3EIPA

Crystal structure of colicin e3 immunity protein: an inhibitor to a ribosome-inactivating rnase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of colicin E3 immunity protein: an inhibitor of a ribosome-inactivating RNase.
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Immune system
molecule keywords PROTEIN (COLICIN E3 IMMUNITY PROTEIN)
total genus 18
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 3eipA00
3EIPA 1E44A 2B5UB 4UDMA 1JCHB
chains in the Genus database with same CATH superfamily
3ARWA 4HBEA 4JFMA 2M2AA 4DRKA 4UDMA 2XP7A 3TC5A 5B8IC 1P5QA 2FKEA 2KO7A 4TW8A 4TX0A 4DRHA 4WKAA 4MAVA 1FKRA 1D7JA 3IK8A 3QOKA 2ZQTA 1H0IA 4LAVA 1LL6A 4DT4A 4DRIA 4Z2KA 1N1AA 2D9FA 4LAYA 4ITZA 3GU0A 3WD0A 1ROUA 1NMWA 1FKJA 2XPAA 2IF4A 2KR7A 4WKFA 1R9HA 5DITA 2ZR4A 3EY6A 1KFWA 3O5JA 2AWGA 1M5YA 3RFWA 3WQWA 1NWTA 2DSUA 4U86A 1VF8A 2G41A 2YBUA 3ARPA 5GPRA 4P8XA 4J4OA 3GPKA 4IQ2A 3WD4A 4MTVA 1C9HA 4WJXA 1O6IA 2JZVA 2DSWA 1ZB5A 4S3KA 5JH8A 4ODRA 2LKNA 1XRVA 2B5UB 1SR0A 3B9AA 1JCHB 1OWQA 4URIA 3KACA 4MGVA 2KFWA 4TYOA 4NNRA 1Q6IA 2ETNA 3IKDA 4DWSD 3ARXA 3LUOA 4DRQA 1T11A 3VAWA 3IHZA 3G6MA 2MF9A 3I6CA 1HKKA 1OGBA 4MNMA 1WB0A 3B7XA 4WIWA 3AS0A 4GIVA 3O5RA 5D75A 4WKHA 3TDBA 4IQCA 3O5QA 2O92A 1HXVA 1FKDA 3B8SA 3GTYX 1FAPA 4O2TA 2Q5AA 2MNTA 2XP4A 3WL1A 4BF8A 2N87A 2AOSA 4DRPA 3CZ8A 4ZS6A 1W9UA 2LJ4A 3KABA 3UI4A 1LG1A 1W9VA 2PPPA 4ML4A 1W1YA 1HJXA 4IPXA 1W26A 3O5IA 1ZK6A 4Z2GA 3ARTA 1EDQA 2MLZA 3EIPA 5DIVA 4Z2LA 2DT2A 4W9OA 1FKIA 4DZ3A 1W1VA 4W9PA 1IX5A 2A3CA 2RUQA 1E6RA 1FKSA 2KI3A 3RMEA 1PBKA 1HJWA 3PRBA 1X6NA 2DG3A 3KADA 1GRJA 5GPGA 1JNSA 2B31A 1EYMA 4G2PA 4QIBA 3B9DA 4JYSA 1HKJA 3ALFA 1KT1A 2MLXA 4DIPA 3BMBA 1SYTA 1E6ZA 4G50A 1J4HA 3RGCA 1LG2A 2F4EA 2A3BA 1BKFA 3UQBA 2DT3A 3TCZA 3WKZA 1LL7A 3CHFA 1E15A 1FKTA 4JFKA 1D7IA 1QZ2A 1FKGA 2DT1A 1ITXA 2WM0A 1WAWA 4ODPA 1B6CA 4LAWA 1WNOA 3CHDA 3UQIA 4ZPWR 3RM9A 2IUZA 4FN2A 1FKKA 1FKBA 3B9EA 1YATA 1LJYA 1FJDA 1F8AB 2XPBA 2PPOA 4DRMA 2F23A 1D2KA 2XP3A 1LQ0A 1NWUA 3CH9A 1D6OA 3O5FA 5HKGA 4ZPTR 4ZPVR 4LGXA 3FY1A 4XAKA 4MNLA 5DO2A 1YW5A 4GGQA 3CGNA 2G8ZA 1FKLA 2KE0A 2DPEA 2OFNA 1FKHA 5J6EA 4DRJA 5HTGA 4DRNA 3BXWA 1RD6A 4FAPA 1NH6A 3AS3A 3PA7A 1H0GA 4IT4A 4TNSA 5HT1A 1HKMA 1EIBA 1UR8A 4S3JA 3O5OA 