3EIWA

Crystal structure of staphylococcus aureus lipoprotein, htsa
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
292
structure length
292
Chain Sequence
ASTISVKDENGTVKVPKDAKRIVVLEYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSVGTRKQPNLEEISKLKPDLIIADSSRHKGINKELNKIAPTLSLKSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKLINKYKDEIKFDRNQKVLPAVVAKAGLLAHPNYSYVGQFLNELGFKNALSDDVTKGLSKYLKGPYLQLDTEHLADLNPERMIIMTDHAKKDSAEFKKLQEDATWKKLNAVKNNRVDIVDRDVWARSRGLISSEEMAKELVELSKKEQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HtsA protein
publication title Characterization of staphyloferrin A biosynthetic and transport mutants in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transport protein
total genus 102
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3eiwA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3eiwA02
2XUZA 4FKMA 2RG7A 2QI9F 4HMQA 1N2CB 2YNMC 2M6KA 2Q8PA 5GGXA 5JOQA 4WZBB 1K7SN 1K2VN 3LI2A 4OXQA 1QGUA 2OGWA 4UTPA 1PSZA 3TLKA 1QGUB 1KAEA 4N01A 4WESA 3U7QA 4WN9A 5BVGA 1G21B 2XY4A 1M34A 4TKUB 3AERA 4UDNA 4WN9B 4MDYA 1M34B 4K3VA 3HH8A 3R5TA 3MINA 2AFIA 5AFSA 2O1EA 1L5HB 3CX3A 3AETA 3MINB 3R5SA 2AFIB 3PDIA 1K75A 3AEUA 2R7AA 4MO9A 4XPIB 4TKUA 4MLZA 3PDIB 5JJ5A 4CL2A 1N2CA 4INPA 4G09A 1H1LB 4WZBA 4WZAA 3ZK9A 3EIXA 1PQ4A 1M1NB 3MWGA 2OV3A 3ZTTA 4IRMA 4LS3A 4FI3F 4WZAB 1KAHA 2R79A 3TNYA 1XVLA 4M7OA 5JPDA 4GICA 1N4DA 1G21A 4FNAA 3MD9A 2YNMD 3UJPA 2OSVA 3BE6A 4HN9A 5CX1B 2WI8A 4PM4A 2PHZA 2X4LA 1L5HA 4PAGA 1G20A 1TOAA 5B58T 3AESB 1FP4A 1M1YB 4OXRA 4XPIA 1G20B 3ZK8A 1FP4B 2AFHB 3HJTA 1N4AA 5HX7A 4NNOA 1KARA 4G07A 4MX8A 4UDOA 1H1LA 3ZKAA 1M1NA 3HXPA 3EIWA 3MFQA 5JG7A 4ND8A 4BBPA 3AEKA 4ND8B 2PS0A 3GI1A 2MINB 3AEKB 5M34A 1N2ZA 4WNAB 4DBLE 2XH8A 5CX1A 5M2QA 3PSHA 3LHSA 4LJSA 3MWFA 2WHYA 3AESA 4H0FA 5GGYA 3ZK7A 5KOJB 1M1YA 3PSAA 4HMOA 1QH1B 2Q8QA 1EFDN 2AFHA 5M3BA 3NU1A 5CR9A 5I4KA 3TEFA 2XV1A 3BE5A 2XDQA 4OVKA 3K1AA 5HDQA 2PS3A 4H59A 2XDQB 3K1AB 1QH8A 1MIOA 2MINA 4WNAA 1QH8B 1MIOB 4WESB 2OV1A 5FLYA 3U7QB 5BVHA 5BVGB 5KHLB 4UTOA 3AERB 2ETVA 5BVHB 4B8YA 3AEQA 5KOJA 5M29A 1QH1A 3G9QA 2M6LA 4TKVA 3AEQB 4INOA 3AETB 2PRSA 4NNPA 5KOHA 4TKVB 4HMPA 4FILA 1ESZA 3AEUB 5KOHB 2XQVA 2PS9A 1K0FA
