6A 5KEJA 1A8LA 4YAVA 2R5GA 3C73A 4FYUA 3U5RE 5A4UA 2NDOA 4EDZA 3TJFA 3FYGA 1VF2A 4AJ6A 2CZ2A 3LJRA 2FWFA 2ZNMA 2VL2A 4RQRA 3V1WA 1YKAA 1OAZA 4NV2A 1YF0A 1VF1A 1QGVA 1KEBA 3KMNA 2H01A 2WZ9A 4E8HA 4IVFA 4ECIA 1K0BA 3LORA 4MJEA 3FEUA 5AISA 3UOMA 3NOFA 3L78A 3IV4A 4TOPA 5DJLA 3HJPA 1LU4A 4MABA 2PVQA 1ZYQB 1GSUA 3PGTA 4EUYA 2L4QA 3CXGA 1A0RP 3EC3A 2H70A 1U3IA 5F0GA 2M80A 4QQ7A 2VCVA 1N2AA 4TR4A 4PNGA 3CSJA 2B6MA 1YQ1A 3FZAA 2VOCA 1LJRA 2LJRA 3U6VA 2FHEA 5JCUA 1TI1A 1WP0A 2HSMA 1FB6A 1WPIA 5ID2B 2REMA 3SBCA 3GKNA 3ZYWA 1PX7A 3ZL5A 3ZTLA 2VL9A 1T7PB 2E7PA 2LUSA 2FA4A 20GSA 2LRCA 2LJKA 2CVKA 4KDUA 2C4JA 5HFGA 5GAPD 1AXDA 3F6FA 1K0OA 2LV3A 2XC2A 1G7OA 2GQMA 2P5RA 2B5XA 3OR5A 3QAVA 4GRFA 4MA9A 1M99A 3WT2A 3O3TA 3QCPA 4ACSA 5CREA 1WRYA 3QAGA 3DRNA 2DC5A 4HDEA 2WFCA 4KX4A 2HSHA 4TR0A 1EV4A 4NHZA 1HYUA 5IMZA 3A2VA 1JFUA 2C0EA 2O89A 3ME8A 4XS1A 1GSSA 1M9AA 4HI7A 2NBSA 4QL9A 2B7KA 2MBTA 5HQPA 1OVNA 1R26A 1GUMA 3ZRDA 1V9WA 1TU7A 2R4VA 2OE1A 2VCXA 3CSHA 3ERWA 4RI6A 6GSUA 2MMZA 2FA8A 5JWQB 2OACA 1JLVA 1ZZYA 4P3YB 1GNEA 1UN2A 2QKEA 2A4VA 1TK8B 3FZ5A 4USSA 3BCKA 4PNFA 1URMA 4PQHA 3UAPA 3ZVJD 3A5WA 3VWWA 1GSFA 1B9YC 2VLTA 2PBJA 4K1FA 4MK3A 1PKZA 2L4CA 1GLPA 4N10A 3ZLPA 18GSA 1X5EA 1Y6EA 2RM5A 3UMAA 2G0FA 1ABAA 5ECOB 5HFKA 3HVVA 3RPPA 5ECSA 1OC9A 1WWJA 3HZ8A 2K8SA 2BMXA 4WEYA 1FO5A 4GQCA 5D93A 4LMWA 4NAXA 1LBKA 4JEDA 3FR9A 5DCGA 4DEJA 4JU5A 1F2EA 3WGDA 2H74A 3Q18A 2LQQA 1U6TA 3UJ1A 2FY6A 1ACVA 3D4MA 3ZMKA 4TR1A 1OC9B 3IC4A 5J3RA 5FT3A 3KCMA 4HU7A 3LG6A 4AGSA 2IMFA 2LRTA 4LMVA 4MMMA 4I2UA 1XPVA 1QFNA 2YZUA 1DBYA 2WULA 3CSIA 1X9WB 2VD0A 4BWQA 3C8EA 4G9HA 1VF4A 4FO5A 5D8IA 1USBA 3FW2A 1AC1A 3KD0A 4TR1B 1FAAA 4OMVA 4LA1A 2CA8A 4KDXA 2X8HA 2X8CA 2FUG2 3H4KA 5IPGA 4K8MA 1PL2A 5IMAA 3WYWA 5GSSA 4AJ8A 5IMCA 2OADA 2PERA 5DDLA 5IQYA 1R5PA 3J7Yb 2VUPA 2YANA 4YQUA 1OC8A 2H71A 2OA7A 4F0CA 3IR4A 1TRWA 4BVXA 4XCSA 1Z6NA 5DAKA 3EMXA 1K3OA 1TK0B 4O32A 5D73A 2IMEA 3TKSC 1EV9A 3D0ZA 2NPBA 4LLRA 2CQ9A 3APSA 3UBKA 3KIJA 5A4VA 2VCWA 1SKSB 2KLXA 3F8UA 1U88A 5JCWA 3I9V2 2YCDA 2V1MA 4WETA 1CQGA 2V2GA 3ZREA 4XS4A 3Q74A 4BVXB 2KP2A 5DAKB 2C80A 1YEPA 5DALB 2XPEA 4IQAA 4KE3A 2LJAA 4PQIA 3IBHA 1J0FA 2DBCA 2YPMA 1XWKA 1S3CA 1OE8A 1V40A 1GH2A 2L6CA 1ST9A 2CX4A 2TRXA 2RUEA 4IP6A 2GSQA 1XXUA 3RDWA 1HNBA 4XS4B 4FQUA 3IAM2 1XWAA 1A8YA 1M2BA 4V1Ap 2FNOA 3IK9A 4IW9A 4PQ1A 1ON4A 1TDIA 3KP9A 5AIXA 4ZB9A 1BAYA 5IO2A 2ES7A 3HHVA 1K0AA 3P90A 4KSOA 3D6IA 3GIXA 3KP8A 4HJ2A 4JE1A 2GS3A 4MH2A 3MWHA 3BCIA 1TP9A 2M46A 4JBBA 2JL4A 2JZRA 4KGIA 5G5EA 4KW6A 2P5QA 1XFLA 2GLRA 1NHYA 4KUNA 3IRAA 4POMA 4ECJA 2IN3A 4F82A 2VD1A 1J08A 2ZUPA 1FHEA 2K9FA 1ZGNA 3QFAC 4PURA 3KM6A 1A23A 2C0GA 4ID0A 2EIRA 4F2IA 3BJ5A 2AJQB 4K0GA 2MYGA 3F4SA 3GV1A 5D9VA 5JWRB 2L57A 5IOWA 22GSA 4KCAA 3GFKA 4IP1A 1GULA 3DKSA 4ECCA 1WMJA 3ZFBA 2L5OA 3EU3A 4MJBA 2YWOA 3P7XA 1EP8A 4Q5NA 4MF6A 1UC7A 1NW2A 3TUEA 3IHQA 5CO3A 4N11A 2ZCTA 1OE7A 4MH3A 3UARA 3I69A 3QAWA 2LQOA 1BEDA 5FHIA 1T00A 12GSA 1RQMA 1S3AA 4Q5QA 2H1AA 2HZEB 2C0DA 6GSTA 2YZHA 1FW1A 2IMDA 3US3A 3IE3A 3W8JA 3IA1A 2P0GA 3EVIA 1GSEA 2YWNA 4H86A 3UIWA 3IPZA 4FYBA 3D22A 5C00A 4Q5RA 3IK7A 1YF1A 2J23A 4MJCA 1EEMA 1V98A 4WF4A 4IHUA 3GHAA 4ZBAA 5B7CA 3LYPA 4K6XA 5CP1A 3RHCA 2B5YA 4GCIA 1PN9A 3RHBA 1K0DA 3R3EA 2GZYA 3DIEA 4O5RA 1SKRB 3LFLA 2VM2A 2K6VA 3VI5A 1XVQA 3O6TA 3TJJA 2C3TA 1Q4JA 1UA5A 5ELAA 1MDJA 4J2FA 3F0IA 3EINA 1NHOA 3W8SA 2PWJA 4BA7A 1XCCA 1OC3A 1BX9A 2NTOA 4F9ZA 13GSA 6GSWA 1HNCA 1EZKA 2YWMA 2EIOA 2TIRA 2VAFA 1DUGA 4IBPA 1YDKA 2DJ2A 3H93A 1GSYA 4MPGA 1V2AA 4KNDA 2H1GA 2E2MA 5ECQB 4J57E 3FR3A 1F3AA 1PMTA 3GN3A 3C1SA 3FZ9A 2YWIA 3DVWA 3KH7A 1K3LA 2Z9SA 3BD2A 4MF7A 2H0HA 2CZ3A 1PD21 5LNKe 2DIYA 4K7IA 2FWEA 4K9ZA 4NXIA 1ML6A 1Z7RA 4NPBA 4WBJA 1TK5B 1IYIA 4IKHA 3D5JA 3GMFA 2VCQA 8GSSA 4WBRD 4KAEA 3M8NA 4WXTA 1RW1A 5ECPB 1BQ7A 4EDYA 1XBSA 3Q6OA 2YJ7A 5ECIB 1Y25A 3VPTA 3HY2A 1B8XA 1NSWA 2FD3A 1TOFA 3EU4A 5DQSA 1F3BA 2HRFA 4GSNA 2I1UA 1SK2A 3TKSA 1S3DA 1TTZA 5JCGA 1EGOA 3H1NA 5E4WA 4MZBA 3CTGA 3F6DA 2HSMB 3CMIA 3GH9A 2EIQA 3ZIJA 5DJMA 4EL1A 5J9CA 1EWXA 1M7TA 4ZBDA 4ZB6A 5HR2A 5HFIA 1R4WA 2GZPA 4YH2A 2AV4A 2MZCA 3MNGA 4GSSA 3KZQA 1DE1A 5ECKB 1ERUA 4RI7A 2D2ZA 2H0IA 2QSIA 4KB3A 1SU9A 2AUVA 4ZL8A 3TJGA 3HXSA 1BJXA 1NM3A 4I2TA 3CYNA 1EOHA 1AUCA 5G31A 2GSRA 1SJ6A 4G0IA 3LXTA 2YN1A 1YY7A 2WDUA 3VLNA 4IS0A 2NVLA 1GLQA 3L9VA 1KNGA 4TXVA 4HZ4A 6GSSA 3RAZA 4POBA 3IXRA 2V32A 2HRKA 5ECLB 2DLXA 4HQSA 7GSSA 1EEJA 1TRUA 4EVMA 3FY7A 4XIHA 1HNAA 1TI3A 2PUKC 1R5AA 5ENUA 3ERGA 1GP1A 3MSZA 2FCHA 2LEGA 4DVCA 5ECHB 2FWGA 5C04A 3GKKA 2AAWA 4GF0A 4O92A 4K7NA 1QXHA 4HEA2 2HT9A 1XW5A 1FOVA 1M9BA 4EC0A 2HE3A 4MLYA 3N9JA 1DSBA 2CX3A 4LL4B 5IIZA 2HRKB 3KGKA 5CRHA 2H1BA 3VK9A 2HYXA 3CRTA 3ZIVA 3GRXA 3RPNA 2PMTA 4OFMA 5D9TA 2CVDA 3DVXA 3WD6A 1U87A 5G1LA 2CT6A 3ME7A 2DJJA 3GL3A 1GSDA 3GYKA 4TN8A 4LL1B 1GRXA 3GX8A 4TKYA 1T3BA 1TU8A 3JCML 3APQA 5CYYA 3HDCA 2GZZA 4OO4A 1JHBA 3NZNA 3I6AA 5CNWA 4G10A 5CRDA 3N5OA 1SD8A 2DJKA 3TJBA 4ZBBA 2VCZA 2JZSA 4IGJA 1GUKA 4CW9A 1HQOA 1Z3EA 3DWVA 2ALBA 4MJAA 2XBIA 2C3NA 4POKA 3TDGA 5D96A 1SJIA
chains in the Genus database with same CATH superfamily
1YEXA 1MDIA 3M0FA 3DMLA 1SENA 4ZB8A 4KA0A 5DCHA 1YJ6A 2B1KA 3QMXA 5B6MA 2XPDA 1G6YA 3LSZA 1QMVA 1SL0B 3EPTA 3LQ7A 3MIXA 1G0TA 2F3MA 5J9BA 5G2ZA 5F8BA 3KJYA 4FIWA 2GGTA 4X0XA 2F8AA 3GL5A 1QUWA 3WGXA 1B4QA 9GSSA 3F4TA 3FKFA 2YV7A 1XW9A 3GTUA 3HA9A 3PR8A 4BL7A 4HOJA 4I6XA 2O85A 1H75A 2FGXA 4K2XA 2QC7A 2L59A 4X43A 4ILFA 2LS5A 2I4AA 1GL8A 1X0RA 3A2XA 4K7OA 5AIVA 2H30A 1M2AA 1MD4A 3LEFA 1XOAA 4TXOA 4Z2TA 2HSYA 3GTUB 3CBUA 3DGQA 3PINA 3KTBA 4JR4A 5EL8A 2I81A 2X8GA 1V57A 2C3QA 5LCZA 3IDVA 1QK8A 2C1YA 5G30A 1I1IP 1PL1A 2WW1A 2BJXA 3QD9A 3VPQA 4F03A 5J41A 4HSCX 1G6WA 2WS2A 1U3AA 2A4HA 3TOTA 3UVHA 3G9BA 4JRRA 1ERWA 5BMUA 3TKRA 5H5RA 4TXOB 4CHSA 2KOKA 2IMIA 2R6KA 2JSZA 3GUSA 3LWAA 1FVKA 4RUVA 1I5GA 1XOBA 3FZ4A 3GA4A 3TRPA 4L0WA 4Z2UA 3E9JB 4K2DA 3MAKA 4XRDA 2VL3A 4I97A 3PH9A 1XWBA 3KXOA 4IELA 2FWHA 4D73A 3A3TA 1SVMA 5J47A 4AKXB 1ILOA 3VWXA 2YOIA 4XS6A 2R37A 2A2SA 2GDRA 1K0CA 5BMUB 3WGEA 2CAQA 3PPUA 3F63A 3M1GA 4AKIA 2P31A 2HRAA 3GSSA 3QFBC 2EC4A 2RUFA 3KH9A 5E59A 4IJ3A 1O8XA 1T4YA 2DMLA 2EFCA 1M0UA 4NHWA 1SKWB 2IJYA 3R2QA 4D73B 5H5SA 1GTUA 4G2EA 5INYA 2H1DA 1JZOA 3O76A 5IMDA 3FR6A 1M2DA 3TRQA 1ZL9A 2H0GA 1SL2B 3F3QA 2DKIA 3KTLA 2LSTA 4G0KA 2X4AA 4BWSA 2WVYA 1KTEA 5ECNB 2DJ3A 5CRGA 3Q19A 4BIKA 3GKXA 4O7HA 3VI7A 3AY8A 4F0BA 4EIPA 2A2RA 3HYPA 1H4OA 5JWOB 5KN2A 2WVXA 2V6OA 1ZYNA 2G2QA 2XBQA 3LGCA 5DQYA 1A0FA 1TW9A 4ML6A 3ZFLA 4HS1A 4YQMA 1OKTA 2OBIA 2OBKA 2HSNB 3HVSA 5L71A 4OFNA 4ISDA 2OE0A 1B9XC 5IMFA 3LYKA 1Z6MA 2GT6A 5DVBA 2AYTA 1FVJA 5DBQA 3DEXA 2WJUA 3ED3A 2WVXB 2R2JA 2X64A 5G1KA 1B48A 3HCZA 2O8VB 1GSQA 1AQWA 2OJLA 2L6DA 1BYEA 1MTCA 2HRNA 3WT1A 2N5FA 3SWLA 2EFEA 3CWGA 4ULXA 4YQVA 2E0QA 4GTUA 4CDOA 5H5QA 3L4NA 2GSTA 1N8JA 4OFTA 3TKPA 2XHFA 3E0UA 2VM1A 4WKWA 4BVYA 1PGTA 1K3YA 4XHMA 1A2MA 2GTUA 3M9KA 2H76A 4TW5A 4N30A 2DJ1A 5LD0A 3RBTA 1V58A 1ERTA 1F9MA 1XW6A 4X1UA 3HZ4A 4KDYA 4HQZA 1HD2A 2JADA 1Z5YE 3CRUA 5ECMB 5ID2A 1TRSA 2F8FA 2VLUA 2PN8A 4DSQA 3L9UA 2DKHA 5ABRA 3F9UA 3DXBA 5J5NA 4EF0A 4PUAA 5IO0A 4FH8A 3UVTA 3M3MA 3EYTA 2M72A 4BVYB 3EE2A 1I9DA 1WE0A 3C71A 2IL3A 2JU5A 2MMOA 14GSA 4PHZC 3VURA 4AI6A 1AIUA 3ZVJA 2V6KA 3CHXC 1BG1A 4ZXGA 16GSA 1YZXA 3GX0A 5KN0A 2HQTA 3M9JA 5ECRB 2R3XA 3F4RA 3K8NA 2PPTA 2A2PA 2IWTA 1IYHA 3UL3A 2YJHA 3L0HA 1GTBA 2EFHA 3HVXA 1AW9A 1FOHA 5KN3A 1E6BA 2LRNA 1XZOA 1FB0A 1F6MC 1SL1B 4HZ2A 2LTKA 2QGVA 3S9FA 3I43A 2H73A 3GURA 1TXXA 1CQHA 2ON7A 1EP7A 1X5CA 4DSRA 1K0NA 4A5PA 1GWCA 2HFDA 2VO4A 2H8LA 4DSSA 5CRWA 1JZRA 1O73A 2YNXA 3C7MA 1K0MA 2HNLA 2KUCA 4IQ1A 4GDFA 2RM6A 1A24A 3TB2A 3QPMA 2PGTA 5FWGA 3E3EA 5A34A 4V2MA 3DYRA 1BG5A 3TU3B 1XIYA 5IOXA 5AGYA 2F9SA 2HXKA 2MBSA 1AQVA 2H6YA 4OCEA 4EIQA 2HZFA 2ON5A 4PXOA 2YP6A 5IM9A 3CQFA 3HD5A 1O6JA 1UVZA 4KH7A 2DJ0A 4DSSB 4HU9A 2GQLA 3J7Yk 4GSTA 1TKDB 2IIYA 2UZ8A 2DMMA 1THOA 2HI7A 3BOAA 3ERFA 3QOUA 4GXZA 2H66A 3TKSE 5A34B 5F07A 1SK1A 3TKQA 1S3RA 3ZZXA 3C1RA 1PA3A 17GSA 4MZWA 1PRXA 4V1Ag 11GSA 1SYXA 2B7JA 1JZWA 3VWVA 2LKUA 3IAS2 4I8BA 2VL2C 5COHA 1RK4A 2CVBA 1Z7PA 2I3YA 4ZL7A 4XRAA 2L5LA 3IC8A 1OKDA 1YEWC 2UV8G 4MZCA 1PQNA 3TRXA 4QL7A 2IFQA 1O81A 6GSVA 1Q98A 2H6ZA 3L9SA 4TVEA 5A5KA 3H79A 4GQFA 2B5EA 4ZILA 5B8AA 1EGRA 2PVOC 3EWLA 5EY6A 1G7EA 1SD9A 4EE0A 4PUFC 1YKCA 1MEKA 1W89A 1ZMAA 4XTSA 1T4ZA 4HUAA 5EPFA 4L8EA 2I9HA 2WB9A 2C8UA 2GT5A 1SJZA 1GTIA 1GNWA 4V2LA 4V2NA 2H75A 3G7YA 2IFQB 3G7IA 2RIIA 4NMUA 2R0PA 1A2LA 2KHPA 2DIZA 3TCOA 2QA2A 1F37A 2DSAA 5D9XA 1O8WA 1VGLA 4JZQA 1WOUA 5GSTA 4EKZA 2AHEA 5KN1A 1WIKA 4GWRA 1THXA 1XVWA 4ZL9A 1O7UA 2KP1A 3CTFA 2WW0A 3HJMA 4IN0A 1KBNA 5F06A 4L5LA 4MP4A 5CAXA 3HJOA 3TJKA 2MMNA 1PX6A 4OD7A 4HJMA 4K5SA 5IPHA 3GH6A 4TRXA 3QDNA 3MDKA 1GUHA 5DALA 1E2YA 6GSYA 5AN1A 1ZOFA 3UEMA 3HKRA 1DE2A 3KEBA 3DD3A 5J4UA 1A2JA 3P8WA 4YAPA 2FLSA 4KF9A 2GVPA 2H19A 4EXJA 2TRCP 