5BXJA 2PV1A 3PRAA 2DT0A 2MLYA 1ZU8A 3FXYA 4Q22A 1J4RA 1ZBKA 2K8IA 4NSBA 4QZVB 1Q1CA 3AROA 3O5GA 3KAIA 4W9QA 5HW7A 2QF8A 2FDMA 2WLZA 4JFIA 2ZR5A 3WD3A 4C02B 3UI5A 2A3AA 4JFLA 4ODQA 4HBOA 4ODNA 4WK9A 4Z2HA 3ALGA 4Z2JA 1HJVA 3CHEA 5GQBA 4R5EA 1X6LA 2DSVA 2L2SA 4DZ2A 4KR0B 1JNDA 3OOBA 3WD2A 2VN1A 1EQ3A 2ESCA 2RUCA 3AQUA 3RM4A 1JNEA 2PBCA 2WLYA 3O5PA 2KGJA 1XHGA 2A3EA 3CGMA 1JVWA 3ARRA 5HW6A 1FKFA 3NRKA 3WH0A 4U85A 3KAGA 3ARVA 2DSZA 2DG4A 3WQVA 3H9RB 3UI6A 3WL0A 2MPHA 1Y0OA 4L3NA 2WK2A 4QT2A 2ITKA 4ODLA 4DROA 3JYMA 4Z2IA 4DWSC 1HKIA 1W1TA 4P8UA 2Y78A 3MDYB 2EULA 2F2DA 2ZQVA 3JYJA 1ZL1A 3W4RA 2PV3A 3KZ7A 3NTPA 1FD9A 2YBTA 4MNKA 3CHCA 1FFQA 4KQZA 5DIUA 4P8VA 1JNTA 2PN0A 1NWSA 4PTMA 3PRDA 2O9OA 4IT6A 3UQAA 3AS2A 2XP6A 3KAFA 4L72B 2M08A 1D7HA 3G6LA 3RM8A 3OA5A 2PPNA 4JFJA 1NMVA 2XP8A 2RQSA 1QPFA 4DWSA 1ZCNA 4J4NA 4MNJA 4W5UA 3NI6A 5I98A 1GPFA 1GOIA 1L1PA 4ODOA 3O5DA 1ZBVA 1E6NA 3AS1A 2M1IA 4MSPA 4TW7A 1EHNA 2FAPA 4NZCA 3UF8A 2PV2A 1OGGA 4HARA 3ARYA 1NSGA 5HW8A 1GUVA 1ROTA 3KCEA 2LPVA 3FAPA 1KT0A 4R0XA 2OLHA 1E44A 2XP9A 2RUDA 5DF0A 1A7XA 2ZQSA 4ODKA 3ARUA 1ZBWA 1J4IA 3IKGA 2ZR6A 4MPKA 3ARQA 3WIJA 3KAHA 3WD1A 4U84A 4Q7NA 1J6YA 1U79A 2ZQUA 1QPLA 1Q6HA 5HWCA 2XP5A 3ODKA 5HUAA 4QT3A 1LL4A 4N19A 3JXVA 1PINA 3O5EA 3O5LA 2RSEA 1FFRA 4DWSB 2UZ5A 4ODMA 2RURA 3O5KA 1TFVA 4P8WA 1Q6UA 1ZBCA 1E9LA 2DG9A 3O5MA 1E6PA 1K9TA 4AY1A 1W1PA 1W9PA 3ARZA 2P4VA 4LAXA 4TW6A 1NWRA 3ARSA 1TCOC 4DH0A 2LGOA 2F21A 1BL4A 1CTNA 3PR9A 5DEZA 5HWBA 1UR9A 2PI6A 2VCDA 5HBFA 1F40A
chains in the Genus database with same CATH topology
3EIPA 1E44A 2B5UB 4UDMA 1JCHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIP A;  1E44 A;  2B5U B;  4UDM A;  1JCH B; 
#chains in the Genus database with same CATH topology
 3ARW A;  4HBE A;  4JFM A;  2M2A A;  4DRK A;  4UDM A;  2XP7 A;  3TC5 A;  5B8I C;  1P5Q A;  2FKE A;  2KO7 A;  4TW8 A;  4TX0 A;  4DRH A;  4WKA A;  4MAV A;  1FKR A;  1D7J A;  3IK8 A;  3QOK A;  2ZQT A;  1H0I A;  4LAV A;  1LL6 A;  4DT4 A;  4DRI A;  4Z2K A;  1N1A A;  2D9F A;  4LAY A;  4ITZ A;  3GU0 A;  3WD0 A;  1ROU A;  1NMW A;  1FKJ A;  2XPA A;  2IF4 A;  2KR7 A;  4WKF A;  1R9H A;  5DIT A;  2ZR4 A;  3EY6 A;  1KFW A;  3O5J A;  2AWG A;  1M5Y A;  3RFW A;  3WQW A;  1NWT A;  2DSU A;  