chains in the Genus database with same CATH superfamily
1Q1EA 4XCVA 4BTEA 2EP5A 2WZBA 3H9EO 3R6LA 4K9SA 4NRDA 3PUZA 2Y0CA 4EHLA 3EMKA 1T29A 3PFWO 3V9PA 5AESA 5HGXA 4OLAA 4L74A 5JS7A 4R5MA 2HUNA 1Y7HA 3BWXA 2V4ZA 2DFNA 5E1OA 4P5EA 5ALIA 2W2PA 2NNWB 5C1BA 2QNIA 1KYQA 2CNDA 4XPZA 1SZJG 1UKZA 2FYTA 3LRXA 4FHEA 4GXQA 3IL2A 2XMPA 1U7UA 3UUEA 3ESZA 2WMDA 3WGMA 3AVTA 3JWJA 3L4KA 1CHDA 2J09A 1K1EA 4YXFA 3F98A 4MW5A 2HHJA 1CEQA 1TQDA 2O1WA 2B30A 4HAOA 3BKXA 2D00A 4PICA 1GNQA 1SHTX 4R05A 3R75A 3WAJA 5IAOA 3AIOA 1PP4A 2YQ5A 1UBMS 1XK7A 1IY8A 1AO3A 4X5OA 1AQIA 1ZH6A 3EA5A 3UZUA 2QMZA 2W6IA 4A7PA 3IAUA 1CP2A 2CJPA 2BJWA 4C4RA 4O4JB 2IP1A 2V5AA 3IDQA 5FF9A 3ZKWA 4B7AA 3W5VA 1X7ZB 1I7NA 5SZJA 1R4NB 4BVBA 1OLSA 1VI5A 3UANA 3I6IA 5DW0A 4OJYA 2CCKA 1D1QA 1ZC3A 2DBZA 3E3AA 4OM8A 5BOVA 4KNVA 5HUJA 2BGWA 2ZU0C 2OWEA 4M98A 2IBSA 1P1HA 3WMGA 4JNKA 1EXMA 4MVWA 1KFEB 2ZI6A 1DC7A 5HIKA 1QKJA 2C61A 4FX2A 5K45A 1M0TA 5CCBA 4I5GA 5GIOE 1N6IA 3A6PC 8MHTA 5AR1A 3ZK8A 3W5DA 3MGAA 1GPUA 4HXFB 4M6WA 4G3XA 4G0ZA 1ECBA 1X8KA 2ODNA 3GEPA 4JWTA 2PKQO 4G8CA 2Q2OA 2O8FB 1WDKA 3MJHA 5HK9A 1D2MA 3GEMA 2G0NA 3QQPA 4OSOA 4WZBE 2WJGA 4HUJA 3ZCQA 1JAHA 4MR7A 5CM2Z 1QGED 5A9TA 2D1RA 1IUPA 3QI2A 4GL2A 3W8FA 3F9CA 4MHTA 4MGZR 1LJUA 2QM0A 1OI7A 3CWZA 1Y9DA 1YZYA 2AJBA 1UPXA 1ZLXA 2Q0XA 3PXBA 5H80A 1OTYA 3RO7A 1KKUA 1T1JA 5FOXA 2VDWA 1N7IA 3A25A 3OEWA 3PPWA 1QVRA 3OAAA 3U4HA 3V32A 1CC1S 1SXJB 1XMSA 3H99A 3M1YA 3DOOA 4UUNA 5CLJA 4JYAB 5BN3B 4PAWA 1QUFA 2VBCA 2FR8C 3WRWA 2GPWA 3AYXB 4U0KA 4ZOLB 3AL3A 3PLNA 4CPDA 1Z22A 3IEPA 1FCJA 2GJSA 2EJBA 3VBCA 4IINA 2N9UA 1JQEA 1WUTA 4RSGA 4TMXA 2ZRAA 4MB0A 4C4OA 1RDFA 2ZVDA 3WE7A 1ZA2A 5FXMA 5LC1A 1JI3A 1U1CA 4X6XA 1EG7A 1NVDA 1SUEA 4H31A 3DL4A 4LBYA 4TMZA 