1EOGA 2B1LA 4MPFA 3D21A 1VRSD 2IPAA 4L5OA 4MF5A 3KMOA 5HR3A 4WR4A 2OKAA 3GSTA 3GKMA 2H6XA 2O3EA 3D4TA 4ECBA 2B3SA 2O7KA 3GNJA 3G7JA 3FHKA 4J56E 4TR3A 2C0FA 1X9SB 2K18A 3APOA 4FYCA 4OCFA 4G19A 2JZTA 4KSMA 1W4VA 2GSSA 1TJDA 1T8EB 4ML1A 1J9BA 1XWCA 3FRCA 4N0VA 1OYJA 4GLTA 2O87A 2LNSA 4N0ZA 4NWYA 1T1VA 4PX1A 5ELGA 2IMKA 3EMPA 4AJ7A 4BL7B 4IJIA 4WR5A 1JZDA 2N5AA 1O85A 2HLSA 4CY6A 3A2WA 3QR6A 1ZYEA 4X4JA 4OO5A 1B4PA 2VIMA 2CAIA 2BTOT 3H8QA 5D9WA 1GTAA 3F3RA 1R7HA 5GZZB 4MDCA 5F05A 3ZITA 4I5QA 2LNTA 4BPYA 1ZCPA 4Z7XA 5G5FA 4L0UA 3EURA 2E2GA 3IOSA 1Z9HA 19GSA 1FG4A 1AQXA 4OWYA 4K0NA 4WF5A 1SK0A 4POLA 10GSA 1MD3A 1VF3A 1XWGA 5EVOA 1JLWA 2N5BA 2MMAA 4EO3A 5B6NA 5HR0A 5HR1A 2RLIA 1SYRA 3W6GA 5IMVA 2CV4A 2OE3A 4G0LA 2WRTA 5B8BA 3TOUA 1N25A 3FK8A 2X99A 2HZEA 1TXUA 2K8VA 1AAZA 2AB6A 1WJKA 3TGZA 6GSXA 1ERVA 1TRVA 2PU9C 4NV5A 1X9MB 3UBLA 2V41A 2H72A 5GAND 4PTSA 3ISOA 2VCTA 2VLVA 1PSQA 4KCEA 5A4WA 1C72A 2JSYA 3NIVA 1X5DA 4Q5FA 3BBYA 2GQKA 3ZMLA 2JACA 4ZIJA 3P2AA 2WCIA 2YV9A 1QQ2A 1MDKA 4E8EA 4PGTA 2J9HA 2F51A 4RQXA 1PKWA 2WGRA 3IHGA 1Y1UA 4AF2A 3LXZA 4MCUA 3VWUA 3VFIA 4JR6A 5KEJA 1A8LA 4YAVA 2R5GA 3C73A 4FYUA 3U5RE 2EFDA 5A4UA 2NDOA 4EDZA 3TJFA 3FYGA 1VF2A 4AJ6A 2CZ2A 3LJRA 2FWFA 2ZNMA 2VL2A 4RQRA 3V1WA 1YKAA 1OAZA 4NV2A 1YF0A 4FXYP 5A5HA 1VF1A 1QGVA 1KEBA 1PN0A 2X49A 3KMNA 2H01A 2WZ9A 4E8HA 4IVFA 4ECIA 1K0BA 4ICYA 3LORA 4MJEA 3FEUA 5AISA 3UOMA 3NOFA 3L78A 3IV4A 4TOPA 5DJLA 3HJPA 1LU4A 4MABA 2PVQA 1ZYQB 1GSUA 5A5HB 3PGTA 4EUYA 2L4QA 3CXGA 1A0RP 3EC3A 2H70A 2R0GA 1U3IA 5F0GA 2M80A 4QQ7A 4K5RA 2VCVA 1N2AA 1PFOA 4TR4A 4PNGA 3CSJA 2B6MA 1YQ1A 3FZAA 2VOCA 1LJRA 2LJRA 3U6VA 4YKGA 2FHEA 5JCUA 1TI1A 1WP0A 2HSMA 1FB6A 1WPIA 5ID2B 2REMA 3SBCA 3GKNA 3ZYWA 1PX7A 3ZL5A 3ZTLA 2VL9A 1T7PB 2E7PA 3RFRC 2LUSA 2FA4A 20GSA 2LRCA 2LJKA 2CVKA 4KDUA 2C4JA 2O5VA 5HFGA 4MNNA 5GAPD 1AXDA 3F6FA 1K0OA 2LV3A 2XC2A 1G7OA 2GQMA 2P5RA 2B5XA 3OR5A 3QAVA 4GRFA 5J40A 4MA9A 1M99A 3WT2A 3O3TA 2OT3A 3QCPA 4ACSA 5CREA 1WRYA 3QAGA 3DRNA 2DC5A 4HDEA 2WFCA 4KX4A 2HSHA 4TR0A 1EV4A 4NHZA 1HYUA 5IMZA 3A2VA 1JFUA 2C0EA 2O89A 3FMWA 3ME8A 4XS1A 1GSSA 5BRTA 1M9AA 4HI7A 2NBSA 4QL9A 2B7KA 2MBTA 5HQPA 1OVNA 1R26A 1GUMA 3ZRDA 1V9WA 1TU7A 2R4VA 2OE1A 2VCXA 4PI2C 3CSHA 3ERWA 4RI6A 6GSUA 2MMZA 2FA8A 5JWQB 2OACA 1JLVA 1ZZYA 4P3YB 1GNEA 1UN2A 2QKEA 2A4VA 1TK8B 3FZ5A 4USSA 3BCKA 4PNFA 1URMA 4PQHA 3UAPA 3ZVJD 4G01A 4AKHA 3A5WA 3VWWA 1GSFA 1B9YC 2H1LA 2VLTA 2PBJA 4K1FA 4MK3A 1PKZA 2L4CA 1GLPA 4N10A 3ZLPA 18GSA 1X5EA 1Y6EA 2RM5A 3UMAA 2G0FA 1ABAA 5ECOB 5HFKA 3HVVA 3RPPA 5ECSA 1OC9A 1WWJA 3HZ8A 2K8SA 3MYDA 4O5QA 2BMXA 4WEYA 1FO5A 4GQCA 5D93A 4LMWA 4NAXA 1LBKA 4JEDA 3FR9A 5DCGA 4DEJA 4JU5A 1F2EA 3WGDA 2H74A 3Q18A 2LQQA 4O5UA 1U6TA 3UJ1A 2FY6A 1ACVA 3D4MA 3ZMKA 4TR1A 1OC9B 3IC4A 5J3RA 5FT3A 3KCMA 2O36A 4HU7A 3LG6A 4AGSA 2IMFA 2LRTA 4LMVA 4MMMA 4I2UA 1XPVA 1QFNA 1BF5A 2YZUA 1DBYA 2WULA 3CSIA 1X9WB 2VD0A 4BWQA 3C8EA 4G9HA 1VF4A 4FO5A 5D8IA 1USBA 3FW2A 1AC1A 3KD0A 2VKZG 4TR1B 1FAAA 4OMVA 4LA1A 2CA8A 4KDXA 2X8HA 2X8CA 2FUG2 3H4KA 5IPGA 4K8MA 2R0CA 1PL2A 5IMAA 3WYWA 5GSSA 4AJ8A 5IMCA 2OADA 2PERA 5DDLA 5IQYA 4ZB7A 3RGBC 1R5PA 3J7Yb 2VUPA 2YANA 4YQUA 1OC8A 2H71A 2OA7A 4F0CA 3IR4A 1TRWA 4BVXA 4XCSA 1Z6NA 5DAKA 3EMXA 1K3OA 1ZYPA 1TK0B 4O32A 5D73A 2IMEA 3TKSC 1EV9A 3D0ZA 2NPBA 4LLRA 2CQ9A 3APSA 3UBKA 3KIJA 5A4VA 2VCWA 1SKSB 2KLXA 3F8UA 1U88A 5JCWA 3I9V2 2YCDA 2V1MA 4WETA 1CQGA 2V2GA 3ZREA 4XS4A 3Q74A 4BVXB 2KP2A 5DAKB 2C80A 1YEPA 5DALB 2XPEA 4IQAA 4KE3A 2LJAA 4PQIA 3IBHA 1S4BP 1J0FA 2DBCA 2YPMA 1XWKA 1S3CA 1OE8A 1V40A 1GH2A 2L6CA 1ST9A 2CX4A 2TRXA 2RUEA 4PI0C 2GSQA 4IP6A 1XXUA 3RDWA 1HNBA 4XS4B 4FQUA 3IAM2 1XWAA 1A8YA 1M2BA 4V1Ap 2FNOA 3IK9A 4IW9A 4PQ1A 1ON4A 1TDIA 3KP9A 5AIXA 4ZB9A 1BAYA 4Z2RA 3LW9A 5IO2A 2ES7A 3HHVA 1K0AA 3P90A 4KSOA 3D6IA 3GIXA 3KP8A 1XG8A 4HJ2A 4JE1A 2GS3A 4MH2A 3MWHA 3BCIA 1TP9A 2M46A 4JBBA 2JL4A 1M3JA 2JZRA 4KGIA 5G5EA 4KW6A 2P5QA 1XFLA 2GLRA 1NHYA 4KUNA 3IRAA 4POMA 4ECJA 2IN3A 4F82A 2VD1A 1J08A 2ZUPA 1FHEA 2K9FA 1ZGNA 3QFAC 5J4YA 4PURA 3KM6A 1A23A 2C0GA 4ID0A 2EIRA 4F2IA 3BJ5A 5J4VA 2AJQB 4K0GA 2MYGA 3F4SA 3GV1A 5D9VA 5JWRB 2L57A 5IOWA 22GSA 4KCAA 3GFKA 4IP1A 1GULA 3DKSA 4ECCA 1WMJA 3ZFBA 2L5OA 3EU3A 1M3IA 4MJBA 2YWOA 3P7XA 1EP8A 4Q5NA 3HMJG 4MF6A 1UC7A 1NW2A 3TUEA 3IHQA 5CO3A 4N11A 2ZCTA 1OE7A 4MH3A 3UARA 4QMKA 3I69A 3QAWA 2LQOA 1BEDA 5FHIA 1T00A 12GSA 1RQMA 1S3AA 4Q5QA 4AKGA 2WVZA 2H1AA 2HZEB 2C0DA 6GSTA 4E68A 2YZHA 1FW1A 2IMDA 3US3A 3IE3A 3W8JA 2WW2A 3IA1A 2P0GA 5KOXA 3EVIA 2WW3A 1GSEA 2YWNA 3HVNA 2HSNA 4H86A 3UIWA 3IPZA 4FYBA 3D22A 5C00A 4Q5RA 3IK7A 1YF1A 2J23A 4MJCA 1EEMA 1V98A 4WF4A 4IHUA 3GHAA 4ZBAA 5B7CA 3LYPA 4K6XA 5CP1A 3RHCA 2B5YA 4GCIA 2WZSA 1PN9A 2QA1A 3RHBA 1K0DA 3R3EA 2GZYA 3DIEA 4O5RA 1SKRB 3LFLA 2VM2A 2K6VA 3VI5A 1XVQA 3O6TA 3TJJA 2C3TA 1Q4JA 1UA5A 5ELAA 1MDJA 4J2FA 3F0IA 3EINA 1NHOA 3W8SA 1SVOA 2PWJA 4BA7A 1XCCA 1OC3A 1BX9A 2NTOA 4F9ZA 13GSA 6GSWA 1HNCA 1EZKA 2YWMA 2EIOA 2TIRA 2VAFA 1DUGA 4IBPA 1YDKA 2DJ2A 3H93A 1GSYA 4MPGA 1V2AA 4KNDA 2H1GA 2E2MA 5ECQB 4J57E 3FR3A 1F3AA 1PMTA 3GN3A 3C1SA 3FZ9A 2YWIA 3DVWA 3KH7A 4CY8A 1K3LA 2Z9SA 3BD2A 4MF7A 2H0HA 2CZ3A 1PD21 5LNKe 2DIYA 4K7IA 2FWEA 4K9ZA 4NXIA 1ML6A 1Z7RA 4NPBA 4WBJA 1TK5B 1IYIA 4IKHA 3D5JA 3GMFA 2VCQA 8GSSA 4WBRD 4KAEA 3M8NA 4WXTA 1RW1A 4N3ZA 5ECPB 1BQ7A 4EDYA 1XBSA 3Q6OA 2YJ7A 5ECIB 1Y25A 3VPTA 3HY2A 1B8XA 1NSWA 2FD3A 1TOFA 3EU4A 5DQSA 1F3BA 2HRFA 4GSNA 2I1UA 1SK2A 3TKSA 1S3DA 1TTZA 5JCGA 1EGOA 3H1NA 5E4WA 4MZBA 3CTGA 3F6DA 2HSMB 3CMIA 3GH9A 2EIQA 3ZIJA 1YVLA 3A5IA 5DJMA 4EL1A 5J9CA 1EWXA 1M7TA 4ZBDA 4ZB6A 5HR2A 5KOWA 5HFIA 1R4WA 2GZPA 4YH2A 2AV4A 2MZCA 3MNGA 4GSSA 3KZQA 1DE1A 5ECKB 1ERUA 4RI7A 2D2ZA 2H0IA 2QSIA 4KB3A 1SU9A 2AUVA 4ZL8A 3TJGA 3HXSA 1BJXA 1NM3A 4I2TA 3CYNA 1EOHA 1AUCA 5G31A 2GSRA 1SJ6A 4G0IA 3LXTA 2YN1A 1YY7A 2WDUA 3VLNA 4IS0A 2NVLA 1GLQA 3L9VA 1KNGA 4TXVA 4HZ4A 6GSSA 3RAZA 4POBA 3IXRA 2V32A 2HRKA 5ECLB 2DLXA 4HQSA 7GSSA 1EEJA 1TRUA 4EVMA 3FY7A 4XIHA 1HNAA 1TI3A 2PUKC 1R5AA 5ENUA 3ERGA 4W66A 1GP1A 3MSZA 2FCHA 2LEGA 4YKFA 5ECHB 4DVCA 2FWGA 5C04A 3GKKA 2AAWA 4GF0A 4O92A 4K7NA 1QXHA 2HT9A 4HEA2 1XW5A 1FOVA 1M9BA 4EC0A 2HE3A 4MLYA 3N9JA 1DSBA 2CX3A 4LL4B 5IIZA 2HRKB 3KGKA 5CRHA 2H1BA 3VK9A 2HYXA 3CRTA 3ZIVA 3GRXA 3RPNA 2PMTA 4OFMA 5D9TA 2CVDA 3DVXA 3WD6A 1U87A 5G1LA 2CT6A 3ME7A 2DJJA 3GL3A 1GSDA 3GYKA 4TN8A 4LL1B 1GRXA 3GX8A 4TKYA 1T3BA 1TU8A 3JCML 3APQA 5CYYA 3HDCA 2GZZA 4OO4A 1JHBA 5A1NA 3NZNA 3I6AA 5CNWA 4G10A 5CRDA 3N5OA 1SD8A 1SVLA 2DJKA 3TJBA 4ZBBA 2VCZA 2JZSA 4IGJA 1GUKA 4CW9A 1HQOA 1Z3EA 3DWVA 2ALBA 4MJAA 2XBIA 2C3NA 4POKA 3TDGA 5D96A 1SJIA 5A1NB
chains in the Genus database with same CATH topology
1YEXA 1MDIA 3M0FA 3DMLA 1SENA 4ZB8A 4KA0A 5DCHA 1YJ6A 2B1KA 3QMXA 5B6MA 2XPDA 1G6YA 3LSZA 1QMVA 1SL0B 3EPTA 3LQ7A 3MIXA 1G0TA 2F3MA 5J9BA 5G2ZA 5F8BA 3KJYA 4FIWA 2GGTA 4X0XA 2F8AA 3GL5A 1QUWA 3WGXA 1B4QA 9GSSA 3F4TA 3FKFA 2YV7A 1XW9A 3GTUA 3HA9A 3PR8A 4BL7A 4HOJA 4I6XA 2O85A 1H75A 2FGXA 4K2XA 2QC7A 2L59A 4X43A 4ILFA 2LS5A 2I4AA 1GL8A 1X0RA 3A2XA 4K7OA 5AIVA 2H30A 1M2AA 1MD4A 3LEFA 1XOAA 4TXOA 4Z2TA 2HSYA 3GTUB 3CBUA 3DGQA 3PINA 3KTBA 4JR4A 5EL8A 2I81A 2X8GA 1V57A 2C3QA 5LCZA 3IDVA 1QK8A 2C1YA 5G30A 1PL1A 2BJXA 3QD9A 3VPQA 4F03A 5J41A 1G6WA 2WS2A 1U3AA 2A4HA 3TOTA 3UVHA 3G9BA 4JRRA 1ERWA 5BMUA 3TKRA 5H5RA 4TXOB 4CHSA 2KOKA 2IMIA 2R6KA 2JSZA 3GUSA 3LWAA 1FVKA 4RUVA 1I5GA 1XOBA 3FZ4A 3GA4A 3TRPA 4L0WA 4Z2UA 3E9JB 4K2DA 3MAKA 4XRDA 2VL3A 4I97A 3PH9A 1XWBA 3KXOA 4IELA 2FWHA 4D73A 3A3TA 1SVMA 5J47A 4AKXB 1ILOA 3VWXA 2YOIA 4XS6A 2R37A 2A2SA 2GDRA 1K0CA 5BMUB 3WGEA 2CAQA 3PPUA 3F63A 3M1GA 4AKIA 2P31A 2HRAA 3GSSA 3QFBC 2EC4A 2RUFA 3KH9A 5E59A 4IJ3A 1O8XA 1T4YA 2DMLA 2EFCA 1M0UA 4NHWA 1SKWB 2IJYA 3R2QA 4D73B 5H5SA 1GTUA 4G2EA 5INYA 2H1DA 1JZOA 3O76A 5IMDA 3FR6A 1M2DA 3TRQA 1ZL9A 2H0GA 1SL2B 3F3QA 2DKIA 3KTLA 2LSTA 4G0KA 2X4AA 4BWSA 1KTEA 5ECNB 2DJ3A 5CRGA 3Q19A 3GKXA 4O7HA 3VI7A 3AY8A 4F0BA 4EIPA 2A2RA 3HYPA 1H4OA 5JWOB 5KN2A 2V6OA 1ZYNA 2G2QA 2XBQA 3LGCA 5DQYA 1A0FA 1TW9A 4ML6A 3ZFLA 4HS1A 4YQMA 1OKTA 2OBIA 2OBKA 2HSNB 3HVSA 5L71A 4OFNA 4ISDA 2OE0A 1B9XC 5IMFA 3LYKA 1Z6MA 2GT6A 5DVBA 2AYTA 1FVJA 5DBQA 3DEXA 2WJUA 3ED3A 2R2JA 2X64A 5G1KA 1B48A 3HCZA 2O8VB 1GSQA 1AQWA 2OJLA 2L6DA 1BYEA 1MTCA 2HRNA 3WT1A 2N5FA 3SWLA 2EFEA 3CWGA 4ULXA 4YQVA 2E0QA 4GTUA 4CDOA 5H5QA 3L4NA 2GSTA 1N8JA 4OFTA 3TKPA 2XHFA 3E0UA 2VM1A 4WKWA 4BVYA 1PGTA 1K3YA 4XHMA 1A2MA 2GTUA 3M9KA 2H76A 4TW5A 4N30A 2DJ1A 5LD0A 3RBTA 1V58A 1ERTA 1F9MA 1XW6A 4X1UA 3HZ4A 4KDYA 4HQZA 1HD2A 2JADA 1Z5YE 3CRUA 5ECMB 5ID2A 1TRSA 2F8FA 2VLUA 2PN8A 4DSQA 3L9UA 2DKHA 5ABRA 3F9UA 3DXBA 5J5NA 4EF0A 4PUAA 5IO0A 4FH8A 3UVTA 3M3MA 3EYTA 2M72A 4BVYB 3EE2A 1I9DA 1WE0A 3C71A 2IL3A 2JU5A 14GSA 2MMOA 3VURA 4AI6A 1AIUA 3ZVJA 2V6KA 1BG1A 4ZXGA 16GSA 1YZXA 3GX0A 5KN0A 2HQTA 3M9JA 5ECRB 2R3XA 3F4RA 3K8NA 2PPTA 2A2PA 2IWTA 1IYHA 3UL3A 2YJHA 3L0HA 1GTBA 2EFHA 3HVXA 1AW9A 1FOHA 5KN3A 1E6BA 