3EIPA

Crystal structure of colicin e3 immunity protein: an inhibitor to a ribosome-inactivating rnase
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of colicin E3 immunity protein: an inhibitor of a ribosome-inactivating RNase.
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Immune system
molecule keywords PROTEIN (COLICIN E3 IMMUNITY PROTEIN)
total genus 18
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03513 Cloacin_immun Cloacin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.20 Alpha Beta Roll Chitinase A; domain 3 Cloacin immunity protein 3eipA00
3EIPA 1JCHB 2B5UB 1E44A 4UDMA
chains in the Genus database with same CATH superfamily
2PI6A 3CGNA 3UQIA 2WM0A 1FD9A 2PBCA 4HBOA 4IQ2A 2IUZA 2ZQSA 4DRKA 1D7HA 4Z2GA 2M1IA 3O5GA 3AQUA 4P8WA 3O5RA 2O92A 4TW8A 4LAWA 4S3KA 4MGVA 2YBTA 3IKGA 4TW7A 1LG2A 3ARXA 1OWQA 1FKSA 3LUOA 3UQBA 3KADA 4GIVA 1U79A 3PRAA 3B9DA 3B9EA 1HKIA 2ITKA 2RUCA 4DZ3A 2M08A 3WD4A 3KACA 2DT0A 1W1VA 4MNJA 1FAPA 1ROTA 1R9HA 2PPNA 5DIUA 3RGCA 2DG3A 2DG9A 1Q6UA 4WIWA 1W9UA 2VN1A 2WK2A 3B7XA 3CHDA 4ODOA 1HKMA 4TX0A 2O9OA 1E6RA 4U86A 2ESCA 5BXJA 1KT1A 2XP7A 4DT4A 1A7XA 1JNTA 2OLHA 4WKFA 2QF8A 4P8XA 4ZPWR 2FKEA 4MPKA 4Z2HA 4DRPA 3KAHA 2F4EA 4ML4A 2G41A 3EIPA 3GU0A 2VCDA 2PPOA 3B8SA 3KCEA 4KR0B 3B9AA 5HTGA 4URIA 2DT3A 1EIBA 3CHFA 1YATA 1Q6HA 3FY1A 3ALFA 3KABA 2DSWA 4MAVA 1OGGA 1UR9A 2A3AA 1EDQA 2MLZA 2EULA 5HBFA 4WKHA 2Q5AA 2DG4A 1FKDA 2DT2A 4GGQA 4FAPA 2JZVA 5J6EA 2G8ZA 1ZL1A 4TW6A 1CTNA 2OFNA 4QT3A 3ARQA 5HW7A 3BMBA 1LJYA 1XRVA 3AS1A 4DRHA 3ARTA 1XHGA 5GPGA 2IF4A 4R5EA 4WK9A 1JCHB 2DSVA 2KR7A 1ZBCA 2XP9A 4U85A 3ARVA 3G6MA 3CHCA 4DRMA 1FKFA 3WL1A 2P4VA 1HJVA 2A3CA 3ODKA 1KFWA 3WD0A 1GRJA 1W1PA 4ODRA 3NTPA 4KQZA 1H0GA 3ARYA 2AOSA 3PRDA 5DF0A 2KO7A 4DRIA 3OOBA 1TFVA 4WJXA 4DZ2A 3UI4A 3AROA 1LG1A 3O5PA 4NNRA 1BL4A 1Q1CA 4DROA 1FKKA 1FFQA 1LQ0A 2PV3A 3OA5A 3WKZA 4JYSA 5HUAA 4UDMA 2LKNA 1FKIA 1LL6A 3RM8A 4ODLA 3WD1A 4DH0A 3RM4A 1X6LA 3GPKA 1N1AA 3CGMA 3MDYB 1D7JA 2ZR5A 2DSZA 4QIBA 2UZ5A 1E6NA 1E6PA 1ZCNA 1IX5A 2D9FA 2PV1A 5D75A 5JH8A 1QPLA 4DRNA 1LL4A 3AS3A 3WQWA 4JFMA 3IK8A 1X6NA 5HKGA 2F21A 1BKFA 3PA7A 4DWSD 4ZPTR 1ZU8A 4Z2LA 1QZ2A 1HJWA 1FKHA 3O5IA 1T11A 4LAXA 4ODMA 1PBKA 2F2DA 1JNSA 4ODKA 2KGJA 3VAWA 3RM9A 2KFWA 1OGBA 1FKBA 1ZBWA 1NH6A 