1S89A 1G2QA 1EHYA 1H2ZA 3DJFA 3H2YA 3MMNA 3PDUA 4X6LA 3SYTA 1M9NA 3NOOA 3IPXA 2HF2A 4BQNA 5IDQA 4L5IA 3UKDA 1I7QB 3QITA 4LWZA 5BSEA 5H59A 3ETLA 1RPTA 1XDBA 1LRKA 1T91A 4L7VA 2FE4A 3USCS 1MDFA 2IOYA 3K5HA 4BCCA 2PUCA 2QRLA 2DHEA 2DY0A 2ZPUA 2IZZA 4FHGA 1KQNA 2ZYRA 1BD3A 1IOVA 4ALNA 3IOYA 2UYHA 2R4QA 1MAAA 3T54A 1TEVA 2ZUCA 4HMQA 3IA2A 1CF4A 1YDGA 4TTPA 1LPMA 1T10A 3CPEA 1TK2A 2J5RA 3K0AB 3BE4A 2AOWA 4LVNA 3PUHA 1XEWX 1KEWA 5FI3A 2YWRA 4WBSA 3CX8A 4JR0A 4FN4A 2AG0A 1EXNA 4R2XA 2ZYAA 1JVSA 1T2VA 3DWEX 5C7LO 3KPYA 1KI7A 3HCDA 3W8DA 3R5TA 1RLIA 3EXAA 4NOJA 1PIWA 4RGQA 2QTZA 5L3QB 2RI1A 3G2JA 4WECA 2P9HA 4M38A 3CRMA 4P2BA 2WVAA 3QQ5A 3H5OA 4ZZIA 1L1EA 4TRRA 2JD1A 1EFLA 3B38A 4U8HA 4DEYA 1VZ2A 3JATA 3IMKA 4UE2A 1SBQA 4H15A 4B7ZA 3BWVA 4PZCA 2HH9A 4BN0A 2GWRA 1GRNA 2EGUA 4QQFA 3F8SA 4OHXA 1D07A 3OLWA 4FLMA 4PLWA 2VBFA 1V6AA 1O87A 3UCEA 3V4RA 5FD8A 5HTOA 1G8PA 3THXA 2CVPA 4EG1A 4D80A 4OXNA 4U2FA 5IDYA 4U2CA 1GGMA 2HREA 3ILXA 3HBJA 1K8QA 1AQJA 3ELDA 1FRNA 4EG0A 3DF7A 3NETA 1CLUA 1PEAA 2RG1A 1Z0KA 3LT4A 5KYNA 1ZGAA 5KDOA 2FH5B 3BXEA 1EVIA 4LZJA 2XX3A 5EP1A 1M1YB 5EXPA 3RCBA 3CW2A 4DSTA 3WBFA 1F3OA 3I39X 1NLFA 4Q12A 1KARA 4MINA 3RHTA 1IHPA 3GUCA 3RYHB 4DIUA 3FRHA 3IP5A 2CBXA 2CDNA 3TBKA 1AKVA 3DHEA 3QIAA 4QHYA 1NVFA 4J94A 4K9RA 1KEZA 1I3KA 4XWOA 3BCUA 1V5EA 5CFZA 1DQSA 2PH7A 3JVDA 2P5TB 1MPXA 1EUDB 2HAEA 5DM0A 3W04A 1VDMA 4AIRA 2JJ8A 3C3BA 1BU8A 4N5IX 3ULKA 1E3WB 2ZJ0A 3E7FA 4L02A 1U28A 4EB3A 4EG3A 1NYQA 2WAMA 4BWGA 5KYWA 5L6MB 1RVDA 2NO5A 2CVFA 5CVCA 3U3RA 3O8NA 1CR2A 4FONA 3X43A 2HRRA 4L8YA 3H7AA 4RVDA 4S05A 5HF8A 2LCFA 1T5SA 2FWAA 2RKOA 5J5AA 4I50A 1XEXA 2DR0A 4BB9A 1A5ZA 3QPCA 2GCOA 2RHTA 4Q7KA 5HJ2A 1Y6ZA 1U4OA 1L4FA 1WDMA 2QK4A 3F4LA 3VGPA 5I9LA 3JPWA 5IEBA 3ZXUB 4LJLA 5HBRA 2FDXA 2RBGA 4L0DA 4IQFA 4MUJA 4EJSB 1PTJA 1VPVA 1BKSB 1UT5A 1U11A 4FFDA 4GM4A 1X8JA 2XPCA 4N3BA 3EEQA 4L5JA 4WLEA 5DKFA 5DSXA 4HL6A 4ER7A 1UZAA 3RD5A 3HDQA 1R5JA 3HYTA 3H17A 4QBFA 4KBGA 3OU7A 4ITUA 3W0LB 2F4VB 