2LRNA 1XZOA 1FB0A 1F6MC 1SL1B 4HZ2A 2LTKA 2QGVA 3S9FA 3I43A 2H73A 3GURA 1TXXA 1CQHA 2ON7A 1EP7A 1X5CA 4DSRA 1K0NA 4A5PA 1GWCA 2HFDA 2VO4A 2H8LA 4DSSA 5CRWA 1JZRA 1O73A 2YNXA 3C7MA 1K0MA 2HNLA 2KUCA 4IQ1A 4GDFA 2RM6A 1A24A 3TB2A 3QPMA 2PGTA 5FWGA 3E3EA 5A34A 4V2MA 3DYRA 1BG5A 3TU3B 1XIYA 5IOXA 5AGYA 2F9SA 2HXKA 2MBSA 1AQVA 2H6YA 4OCEA 4EIQA 2HZFA 2ON5A 4PXOA 2YP6A 5IM9A 3HD5A 1O6JA 1UVZA 4KH7A 2DJ0A 4DSSB 4HU9A 2GQLA 3J7Yk 4GSTA 1TKDB 2IIYA 2UZ8A 2DMMA 1THOA 2HI7A 3BOAA 3ERFA 3QOUA 4GXZA 2H66A 3TKSE 5A34B 5F07A 1SK1A 3TKQA 3ZZXA 3C1RA 1PA3A 17GSA 4MZWA 1PRXA 4V1Ag 11GSA 1SYXA 2B7JA 1JZWA 3VWVA 2LKUA 3IAS2 4I8BA 2VL2C 5COHA 1RK4A 2CVBA 1Z7PA 2I3YA 4ZL7A 4XRAA 2L5LA 3IC8A 1OKDA 2UV8G 4MZCA 1PQNA 3TRXA 4QL7A 2IFQA 1O81A 6GSVA 1Q98A 2H6ZA 3L9SA 4TVEA 5A5KA 3H79A 4GQFA 2B5EA 4ZILA 5B8AA 1EGRA 2PVOC 3EWLA 5EY6A 1G7EA 1SD9A 4EE0A 4PUFC 1YKCA 1MEKA 1W89A 1ZMAA 4XTSA 1T4ZA 4HUAA 5EPFA 4L8EA 2I9HA 2WB9A 2C8UA 2GT5A 1SJZA 1GTIA 1GNWA 4V2LA 4V2NA 2H75A 3G7YA 2IFQB 3G7IA 2RIIA 4NMUA 2R0PA 1A2LA 2KHPA 2DIZA 3TCOA 2QA2A 1F37A 2DSAA 5D9XA 1O8WA 1VGLA 4JZQA 1WOUA 5GSTA 4EKZA 2AHEA 5KN1A 1WIKA 4GWRA 1THXA 1XVWA 4ZL9A 1O7UA 2KP1A 3CTFA 3HJMA 4IN0A 1KBNA 5F06A 4L5LA 4MP4A 5CAXA 3HJOA 3TJKA 2MMNA 1PX6A 4OD7A 4HJMA 4K5SA 5IPHA 3GH6A 4TRXA 3QDNA 3MDKA 1GUHA 5DALA 1E2YA 6GSYA 5AN1A 1ZOFA 3UEMA 3HKRA 1DE2A 3KEBA 3DD3A 5J4UA 1A2JA 3P8WA 4YAPA 2FLSA 4KF9A 2GVPA 2H19A 4EXJA 2TRCP 1EOGA 2B1LA 4MPFA 3D21A 1VRSD 2IPAA 4L5OA 4MF5A 3KMOA 5HR3A 4WR4A 2OKAA 3GSTA 3GKMA 2H6XA 3D4TA 4ECBA 2B3SA 2O7KA 3GNJA 3G7JA 3FHKA 4J56E 4TR3A 2C0FA 1X9SB 2K18A 3APOA 4FYCA 4OCFA 4G19A 2JZTA 4KSMA 1W4VA 2GSSA 1TJDA 1T8EB 4ML1A 1J9BA 1XWCA 3FRCA 4N0VA 1OYJA 4GLTA 2O87A 2LNSA 4N0ZA 4NWYA 1T1VA 4PX1A 5ELGA 2IMKA 3EMPA 4AJ7A 4BL7B 4IJIA 4WR5A 1JZDA 2N5AA 1O85A 2HLSA 4CY6A 3A2WA 3QR6A 1ZYEA 4X4JA 4OO5A 1B4PA 2VIMA 2CAIA 2BTOT 3H8QA 5D9WA 1GTAA 3F3RA 1R7HA 5GZZB 4MDCA 5F05A 3ZITA 4I5QA 2LNTA 4BPYA 1ZCPA 4Z7XA 5G5FA 4L0UA 3EURA 2E2GA 3IOSA 1Z9HA 19GSA 1FG4A 1AQXA 4OWYA 4K0NA 4WF5A 1SK0A 4POLA 10GSA 1MD3A 1VF3A 1XWGA 5EVOA 1JLWA 2N5BA 2MMAA 4EO3A 5B6NA 5HR0A 5HR1A 2RLIA 1SYRA 3W6GA 5IMVA 2CV4A 2OE3A 4G0LA 2WRTA 5B8BA 3TOUA 1N25A 3FK8A 2X99A 2HZEA 1TXUA 2K8VA 1AAZA 2AB6A 1WJKA 3TGZA 6GSXA 1ERVA 1TRVA 2PU9C 4NV5A 1X9MB 3UBLA 2V41A 2H72A 5GAND 4PTSA 3ISOA 2VCTA 2VLVA 1PSQA 4KCEA 5A4WA 1C72A 2JSYA 3NIVA 1X5DA 4Q5FA 3BBYA 2GQKA 3ZMLA 2JACA 4ZIJA 3P2AA 2WCIA 2YV9A 1QQ2A 1MDKA 4E8EA 4PGTA 2J9HA 2F51A 4RQXA 1PKWA 2WGRA 3IHGA 1Y1UA 4AF2A 3LXZA 4MCUA 3VWUA 3VFIA 4JR6A 5KEJA 1A8LA 4YAVA 2R5GA 3C73A 4FYUA 3U5RE 2EFDA 5A4UA 2NDOA 4EDZA 3TJFA 3FYGA 1VF2A 4AJ6A 2CZ2A 3LJRA 2FWFA 2ZNMA 2VL2A 4RQRA 3V1WA 1YKAA 1OAZA 4NV2A 1YF0A 5A5HA 1VF1A 1QGVA 1KEBA 1PN0A 2X49A 3KMNA 2H01A 2WZ9A 4E8HA 4IVFA 4ECIA 1K0BA 4ICYA 3LORA 4MJEA 3FEUA 5AISA 3UOMA 3NOFA 3L78A 3IV4A 4TOPA 5DJLA 3HJPA 1LU4A 4MABA 2PVQA 1ZYQB 1GSUA 5A5HB 3PGTA 4EUYA 2L4QA 3CXGA 1A0RP 3EC3A 2H70A 2R0GA 1U3IA 5F0GA 2M80A 4QQ7A 4K5RA 2VCVA 1N2AA 4TR4A 4PNGA 3CSJA 2B6MA 1YQ1A 3FZAA 2VOCA 1LJRA 2LJRA 3U6VA 4YKGA 2FHEA 5JCUA 1TI1A 1WP0A 2HSMA 1FB6A 1WPIA 5ID2B 2REMA 3SBCA 3GKNA 3ZYWA 1PX7A 3ZL5A 3ZTLA 2VL9A 1T7PB 2E7PA 2LUSA 2FA4A 20GSA 2LRCA 2LJKA 2CVKA 4KDUA 2C4JA 2O5VA 5HFGA 4MNNA 5GAPD 1AXDA 3F6FA 1K0OA 2LV3A 2XC2A 1G7OA 2GQMA 2P5RA 2B5XA 3OR5A 3QAVA 4GRFA 5J40A 4MA9A 1M99A 3WT2A 3O3TA 2OT3A 3QCPA 4ACSA 5CREA 1WRYA 3QAGA 3DRNA 2DC5A 4HDEA 2WFCA 4KX4A 2HSHA 4TR0A 1EV4A 4NHZA 1HYUA 5IMZA 3A2VA 1JFUA 2C0EA 2O89A 3FMWA 3ME8A 4XS1A 1GSSA 5BRTA 1M9AA 4HI7A 2NBSA 4QL9A 2B7KA 2MBTA 5HQPA 1OVNA 1R26A 1GUMA 3ZRDA 1V9WA 1TU7A 2R4VA 2OE1A 2VCXA 3CSHA 3ERWA 4RI6A 6GSUA 2MMZA 2FA8A 5JWQB 2OACA 1JLVA 1ZZYA 4P3YB 1GNEA 1UN2A 2QKEA 2A4VA 1TK8B 3FZ5A 4USSA 3BCKA 4PNFA 1URMA 4PQHA 3UAPA 3ZVJD 4G01A 4AKHA 3A5WA 3VWWA 1GSFA 1B9YC 2H1LA 2VLTA 2PBJA 4K1FA 4MK3A 1PKZA 2L4CA 1GLPA 4N10A 3ZLPA 18GSA 1X5EA 1Y6EA 2RM5A 3UMAA 2G0FA 1ABAA 5ECOB 5HFKA 3HVVA 3RPPA 5ECSA 1OC9A 1WWJA 3HZ8A 2K8SA 3MYDA 4O5QA 2BMXA 4WEYA 1FO5A 4GQCA 5D93A 4LMWA 4NAXA 1LBKA 4JEDA 3FR9A 5DCGA 4DEJA 4JU5A 1F2EA 3WGDA 2H74A 3Q18A 2LQQA 4O5UA 1U6TA 3UJ1A 2FY6A 1ACVA 3D4MA 3ZMKA 4TR1A 1OC9B 3IC4A 5J3RA 5FT3A 3KCMA 4HU7A 3LG6A 4AGSA 2IMFA 2LRTA 4LMVA 4MMMA 4I2UA 1XPVA 1QFNA 1BF5A 2YZUA 1DBYA 2WULA 3CSIA 1X9WB 2VD0A 4BWQA 3C8EA 4G9HA 1VF4A 4FO5A 5D8IA 1USBA 3FW2A 1AC1A 3KD0A 2VKZG 4TR1B 1FAAA 4OMVA 4LA1A 2CA8A 4KDXA 2X8HA 2X8CA 2FUG2 3H4KA 5IPGA 4K8MA 2R0CA 1PL2A 5IMAA 3WYWA 5GSSA 4AJ8A 5IMCA 2OADA 2PERA 5DDLA 5IQYA 4ZB7A 1R5PA 3J7Yb 2VUPA 2YANA 4YQUA 1OC8A 2H71A 2OA7A 4F0CA 3IR4A 1TRWA 4BVXA 4XCSA 1Z6NA 5DAKA 3EMXA 1K3OA 1ZYPA 1TK0B 4O32A 5D73A 2IMEA 3TKSC 1EV9A 3D0ZA 2NPBA 4LLRA 2CQ9A 3APSA 3UBKA 3KIJA 5A4VA 2VCWA 1SKSB 2KLXA 3F8UA 1U88A 5JCWA 3I9V2 2YCDA 2V1MA 4WETA 1CQGA 2V2GA 3ZREA 4XS4A 3Q74A 4BVXB 2KP2A 5DAKB 2C80A 1YEPA 5DALB 2XPEA 4IQAA 4KE3A 2LJAA 4PQIA 3IBHA 1J0FA 2DBCA 2YPMA 1XWKA 1S3CA 1OE8A 1V40A 1GH2A 2L6CA 1ST9A 2CX4A 2TRXA 2RUEA 4IP6A 2GSQA 1XXUA 3RDWA 1HNBA 4XS4B 4FQUA 3IAM2 1XWAA 1A8YA 1M2BA 4V1Ap 2FNOA 3IK9A 4IW9A 4PQ1A 1ON4A 1TDIA 3KP9A 5AIXA 4ZB9A 1BAYA 4Z2RA 3LW9A 5IO2A 2ES7A 3HHVA 1K0AA 3P90A 4KSOA 3D6IA 3GIXA 3KP8A 4HJ2A 4JE1A 2GS3A 4MH2A 3MWHA 3BCIA 1TP9A 2M46A 4JBBA 2JL4A 2JZRA 4KGIA 5G5EA 4KW6A 2P5QA 1XFLA 2GLRA 1NHYA 4KUNA 3IRAA 4POMA 4ECJA 2IN3A 4F82A 2VD1A 1J08A 2ZUPA 1FHEA 2K9FA 1ZGNA 3QFAC 5J4YA 4PURA 3KM6A 1A23A 2C0GA 4ID0A 2EIRA 4F2IA 3BJ5A 5J4VA 2AJQB 4K0GA 2MYGA 3F4SA 3GV1A 5D9VA 5JWRB 2L57A 5IOWA 22GSA 4KCAA 3GFKA 4IP1A 1GULA 3DKSA 4ECCA 1WMJA 3ZFBA 2L5OA 3EU3A 4MJBA 2YWOA 3P7XA 1EP8A 4Q5NA 3HMJG 4MF6A 1UC7A 1NW2A 3TUEA 3IHQA 5CO3A 4N11A 2ZCTA 1OE7A 4MH3A 3UARA 4QMKA 3I69A 3QAWA 2LQOA 1BEDA 5FHIA 1T00A 12GSA 1RQMA 1S3AA 4Q5QA 4AKGA 2H1AA 2HZEB 2C0DA 6GSTA 4E68A 2YZHA 1FW1A 2IMDA 3US3A 3IE3A 3W8JA 3IA1A 2P0GA 5KOXA 3EVIA 1GSEA 2YWNA 2HSNA 4H86A 3UIWA 3IPZA 4FYBA 3D22A 5C00A 4Q5RA 3IK7A 1YF1A 2J23A 4MJCA 1EEMA 1V98A 4WF4A 4IHUA 3GHAA 4ZBAA 5B7CA 3LYPA 4K6XA 5CP1A 3RHCA 2B5YA 4GCIA 1PN9A 2QA1A 3RHBA 1K0DA 3R3EA 2GZYA 3DIEA 4O5RA 1SKRB 3LFLA 2VM2A 2K6VA 3VI5A 1XVQA 3O6TA 3TJJA 2C3TA 1Q4JA 1UA5A 5ELAA 1MDJA 4J2FA 3F0IA 3EINA 1NHOA 3W8SA 1SVOA 2PWJA 4BA7A 1XCCA 1OC3A 1BX9A 2NTOA 4F9ZA 13GSA 6GSWA 1HNCA 1EZKA 2YWMA 2EIOA 2TIRA 2VAFA 1DUGA 4IBPA 1YDKA 2DJ2A 3H93A 1GSYA 4MPGA 1V2AA 4KNDA 2H1GA 2E2MA 5ECQB 4J57E 3FR3A 1F3AA 1PMTA 3GN3A 3C1SA 3FZ9A 2YWIA 3DVWA 3KH7A 4CY8A 1K3LA 2Z9SA 3BD2A 4MF7A 2H0HA 2CZ3A 1PD21 5LNKe 2DIYA 4K7IA 2FWEA 4K9ZA 4NXIA 1ML6A 1Z7RA 4NPBA 4WBJA 1TK5B 1IYIA 4IKHA 3D5JA 3GMFA 2VCQA 8GSSA 4WBRD 4KAEA 3M8NA 4WXTA 1RW1A 4N3ZA 5ECPB 1BQ7A 4EDYA 1XBSA 3Q6OA 2YJ7A 5ECIB 1Y25A 3VPTA 3HY2A 1B8XA 1NSWA 2FD3A 1TOFA 3EU4A 5DQSA 1F3BA 2HRFA 4GSNA 2I1UA 1SK2A 3TKSA 1S3DA 1TTZA 5JCGA 1EGOA 3H1NA 5E4WA 4MZBA 3CTGA 3F6DA 2HSMB 3CMIA 3GH9A 2EIQA 3ZIJA 1YVLA 3A5IA 5DJMA 4EL1A 5J9CA 1EWXA 1M7TA 4ZBDA 4ZB6A 5HR2A 5KOWA 5HFIA 1R4WA 2GZPA 4YH2A 2AV4A 2MZCA 3MNGA 4GSSA 3KZQA 1DE1A 5ECKB 1ERUA 4RI7A 2D2ZA 2H0IA 2QSIA 4KB3A 1SU9A 2AUVA 4ZL8A 3TJGA 3HXSA 1BJXA 1NM3A 4I2TA 3CYNA 1EOHA 1AUCA 5G31A 2GSRA 1SJ6A 4G0IA 3LXTA 2YN1A 1YY7A 2WDUA 3VLNA 4IS0A 2NVLA 1GLQA 3L9VA 1KNGA 4TXVA 4HZ4A 6GSSA 3RAZA 4POBA 3IXRA 2V32A 2HRKA 5ECLB 2DLXA 4HQSA 7GSSA 1EEJA 1TRUA 4EVMA 3FY7A 4XIHA 1HNAA 1TI3A 2PUKC 1R5AA 5ENUA 3ERGA 4W66A 1GP1A 3MSZA 2FCHA 2LEGA 4YKFA 5ECHB 4DVCA 2FWGA 5C04A 3GKKA 2AAWA 4GF0A 4O92A 4K7NA 1QXHA 2HT9A 4HEA2 1XW5A 1FOVA 1M9BA 4EC0A 2HE3A 4MLYA 3N9JA 1DSBA 2CX3A 4LL4B 5IIZA 2HRKB 3KGKA 5CRHA 2H1BA 3VK9A 2HYXA 3CRTA 3ZIVA 3GRXA 3RPNA 2PMTA 4OFMA 5D9TA 2CVDA 3DVXA 3WD6A 1U87A 5G1LA 2CT6A 3ME7A 2DJJA 3GL3A 1GSDA 3GYKA 4TN8A 4LL1B 1GRXA 3GX8A 4TKYA 1T3BA 1TU8A 3JCML 3APQA 5CYYA 3HDCA 2GZZA 4OO4A 1JHBA 5A1NA 3NZNA 3I6AA 5CNWA 4G10A 5CRDA 3N5OA 1SD8A 1SVLA 2DJKA 3TJBA 4ZBBA 2VCZA 2JZSA 4IGJA 1GUKA 4CW9A 1HQOA 1Z3EA 3DWVA 2ALBA 4MJAA 2XBIA 2C3NA 4POKA 3TDGA 5D96A 1SJIA 5A1NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YEX A;  1MDI A;  3M0F A;  3DML A;  1SEN A;  4ZB8 A;  4KA0 A;  5DCH A;  1YJ6 A;  2B1K A;  3QMX A;  5B6M A;  2XPD A;  1G6Y A;  3LSZ A;  1QMV A;  1SL0 B;  3LQ7 A;  1G0T A;  2F3M A;  5J9B A;  5G2Z A;  5F8B A;  3KJY A;  4FIW A;  2GGT A;  4X0X A;  2F8A A;  3GL5 A;  1QUW A;  3WGX A;  1B4Q A;  9GSS A;  3F4T A;  3FKF A;  2YV7 A;  1XW9 A;  3GTU A;  3HA9 A;  3PR8 A;  4BL7 A;  4HOJ A;  4I6X A;  2O85 A;  1H75 A;  2FGX A;  2QC7 A;  2L59 A;  4X43 A;  4ILF A;  2LS5 A;  2I4A A;  1GL8 A;  1X0R A;  3A2X A;  4K7O A;  5AIV A;  2H30 A;  1M2A A;  1MD4 A;  3LEF A;  1XOA A;  4TXO A;  2HSY A;  3GTU B;  3CBU A;  3DGQ A;  3PIN A;  3KTB A;  4JR4 A;  5EL8 A;  2I81 A;  2X8G A;  1V57 A;  2C3Q A;  5LCZ A;  3IDV A;  1QK8 A;  2C1Y A;  5G30 A;  1PL1 A;  2BJX A;  3QD9 A;  3VPQ A;  4F03 A;  5J41 A;  1G6W A;  2WS2 A;  1U3A A;  3TOT A;  3UVH A;  3G9B A;  4JRR A;  1ERW A;  5BMU A;  3TKR A;  5H5R A;  4TXO