1FKRA 3BXWA 1GPFA 2RQSA 3WH0A 1HKKA 4FN2A 3IHZA 4TYOA 2ZR4A 4Z2IA 2FAPA 3AS0A 4N19A 4HARA 4C02B 4Q7NA 1UR8A 1SR0A 3KAGA 5B8IC 1NMWA 3O5LA 4MTVA 3TC5A 3WQVA 1FJDA 1NWRA 2Y78A 2XP6A 2RSEA 1W1YA 1EYMA 4P8VA 4LAYA 4L3NA 4NSBA 2XPBA 4DWSB 5DITA 3O5EA 4DWSC 3JYJA 5HW8A 4S3JA 4ODQA 3QOKA 4NZCA 4PTMA 3ARWA 4G2PA 3W4RA 2WLZA 3ARPA 1WB0A 2ZQTA 1W9PA 1FFRA 1EHNA 2LGOA 3JXVA 3NRKA 1FKGA 4ODPA 2WLYA 5DO2A 3UQAA 1JVWA 2FDMA 2LJ4A 3G6LA 1NWUA 1W9VA 3O5QA 4R0XA 1W26A 1TCOC 1J4HA 4W5UA 3WIJA 3CZ8A 2MNTA 3KAIA 4LGXA 1ZB5A 2A3BA 1J6YA 3EY6A 1FKJA 1F8AB 4U84A 4IQCA 3ARZA 5DIVA 1D7IA 1ITXA 2ZQUA 5I98A 5GQBA 4WKAA 1EQ3A 2ZR6A 3WL0A 1NMVA 4O2TA 2MLXA 1NWSA 2ETNA 4W9QA 3WD3A 1D2KA 4DRJA 1O6IA 3ARRA 1GOIA 1E44A 2B5UB 5GPRA 2XP4A 1B6CA 4W9OA 1FKLA 2RUDA 1JNEA 1HXVA 2MF9A 1D6OA 4J4NA 2RUQA 3IKDA 1FKTA 1E9LA 4L72B 5DEZA 3O5KA 4Z2KA 3ARSA 1PINA 2KI3A 1J4IA 1WAWA 4IPXA 3NI6A 2L2SA 4JFKA 3WD2A 1QPFA 2XP5A 4Q22A 3O5MA 2K8IA 2F23A 4MNMA 3ARUA 4P8UA 4G50A 1VF8A 1F40A 1Q6IA 1C9HA 4JFIA 4MNLA 4Z2JA 4ZS6A 2PN0A 3UI5A 1P5QA 2XPAA 3RFWA 3H9RB 4IT6A 4MSPA 3I6CA 4XAKA 2RURA 3TDBA 2XP3A 3UF8A 3TCZA 4JFJA 5HWCA 2DSUA 2AWGA 1M5YA 3JYMA 5HW6A 4ITZA 2PPPA 3O5OA 3KAFA 4IT4A 1KT0A 2N87A 3FAPA 1HJXA 3KZ7A 3AS2A 1ROUA 3CHEA 2DPEA 2ZQVA 2B31A 4J4OA 3UI6A 1GUVA 3O5FA 3RMEA 4HBEA 2PV2A 2XP8A 1SYTA 3FXYA 1YW5A 1Y0OA 2MPHA 1H0IA 4QZVB 1W1TA 1J4RA 1LL7A 4MNKA 1NWTA 2DT1A 3CH9A 2M2AA 4DWSA 2LPVA 2A3EA 1RD6A 1WNOA 4BF8A 1JNDA 4ODNA 2MLYA 4AY1A 1HKJA 4LAVA 1ZBVA 5HWBA 1L1PA 3GTYX 3O5DA 1E6ZA 3ALGA 4JFLA 1NSGA 1ZBKA 5HT1A 4W9PA 4DRQA 1K9TA 2KE0A 3PRBA 4QT2A 4ZPVR 1E15A 3O5JA 4TNSA 1ZK6A 4DIPA 2YBUA 3PR9A
chains in the Genus database with same CATH topology
3EIPA 1JCHB 2B5UB 1E44A 4UDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIP A;  1JCH B;  2B5U B;  1E44 A;  4UDM A; 
#chains in the Genus database with same CATH topology
 2PI6 A;  3CGN A;  3UQI A;  2WM0 A;  1FD9 A;  2PBC A;  4HBO A;  4IQ2 A;  2IUZ A;  2ZQS A;  4DRK A;  1D7H A;  4Z2G A;  2M1I A;  3O5G A;  3AQU A;  4P8W A;  3O5R A;  2O92 A;  4TW8 A;  4LAW A;  4S3K A;  4MGV A;  2YBT A;  3IKG A;  4TW7 A;  1LG2 A;  3ARX A;  1OWQ A;  1FKS A;  3LUO A;  3UQB A;  3KAD A;  4GIV A;  1U79 A;  3PRA A;  3B9D A;  3B9E A;  1HKI A;  2ITK A;  2RUC A;  4DZ3 A;  2M08 A;  3WD4 A;  3KAC