7AT1A 1JR3E 1CUIA 1YIAA 1VLHA 4EUSA 3CU5A 2I6XA 4R9UC 5K4AA 3C3CA 3KQWA 1F0NA 3Q7QA 1XX6A 2N42A 3BD6A 2WUGA 3QMVA 3KJFA 2OPHA 3AILA 1OE0A 1HEIA 2C83A 3CIOA 5I45A 2HU7A 2PT7A 4MW6A 1JEEA 1AXRA 1DBPA 1CRWG 2BMWA 1A9PA 4MWOA 2J30A 2QTHA 3H0CA 3HP4A 2ERYA 4R1LA 3N0VA 2AMFA 1E3JA 3KG2A 5FOVA 1TFRA 2IXGA 4JT9A 3E9EA 3QYPA 2I1WA 1K97A 3SICE 3VPCA 4BTVA 1ZCFA 4F72A 2FRDC 2EFEB 4H60A 3ZE6A 4X8OA 4BO0A 1CU1A 3MUNA 1NE7A 1PS9A 4TWBA 1Z82A 2PKWA 1ORHA 1JEQA 4IVQA 2VOEA 4BEBA 1TPYA 2HQBA 3DDOA 3PZBA 2R3SA 2H0RA 2HK8A 2BFFA 4CKYA 2FZ4A 3L4BC 3R0VA 1RKXA 1YCDA 5H70A 1V5WA 4TTVA 1G2OA 2EQAA 3W6PA 3L43A 3L7JA 1LSSA 4UCWA 3FBTA 2P67A 3ONWA 1LPNA 2EGHA 4C4TA 4ETWA 5K4GA 2R5NA 3O74A 3N8HA 1GTL1 2EFJA 3CKKA 4IYJA 3WB0A 3GLFA 1T36A 5JRZA 1OFIA 3B85A 4QODA 4I55F 1JBQA 3FUVA 5G2OA 2GN8A 5C7YA 5BXQC 4H4DA 5AM5A 3WGJA 4V2UA 1GPYA 1Z0DA 5EYPB 2B8NA 3PUXA 4HYYA 4YRLA 1E59A 3FLEA 5IAKA 4YI5A 3T5AA 3KT0A 4R2JA 3PQFA 1K2WA 1T2FA 1T6XA 2EFHB 4PHGA 5FV7A 2P11A 3B1YA 5FUXA 4BUCA 4DWOA 4ENRA 1BFKA 5BNWA 4B3RB 4Y30A 2CUNA 3TR5A 3ZU2A 1KEUA 2ZAGA 2V59A 3OURA 13PKA 4K8OA 4MQ6A 3ZGVA 5CDTA 4GLLA 1F17A 4M49A 4WA7A 3U0BA 3U44A 3HFRA 2BEVA 4UDOA 2XVAA 4U7TB 1XMXA 1AN0A 3GG9A 3K35A 3T34A 1CUVA 2GVZC 1DINA 1F0YA 1ST3A 3EH1A 4V02A 5KOIA 3HLTA 1NZJA 1QOPB 1QU3A 4OBEA 2X0NA 4GKAA 4RCVA 3RS4A 3T1VA 4M0CA 3CUEF 5SYAA 4HPWA 1N2ZA 1U28C 3H6HA 4M1MA 1ADYA 4TL8A 1UPAA 1XD9A 2X1LA 4DDMA 3M6XA 5AHWA 2GN9A 5M2QA 1MOZA 1ZBDA 2H4XA 3SIRA 2CY0A 1W35A 5AIBA 2HLPA 1MGPA 3O0TA 4REQB 3ONEA 4MYUA 4MQFA 3VQTA 2VYVD 1TC1A 1JIXA 1KPGA 1EG2A 3FNGA 3VR2D 4HQ0A 1WV1A 1KI1A 1V7PC 4OBWA 2AQ8A 2ZJ7A 4OHWA 4Z49A 1PTJC 4ZIRA 2NZVG 3E15A 4QNRA 1ATIA 2Y1DA 2KMLA 2GPTA 4D42A 5C81A 2PBFA 1GHTA 1BXRB 5FFMA 4LK3A 2FW0A 1XB2A 1T0BA 1Q44A 1XZEA 1E92A 3MMZA 3VC7A 4XTRA 2GK4A 3BEOA 2ZPTX 3H84A 4O33A 1G8MA 4ZWNA 3ZU4A 1GQFA 5JCJD 5JZBA 1QTRA 4RCYA 3PX2A 3LS2A 5KX5F 2YIJA 1HLFA 2MSDB 3F6PA 1PBNA 3DVAA 5EEHA 3FHLA 3DHYA 3R6WA 3D8RA 1XC7A 2C9DA 3DFZA 4JJAA 1VJ1A 