B;  4CHS A;  2KOK A;  2IMI A;  2R6K A;  2JSZ A;  3GUS A;  3LWA A;  1FVK A;  4RUV A;  1I5G A;  1XOB A;  3FZ4 A;  3GA4 A;  3TRP A;  4L0W A;  3E9J B;  4K2D A;  3MAK A;  4XRD A;  2VL3 A;  4I97 A;  3PH9 A;  1XWB A;  3KXO A;  4IEL A;  2FWH A;  4D73 A;  3A3T A;  1ILO A;  3VWX A;  2YOI A;  4XS6 A;  2R37 A;  2A2S A;  2GDR A;  1K0C A;  3WGE A;  2CAQ A;  3PPU A;  3F63 A;  3M1G A;  2P31 A;  2HRA A;  3GSS A;  3QFB C;  2EC4 A;  2RUF A;  3KH9 A;  5E59 A;  4IJ3 A;  1O8X A;  1T4Y A;  2DML A;  1M0U A;  4NHW A;  1SKW B;  2IJY A;  3R2Q A;  4D73 B;  5H5S A;  1GTU A;  4G2E A;  5INY A;  2H1D A;  1JZO A;  3O76 A;  5IMD A;  3FR6 A;  1M2D A;  3TRQ A;  1ZL9 A;  2H0G A;  1SL2 B;  3F3Q A;  3KTL A;  2LST A;  4G0K A;  4BWS A;  1KTE A;  5ECN B;  2DJ3 A;  5CRG A;  3Q19 A;  3GKX A;  4O7H A;  3VI7 A;  3AY8 A;  4F0B A;  2A2R A;  3HYP A;  1H4O A;  5JWO B;  5KN2 A;  2V6O A;  2G2Q A;  2XBQ A;  3LGC A;  5DQY A;  1A0F A;  1TW9 A;  4ML6 A;  3ZFL A;  4HS1 A;  4YQM A;  1OKT A;  2OBI A;  2OBK A;  2HSN B;  3HVS A;  5L71 A;  4OFN A;  4ISD A;  2OE0 A;  1B9X C;  5IMF A;  3LYK A;  1Z6M A;  2GT6 A;  5DVB A;  2AYT A;  1FVJ A;  5DBQ A;  3DEX A;  2WJU A;  3ED3 A;  2R2J A;  2X64 A;  5G1K A;  1B48 A;  3HCZ A;  2O8V B;  1GSQ A;  1AQW A;  2OJL A;  2L6D A;  1BYE A;  1MTC A;  2HRN A;  3WT1 A;  2N5F A;  3SWL A;  4ULX A;  4YQV A;  2E0Q A;  4GTU A;  4CDO A;  5H5Q A;  3L4N A;  2GST A;  1N8J A;  4OFT A;  3TKP A;  2XHF A;  3E0U A;  2VM1 A;  4WKW A;  4BVY A;  1PGT A;  1K3Y A;  4XHM A;  1A2M A;  2GTU A;  3M9K A;  2H76 A;  4TW5 A;  4N30 A;  2DJ1 A;  5LD0 A;  3RBT A;  1V58 A;  1ERT A;  1F9M A;  1XW6 A;  4X1U A;  3HZ4 A;  4KDY A;  4HQZ A;  1HD2 A;  2JAD A;  1Z5Y E;  3CRU A;  5ECM B;  5ID2 A;  1TRS A;  2F8F A;  2VLU A;  2PN8 A;  4DSQ A;  3L9U A;  5ABR A;  3F9U A;  3DXB A;  5J5N A;  4EF0 A;  4PUA A;  5IO0 A;  4FH8 A;  3UVT A;  3M3M A;  3EYT A;  2M72 A;  4BVY B;  3EE2 A;  1I9D A;  1WE0 A;  3C71 A;  2IL3 A;  2JU5 A;  14GS A;  2MMO A;  3VUR A;  1AIU A;  3ZVJ A;  2V6K A;  4ZXG A;  16GS A;  1YZX A;  3GX0 A;  5KN0 A;  2HQT A;  3M9J A;  5ECR B;  2R3X A;  3F4R A;  3K8N A;  2PPT A;  2IWT A;  1IYH A;  3UL3 A;  2YJH A;  3L0H A;  1GTB A;  5KN3 A;  3HVX A;  1AW9 A;  1E6B A;  2LRN A;  1XZO A;  1FB0 A;  1F6M C;  1SL1 B;  4HZ2 A;  2LTK A;  2QGV A;  3S9F A;  3I43 A;  2H73 A;  3GUR A;  1TXX A;  1CQH A;  2ON7 A;  1EP7 A;  1X5C A;  4DSR A;  1K0N A;  1GWC A;  2HFD A;  2VO4 A;  2H8L A;  4DSS A;  5CRW A;  1JZR A;  1O73 A;  2YNX A;  3C7M A;  1K0M A;  2HNL A;  2KUC A;  4IQ1 A;  2RM6 A;  1A24 A;  3TB2 A;  3QPM A;  2PGT A;  5FWG A;  3E3E A;  4V2M A;  3DYR A;  1BG5 A;  5IOX A;  1XIY A;  5AGY A;  2F9S A;  2HXK A;  2MBS A;  1AQV A;  2H6Y A;  4OCE A;  2HZF A;  2ON5 A;  4PXO A;  2YP6 A;  5IM9 A;  3HD5 A;  1O6J A;  1UVZ A;  4KH7 A;  2DJ0 A;  4DSS B;  4HU9 A;  2GQL A;  3J7Y k;  4GST A;  1TKD B;  2IIY A;  2UZ8 A;  2DMM A;  1THO A;  2HI7 A;  3BOA A;  3ERF A;  3QOU A;  4GXZ A;  2H66 A;  3TKS E;  5F07 A;  1SK1 A;  3TKQ A;  3ZZX A;  3C1R A;  1PA3 A;  17GS A;  4MZW A;  1PRX A;  4V1A g;  11GS A;  1SYX A;  2B7J A;  1JZW A;  3VWV A;  2LKU A;  3IAS 2;  4I8B A;  2VL2 C;  5COH A;  1RK4 A;  2CVB A;  1Z7P A;  2I3Y A;  4ZL7 A;  4XRA A;  2L5L A;  3IC8 A;  1OKD A;  4MZC A;  1PQN A;  3TRX A;  4QL7 A;  2IFQ A;  1O81 A;  6GSV A;  1Q98 A;  2H6Z A;  3L9S A;  4TVE A;  5A5K A;  3H79 A;  4GQF A;  2B5E A;  4ZIL A;  5B8A A;  1EGR A;  2PVO C;  3EWL A;  5EY6 A;  1G7E A;  1SD9 A;  4EE0 A;  4PUF C;  1YKC A;  1MEK A;  1W89 A;  1ZMA A;  4XTS A;  1T4Z A;  4HUA A;  5EPF A;  4L8E A;  2I9H A;  2WB9 A;  2C8U A;  2GT5 A;  1SJZ A;  1GTI A;  1GNW A;  4V2L A;  4V2N A;  2H75 A;  3G7Y A;  2IFQ B;  3G7I A;  2RII A;  4NMU A;  1A2L A;  2KHP A;  2DIZ A;  3TCO A;  1F37 A;  2DSA A;  5D9X A;  1O8W A;  1VGL A;  4JZQ A;  1WOU A;  5GST A;  4EKZ A;  2AHE A;  5KN1 A;  1WIK A;  4GWR A;  1THX A;  1XVW A;  4ZL9 A;  1O7U A;  2KP1 A;  3CTF A;  3HJM A;  4IN0 A;  1KBN A;  5F06 A;  4L5L A;  4MP4 A;  5CAX A;  3HJO A;  3TJK A;  2MMN A;  1PX6 A;  4OD7 A;  4HJM A;  5IPH A;  3GH6 A;  4TRX A;  3QDN A;  3MDK A;  1GUH A;  5DAL A;  1E2Y A;  6GSY A;  5AN1 A;  1ZOF A;  3UEM A;  3HKR A;  1DE2 A;  3KEB A;  3DD3 A;  5J4U A;  1A2J A;  3P8W A;  4YAP A;  2FLS A;  4KF9 A;  2GVP A;  2H19 A;  4EXJ A;  2TRC P;  1EOG A;  2B1L A;  4MPF A;  3D21 A;  1VRS D;  2IPA A;  4L5O A;  4MF5 A;  3KMO A;  5HR3 A;  4WR4 A;  2OKA A;  3GST A;  3GKM A;  2H6X A;  3D4T A;  4ECB A;  2B3S A;  2O7K A;  3GNJ A;  3G7J A;  3FHK A;  4J56 E;  4TR3 A;  2C0F A;  1X9S B;  2K18 A;  3APO A;  4FYC A;  4OCF A;  4G19 A;  2JZT A;  4KSM A;  1W4V A;  2GSS A;  1TJD A;  1T8E B;  4ML1 A;  1J9B A;  1XWC A;  3FRC A;  4N0V A;  1OYJ A;  4GLT A;  2O87 A;  2LNS A;  4N0Z A;  4NWY A;  1T1V A;  4PX1 A;  5ELG A;  2IMK A;  3EMP A;  4AJ7 A;  4BL7 B;  4IJI A;  4WR5 A;  1JZD A;  2N5A A;  1O85 A;  2HLS A;  3A2W A;  3QR6 A;  1ZYE A;  4OO5 A;  1B4P A;  2VIM A;  2CAI A;  2BTO T;  3H8Q A;  5D9W A;  1GTA A;  3F3R A;  1R7H A;  5GZZ B;  4MDC A;  5F05 A;  3ZIT A;  4I5Q A;  2LNT A;  4BPY A;  1ZCP A;  4Z7X A;  5G5F A;  4L0U A;  3EUR A;  2E2G A;  3IOS A;  1Z9H A;  19GS A;  1FG4 A;  1AQX A;  4OWY A;  4K0N A;  4WF5 A;  1SK0 A;  4POL A;  10GS A;  1MD3 A;  1VF3 A;  1XWG A;  5EVO A;  1JLW A;  2N5B A;  2MMA A;  4EO3 A;  5B6N A;  5HR0 A;  5HR1 A;  2RLI A;  1SYR A;  3W6G A;  5IMV A;  2CV4 A;  2OE3 A;  4G0L A;  2WRT A;  5B8B A;  3TOU A;  3FK8 A;  2X99 A;  2HZE A;  2K8V A;  1AAZ A;  2AB6 A;  1WJK A;  3TGZ A;  6GSX A;  1ERV A;  1TRV A;  2PU9 C;  4NV5 A;  1X9M B;  3UBL A;  2V41 A;  2H72 A;  5GAN D;  4PTS A;  3ISO A;  2VCT A;  2VLV A;  1PSQ A;  4KCE A;  5A4W A;  1C72 A;  2JSY A;  3NIV A;  1X5D A;  4Q5F A;  3BBY A;  2GQK A;  3ZML A;  2JAC A;  4ZIJ A;  3P2A A;  2WCI A;  2YV9 A;  1QQ2 A;  1MDK A;  4E8E A;  4PGT A;  2J9H A;  2F51 A;  4RQX A;  1PKW A;  2WGR A;  4AF2 A;  3LXZ A;  4MCU A;  3VWU A;  3VFI A;  4JR6 A;  5KEJ A;  1A8L A;  4YAV A;  2R5G A;  3C73 A;  4FYU A;  3U5R E;  5A4U A;  2NDO A;  4EDZ A;  3TJF A;  3FYG A;  1VF2 A;  4AJ6 A;  2CZ2 A;  3LJR A;  2FWF A;  2ZNM A;  2VL2 A;  4RQR A;  3V1W A;  1YKA A;  1OAZ A;  4NV2 A;  1YF0 A;  1VF1 A;  1QGV A;  1KEB A;  3KMN A;  2H01 A;  2WZ9 A;  4E8H A;  4IVF A;  4ECI A;  1K0B A;  3LOR A;  4MJE A;  3FEU A;  5AIS A;  3UOM A;  3NOF A;  3L78 A;  3IV4 A;  4TOP A;  5DJL A;  3HJP A;  1LU4 A;  4MAB A;  2PVQ A;  1ZYQ B;  1GSU A;  3PGT A;  4EUY A;  2L4Q A;  3CXG A;  1A0R P;  3EC3 A;  2H70 A;  1U3I A;  5F0G A;  2M80 A;  4QQ7 A;  2VCV A;  1N2A A;  4TR4 A;  4PNG A;  3CSJ A;  2B6M A;  1YQ1 A;  3FZA A;  2VOC A;  1LJR A;  2LJR A;  3U6V A;  2FHE A;  5JCU A;  1TI1 A;  1WP0 A;  2HSM A;  1FB6 A;  1WPI A;  5ID2 B;  2REM A;  3SBC A;  3GKN A;  3ZYW A;  1PX7 A;  3ZL5 A;  3ZTL A;  2VL9 A;  1T7P B;  2E7P A;  2LUS A;  2FA4 A;  20GS A;  2LRC A;  2LJK A;  2CVK A;  4KDU A;  2C4J A;  5HFG A;  5GAP D;  1AXD A;  3F6F A;  1K0O A;  2LV3 A;  2XC2 A;  1G7O A;  2GQM A;  2P5R A;  2B5X A;  3OR5 A;  3QAV A;  4GRF A;  4MA9 A;  1M99 A;  3WT2 A;  3O3T A;  3QCP A;  4ACS A;  5CRE A;  1WRY A;  3QAG A;  3DRN A;  2DC5 A;  4HDE A;  2WFC A;  4KX4 A;  2HSH A;  4TR0 A;  1EV4 A;  4NHZ A;  1HYU A;  5IMZ A;  3A2V A;  1JFU A;  2C0E A;  2O89 A;  3ME8 A;  4XS1 A;  1GSS A;  1M9A A;  4HI7 A;  2NBS A;  4QL9 A;  2B7K A;  2MBT A;  5HQP A;  1OVN A;  1R26 A;  1GUM A;  3ZRD A;  1V9W A;  1TU7 A;  2R4V A;  2OE1 A;  2VCX A;  3CSH A;  3ERW A;  4RI6 A;  6GSU A;  2MMZ A;  2FA8 A;  5JWQ B;  2OAC A;  1JLV A;  1ZZY A;  4P3Y B;  1GNE A;  1UN2 A;  2QKE A;  2A4V A;  1TK8 B;  3FZ5 A;  4USS A;  3BCK A;  4PNF A;  1URM A;  4PQH A;  3UAP A;  3ZVJ D;  3A5W A;  3VWW A;  1GSF A;  1B9Y C;  2VLT A;  2PBJ A;  4K1F A;  4MK3 A;  1PKZ A;  2L4C A;  1GLP A;  4N10 A;  3ZLP A;  18GS A;  1X5E A;  1Y6E A;  2RM5 A;  3UMA A;  2G0F A;  1ABA A;  5ECO B;  5HFK A;  3HVV A;  3RPP A;  5ECS A;  1OC9 A;  1WWJ A;  3HZ8 A;  2K8S A;  2BMX A;  4WEY A;  1FO5 A;  4GQC A;  5D93 A;  4LMW A;  4NAX A;  1LBK A;  4JED A;  3FR9 A;  5DCG A;  4DEJ A;  4JU5 A;  1F2E A;  3WGD A;  2H74 A;  3Q18 A;  2LQQ A;  1U6T A;  3UJ1 A;  2FY6 A;  1ACV A;  3D4M A;  3ZMK A;  4TR1 A;  1OC9 B;  3IC4 A;  5J3R A;  5FT3 A;  3KCM A;  4HU7 A;  3LG6 A;  4AGS A;  2IMF A;  2LRT A;  4LMV A;  4MMM A;  4I2U A;  1XPV A;  1QFN A;  2YZU A;  1DBY A;  2WUL A;  3CSI A;  1X9W B;  2VD0 A;  4BWQ A;  3C8E A;  4G9H A;  1VF4 A;  4FO5 A;  5D8I A;  1USB A;  3FW2 A;  1AC1 A;  3KD0 A;  4TR1 B;  1FAA A;  4OMV A;  4LA1 A;  2CA8 A;  4KDX A;  2X8H A;  2X8C A;  2FUG 2;  3H4K A;  5IPG A;  4K8M A;  1PL2 A;  5IMA A;  3WYW A;  5GSS A;  4AJ8 A;  5IMC A;  2OAD A;  2PER A;  5DDL A;  5IQY A;  1R5P A;  3J7Y b;  2VUP A;  2YAN A;  4YQU A;  1OC8 A;  2H71 A;  2OA7 A;  4F0C A;  3IR4 A;  1TRW A;  4BVX A;  4XCS A;  1Z6N A;  5DAK A;  3EMX A;  1K3O A;  1TK0 B;  4O32 A;  5D73 A;  2IME A;  3TKS C;  1EV9 A;  3D0Z A;  2NPB A;  4LLR A;  2CQ9 A;  3APS A;  