A;  2DT0 A;  1W1V A;  4MNJ A;  1FAP A;  1ROT A;  1R9H A;  2PPN A;  5DIU A;  3RGC A;  2DG3 A;  2DG9 A;  1Q6U A;  4WIW A;  1W9U A;  2VN1 A;  2WK2 A;  3B7X A;  3CHD A;  4ODO A;  1HKM A;  4TX0 A;  2O9O A;  1E6R A;  4U86 A;  2ESC A;  5BXJ A;  1KT1 A;  2XP7 A;  4DT4 A;  1A7X A;  1JNT A;  2OLH A;  4WKF A;  2QF8 A;  4P8X A;  4ZPW R;  2FKE A;  4MPK A;  4Z2H A;  4DRP A;  3KAH A;  2F4E A;  4ML4 A;  2G41 A;  3EIP A;  3GU0 A;  2VCD A;  2PPO A;  3B8S A;  3KCE A;  4KR0 B;  3B9A A;  5HTG A;  4URI A;  2DT3 A;  1EIB A;  3CHF A;  1YAT A;  1Q6H A;  3FY1 A;  3ALF A;  3KAB A;  2DSW A;  4MAV A;  1OGG A;  1UR9 A;  2A3A A;  1EDQ A;  2MLZ A;  2EUL A;  5HBF A;  4WKH A;  2Q5A A;  2DG4 A;  1FKD A;  2DT2 A;  4GGQ A;  4FAP A;  2JZV A;  5J6E A;  2G8Z A;  1ZL1 A;  4TW6 A;  1CTN A;  2OFN A;  4QT3 A;  3ARQ A;  5HW7 A;  3BMB A;  1LJY A;  1XRV A;  3AS1 A;  4DRH A;  3ART A;  1XHG A;  5GPG A;  2IF4 A;  4R5E A;  4WK9 A;  1JCH B;  2DSV A;  2KR7 A;  1ZBC A;  2XP9 A;  4U85 A;  3ARV A;  3G6M A;  3CHC A;  4DRM A;  1FKF A;  3WL1 A;  2P4V A;  1HJV A;  2A3C A;  3ODK A;  1KFW A;  3WD0 A;  1GRJ A;  1W1P A;  4ODR A;  3NTP A;  4KQZ A;  1H0G A;  3ARY A;  2AOS A;  3PRD A;  5DF0 A;  2KO7 A;  4DRI A;  3OOB A;  1TFV A;  4WJX A;  4DZ2 A;  3UI4 A;  3ARO A;  1LG1 A;  3O5P A;  4NNR A;  1BL4 A;  1Q1C A;  4DRO A;  1FKK A;  1FFQ A;  1LQ0 A;  2PV3 A;  3OA5 A;  3WKZ A;  4JYS A;  5HUA A;  4UDM A;  2LKN A;  1FKI A;  1LL6 A;  3RM8 A;  4ODL A;  3WD1 A;  4DH0 A;  3RM4 A;  1X6L A;  3GPK A;  1N1A A;  3CGM A;  3MDY B;  1D7J A;  2ZR5 A;  2DSZ A;  4QIB A;  2UZ5 A;  1E6N A;  1E6P A;  1ZCN A;  1IX5 A;  2D9F A;  2PV1 A;  5D75 A;  5JH8 A;  1QPL A;  4DRN A;  1LL4 A;  3AS3 A;  3WQW A;  4JFM A;  3IK8 A;  1X6N A;  5HKG A;  2F21 A;  1BKF A;  3PA7 A;  4DWS D;  4ZPT R;  1ZU8 A;  4Z2L A;  1QZ2 A;  1HJW A;  1FKH A;  3O5I A;  1T11 A;  4LAX A;  4ODM A;  1PBK A;  2F2D A;  1JNS A;  4ODK A;  2KGJ A;  3VAW A;  3RM9 A;  2KFW A;  1OGB A;  1FKB A;  1ZBW A;  1NH6 A;  1FKR A;  3BXW A;  1GPF A;  2RQS A;  3WH0 A;  1HKK A;  4FN2 A;  3IHZ A;  4TYO A;  2ZR4 A;  4Z2I A;  2FAP A;  3AS0 A;  4N19 A;  4HAR A;  4C02 B;  4Q7N A;  1UR8 A;  1SR0 A;  3KAG A;  5B8I C;  1NMW A;  3O5L A;  4MTV A;  3TC5 A;  3WQV A;  1FJD A;  1NWR A;  2Y78 A;  2XP6 A;  2RSE A;  1W1Y A;  1EYM A;  4P8V