3HVJA 5J4YA 2ZBFA 3CTPA 3PXXA 1P2TA 1FP6A 1AS3A 4HWPA 4L50A 4FZ3A 3VR6H 1ZVVA 3I34X 1A9SA 4OV6B 5KWVA 4UARA 4JBNA 3E0XA 3GARA 3MJRA 2YNMC 4ID3A 3A2LA 4QWWA 2M6KA 1MPTA 5DHUA 2W48A 1TO2E 2QTRA 3HFGA 3Q1LA 2IX3A 4MVJG 2Z2YA 2I3ZA 4YP6A 3HV2A 4WASA 4TV9A 4R1TA 4EDHA 4DEXA 1P1FA 1FFSA 3AERA 3THWA 3NP7A 4AMYA 1QXSA 2OE2A 2P0YA 2I2BA 1RBMA 1A9QA 1U2QA 2LVBA 2Y76A 1EI9A 1N2GA 1T9GR 1C5KA 2AD5A 1Y9ZA 2E0IA 2HR1A 2TSYB 1RC1A 4IS3A 4IJMA 1GZ5A 2CMDA 3PQEA 5CW1A 4AQYB 1G5TA 1IY2A 1GTJ1 3OZFA 4BFTA 1ENYA 2IJGX 2Y99A 4OHCA 2J0VA 2IHTA 4JGBA 2CFOA 1HBJA 5CB4B 2NX2A 1NFRA 2MSNA 4IIHA 1ZUIA 2NU9B 3SNHA 5AK6A 3OOYA 1H4VB 4JLWA 3JRWA 4ZTZB 2Q4BA 1KQGA 2FN4A 1O8CA 4UE6A 4ID9A 1EEXB 2QYHA 3VOSA 3PEUA 1EFVA 2FPOA 4KU4A 3TUZC 3AR5A 3IOMA 4QVKA 1M2NA 1U5BA 1GG2A 4RVFA 4F71A 1KWGA 1ML3A 2FETA 2P91A 2NOAA 5KQGA 4EEZA 3C3MA 2A0KA 3BB4A 2J7PD 4ENTA 3A1UA 3QWBA 5JATA 1LB1B 1I0ZA 1TCAA 2A1TR 2H3EA 3K70C 1RRGA 4QA9A 1VKRA 3BERA 3BQMB 3G2OA 2ZUSA 4NS4A 4UKDA 3NC1C 5KSYA 4BQIA 1MVNA 4JLVA 1ODTC 4JBHA 4IWNA 1FJGB 1F7VA 4XZ3A 3OZDA 2HWUA 4WTOA 1X19A 1NA5A 1CD5A 1ODFA 4QYTA 4LRWA 3I5YA 3W9SA 1NT2A 2F67A 3GPCA 4UAVA 3S8MA 2QAGA 2V7WA 3WYAA 3Q5DA 4B17A 4MQ4A 1DCFA 2E4UA 1AOXA 2ZTUA 2VT2A 4GMHA 5JQGB 2FOIA 3ZY3A 2RAUA 3ZV3A 2HO5A 5I7WA 4JBWA 4YJ3A 4M0MA 3RJ5A 4QQ8A 4OBBA 4A92A 3U61B 3LHSA 4QASA 5TT0A 4DMHA 5J2UF 2W00A 2ZTHA 5L4SA 3WLFA 3OQNA 2IPXA 3CR8A 3LHDA 1SGWA 1JUDA 1XLTC 4NEGA 4QTZA 2QRKA 3SZ3A 4U7FA 5JI3E 2W6QA 1SU8A 1UKCA 1F3LA 2H1FA 3K9GA 2CNLA 2HMVA 1WCIA 4E51A 4YLYA 5TQ0B 2HADA 1U3DA 2XDQA 3OE7A 3W79A 4N9QA 3VV2A 1QH8A 1XKQA 3BIWA 4PX3A 1IK4A 1FFCA 1N2IA 1EJ6A 1RR6A 2XOKD 1NY5A 3FA2A 3UJ6A 3ZXYA 4TWAA 2PU5A 3B60A 1V2GA 4K05A 4L8FA 2YJ3A 3ZIAD 3RVQA 2ODWA 5EQTA 2HMTA 2ODPA 4MARA 4OB6A 3C39A 2C7PA 1UDWA 2WHEA 2JCBA 2OZLA 2Y1LA 1IQUA 4V0KA 3RB8A 2MJLA 1ZZEA 2M9MA 4AN0A 2PKYX 7ADHA 1P5FA 4C4SA 3KEGA 2E4YA 4GBGA 2M1ZA 3FPSA 4Z1MD 1CQJA 2DWOA 3PR1A 1Y1LA 2QAJA 2YUIA 4O4HB 4OJQA 2IBMA 4BNWA 1P7YA 3KR1A 2YN0A 