3UBK A;  3KIJ A;  5A4V A;  2VCW A;  1SKS B;  2KLX A;  3F8U A;  1U88 A;  5JCW A;  3I9V 2;  2YCD A;  2V1M A;  4WET A;  1CQG A;  2V2G A;  3ZRE A;  4XS4 A;  3Q74 A;  4BVX B;  2KP2 A;  5DAK B;  2C80 A;  1YEP A;  5DAL B;  2XPE A;  4IQA A;  4KE3 A;  2LJA A;  4PQI A;  3IBH A;  1J0F A;  2DBC A;  2YPM A;  1XWK A;  1S3C A;  1OE8 A;  1V40 A;  1GH2 A;  2L6C A;  1ST9 A;  2CX4 A;  2TRX A;  2RUE A;  4IP6 A;  2GSQ A;  1XXU A;  3RDW A;  1HNB A;  4XS4 B;  4FQU A;  3IAM 2;  1XWA A;  1A8Y A;  1M2B A;  4V1A p;  2FNO A;  3IK9 A;  4IW9 A;  4PQ1 A;  1ON4 A;  1TDI A;  3KP9 A;  5AIX A;  4ZB9 A;  1BAY A;  5IO2 A;  2ES7 A;  3HHV A;  1K0A A;  3P90 A;  4KSO A;  3D6I A;  3GIX A;  3KP8 A;  4HJ2 A;  4JE1 A;  2GS3 A;  4MH2 A;  3MWH A;  3BCI A;  1TP9 A;  2M46 A;  4JBB A;  2JL4 A;  2JZR A;  4KGI A;  5G5E A;  4KW6 A;  2P5Q A;  1XFL A;  2GLR A;  1NHY A;  4KUN A;  3IRA A;  4POM A;  4ECJ A;  2IN3 A;  4F82 A;  2VD1 A;  1J08 A;  2ZUP A;  1FHE A;  2K9F A;  1ZGN A;  3QFA C;  4PUR A;  3KM6 A;  1A23 A;  2C0G A;  4ID0 A;  2EIR A;  4F2I A;  3BJ5 A;  2AJQ B;  4K0G A;  2MYG A;  3F4S A;  3GV1 A;  5D9V A;  5JWR B;  2L57 A;  5IOW A;  22GS A;  4KCA A;  3GFK A;  4IP1 A;  1GUL A;  3DKS A;  4ECC A;  1WMJ A;  3ZFB A;  2L5O A;  3EU3 A;  4MJB A;  2YWO A;  3P7X A;  1EP8 A;  4Q5N A;  4MF6 A;  1UC7 A;  1NW2 A;  3TUE A;  3IHQ A;  5CO3 A;  4N11 A;  2ZCT A;  1OE7 A;  4MH3 A;  3UAR A;  3I69 A;  3QAW A;  2LQO A;  1BED A;  5FHI A;  1T00 A;  12GS A;  1RQM A;  1S3A A;  4Q5Q A;  2H1A A;  2HZE B;  2C0D A;  6GST A;  2YZH A;  1FW1 A;  2IMD A;  3US3 A;  3IE3 A;  3W8J A;  3IA1 A;  2P0G A;  3EVI A;  1GSE A;  2YWN A;  4H86 A;  3UIW A;  3IPZ A;  4FYB A;  3D22 A;  5C00 A;  4Q5R A;  3IK7 A;  1YF1 A;  2J23 A;  4MJC A;  1EEM A;  1V98 A;  4WF4 A;  4IHU A;  3GHA A;  4ZBA A;  5B7C A;  3LYP A;  4K6X A;  5CP1 A;  3RHC A;  2B5Y A;  4GCI A;  1PN9 A;  3RHB A;  1K0D A;  3R3E A;  2GZY A;  3DIE A;  4O5R A;  1SKR B;  3LFL A;  2VM2 A;  2K6V A;  3VI5 A;  1XVQ A;  3O6T A;  3TJJ A;  2C3T A;  1Q4J A;  1UA5 A;  5ELA A;  1MDJ A;  4J2F A;  3F0I A;  3EIN A;  1NHO A;  3W8S A;  2PWJ A;  4BA7 A;  1XCC A;  1OC3 A;  1BX9 A;  2NTO A;  4F9Z A;  13GS A;  6GSW A;  1HNC A;  1EZK A;  2YWM A;  2EIO A;  2TIR A;  2VAF A;  1DUG A;  4IBP A;  1YDK A;  2DJ2 A;  3H93 A;  1GSY A;  4MPG A;  1V2A A;  4KND A;  2H1G A;  2E2M A;  5ECQ B;  4J57 E;  3FR3 A;  1F3A A;  1PMT A;  3GN3 A;  3C1S A;  3FZ9 A;  2YWI A;  3DVW A;  3KH7 A;  1K3L A;  2Z9S A;  3BD2 A;  4MF7 A;  2H0H A;  2CZ3 A;  1PD2 1;  5LNK e;  2DIY A;  4K7I A;  2FWE A;  4K9Z A;  4NXI A;  1ML6 A;  1Z7R A;  4NPB A;  4WBJ A;  1TK5 B;  1IYI A;  4IKH A;  3D5J A;  3GMF A;  2VCQ A;  8GSS A;  4WBR D;  4KAE A;  3M8N A;  4WXT A;  1RW1 A;  5ECP B;  1BQ7 A;  4EDY A;  1XBS A;  3Q6O A;  2YJ7 A;  5ECI B;  1Y25 A;  3VPT A;  3HY2 A;  1B8X A;  1NSW A;  2FD3 A;  1TOF A;  3EU4 A;  5DQS A;  1F3B A;  2HRF A;  4GSN A;  2I1U A;  1SK2 A;  3TKS A;  1S3D A;  1TTZ A;  5JCG A;  1EGO A;  3H1N A;  5E4W A;  4MZB A;  3CTG A;  3F6D A;  2HSM B;  3CMI A;  3GH9 A;  2EIQ A;  3ZIJ A;  5DJM A;  4EL1 A;  5J9C A;  1EWX A;  1M7T A;  4ZBD A;  4ZB6 A;  5HR2 A;  5HFI A;  1R4W A;  2GZP A;  4YH2 A;  2AV4 A;  2MZC A;  3MNG A;  4GSS A;  3KZQ A;  1DE1 A;  5ECK B;  1ERU A;  4RI7 A;  2D2Z A;  2H0I A;  2QSI A;  4KB3 A;  1SU9 A;  2AUV A;  4ZL8 A;  3TJG A;  3HXS A;  1BJX A;  1NM3 A;  4I2T A;  3CYN A;  1EOH A;  1AUC A;  5G31 A;  2GSR A;  1SJ6 A;  4G0I A;  3LXT A;  2YN1 A;  1YY7 A;  2WDU A;  3VLN A;  4IS0 A;  2NVL A;  1GLQ A;  3L9V A;  1KNG A;  4TXV A;  4HZ4 A;  6GSS A;  3RAZ A;  4POB A;  3IXR A;  2V32 A;  2HRK A;  5ECL B;  2DLX A;  4HQS A;  7GSS A;  1EEJ A;  1TRU A;  4EVM A;  3FY7 A;  4XIH A;  1HNA A;  1TI3 A;  2PUK C;  1R5A A;  5ENU A;  3ERG A;  1GP1 A;  3MSZ A;  2FCH A;  2LEG A;  4DVC A;  5ECH B;  2FWG A;  5C04 A;  3GKK A;  2AAW A;  4GF0 A;  4O92 A;  4K7N A;  1QXH A;  4HEA 2;  2HT9 A;  1XW5 A;  1FOV A;  1M9B A;  4EC0 A;  2HE3 A;  4MLY A;  3N9J A;  1DSB A;  2CX3 A;  4LL4 B;  5IIZ A;  2HRK B;  3KGK A;  5CRH A;  2H1B A;  3VK9 A;  2HYX A;  3CRT A;  3ZIV A;  3GRX A;  3RPN A;  2PMT A;  4OFM A;  5D9T A;  2CVD A;  3DVX A;  3WD6 A;  1U87 A;  5G1L A;  2CT6 A;  3ME7 A;  2DJJ A;  3GL3 A;  1GSD A;  3GYK A;  4TN8 A;  4LL1 B;  1GRX A;  3GX8 A;  4TKY A;  1T3B A;  1TU8 A;  3JCM L;  3APQ A;  5CYY A;  3HDC A;  2GZZ A;  4OO4 A;  1JHB A;  3NZN A;  3I6A A;  5CNW A;  4G10 A;  5CRD A;  3N5O A;  1SD8 A;  2DJK A;  3TJB A;  4ZBB A;  2VCZ A;  2JZS A;  4IGJ A;  1GUK A;  4CW9 A;  1HQO A;  1Z3E A;  3DWV A;  2ALB A;  4MJA A;  2XBI A;  2C3N A;  4POK A;  3TDG A;  5D96 A;  1SJI A; 
#chains in the Genus database with same CATH topology
 1YEX A;  1MDI A;  3M0F A;  3DML A;  1SEN A;  4ZB8 A;  4KA0 A;  5DCH A;  1YJ6 A;  2B1K A;  3QMX A;  5B6M A;  2XPD A;  1G6Y A;  3LSZ A;  1QMV A;  1SL0 B;  3EPT A;  3LQ7 A;  3MIX A;  1G0T A;  2F3M A;  5J9B A;  5G2Z A;  5F8B A;  3KJY A;  4FIW A;  2GGT A;  4X0X A;  2F8A A;  3GL5 A;  1QUW A;  3WGX A;  1B4Q A;  9GSS A;  3F4T A;  3FKF A;  2YV7 A;  1XW9 A;  3GTU A;  3HA9 A;  3PR8 A;  4BL7 A;  4HOJ A;  4I6X A;  2O85 A;  1H75 A;  2FGX A;  4K2X A;  2QC7 A;  2L59 A;  4X43 A;  4ILF A;  2LS5 A;  2I4A A;  1GL8 A;  1X0R A;  3A2X A;  4K7O A;  5AIV A;  2H30 A;  1M2A A;  1MD4 A;  3LEF A;  1XOA A;  4TXO A;  4Z2T A;  2HSY A;  3GTU B;  3CBU A;  3DGQ A;  3PIN A;  3KTB A;  4JR4 A;  5EL8 A;  2I81 A;  2X8G A;  1V57 A;  2C3Q A;  5LCZ A;  3IDV A;  1QK8 A;  2C1Y A;  5G30 A;  1I1I P;  1PL1 A;  2WW1 A;  2BJX A;  3QD9 A;  3VPQ A;  4F03 A;  5J41 A;  4HSC X;  1G6W A;  2WS2 A;  1U3A A;  2A4H A;  3TOT A;  3UVH A;  3G9B A;  4JRR A;  1ERW A;  5BMU A;  3TKR A;  5H5R A;  4TXO B;  4CHS A;  2KOK A;  2IMI A;  2R6K A;  2JSZ A;  3GUS A;  3LWA A;  1FVK A;  4RUV A;  1I5G A;  1XOB A;  3FZ4 A;  3GA4 A;  3TRP A;  4L0W A;  4Z2U A;  3E9J B;  4K2D A;  3MAK A;  4XRD A;  2VL3 A;  4I97 A;  3PH9 A;  1XWB A;  3KXO A;  4IEL A;  2FWH A;  4D73 A;  3A3T A;  1SVM A;  5J47 A;  4AKX B;  1ILO A;  3VWX A;  2YOI A;  4XS6 A;  2R37 A;  2A2S A;  2GDR A;  1K0C A;  5BMU B;  3WGE A;  2CAQ A;  3PPU A;  3F63 A;  3M1G A;  4AKI A;  2P31 A;  2HRA A;  3GSS A;  3QFB C;  2EC4 A;  2RUF A;  3KH9 A;  5E59 A;  4IJ3 A;  1O8X A;  1T4Y A;  2DML A;  2EFC A;  1M0U A;  4NHW A;  1SKW B;  2IJY A;  3R2Q A;  4D73 B;  5H5S A;  1GTU A;  4G2E A;  5INY A;  2H1D A;  1JZO A;  3O76 A;  5IMD A;  3FR6 A;  1M2D A;  3TRQ A;  1ZL9 A;  2H0G A;  1SL2 B;  3F3Q A;  2DKI A;  3KTL A;  2LST A;  4G0K A;  2X4A A;  4BWS A;  2WVY A;  1KTE A;  5ECN B;  2DJ3 A;  5CRG A;  3Q19 A;  4BIK A;  3GKX A;  4O7H A;  3VI7 A;  3AY8 A;  4F0B A;  4EIP A;  2A2R A;  3HYP A;  1H4O A;  5JWO B;  5KN2 A;  2WVX A;  2V6O A;  1ZYN A;  2G2Q A;  2XBQ A;  3LGC A;  5DQY A;  1A0F A;  1TW9 A;  4ML6 A;  3ZFL A;  4HS1 A;  4YQM A;  1OKT A;  2OBI A;  2OBK A;  2HSN B;  3HVS A;  5L71 A;  4OFN A;  4ISD A;  2OE0 A;  1B9X C;  5IMF A;  3LYK A;  1Z6M A;  2GT6 A;  5DVB A;  2AYT A;  1FVJ A;  5DBQ A;  3DEX A;  2WJU A;  3ED3 A;  2WVX B;  2R2J A;  2X64 A;  5G1K A;  1B48 A;  3HCZ A;  2O8V B;  1GSQ A;  1AQW A;  2OJL A;  2L6D A;  1BYE A;  1MTC A;  2HRN A;  3WT1 A;  2N5F A;  3SWL A;  2EFE A;  3CWG A;  4ULX A;  4YQV A;  2E0Q A;  4GTU A;  4CDO A;  5H5Q A;  3L4N A;  2GST A;  1N8J A;  4OFT A;  3TKP A;  2XHF A;  3E0U A;  2VM1 A;  4WKW A;  4BVY A;  1PGT A;  1K3Y A;  4XHM A;  1A2M A;  2GTU A;  3M9K A;  2H76 A;  4TW5 A;  4N30 A;  2DJ1 A;  5LD0 A;  3RBT A;  1V58 A;  1ERT A;  1F9M A;  1XW6 A;  4X1U A;  3HZ4 A;  4KDY A;  4HQZ A;  1HD2 A;  2JAD A;  1Z5Y E;  3CRU A;  5ECM B;  5ID2 A;  1TRS A;  2F8F A;  2VLU A;  2PN8 A;  4DSQ A;  3L9U A;  2DKH A;  5ABR A;  3F9U A;  3DXB A;  5J5N A;  4EF0 A;  4PUA A;  5IO0 A;  4FH8 A;  3UVT A;  3M3M A;  3EYT A;  2M72 A;  4BVY B;  3EE2 A;  1I9D A;  1WE0 A;  3C71 A;  2IL3 A;  2JU5 A;  2MMO A;  14GS A;  4PHZ C;  3VUR A;  4AI6 A;  1AIU A;  3ZVJ A;  2V6K A;  3CHX C;  1BG1 A;  4ZXG A;  16GS A;  1YZX A;  3GX0 A;  5KN0 A;  2HQT A;  3M9J A;  5ECR B;  2R3X A;  3F4R A;  3K8N A;  2PPT A;  2A2P A;  2IWT A;  1IYH A;  3UL3 A;  2YJH A;  3L0H A;  1GTB A;  2EFH A;  3HVX A;  1AW9 A;  1FOH A;  5KN3 A;  1E6B A;  2LRN A;  1XZO A;  1FB0 A;  1F6M C;  1SL1 B;  4HZ2 A;  2LTK A;  2QGV A;  3S9F A;  3I43 A;  2H73 A;  3GUR A;  1TXX A;  1CQH A;  2ON7 A;  1EP7 A;  1X5C A;  4DSR A;  1K0N A;  4A5P A;  1GWC A;  2HFD A;  2VO4 A;  2H8L A;  4DSS A;  5CRW A;  1JZR A;  1O73 A;  2YNX A;  3C7M A;  1K0M A;  2HNL A;  2KUC A;  4IQ1 A;  4GDF A;  2RM6 A;  1A24 A;  3TB2 A;  3QPM A;  2PGT A;  5FWG A;  3E3E A;  5A34 A;  4V2M A;  3DYR A;  1BG5 A;  3TU3 B;  1XIY A;  5IOX A;  5AGY A;  2F9S A;  2HXK A;  2MBS A;  1AQV A;  2H6Y A;  4OCE A;  4EIQ A;  2HZF A;  2ON5 A;  4PXO A;  2YP6 A;  5IM9 A;  3CQF A;  3HD5 A;  1O6J A;  1UVZ A;  4KH7 A;  2DJ0 A;  4DSS B;  4HU9 A;  2GQL A;  3J7Y k;  4GST A;  1TKD B;  2IIY A;  2UZ8 A;  2DMM A;  1THO A;  2HI7 A;  3BOA A;  3ERF A;  