4U86 A;  1VF8 A;  2G41 A;  2YBU A;  3ARP A;  5GPR A;  4P8X A;  4J4O A;  3GPK A;  4IQ2 A;  3WD4 A;  4MTV A;  1C9H A;  4WJX A;  1O6I A;  2JZV A;  2DSW A;  1ZB5 A;  4S3K A;  5JH8 A;  4ODR A;  2LKN A;  1XRV A;  2B5U B;  1SR0 A;  3B9A A;  1JCH B;  1OWQ A;  4URI A;  3KAC A;  4MGV A;  2KFW A;  4TYO A;  4NNR A;  1Q6I A;  2ETN A;  3IKD A;  4DWS D;  3ARX A;  3LUO A;  4DRQ A;  1T11 A;  3VAW A;  3IHZ A;  3G6M A;  2MF9 A;  3I6C A;  1HKK A;  1OGB A;  4MNM A;  1WB0 A;  3B7X A;  4WIW A;  3AS0 A;  4GIV A;  3O5R A;  5D75 A;  4WKH A;  3TDB A;  4IQC A;  3O5Q A;  2O92 A;  1HXV A;  1FKD A;  3B8S A;  3GTY X;  1FAP A;  4O2T A;  2Q5A A;  2MNT A;  2XP4 A;  3WL1 A;  4BF8 A;  2N87 A;  2AOS A;  4DRP A;  3CZ8 A;  4ZS6 A;  1W9U A;  2LJ4 A;  3KAB A;  3UI4 A;  1LG1 A;  1W9V A;  2PPP A;  4ML4 A;  1W1Y A;  1HJX A;  4IPX A;  1W26 A;  3O5I A;  1ZK6 A;  4Z2G A;  3ART A;  1EDQ A;  2MLZ A;  3EIP A;  5DIV A;  4Z2L A;  2DT2 A;  4W9O A;  1FKI A;  4DZ3 A;  1W1V A;  4W9P A;  1IX5 A;  2A3C A;  2RUQ A;  1E6R A;  1FKS A;  2KI3 A;  3RME A;  1PBK A;  1HJW A;  3PRB A;  1X6N A;  2DG3 A;  3KAD A;  1GRJ A;  5GPG A;  1JNS A;  2B31 A;  1EYM A;  4G2P A;  4QIB A;  3B9D A;  4JYS A;  1HKJ A;  3ALF A;  1KT1 A;  2MLX A;  4DIP A;  3BMB A;  1SYT A;  1E6Z A;  4G50 A;  1J4H A;  3RGC A;  1LG2 A;  2F4E A;  2A3B A;  1BKF A;  3UQB A;  2DT3 A;  3TCZ A;  3WKZ A;  1LL7 A;  3CHF A;  1E15 A;  1FKT A;  4JFK A;  1D7I A;  1QZ2 A;  1FKG A;  2DT1 A;  1ITX A;  2WM0 A;  1WAW A;  4ODP A;  1B6C A;  4LAW A;  1WNO A;  3CHD A;  3UQI A;  4ZPW R;  3RM9 A;  2IUZ A;  4FN2 A;  1FKK A;  1FKB A;  3B9E A;  1YAT A;  1LJY A;  1FJD A;  1F8A B;  2XPB A;  2PPO A;  4DRM A;  2F23 A;  1D2K A;  2XP3 A;  1LQ0 A;  1NWU A;  3CH9 A;  1D6O A;  3O5F A;  5HKG A;  4ZPT R;  4ZPV R;  4LGX A;  3FY1 A;  4XAK A;  4MNL A;  5DO2 A;  1YW5 A;  4GGQ A;  3CGN A;  2G8Z A;  1FKL A;  2KE0 A;  2DPE A;  2OFN A;  1FKH A;  5J6E A;  4DRJ A;  5HTG A;  4DRN A;  3BXW A;  1RD6 A;  4FAP A;  1NH6 A;  3AS3 A;  3PA7 A;  1H0G A;  4IT4 A;  4TNS A;  5HT1 A;  1HKM A;  1EIB A;  1UR8 A;  4S3J A;  3O5O A;  5BXJ A;  2PV1 A;  3PRA A;  2DT0 A;  2MLY A;  1ZU8 A;  3FXY A;  4Q22 A;  1J4R A;  1ZBK A;  2K8I A;  4NSB A;  4QZV B;  1Q1C A;  3ARO A;  3O5G A;  3KAI A;  4W9Q A;  5HW7 A;  