3FUCA 4W5RA 4GOND 3C3KA 3ELBA 3CO0S 2W4QA 3IAHA 2IYUA 1QX3A 3W3AA 2OZPA 1QKIA 3FD8A 1PT7A 1FFGA 4ZQFA 4ILKA 4Y2JA 1DI0A 3ZQJA 1IN5A 3JSXA 3PTAA 2Y6UA 4D45A 3T94A 2IUEA 4LTMA 1EBFA 1EFRD 1YAHA 3RC2A 4XWKA 4AG5A 4D6YA 3FVTA 3S27A 2LRHA 1BROA 4HY3A 4P3YA 1UZNA 3TH5A 4CTOA 3WDMA 2IS2A 1WUKS 2P9TA 1GR0A 3B8EA 5ALDA 2FHPA 1WY7A 3FVQA 4TLAA 3A58B 1Z17A 4P82A 5BQXA 2QPAA 2ZJ3A 4GX1A 1AO0A 5C2JB 4QDOA 1RZVA 5LOVF 2Y77A 2PXHA 3DMGA 4AKHA 1G21A 3WWDA 2HOQA 4WGFA 4OP1A 1JZQA 2Z2KA 4UUAA 4A8HA 3F6RA 1LDEA 4CM5A 4EFMA 2WYIA 2IC5A 3LXXA 1VRWA 1V25A 2C95A 3ZY6A 4HFRA 4C07A 5BQFA 2QSZA 5K8JB 5LIRA 1L5HA 1YQEA 4ZYWA 1D0SA 1QPZA 2QE7D 1SY7A 4BMYA 3GB9A 2G7MC 2PX6A 3I0NA 3U7IA 4J2TA 1RFLA 4N5LA 5K9ZA 3T5TA 4AP9A 2C58A 5IJ9A 4NNOA 4K87A 1NW3A 1XKTA 2NTNA 2XODA 4JJ6A 1H1LA 3HCBA 1IOWA 4KJXA 2IWRA 1OFVA 4B09A 1XI2A 2PUEA 1OXMA 5ALEA 2EQ5A 2ZT6A 3GELA 1XMQB 1PLJA 1E2HA 4RKEA 5AI8A 3WQHA 3NVKI 3R9XB 4LEIA 2O05A 4XD7D 4KQGA 2XRFA 3UAXA 3U39A 4EAAA 4EZIA 3VNVA 1V1MB 2PNFA 2A4MA 3L82B 3PNLA 1Q50A 2XYGA 4FYIA 5HFJA 5IAAA 3UW1A 4DV2B 1IZ7A 1TPZA 4MGHA 1QK4A 3G88A 2IEGA 1DWQA 2OLJA 3QWFA 5KSPA 3JQAA 4BNKA 2SNIE 3W4IA 4KKXB 4DMCA 1C30B 2VXCA 4KUEA 2GN0A 3ZK7A 2RI0A 4J2OA 2GLXA 1SC3A 1SHJA 1IEVA 3BK2A 3MOSA 4MEBA 2GEVA 4QBTA 3OLQA 3OAAD 4Z0NA 2G1PA 5HJEA 1NKSA 1E5TA 5JANA 2VEOA 4NHEA 1H9AA 2C4WA 3LQ1A 3B6KA 4EG4A 1C8BA 1NZDA 1OA0A 4ZT2A 3SLGA 4A0SA 1UAYA 4BNZA 4WZ6A 2R68A 3TVTA 1RWKA 1JYEA 5C9ZA 1T2DA 2AMYA 2H16A 3AB7A 1BX0A 1JIKA 2BFAA 4W7IA 2EG5A 4FFVA 3F5QA 3SY8A 4GM0A 3MJVA 1NMEA 2GYUA 1GCIA 2DQZA 2O2EA 4PSCA 4N49A 2B20A 2AXQA 4YMHA 5A1JA 1AGXA 3E22A 3LYUA 3AU9A 1VPTA 4ND4A 1A8HA 4BDSA 1UXGA 4RPGA 3H16A 3KL4A 5KU7A 1L4YA 1U8TA 2H7XA 1US8B 5DTIA 2W8ZA 3QVLA 4GLOA 2ZSHA 1SULA 4DCVA 3KYBA 4PSVA 1N5RA 2EZ4A 3BHIA 1U9ZA 2IEAA 5A4DA 4NQZA 4HWSA 3HZHA 1VIVA 2ZATA 3FCEA 1RMTA 4QVGA 5I3CA 4R3NA 4WH0A 1HO3A 1RWOA 5FORA 3L7NA 4G0WA 1MZPA 1G8HA 1ZCAA 3GVIA 4UUMA 4WFQA 3EVGA 5K1ZA 4LY6A 2WD9A 3F47A 3I2FA 3OPYI 3D7RA 