3QOU A;  4GXZ A;  2H66 A;  3TKS E;  5A34 B;  5F07 A;  1SK1 A;  3TKQ A;  1S3R A;  3ZZX A;  3C1R A;  1PA3 A;  17GS A;  4MZW A;  1PRX A;  4V1A g;  11GS A;  1SYX A;  2B7J A;  1JZW A;  3VWV A;  2LKU A;  3IAS 2;  4I8B A;  2VL2 C;  5COH A;  1RK4 A;  2CVB A;  1Z7P A;  2I3Y A;  4ZL7 A;  4XRA A;  2L5L A;  3IC8 A;  1OKD A;  1YEW C;  2UV8 G;  4MZC A;  1PQN A;  3TRX A;  4QL7 A;  2IFQ A;  1O81 A;  6GSV A;  1Q98 A;  2H6Z A;  3L9S A;  4TVE A;  5A5K A;  3H79 A;  4GQF A;  2B5E A;  4ZIL A;  5B8A A;  1EGR A;  2PVO C;  3EWL A;  5EY6 A;  1G7E A;  1SD9 A;  4EE0 A;  4PUF C;  1YKC A;  1MEK A;  1W89 A;  1ZMA A;  4XTS A;  1T4Z A;  4HUA A;  5EPF A;  4L8E A;  2I9H A;  2WB9 A;  2C8U A;  2GT5 A;  1SJZ A;  1GTI A;  1GNW A;  4V2L A;  4V2N A;  2H75 A;  3G7Y A;  2IFQ B;  3G7I A;  2RII A;  4NMU A;  2R0P A;  1A2L A;  2KHP A;  2DIZ A;  3TCO A;  2QA2 A;  1F37 A;  2DSA A;  5D9X A;  1O8W A;  1VGL A;  4JZQ A;  1WOU A;  5GST A;  4EKZ A;  2AHE A;  5KN1 A;  1WIK A;  4GWR A;  1THX A;  1XVW A;  4ZL9 A;  1O7U A;  2KP1 A;  3CTF A;  2WW0 A;  3HJM A;  4IN0 A;  1KBN A;  5F06 A;  4L5L A;  4MP4 A;  5CAX A;  3HJO A;  3TJK A;  2MMN A;  1PX6 A;  4OD7 A;  4HJM A;  4K5S A;  5IPH A;  3GH6 A;  4TRX A;  3QDN A;  3MDK A;  1GUH A;  5DAL A;  1E2Y A;  6GSY A;  5AN1 A;  1ZOF A;  3UEM A;  3HKR A;  1DE2 A;  3KEB A;  3DD3 A;  5J4U A;  1A2J A;  3P8W A;  4YAP A;  2FLS A;  4KF9 A;  2GVP A;  2H19 A;  4EXJ A;  2TRC P;  1EOG A;  2B1L A;  4MPF A;  3D21 A;  1VRS D;  2IPA A;  4L5O A;  4MF5 A;  3KMO A;  5HR3 A;  4WR4 A;  2OKA A;  3GST A;  3GKM A;  2H6X A;  2O3E A;  3D4T A;  4ECB A;  2B3S A;  2O7K A;  3GNJ A;  3G7J A;  3FHK A;  4J56 E;  4TR3 A;  2C0F A;  1X9S B;  2K18 A;  3APO A;  4FYC A;  4OCF A;  4G19 A;  2JZT A;  4KSM A;  1W4V A;  2GSS A;  1TJD A;  1T8E B;  4ML1 A;  1J9B A;  1XWC A;  3FRC A;  4N0V A;  1OYJ A;  4GLT A;  2O87 A;  2LNS A;  4N0Z A;  4NWY A;  1T1V A;  4PX1 A;  5ELG A;  2IMK A;  3EMP A;  4AJ7 A;  4BL7 B;  4IJI A;  4WR5 A;  1JZD A;  2N5A A;  1O85 A;  2HLS A;  4CY6 A;  3A2W A;  3QR6 A;  1ZYE A;  4X4J A;  4OO5 A;  1B4P A;  2VIM A;  2CAI A;  2BTO T;  3H8Q A;  5D9W A;  1GTA A;  3F3R A;  1R7H A;  5GZZ B;  4MDC A;  5F05 A;  3ZIT A;  4I5Q A;  2LNT A;  4BPY A;  1ZCP A;  4Z7X A;  5G5F A;  4L0U A;  3EUR A;  2E2G A;  3IOS A;  1Z9H A;  19GS A;  1FG4 A;  1AQX A;  4OWY A;  4K0N A;  4WF5 A;  1SK0 A;  4POL A;  10GS A;  1MD3 A;  1VF3 A;  1XWG A;  5EVO A;  1JLW A;  2N5B A;  2MMA A;  4EO3 A;  5B6N A;  5HR0 A;  5HR1 A;  2RLI A;  1SYR A;  3W6G A;  5IMV A;  2CV4 A;  2OE3 A;  4G0L A;  2WRT A;  5B8B A;  3TOU A;  1N25 A;  3FK8 A;  2X99 A;  2HZE A;  1TXU A;  2K8V A;  1AAZ A;  2AB6 A;  1WJK A;  3TGZ A;  6GSX A;  1ERV A;  1TRV A;  2PU9 C;  4NV5 A;  1X9M B;  3UBL A;  2V41 A;  2H72 A;  5GAN D;  4PTS A;  3ISO A;  2VCT A;  2VLV A;  1PSQ A;  4KCE A;  5A4W A;  1C72 A;  2JSY A;  3NIV A;  1X5D A;  4Q5F A;  3BBY A;  2GQK A;  3ZML A;  2JAC A;  4ZIJ A;  3P2A A;  2WCI A;  2YV9 A;  1QQ2 A;  1MDK A;  4E8E A;  4PGT A;  2J9H A;  2F51 A;  4RQX A;  1PKW A;  2WGR A;  3IHG A;  1Y1U A;  4AF2 A;  3LXZ A;  4MCU A;  3VWU A;  3VFI A;  4JR6 A;  5KEJ A;  1A8L A;  4YAV A;  2R5G A;  3C73 A;  4FYU A;  3U5R E;  2EFD A;  5A4U A;  2NDO A;  4EDZ A;  3TJF A;  3FYG A;  1VF2 A;  4AJ6 A;  2CZ2 A;  3LJR A;  2FWF A;  2ZNM A;  2VL2 A;  4RQR A;  3V1W A;  1YKA A;  1OAZ A;  4NV2 A;  1YF0 A;  4FXY P;  5A5H A;  1VF1 A;  1QGV A;  1KEB A;  1PN0 A;  2X49 A;  3KMN A;  2H01 A;  2WZ9 A;  4E8H A;  4IVF A;  4ECI A;  1K0B A;  4ICY A;  3LOR A;  4MJE A;  3FEU A;  5AIS A;  3UOM A;  3NOF A;  3L78 A;  3IV4 A;  4TOP A;  5DJL A;  3HJP A;  1LU4 A;  4MAB A;  2PVQ A;  1ZYQ B;  1GSU A;  5A5H B;  3PGT A;  4EUY A;  2L4Q A;  3CXG A;  1A0R P;  3EC3 A;  2H70 A;  2R0G A;  1U3I A;  5F0G A;  2M80 A;  4QQ7 A;  4K5R A;  2VCV A;  1N2A A;  1PFO A;  4TR4 A;  4PNG A;  3CSJ A;  2B6M A;  1YQ1 A;  3FZA A;  2VOC A;  1LJR A;  2LJR A;  3U6V A;  4YKG A;  2FHE A;  5JCU A;  1TI1 A;  1WP0 A;  2HSM A;  1FB6 A;  1WPI A;  5ID2 B;  2REM A;  3SBC A;  3GKN A;  3ZYW A;  1PX7 A;  3ZL5 A;  3ZTL A;  2VL9 A;  1T7P B;  2E7P A;  3RFR C;  2LUS A;  2FA4 A;  20GS A;  2LRC A;  2LJK A;  2CVK A;  4KDU A;  2C4J A;  2O5V A;  5HFG A;  4MNN A;  5GAP D;  1AXD A;  3F6F A;  1K0O A;  2LV3 A;  2XC2 A;  1G7O A;  2GQM A;  2P5R A;  2B5X A;  3OR5 A;  3QAV A;  4GRF A;  5J40 A;  4MA9 A;  1M99 A;  3WT2 A;  3O3T A;  2OT3 A;  3QCP A;  4ACS A;  5CRE A;  1WRY A;  3QAG A;  3DRN A;  2DC5 A;  4HDE A;  2WFC A;  4KX4 A;  2HSH A;  4TR0 A;  1EV4 A;  4NHZ A;  1HYU A;  5IMZ A;  3A2V A;  1JFU A;  2C0E A;  2O89 A;  3FMW A;  3ME8 A;  4XS1 A;  1GSS A;  5BRT A;  1M9A A;  4HI7 A;  2NBS A;  4QL9 A;  2B7K A;  2MBT A;  5HQP A;  1OVN A;  1R26 A;  1GUM A;  3ZRD A;  1V9W A;  1TU7 A;  2R4V A;  2OE1 A;  2VCX A;  4PI2 C;  3CSH A;  3ERW A;  4RI6 A;  6GSU A;  2MMZ A;  2FA8 A;  5JWQ B;  2OAC A;  1JLV A;  1ZZY A;  4P3Y B;  1GNE A;  1UN2 A;  2QKE A;  2A4V A;  1TK8 B;  3FZ5 A;  4USS A;  3BCK A;  4PNF A;  1URM A;  4PQH A;  3UAP A;  3ZVJ D;  4G01 A;  4AKH A;  3A5W A;  3VWW A;  1GSF A;  1B9Y C;  2H1L A;  2VLT A;  2PBJ A;  4K1F A;  4MK3 A;  1PKZ A;  2L4C A;  1GLP A;  4N10 A;  3ZLP A;  18GS A;  1X5E A;  1Y6E A;  2RM5 A;  3UMA A;  2G0F A;  1ABA A;  5ECO B;  5HFK A;  3HVV A;  3RPP A;  5ECS A;  1OC9 A;  1WWJ A;  3HZ8 A;  2K8S A;  3MYD A;  4O5Q A;  2BMX A;  4WEY A;  1FO5 A;  4GQC A;  5D93 A;  4LMW A;  4NAX A;  1LBK A;  4JED A;  3FR9 A;  5DCG A;  4DEJ A;  4JU5 A;  1F2E A;  3WGD A;  2H74 A;  3Q18 A;  2LQQ A;  4O5U A;  1U6T A;  3UJ1 A;  2FY6 A;  1ACV A;  3D4M A;  3ZMK A;  4TR1 A;  1OC9 B;  3IC4 A;  5J3R A;  5FT3 A;  3KCM A;  2O36 A;  4HU7 A;  3LG6 A;  4AGS A;  2IMF A;  2LRT A;  4LMV A;  4MMM A;  4I2U A;  1XPV A;  1QFN A;  1BF5 A;  2YZU A;  1DBY A;  2WUL A;  3CSI A;  1X9W B;  2VD0 A;  4BWQ A;  3C8E A;  4G9H A;  1VF4 A;  4FO5 A;  5D8I A;  1USB A;  3FW2 A;  1AC1 A;  3KD0 A;  2VKZ G;  4TR1 B;  1FAA A;  4OMV A;  4LA1 A;  2CA8 A;  4KDX A;  2X8H A;  2X8C A;  2FUG 2;  3H4K A;  5IPG A;  4K8M A;  2R0C A;  1PL2 A;  5IMA A;  3WYW A;  5GSS A;  4AJ8 A;  5IMC A;  2OAD A;  2PER A;  5DDL A;  5IQY A;  4ZB7 A;  3RGB C;  1R5P A;  3J7Y b;  2VUP A;  2YAN A;  4YQU A;  1OC8 A;  2H71 A;  2OA7 A;  4F0C A;  3IR4 A;  1TRW A;  4BVX A;  4XCS A;  1Z6N A;  5DAK A;  3EMX A;  1K3O A;  1ZYP A;  1TK0 B;  4O32 A;  5D73 A;  2IME A;  3TKS C;  1EV9 A;  3D0Z A;  2NPB A;  4LLR A;  2CQ9 A;  3APS A;  3UBK A;  3KIJ A;  5A4V A;  2VCW A;  1SKS B;  2KLX A;  3F8U A;  1U88 A;  5JCW A;  3I9V 2;  2YCD A;  2V1M A;  4WET A;  1CQG A;  2V2G A;  3ZRE A;  4XS4 A;  3Q74 A;  4BVX B;  2KP2 A;  5DAK B;  2C80 A;  1YEP A;  5DAL B;  2XPE A;  4IQA A;  4KE3 A;  2LJA A;  4PQI A;  3IBH A;  1S4B P;  1J0F A;  2DBC A;  2YPM A;  1XWK A;  1S3C A;  1OE8 A;  1V40 A;  1GH2 A;  2L6C A;  1ST9 A;  2CX4 A;  2TRX A;  2RUE A;  4PI0 C;  2GSQ A;  4IP6 A;  1XXU A;  3RDW A;  1HNB A;  4XS4 B;  4FQU A;  3IAM 2;  1XWA A;  1A8Y A;  1M2B A;  4V1A p;  2FNO A;  3IK9 A;  4IW9 A;  4PQ1 A;  1ON4 A;  1TDI A;  3KP9 A;  5AIX A;  4ZB9 A;  1BAY A;  4Z2R A;  3LW9 A;  5IO2 A;  2ES7 A;  3HHV A;  1K0A A;  3P90 A;  4KSO A;  3D6I A;  3GIX A;  3KP8 A;  1XG8 A;  4HJ2 A;  4JE1 A;  2GS3 A;  4MH2 A;  3MWH A;  3BCI A;  1TP9 A;  2M46 A;  4JBB A;  2JL4 A;  1M3J A;  2JZR A;  4KGI A;  5G5E A;  4KW6 A;  2P5Q A;  1XFL A;  2GLR A;  1NHY A;  4KUN A;  3IRA A;  4POM A;  4ECJ A;  2IN3 A;  4F82 A;  2VD1 A;  1J08 A;  2ZUP A;  1FHE A;  2K9F A;  1ZGN A;  3QFA C;  5J4Y A;  4PUR A;  3KM6 A;  1A23 A;  2C0G A;  4ID0 A;  2EIR A;  4F2I A;  3BJ5 A;  5J4V A;  2AJQ B;  4K0G A;  2MYG A;  3F4S A;  3GV1 A;  5D9V A;  5JWR B;  2L57 A;  5IOW A;  22GS A;  4KCA A;  3GFK A;  4IP1 A;  1GUL A;  3DKS A;  4ECC A;  1WMJ A;  3ZFB A;  2L5O A;  3EU3 A;  1M3I A;  4MJB A;  2YWO A;  3P7X A;  1EP8 A;  4Q5N A;  3HMJ G;  4MF6 A;  1UC7 A;  1NW2 A;  3TUE A;  3IHQ A;  5CO3 A;  4N11 A;  2ZCT A;  1OE7 A;  4MH3 A;  3UAR A;  4QMK A;  3I69 A;  3QAW A;  2LQO A;  1BED A;  5FHI A;  1T00 A;  12GS A;  1RQM A;  1S3A A;  4Q5Q A;  4AKG A;  2WVZ A;  2H1A A;  2HZE B;  2C0D A;  6GST A;  4E68 A;  2YZH A;  1FW1 A;  2IMD A;  3US3 A;  3IE3 A;  3W8J A;  2WW2 A;  3IA1 A;  2P0G A;  5KOX A;  3EVI A;  2WW3 A;  1GSE A;  2YWN A;  3HVN A;  2HSN A;  4H86 A;  3UIW A;  3IPZ A;  4FYB A;  3D22 A;  5C00 A;  4Q5R A;  3IK7 A;  1YF1 A;  2J23 A;  4MJC A;  1EEM A;  1V98 A;  4WF4 A;  4IHU A;  3GHA A;  4ZBA A;  5B7C A;  3LYP A;  4K6X A;  5CP1 A;  3RHC A;  2B5Y A;  4GCI A;  2WZS A;  1PN9 A;  2QA1 A;  3RHB A;  1K0D A;  3R3E A;  2GZY A;  3DIE A;  4O5R A;  1SKR B;  3LFL A;  2VM2 A;  2K6V A;  3VI5 A;  1XVQ A;  3O6T A;  3TJJ A;  2C3T A;  1Q4J A;  1UA5 A;  5ELA A;  1MDJ A;  4J2F A;  3F0I A;  3EIN A;  1NHO A;  3W8S A;  1SVO A;  2PWJ A;  4BA7 A;  1XCC A;  1OC3 A;  1BX9 A;  2NTO A;  4F9Z A;  13GS A;  6GSW A;  1HNC A;  1EZK A;  2YWM A;  2EIO A;  2TIR A;  2VAF A;  1DUG A;  4IBP A;  1YDK A;  2DJ2 A;  3H93 