2QF8 A;  2FDM A;  2WLZ A;  4JFI A;  2ZR5 A;  3WD3 A;  4C02 B;  3UI5 A;  2A3A A;  4JFL A;  4ODQ A;  4HBO A;  4ODN A;  4WK9 A;  4Z2H A;  3ALG A;  4Z2J A;  1HJV A;  3CHE A;  5GQB A;  4R5E A;  1X6L A;  2DSV A;  2L2S A;  4DZ2 A;  4KR0 B;  1JND A;  3OOB A;  3WD2 A;  2VN1 A;  1EQ3 A;  2ESC A;  2RUC A;  3AQU A;  3RM4 A;  1JNE A;  2PBC A;  2WLY A;  3O5P A;  2KGJ A;  1XHG A;  2A3E A;  3CGM A;  1JVW A;  3ARR A;  5HW6 A;  1FKF A;  3NRK A;  3WH0 A;  4U85 A;  3KAG A;  3ARV A;  2DSZ A;  2DG4 A;  3WQV A;  3H9R B;  3UI6 A;  3WL0 A;  2MPH A;  1Y0O A;  4L3N A;  2WK2 A;  4QT2 A;  2ITK A;  4ODL A;  4DRO A;  3JYM A;  4Z2I A;  4DWS C;  1HKI A;  1W1T A;  4P8U A;  2Y78 A;  3MDY B;  2EUL A;  2F2D A;  2ZQV A;  3JYJ A;  1ZL1 A;  3W4R A;  2PV3 A;  3KZ7 A;  3NTP A;  1FD9 A;  2YBT A;  4MNK A;  3CHC A;  1FFQ A;  4KQZ A;  5DIU A;  4P8V A;  1JNT A;  2PN0 A;  1NWS A;  4PTM A;  3PRD A;  2O9O A;  4IT6 A;  3UQA A;  3AS2 A;  2XP6 A;  3KAF A;  4L72 B;  2M08 A;  1D7H A;  3G6L A;  3RM8 A;  3OA5 A;  2PPN A;  4JFJ A;  1NMV A;  2XP8 A;  2RQS A;  1QPF A;  4DWS A;  1ZCN A;  4J4N A;  4MNJ A;  4W5U A;  3NI6 A;  5I98 A;  1GPF A;  1GOI A;  1L1P A;  4ODO A;  3O5D A;  1ZBV A;  1E6N A;  3AS1 A;  2M1I A;  4MSP A;  4TW7 A;  1EHN A;  2FAP A;  4NZC A;  3UF8 A;  2PV2 A;  1OGG A;  4HAR A;  3ARY A;  1NSG A;  5HW8 A;  1GUV A;  1ROT A;  3KCE A;  2LPV A;  3FAP A;  1KT0 A;  4R0X A;  2OLH A;  1E44 A;  2XP9 A;  2RUD A;  5DF0 A;  1A7X A;  2ZQS A;  4ODK A;  3ARU A;  1ZBW A;  1J4I A;  3IKG A;  2ZR6 A;  4MPK A;  3ARQ A;  3WIJ A;  3KAH A;  3WD1 A;  4U84 A;  4Q7N A;  1J6Y A;  1U79 A;  2ZQU A;  1QPL A;  1Q6H A;  5HWC A;  2XP5 A;  3ODK A;  5HUA A;  4QT3 A;  1LL4 A;  4N19 A;  3JXV A;  1PIN A;  3O5E A;  3O5L A;  2RSE A;  1FFR A;  4DWS B;  2UZ5 A;  4ODM A;  2RUR A;  3O5K A;  1TFV A;  4P8W A;  1Q6U A;  1ZBC A;  1E9L A;  2DG9 A;  3O5M A;  1E6P A;  1K9T A;  4AY1 A;  1W1P A;  1W9P A;  3ARZ A;  2P4V A;  4LAX A;  4TW6 A;  1NWR A;  3ARS A;  1TCO C;  4DH0 A;  2LGO A;  2F21 A;  1BL4 A;  1CTN A;  3PR9 A;  5DEZ A;  5HWB A;  1UR9 A;  2PI6 A;  2VCD A;  5HBF A;  1F40 A; 
#chains in the Genus database with same CATH homology
 3EIP A;  1E44 A;  2B5U B;  4UDM A;  1JCH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...