A;  4LAY A;  4L3N A;  4NSB A;  2XPB A;  4DWS B;  5DIT A;  3O5E A;  4DWS C;  3JYJ A;  5HW8 A;  4S3J A;  4ODQ A;  3QOK A;  4NZC A;  4PTM A;  3ARW A;  4G2P A;  3W4R A;  2WLZ A;  3ARP A;  1WB0 A;  2ZQT A;  1W9P A;  1FFR A;  1EHN A;  2LGO A;  3JXV A;  3NRK A;  1FKG A;  4ODP A;  2WLY A;  5DO2 A;  3UQA A;  1JVW A;  2FDM A;  2LJ4 A;  3G6L A;  1NWU A;  1W9V A;  3O5Q A;  4R0X A;  1W26 A;  1TCO C;  1J4H A;  4W5U A;  3WIJ A;  3CZ8 A;  2MNT A;  3KAI A;  4LGX A;  1ZB5 A;  2A3B A;  1J6Y A;  3EY6 A;  1FKJ A;  1F8A B;  4U84 A;  4IQC A;  3ARZ A;  5DIV A;  1D7I A;  1ITX A;  2ZQU A;  5I98 A;  5GQB A;  4WKA A;  1EQ3 A;  2ZR6 A;  3WL0 A;  1NMV A;  4O2T A;  2MLX A;  1NWS A;  2ETN A;  4W9Q A;  3WD3 A;  1D2K A;  4DRJ A;  1O6I A;  3ARR A;  1GOI A;  1E44 A;  2B5U B;  5GPR A;  2XP4 A;  1B6C A;  4W9O A;  1FKL A;  2RUD A;  1JNE A;  1HXV A;  2MF9 A;  1D6O A;  4J4N A;  2RUQ A;  3IKD A;  1FKT A;  1E9L A;  4L72 B;  5DEZ A;  3O5K A;  4Z2K A;  3ARS A;  1PIN A;  2KI3 A;  1J4I A;  1WAW A;  4IPX A;  3NI6 A;  2L2S A;  4JFK A;  3WD2 A;  1QPF A;  2XP5 A;  4Q22 A;  3O5M A;  2K8I A;  2F23 A;  4MNM A;  3ARU A;  4P8U A;  4G50 A;  1VF8 A;  1F40 A;  1Q6I A;  1C9H A;  4JFI A;  4MNL A;  4Z2J A;  4ZS6 A;  2PN0 A;  3UI5 A;  1P5Q A;  2XPA A;  3RFW A;  3H9R B;  4IT6 A;  4MSP A;  3I6C A;  4XAK A;  2RUR A;  3TDB A;  2XP3 A;  3UF8 A;  3TCZ A;  4JFJ A;  5HWC A;  2DSU A;  2AWG A;  1M5Y A;  3JYM A;  5HW6 A;  4ITZ A;  2PPP A;  3O5O A;  3KAF A;  4IT4 A;  1KT0 A;  2N87 A;  3FAP A;  1HJX A;  3KZ7 A;  3AS2 A;  1ROU A;  3CHE A;  2DPE A;  2ZQV A;  2B31 A;  4J4O A;  3UI6 A;  1GUV A;  3O5F A;  3RME A;  4HBE A;  2PV2 A;  2XP8 A;  1SYT A;  3FXY A;  1YW5 A;  1Y0O A;  2MPH A;  1H0I A;  4QZV B;  1W1T A;  1J4R A;  1LL7 A;  4MNK A;  1NWT A;  2DT1 A;  3CH9 A;  2M2A A;  4DWS A;  2LPV A;  2A3E A;  1RD6 A;  1WNO A;  4BF8 A;  1JND A;  4ODN A;  2MLY A;  4AY1 A;  1HKJ A;  4LAV A;  1ZBV A;  5HWB A;  1L1P A;  3GTY X;  3O5D A;  1E6Z A;  3ALG A;  4JFL A;  1NSG A;  1ZBK A;  5HT1 A;  4W9P A;  4DRQ A;  1K9T A;  2KE0 A;  3PRB A;  4QT2 A;  4ZPV R;  1E15 A;  3O5J A;  4TNS A;  1ZK6 A;  4DIP A;  2YBU A;  3PR9 A; 
#chains in the Genus database with same CATH homology
 3EIP A;  1JCH B;  2B5U B;  1E44 A;  4UDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...