A;  1GSY A;  4MPG A;  1V2A A;  4KND A;  2H1G A;  2E2M A;  5ECQ B;  4J57 E;  3FR3 A;  1F3A A;  1PMT A;  3GN3 A;  3C1S A;  3FZ9 A;  2YWI A;  3DVW A;  3KH7 A;  4CY8 A;  1K3L A;  2Z9S A;  3BD2 A;  4MF7 A;  2H0H A;  2CZ3 A;  1PD2 1;  5LNK e;  2DIY A;  4K7I A;  2FWE A;  4K9Z A;  4NXI A;  1ML6 A;  1Z7R A;  4NPB A;  4WBJ A;  1TK5 B;  1IYI A;  4IKH A;  3D5J A;  3GMF A;  2VCQ A;  8GSS A;  4WBR D;  4KAE A;  3M8N A;  4WXT A;  1RW1 A;  4N3Z A;  5ECP B;  1BQ7 A;  4EDY A;  1XBS A;  3Q6O A;  2YJ7 A;  5ECI B;  1Y25 A;  3VPT A;  3HY2 A;  1B8X A;  1NSW A;  2FD3 A;  1TOF A;  3EU4 A;  5DQS A;  1F3B A;  2HRF A;  4GSN A;  2I1U A;  1SK2 A;  3TKS A;  1S3D A;  1TTZ A;  5JCG A;  1EGO A;  3H1N A;  5E4W A;  4MZB A;  3CTG A;  3F6D A;  2HSM B;  3CMI A;  3GH9 A;  2EIQ A;  3ZIJ A;  1YVL A;  3A5I A;  5DJM A;  4EL1 A;  5J9C A;  1EWX A;  1M7T A;  4ZBD A;  4ZB6 A;  5HR2 A;  5KOW A;  5HFI A;  1R4W A;  2GZP A;  4YH2 A;  2AV4 A;  2MZC A;  3MNG A;  4GSS A;  3KZQ A;  1DE1 A;  5ECK B;  1ERU A;  4RI7 A;  2D2Z A;  2H0I A;  2QSI A;  4KB3 A;  1SU9 A;  2AUV A;  4ZL8 A;  3TJG A;  3HXS A;  1BJX A;  1NM3 A;  4I2T A;  3CYN A;  1EOH A;  1AUC A;  5G31 A;  2GSR A;  1SJ6 A;  4G0I A;  3LXT A;  2YN1 A;  1YY7 A;  2WDU A;  3VLN A;  4IS0 A;  2NVL A;  1GLQ A;  3L9V A;  1KNG A;  4TXV A;  4HZ4 A;  6GSS A;  3RAZ A;  4POB A;  3IXR A;  2V32 A;  2HRK A;  5ECL B;  2DLX A;  4HQS A;  7GSS A;  1EEJ A;  1TRU A;  4EVM A;  3FY7 A;  4XIH A;  1HNA A;  1TI3 A;  2PUK C;  1R5A A;  5ENU A;  3ERG A;  4W66 A;  1GP1 A;  3MSZ A;  2FCH A;  2LEG A;  4YKF A;  5ECH B;  4DVC A;  2FWG A;  5C04 A;  3GKK A;  2AAW A;  4GF0 A;  4O92 A;  4K7N A;  1QXH A;  2HT9 A;  4HEA 2;  1XW5 A;  1FOV A;  1M9B A;  4EC0 A;  2HE3 A;  4MLY A;  3N9J A;  1DSB A;  2CX3 A;  4LL4 B;  5IIZ A;  2HRK B;  3KGK A;  5CRH A;  2H1B A;  3VK9 A;  2HYX A;  3CRT A;  3ZIV A;  3GRX A;  3RPN A;  2PMT A;  4OFM A;  5D9T A;  2CVD A;  3DVX A;  3WD6 A;  1U87 A;  5G1L A;  2CT6 A;  3ME7 A;  2DJJ A;  3GL3 A;  1GSD A;  3GYK A;  4TN8 A;  4LL1 B;  1GRX A;  3GX8 A;  4TKY A;  1T3B A;  1TU8 A;  3JCM L;  3APQ A;  5CYY A;  3HDC A;  2GZZ A;  4OO4 A;  1JHB A;  5A1N A;  3NZN A;  3I6A A;  5CNW A;  4G10 A;  5CRD A;  3N5O A;  1SD8 A;  1SVL A;  2DJK A;  3TJB A;  4ZBB A;  2VCZ A;  2JZS A;  4IGJ A;  1GUK A;  4CW9 A;  1HQO A;  1Z3E A;  3DWV A;  2ALB A;  4MJA A;  2XBI A;  2C3N A;  4POK A;  3TDG A;  5D96 A;  1SJI A;  5A1N B; 
#chains in the Genus database with same CATH homology
 1YEX A;  1MDI A;  3M0F A;  3DML A;  1SEN A;  4ZB8 A;  4KA0 A;  5DCH A;  1YJ6 A;  2B1K A;  3QMX A;  5B6M A;  2XPD A;  1G6Y A;  3LSZ A;  1QMV A;  1SL0 B;  3EPT A;  3LQ7 A;  3MIX A;  1G0T A;  2F3M A;  5J9B A;  5G2Z A;  5F8B A;  3KJY A;  4FIW A;  2GGT A;  4X0X A;  2F8A A;  3GL5 A;  1QUW A;  3WGX A;  1B4Q A;  9GSS A;  3F4T A;  3FKF A;  2YV7 A;  1XW9 A;  3GTU A;  3HA9 A;  3PR8 A;  4BL7 A;  4HOJ A;  4I6X A;  2O85 A;  1H75 A;  2FGX A;  4K2X A;  2QC7 A;  2L59 A;  4X43 A;  4ILF A;  2LS5 A;  2I4A A;  1GL8 A;  1X0R A;  3A2X A;  4K7O A;  5AIV A;  2H30 A;  1M2A A;  1MD4 A;  3LEF A;  1XOA A;  4TXO A;  4Z2T A;  2HSY A;  3GTU B;  3CBU A;  3DGQ A;  3PIN A;  3KTB A;  4JR4 A;  5EL8 A;  2I81 A;  2X8G A;  1V57 A;  2C3Q A;  5LCZ A;  3IDV A;  1QK8 A;  2C1Y A;  5G30 A;  1PL1 A;  2BJX A;  3QD9 A;  3VPQ A;  4F03 A;  5J41 A;  1G6W A;  2WS2 A;  1U3A A;  2A4H A;  3TOT A;  3UVH A;  3G9B A;  4JRR A;  1ERW A;  5BMU A;  3TKR A;  5H5R A;  4TXO B;  4CHS A;  2KOK A;  2IMI A;  2R6K A;  2JSZ A;  3GUS A;  3LWA A;  1FVK A;  4RUV A;  1I5G A;  1XOB A;  3FZ4 A;  3GA4 A;  3TRP A;  4L0W A;  4Z2U A;  3E9J B;  4K2D A;  3MAK A;  4XRD A;  2VL3 A;  4I97 A;  3PH9 A;  1XWB A;  3KXO A;  4IEL A;  2FWH A;  4D73 A;  3A3T A;  1SVM A;  5J47 A;  4AKX B;  1ILO A;  3VWX A;  2YOI A;  4XS6 A;  2R37 A;  2A2S A;  2GDR A;  1K0C A;  5BMU B;  3WGE A;  2CAQ A;  3PPU A;  3F63 A;  3M1G A;  4AKI A;  2P31 A;  2HRA A;  3GSS A;  3QFB C;  2EC4 A;  2RUF A;  3KH9 A;  5E59 A;  4IJ3 A;  1O8X A;  1T4Y A;  2DML A;  2EFC A;  1M0U A;  4NHW A;  1SKW B;  2IJY A;  3R2Q A;  4D73 B;  5H5S A;  1GTU A;  4G2E A;  5INY A;  2H1D A;  1JZO A;  3O76 A;  5IMD A;  3FR6 A;  1M2D A;  3TRQ A;  1ZL9 A;  2H0G A;  1SL2 B;  3F3Q A;  2DKI A;  3KTL A;  2LST A;  4G0K A;  2X4A A;  4BWS A;  1KTE A;  5ECN B;  2DJ3 A;  5CRG A;  3Q19 A;  3GKX A;  4O7H A;  3VI7 A;  3AY8 A;  4F0B A;  4EIP A;  2A2R A;  3HYP A;  1H4O A;  5JWO B;  5KN2 A;  2V6O A;  1ZYN A;  2G2Q A;  2XBQ A;  3LGC A;  5DQY A;  1A0F A;  1TW9 A;  4ML6 A;  3ZFL A;  4HS1 A;  4YQM A;  1OKT A;  2OBI A;  2OBK A;  2HSN B;  3HVS A;  5L71 A;  4OFN A;  4ISD A;  2OE0 A;  1B9X C;  5IMF A;  3LYK A;  1Z6M A;  2GT6 A;  5DVB A;  2AYT A;  1FVJ A;  5DBQ A;  3DEX A;  2WJU A;  3ED3 A;  2R2J A;  2X64 A;  5G1K A;  1B48 A;  3HCZ A;  2O8V B;  1GSQ A;  1AQW A;  2OJL A;  2L6D A;  1BYE A;  1MTC A;  2HRN A;  3WT1 A;  2N5F A;  3SWL A;  2EFE A;  3CWG A;  4ULX A;  4YQV A;  2E0Q A;  4GTU A;  4CDO A;  5H5Q A;  3L4N A;  2GST A;  1N8J A;  4OFT A;  3TKP A;  2XHF A;  3E0U A;  2VM1 A;  4WKW A;  4BVY A;  1PGT A;  1K3Y A;  4XHM A;  1A2M A;  2GTU A;  3M9K A;  2H76 A;  4TW5 A;  4N30 A;  2DJ1 A;  5LD0 A;  3RBT A;  1V58 A;  1ERT A;  1F9M A;  1XW6 A;  4X1U A;  3HZ4 A;  4KDY A;  4HQZ A;  1HD2 A;  2JAD A;  1Z5Y E;  3CRU A;  5ECM B;  5ID2 A;  1TRS A;  2F8F A;  2VLU A;  2PN8 A;  4DSQ A;  3L9U A;  2DKH A;  5ABR A;  3F9U A;  3DXB A;  5J5N A;  4EF0 A;  4PUA A;  5IO0 A;  4FH8 A;  3UVT A;  3M3M A;  3EYT A;  2M72 A;  4BVY B;  3EE2 A;  1I9D A;  1WE0 A;  3C71 A;  2IL3 A;  2JU5 A;  14GS A;  2MMO A;  3VUR A;  4AI6 A;  1AIU A;  3ZVJ A;  2V6K A;  1BG1 A;  4ZXG A;  16GS A;  1YZX A;  3GX0 A;  5KN0 A;  2HQT A;  3M9J A;  5ECR B;  2R3X A;  3F4R A;  3K8N A;  2PPT A;  2A2P A;  2IWT A;  1IYH A;  3UL3 A;  2YJH A;  3L0H A;  1GTB A;  2EFH A;  3HVX A;  1AW9 A;  1FOH A;  5KN3 A;  1E6B A;  2LRN A;  1XZO A;  1FB0 A;  1F6M C;  1SL1 B;  4HZ2 A;  2LTK A;  2QGV A;  3S9F A;  3I43 A;  2H73 A;  3GUR A;  1TXX A;  1CQH A;  2ON7 A;  1EP7 A;  1X5C A;  4DSR A;  1K0N A;  4A5P A;  1GWC A;  2HFD A;  2VO4 A;  2H8L A;  4DSS A;  5CRW A;  1JZR A;  1O73 A;  2YNX A;  3C7M A;  1K0M A;  2HNL A;  2KUC A;  4IQ1 A;  4GDF A;  2RM6 A;  1A24 A;  3TB2 A;  3QPM A;  2PGT A;  5FWG A;  3E3E A;  5A34 A;  4V2M A;  3DYR A;  1BG5 A;  3TU3 B;  1XIY A;  5IOX A;  5AGY A;  2F9S A;  2HXK A;  2MBS A;  1AQV A;  2H6Y A;  4OCE A;  4EIQ A;  2HZF A;  2ON5 A;  4PXO A;  2YP6 A;  5IM9 A;  3HD5 A;  1O6J A;  1UVZ A;  4KH7 A;  2DJ0 A;  4DSS B;  4HU9 A;  2GQL A;  3J7Y k;  4GST A;  1TKD B;  2IIY A;  2UZ8 A;  2DMM A;  1THO A;  2HI7 A;  3BOA A;  3ERF A;  3QOU A;  4GXZ A;  2H66 A;  3TKS E;  5A34 B;  5F07 A;  1SK1 A;  3TKQ A;  3ZZX A;  3C1R A;  1PA3 A;  17GS A;  4MZW A;  1PRX A;  4V1A g;  11GS A;  1SYX A;  2B7J A;  1JZW A;  3VWV A;  2LKU A;  3IAS 2;  4I8B A;  2VL2 C;  5COH A;  1RK4 A;  2CVB A;  1Z7P A;  2I3Y A;  4ZL7 A;  4XRA A;  2L5L A;  3IC8 A;  1OKD A;  2UV8 G;  4MZC A;  1PQN A;  3TRX A;  4QL7 A;  2IFQ A;  1O81 A;  6GSV A;  1Q98 A;  2H6Z A;  3L9S A;  4TVE A;  5A5K A;  3H79 A;  4GQF A;  2B5E A;  4ZIL A;  5B8A A;  1EGR A;  2PVO C;  3EWL A;  5EY6 A;  1G7E A;  1SD9 A;  4EE0 A;  4PUF C;  1YKC A;  1MEK A;  1W89 A;  1ZMA A;  4XTS A;  1T4Z A;  4HUA A;  5EPF A;  4L8E A;  2I9H A;  2WB9 A;  2C8U A;  2GT5 A;  1SJZ A;  1GTI A;  1GNW A;  4V2L A;  4V2N A;  2H75 A;  3G7Y A;  2IFQ B;  3G7I A;  2RII A;  4NMU A;  2R0P A;  1A2L A;  2KHP A;  2DIZ A;  3TCO A;  2QA2 A;  1F37 A;  2DSA A;  5D9X A;  1O8W A;  1VGL A;  4JZQ A;  1WOU A;  5GST A;  4EKZ A;  2AHE A;  5KN1 A;  1WIK A;  4GWR A;  1THX A;  1XVW A;  4ZL9 A;  1O7U A;  2KP1 A;  3CTF A;  3HJM A;  4IN0 A;  1KBN A;  5F06 A;  4L5L A;  4MP4 A;  5CAX A;  3HJO A;  3TJK A;  2MMN A;  1PX6 A;  4OD7 A;  4HJM A;  4K5S A;  5IPH A;  3GH6 A;  4TRX A;  3QDN A;  3MDK A;  1GUH A;  5DAL A;  1E2Y A;  6GSY A;  5AN1 A;  1ZOF A;  3UEM A;  3HKR A;  1DE2 A;  3KEB A;  3DD3 A;  5J4U A;  1A2J A;  3P8W A;  4YAP A;  2FLS A;  4KF9 A;  2GVP A;  2H19 A;  4EXJ A;  2TRC P;  1EOG A;  2B1L A;  4MPF A;  3D21 A;  1VRS D;  2IPA A;  4L5O A;  4MF5 A;  3KMO A;  5HR3 A;  4WR4 A;  2OKA A;  3GST A;  3GKM A;  2H6X A;  3D4T A;  4ECB A;  2B3S A;  2O7K A;  3GNJ A;  3G7J A;  3FHK A;  4J56 E;  4TR3 A;  2C0F A;  1X9S B;  2K18 A;  3APO A;  4FYC A;  4OCF A;  4G19 A;  2JZT A;  4KSM A;  1W4V A;  2GSS A;  1TJD A;  1T8E B;  4ML1 A;  1J9B A;  1XWC A;  3FRC A;  4N0V A;  1OYJ A;  4GLT A;  2O87 A;  2LNS A;  4N0Z A;  4NWY A;  1T1V A;  4PX1 A;  5ELG A;  2IMK A;  3EMP A;  4AJ7 A;  4BL7 B;  4IJI A;  4WR5 A;  1JZD A;  2N5A A;  1O85 A;  2HLS A;  4CY6 A;  3A2W A;  3QR6 A;  1ZYE A;  4X4J A;  4OO5 A;  1B4P A;  2VIM A;  2CAI A;  2BTO T;  3H8Q A;  5D9W A;  1GTA A;  3F3R A;  1R7H A;  5GZZ B;  4MDC A;  5F05 A;  3ZIT A;  4I5Q A;  2LNT A;  4BPY A;  1ZCP A;  4Z7X A;  5G5F A;  4L0U A;  3EUR A;  2E2G A;  3IOS A;  1Z9H A;  19GS A;  1FG4 A;  1AQX