1UC5B 4IIGA 1Z68A 1S96A 1Z5ZA 2IF0A 2RBEA 1OAOA 1KDOA 3A04A 4Y98A 4GP6A 1QYRA 2CKMA 2E5FA 4EVQA 1NKVA 2VAPA 4H16A 2BD0A 5LM3A 3BRWD 2PZMA 4GECA 3ADCA 1WIWA 1IJFA 2RB4A 4KQEA 4WBXC 1GGFA 1LTKA 4R9RA 3ZTTA 4TZ0A 2DPXA 4XSVA 3KB2A 4Y2VA 5EINA 3JXEA 4KFUA 5CXUA 5IMBA 2IE0A 4B6OA 2IEIA 4M7OA 1U8UA 1O6GA 3M6FA 2REQB 1AUOA 2CB9A 2JBHA 4FX5A 1I9GA 5JAQA 4P86A 4FQ7A 4K86A 4EI8A 3AIMA 3G2KA 1BAPA 4K40A 5IC4A 5KPDA 3UXMA 1C29B 2J4DA 4PM4A 3TLYA 4R8LA 4GT1A 4UOZA 3DMRA 4ENWA 2I87A 4KN5A 4PV7A 4X41A 1OMOA 3CC8A 3ZYZA 3MAJA 5EOVA 3VSDA 4EB8A 5JTTA 5DGIA 2HBQA 4JKOA 3AUFA 4ZARA 1E6MA 2DJIA 3L9WA 4L15A 4UAJA 1FTYA 5JUWA 3JAKA 4N48A 5KTPA 3H5TA 2ZYSA 1T5BA 1KZ1A 1CEXA 2CHUA 1EWTA 1FPMA 1U2GC 5HKKA 5EKSA 4BNYA 4EJFA 4JT2A 3LXRA 1IOLA 4J07A 4MKXA 1NDUA 4U5XA 1QGZA 3JQ8B 5GY7A 2RHHA 3T0FA 3U1VA 3U81A 1W4AA 4AS1A 3OLZA 1L7VC 1LJ8A 5ALWA 3W2FA 4YCDA 3DV2A 2PZAA 2OD2A 3P0HA 1N8SA 4IEEA 2RFLA 5AVKA 1N3YA 2AR9A 4LZPA 2ORED 4L07A 4EW6A 1HTWA 1R5NA 1RPAA 1W0JD 1HT3A 1KY5A 1X87A 2BPOA 2J3KA 3IILA 2VI5A 2G83A 5K51A 1TGYA 3ISJA 1DAMA 3A26A 3FPHA 4DLWA 1IJEA 3B6ZA 2KBEA 3IT3A 3U16A 2BIFA 2GTIA 3B53X 4X60A 1WDTA 2PLRA 4GMXA 4QXPA 1JHOA 4GSYA 3D6AA 3ZY2A 2A9PA 5CR9A 4NENB 1C80A 2GM9A 1YNSA 3RC7A 4DWJA 2A57A 3IMGA 2M6SA 3ZLJA 2DLCX 1LDGA 3DVRX 4YUWA 2NO6A 3RW9A 1P91A 3UMYA 1J8QA 1EE2A 6GPBA 1ADBA 1GY8A 2AYYA 1KAGA 2GZSA 4LGMA 5D2CA 3TSCA 1DLJA 3I42A 2WAXA 1Z6YA 4FMDB 2CXHA 1L5SA 3RWMB 4YRZA 2CF6A 5FTMA 1TAUA 5KVVA 1RRKA 2RGWA 5AVRA 2QRUA 3V33A 1YZLA 3QKIA 3WIDA 3NXKA 3A1FA 4XB2A 5LQKA 4KN8A 3LLVA 4M7WA 3VHLB 3OCWA 1PJ4A 3JY6A 4GXNA 1WMSA 4KQ1A 4ZMSA 4QZVA 1Z35A 3HKDA 4A91A 4YUYA 2ATVA 4Z3OA 3LW7A 4OKIA 1A5BB 4WVFA 5C8VA 3NS7A 2H4JA 3T41A 2WZQA 5CH3A 1IN1A 5ICEA 3PZRA 2QDKA 2ZRCA 1QGUB 3L1JA 1YS9A 3WWPA 2QF7A 5JU6A 2WPNA 3M1IA 4Q4JB 1AKMA 4M1QA 2VJKA 3ZS8A 3FCXA 2J9ZB 4L8WB 3BKWA 2CXOA 1NJ5A 4TVOA 3S6JA 5BV0A 1E1CB 2D3WA 4RWZA 1H94A 4Y9RA 2AOXA 2QT0A 3SJ7A 5KI6A 3KSRA 1L4LA 2WVHA 3FYTA 3ORFA 4M1SA 4EBFA 3BX1A 