A;  4OWY A;  4K0N A;  4WF5 A;  1SK0 A;  4POL A;  10GS A;  1MD3 A;  1VF3 A;  1XWG A;  5EVO A;  1JLW A;  2N5B A;  2MMA A;  4EO3 A;  5B6N A;  5HR0 A;  5HR1 A;  2RLI A;  1SYR A;  3W6G A;  5IMV A;  2CV4 A;  2OE3 A;  4G0L A;  2WRT A;  5B8B A;  3TOU A;  1N25 A;  3FK8 A;  2X99 A;  2HZE A;  1TXU A;  2K8V A;  1AAZ A;  2AB6 A;  1WJK A;  3TGZ A;  6GSX A;  1ERV A;  1TRV A;  2PU9 C;  4NV5 A;  1X9M B;  3UBL A;  2V41 A;  2H72 A;  5GAN D;  4PTS A;  3ISO A;  2VCT A;  2VLV A;  1PSQ A;  4KCE A;  5A4W A;  1C72 A;  2JSY A;  3NIV A;  1X5D A;  4Q5F A;  3BBY A;  2GQK A;  3ZML A;  2JAC A;  4ZIJ A;  3P2A A;  2WCI A;  2YV9 A;  1QQ2 A;  1MDK A;  4E8E A;  4PGT A;  2J9H A;  2F51 A;  4RQX A;  1PKW A;  2WGR A;  3IHG A;  1Y1U A;  4AF2 A;  3LXZ A;  4MCU A;  3VWU A;  3VFI A;  4JR6 A;  5KEJ A;  1A8L A;  4YAV A;  2R5G A;  3C73 A;  4FYU A;  3U5R E;  2EFD A;  5A4U A;  2NDO A;  4EDZ A;  3TJF A;  3FYG A;  1VF2 A;  4AJ6 A;  2CZ2 A;  3LJR A;  2FWF A;  2ZNM A;  2VL2 A;  4RQR A;  3V1W A;  1YKA A;  1OAZ A;  4NV2 A;  1YF0 A;  5A5H A;  1VF1 A;  1QGV A;  1KEB A;  1PN0 A;  2X49 A;  3KMN A;  2H01 A;  2WZ9 A;  4E8H A;  4IVF A;  4ECI A;  1K0B A;  4ICY A;  3LOR A;  4MJE A;  3FEU A;  5AIS A;  3UOM A;  3NOF A;  3L78 A;  3IV4 A;  4TOP A;  5DJL A;  3HJP A;  1LU4 A;  4MAB A;  2PVQ A;  1ZYQ B;  1GSU A;  5A5H B;  3PGT A;  4EUY A;  2L4Q A;  3CXG A;  1A0R P;  3EC3 A;  2H70 A;  2R0G A;  1U3I A;  5F0G A;  2M80 A;  4QQ7 A;  4K5R A;  2VCV A;  1N2A A;  4TR4 A;  4PNG A;  3CSJ A;  2B6M A;  1YQ1 A;  3FZA A;  2VOC A;  1LJR A;  2LJR A;  3U6V A;  4YKG A;  2FHE A;  5JCU A;  1TI1 A;  1WP0 A;  2HSM A;  1FB6 A;  1WPI A;  5ID2 B;  2REM A;  3SBC A;  3GKN A;  3ZYW A;  1PX7 A;  3ZL5 A;  3ZTL A;  2VL9 A;  1T7P B;  2E7P A;  2LUS A;  2FA4 A;  20GS A;  2LRC A;  2LJK A;  2CVK A;  4KDU A;  2C4J A;  2O5V A;  5HFG A;  4MNN A;  5GAP D;  1AXD A;  3F6F A;  1K0O A;  2LV3 A;  2XC2 A;  1G7O A;  2GQM A;  2P5R A;  2B5X A;  3OR5 A;  3QAV A;  4GRF A;  5J40 A;  4MA9 A;  1M99 A;  3WT2 A;  3O3T A;  2OT3 A;  3QCP A;  4ACS A;  5CRE A;  1WRY A;  3QAG A;  3DRN A;  2DC5 A;  4HDE A;  2WFC A;  4KX4 A;  2HSH A;  4TR0 A;  1EV4 A;  4NHZ A;  1HYU A;  5IMZ A;  3A2V A;  1JFU A;  2C0E A;  2O89 A;  3FMW A;  3ME8 A;  4XS1 A;  1GSS A;  5BRT A;  1M9A A;  4HI7 A;  2NBS A;  4QL9 A;  2B7K A;  2MBT A;  5HQP A;  1OVN A;  1R26 A;  1GUM A;  3ZRD A;  1V9W A;  1TU7 A;  2R4V A;  2OE1 A;  2VCX A;  3CSH A;  3ERW A;  4RI6 A;  6GSU A;  2MMZ A;  2FA8 A;  5JWQ B;  2OAC A;  1JLV A;  1ZZY A;  4P3Y B;  1GNE A;  1UN2 A;  2QKE A;  2A4V A;  1TK8 B;  3FZ5 A;  4USS A;  3BCK A;  4PNF A;  1URM A;  4PQH A;  3UAP A;  3ZVJ D;  4G01 A;  4AKH A;  3A5W A;  3VWW A;  1GSF A;  1B9Y C;  2H1L A;  2VLT A;  2PBJ A;  4K1F A;  4MK3 A;  1PKZ A;  2L4C A;  1GLP A;  4N10 A;  3ZLP A;  18GS A;  1X5E A;  1Y6E A;  2RM5 A;  3UMA A;  2G0F A;  1ABA A;  5ECO B;  5HFK A;  3HVV A;  3RPP A;  5ECS A;  1OC9 A;  1WWJ A;  3HZ8 A;  2K8S A;  3MYD A;  4O5Q A;  2BMX A;  4WEY A;  1FO5 A;  4GQC A;  5D93 A;  4LMW A;  4NAX A;  1LBK A;  4JED A;  3FR9 A;  5DCG A;  4DEJ A;  4JU5 A;  1F2E A;  3WGD A;  2H74 A;  3Q18 A;  2LQQ A;  4O5U A;  1U6T A;  3UJ1 A;  2FY6 A;  1ACV A;  3D4M A;  3ZMK A;  4TR1 A;  1OC9 B;  3IC4 A;  5J3R A;  5FT3 A;  3KCM A;  4HU7 A;  3LG6 A;  4AGS A;  2IMF A;  2LRT A;  4LMV A;  4MMM A;  4I2U A;  1XPV A;  1QFN A;  1BF5 A;  2YZU A;  1DBY A;  2WUL A;  3CSI A;  1X9W B;  2VD0 A;  4BWQ A;  3C8E A;  4G9H A;  1VF4 A;  4FO5 A;  5D8I A;  1USB A;  3FW2 A;  1AC1 A;  3KD0 A;  2VKZ G;  4TR1 B;  1FAA A;  4OMV A;  4LA1 A;  2CA8 A;  4KDX A;  2X8H A;  2X8C A;  2FUG 2;  3H4K A;  5IPG A;  4K8M A;  2R0C A;  1PL2 A;  5IMA A;  3WYW A;  5GSS A;  4AJ8 A;  5IMC A;  2OAD A;  2PER A;  5DDL A;  5IQY A;  4ZB7 A;  1R5P A;  3J7Y b;  2VUP A;  2YAN A;  4YQU A;  1OC8 A;  2H71 A;  2OA7 A;  4F0C A;  3IR4 A;  1TRW A;  4BVX A;  4XCS A;  1Z6N A;  5DAK A;  3EMX A;  1K3O A;  1ZYP A;  1TK0 B;  4O32 A;  5D73 A;  2IME A;  3TKS C;  1EV9 A;  3D0Z A;  2NPB A;  4LLR A;  2CQ9 A;  3APS A;  3UBK A;  3KIJ A;  5A4V A;  2VCW A;  1SKS B;  2KLX A;  3F8U A;  1U88 A;  5JCW A;  3I9V 2;  2YCD A;  2V1M A;  4WET A;  1CQG A;  2V2G A;  3ZRE A;  4XS4 A;  3Q74 A;  4BVX B;  2KP2 A;  5DAK B;  2C80 A;  1YEP A;  5DAL B;  2XPE A;  4IQA A;  4KE3 A;  2LJA A;  4PQI A;  3IBH A;  1J0F A;  2DBC A;  2YPM A;  1XWK A;  1S3C A;  1OE8 A;  1V40 A;  1GH2 A;  2L6C A;  1ST9 A;  2CX4 A;  2TRX A;  2RUE A;  4IP6 A;  2GSQ A;  1XXU A;  3RDW A;  1HNB A;  4XS4 B;  4FQU A;  3IAM 2;  1XWA A;  1A8Y A;  1M2B A;  4V1A p;  2FNO A;  3IK9 A;  4IW9 A;  4PQ1 A;  1ON4 A;  1TDI A;  3KP9 A;  5AIX A;  4ZB9 A;  1BAY A;  4Z2R A;  3LW9 A;  5IO2 A;  2ES7 A;  3HHV A;  1K0A A;  3P90 A;  4KSO A;  3D6I A;  3GIX A;  3KP8 A;  4HJ2 A;  4JE1 A;  2GS3 A;  4MH2 A;  3MWH A;  3BCI A;  1TP9 A;  2M46 A;  4JBB A;  2JL4 A;  2JZR A;  4KGI A;  5G5E A;  4KW6 A;  2P5Q A;  1XFL A;  2GLR A;  1NHY A;  4KUN A;  3IRA A;  4POM A;  4ECJ A;  2IN3 A;  4F82 A;  2VD1 A;  1J08 A;  2ZUP A;  1FHE A;  2K9F A;  1ZGN A;  3QFA C;  5J4Y A;  4PUR A;  3KM6 A;  1A23 A;  2C0G A;  4ID0 A;  2EIR A;  4F2I A;  3BJ5 A;  5J4V A;  2AJQ B;  4K0G A;  2MYG A;  3F4S A;  3GV1 A;  5D9V A;  5JWR B;  2L57 A;  5IOW A;  22GS A;  4KCA A;  3GFK A;  4IP1 A;  1GUL A;  3DKS A;  4ECC A;  1WMJ A;  3ZFB A;  2L5O A;  3EU3 A;  4MJB A;  2YWO A;  3P7X A;  1EP8 A;  4Q5N A;  3HMJ G;  4MF6 A;  1UC7 A;  1NW2 A;  3TUE A;  3IHQ A;  5CO3 A;  4N11 A;  2ZCT A;  1OE7 A;  4MH3 A;  3UAR A;  4QMK A;  3I69 A;  3QAW A;  2LQO A;  1BED A;  5FHI A;  1T00 A;  12GS A;  1RQM A;  1S3A A;  4Q5Q A;  4AKG A;  2H1A A;  2HZE B;  2C0D A;  6GST A;  4E68 A;  2YZH A;  1FW1 A;  2IMD A;  3US3 A;  3IE3 A;  3W8J A;  3IA1 A;  2P0G A;  5KOX A;  3EVI A;  1GSE A;  2YWN A;  2HSN A;  4H86 A;  3UIW A;  3IPZ A;  4FYB A;  3D22 A;  5C00 A;  4Q5R A;  3IK7 A;  1YF1 A;  2J23 A;  4MJC A;  1EEM A;  1V98 A;  4WF4 A;  4IHU A;  3GHA A;  4ZBA A;  5B7C A;  3LYP A;  4K6X A;  5CP1 A;  3RHC A;  2B5Y A;  4GCI A;  1PN9 A;  2QA1 A;  3RHB A;  1K0D A;  3R3E A;  2GZY A;  3DIE A;  4O5R A;  1SKR B;  3LFL A;  2VM2 A;  2K6V A;  3VI5 A;  1XVQ A;  3O6T A;  3TJJ A;  2C3T A;  1Q4J A;  1UA5 A;  5ELA A;  1MDJ A;  4J2F A;  3F0I A;  3EIN A;  1NHO A;  3W8S A;  1SVO A;  2PWJ A;  4BA7 A;  1XCC A;  1OC3 A;  1BX9 A;  2NTO A;  4F9Z A;  13GS A;  6GSW A;  1HNC A;  1EZK A;  2YWM A;  2EIO A;  2TIR A;  2VAF A;  1DUG A;  4IBP A;  1YDK A;  2DJ2 A;  3H93 A;  1GSY A;  4MPG A;  1V2A A;  4KND A;  2H1G A;  2E2M A;  5ECQ B;  4J57 E;  3FR3 A;  1F3A A;  1PMT A;  3GN3 A;  3C1S A;  3FZ9 A;  2YWI A;  3DVW A;  3KH7 A;  4CY8 A;  1K3L A;  2Z9S A;  3BD2 A;  4MF7 A;  2H0H A;  2CZ3 A;  1PD2 1;  5LNK e;  2DIY A;  4K7I A;  2FWE A;  4K9Z A;  4NXI A;  1ML6 A;  1Z7R A;  4NPB A;  4WBJ A;  1TK5 B;  1IYI A;  4IKH A;  3D5J A;  3GMF A;  2VCQ A;  8GSS A;  4WBR D;  4KAE A;  3M8N A;  4WXT A;  1RW1 A;  4N3Z A;  5ECP B;  1BQ7 A;  4EDY A;  1XBS A;  3Q6O A;  2YJ7 A;  5ECI B;  1Y25 A;  3VPT A;  3HY2 A;  1B8X A;  1NSW A;  2FD3 A;  1TOF A;  3EU4 A;  5DQS A;  1F3B A;  2HRF A;  4GSN A;  2I1U A;  1SK2 A;  3TKS A;  1S3D A;  1TTZ A;  5JCG A;  1EGO A;  3H1N A;  5E4W A;  4MZB A;  3CTG A;  3F6D A;  2HSM B;  3CMI A;  3GH9 A;  2EIQ A;  3ZIJ A;  1YVL A;  3A5I A;  5DJM A;  4EL1 A;  5J9C A;  1EWX A;  1M7T A;  4ZBD A;  4ZB6 A;  5HR2 A;  5KOW A;  5HFI A;  1R4W A;  2GZP A;  4YH2 A;  2AV4 A;  2MZC A;  3MNG A;  4GSS A;  3KZQ A;  1DE1 A;  5ECK B;  1ERU A;  4RI7 A;  2D2Z A;  2H0I A;  2QSI A;  4KB3 A;  1SU9 A;  2AUV A;  4ZL8 A;  3TJG A;  3HXS A;  1BJX A;  1NM3 A;  4I2T A;  3CYN A;  1EOH A;  1AUC A;  5G31 A;  2GSR A;  1SJ6 A;  4G0I A;  3LXT A;  2YN1 A;  1YY7 A;  2WDU A;  3VLN A;  4IS0 A;  2NVL A;  1GLQ A;  3L9V A;  1KNG A;  4TXV A;  4HZ4 A;  6GSS A;  3RAZ A;  4POB A;  3IXR A;  2V32 A;  2HRK A;  5ECL B;  2DLX A;  4HQS A;  7GSS A;  1EEJ A;  1TRU A;  4EVM A;  3FY7 A;  4XIH A;  1HNA A;  1TI3 A;  2PUK C;  1R5A A;  5ENU A;  3ERG A;  4W66 A;  1GP1 A;  3MSZ A;  2FCH A;  2LEG A;  4YKF A;  5ECH B;  4DVC A;  2FWG A;  5C04 A;  3GKK A;  2AAW A;  4GF0 A;  4O92 A;  4K7N A;  1QXH A;  2HT9 A;  4HEA 2;  1XW5 A;  1FOV A;  1M9B A;  4EC0 A;  2HE3 A;  4MLY A;  3N9J A;  1DSB A;  2CX3 A;  4LL4 B;  5IIZ A;  2HRK B;  3KGK A;  5CRH A;  2H1B A;  3VK9 A;  2HYX A;  3CRT A;  3ZIV A;  3GRX A;  3RPN A;  2PMT A;  4OFM A;  5D9T A;  2CVD A;  3DVX A;  3WD6 A;  1U87 A;  5G1L A;  2CT6 A;  3ME7 A;  2DJJ A;  3GL3 A;  1GSD A;  3GYK A;  4TN8 A;  4LL1 B;  1GRX A;  3GX8 A;  4TKY A;  1T3B A;  1TU8 A;  3JCM L;  3APQ A;  5CYY A;  3HDC A;  2GZZ A;  4OO4 A;  1JHB A;  5A1N A;  3NZN A;  3I6A A;  5CNW A;  4G10 A;  5CRD A;  3N5O A;  1SD8 A;  1SVL A;  2DJK A;  3TJB A;  4ZBB A;  2VCZ A;  2JZS A;  4IGJ A;  1GUK A;  4CW9 A;  1HQO A;  1Z3E A;  3DWV A;  2ALB A;  4MJA A;  2XBI A;  2C3N A;  4POK A;  3TDG A;  5D96 A;  1SJI A;  5A1N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...