1N1DA 2JA2A 2HF9A 2ONYA 3HLKA 2H2IA 2VDKB 1DO2A 2KI5A 3ZWPA 1NRWA 3A10A 4EBBA 1SRRA 3V2GA 1FX1A 2MSCB 3NVDA 2IA5A 2IPAB 1ZUWA 3OI7A 3O94A 3EGDB 2F6RA 4IMJB 3RSGA 3S2EA 4DILA 4UPEA 4LYFA 5HPYB 1JG6A 1RLMA 3RVJA 1T6NA 4DB2A 4ER5A 3RIXA 1G9SA 2O4CA 5CK4A 4QTYA 4WDRA 1YRQA 4JI3B 2QTVB 5CB6A 1U5CA 1YI8A 3CF0A 1EB9A 5NLLA 4A27A 4HN9A 1XHFA 1ILWA 1RKUA 3H18A 4LXGA 2H9YA 2Q5LA 4QPPA 4DRXB 1XWWA 3DHVA 3V9AA 4BKMA 2B4YA 1GKIA 2JDIA 1VRVA 1R0XA 1GFWA 3LBNA 1RHUA 1G5RA 4AY2A 2JKYA 1RJGA 1VMAA 1FVHA 1YBFA 1N2XA 2WF6A 1P62B 2WHPB 4YLGA 2QM7A 4E5KA 5B6IA 5FUQA 1EWQA 2LDXA 1ZO8A 3WNDA 4AYTA 4DNOA 5EJ9A 5IFKA 5GIPE 1YSCA 3EPRA 4ZOEA 5EP2A 3KSDO 5FL7A 1U2DA 2JNWA 1BYUA 3RC1A 4CVNA 1HTTA 1VLLA 4J29A 3CX7A 3GFQA 5C34B 3C4VA 4YP1A 2MINB 3UW3A 5M34A 4DM4A 1NZFA 1RMYA 3DB1A 4BHTA 3B2QA 2CV1A 3AVUA 2YCLA 1NTRA 2B25A 3GZTB 1UANA 4PCUA 2WU0A 1HYHA 3JS5A 3LZCA 2VRNA 1VSUA 4JQOA 2I55A 4G1FA 5FBZA 5HF9A 5HKLA 4BMCA 5IHPA 5K0EA 5JXGA 2RC6A 3F6EX 2OCPA 4UPDA 4HAIA 2ESRA 1NHWA 4LBWA 5K3CA 4QXRA 4RLFA 3DEZA 3FWZA 4QEKA 4S3MA 3UM9A 3RBVA 3I8OA 2I62A 3E9NA 2RIRA 3EA4A 4D43A 2K7FA 2O20A 3OIFA 3EBOA 3GMDA 6ADHA 2XXBA 1KH3A 3A6JA 1ZMBA 3HJGA 3PV0A 4M54A 2ZYVX 3U37A 5BQ3A 2ZI4A 2WWRA 3TLAA 1YJCA 3DKPA 1BXZA 3LUAA 3AFGA 3NEYA 1W6RA 1QHNA 2V7PA 2WKRA 4FFOA 4G63A 5EZYF 2HFJA 2BHSA 3OD1A 4BNGA 4L2IB 2Q3MA 4AKTA 3IUPA 2F8MA 2EBFX 4OKNA 4QYSA 4AKIA 3OWHA 4E5VA 2O0JA 4BLPA 2GMWA 3RNLA 4IZHA 1YASA 4MI3A 2P2ZA 3ND5A 4ZA2A 4YXWD 2C57A 4JROA 5AKZA 4F4DA 1V41E 1PUXA 1M1ZA 3C3EA 1W49A 2QLMA 4B3MB 4ENQA 2I6QA 4JXJA 4IDFA 1IAQA 1J9GA 3PFFA 3T3HA 4HQ6A 3DMYA 1Q7RA 4Z54A 1RWWA 4MS1A 2NUPB 2JIPA 3O3NB 2D2EA 1BCRA 3MC1A 3WBJA 3N05A 2OUIA 1LKZA 5LQNA 5CNIA 1DCKA 3K2QA 4UBLA 5KNDH 2P7IA 2VL7A 4JR1A 3RRMA 3HKEA 5J4VA 2HGZA 5G0TA 5JR3A 3H1BA 3PD0A 8AT1A 2Z1MA 1GUDA 4CHTA 2IHBA 4K28A 1HX7A 1EBUA 2ZJAA 3L04A 5H83A 3RUEA 2H52A 3KV3O 4BLUA 1ORTA 1MX9A 3K94A 3PGXA 4PY2A 1LX6A 1XD8A 1X8LA 1KY2A 1Y3AA 3MWDA 4I19A 5FULA 3OQ1A 4CM7A 4ZGWA 4P3PA 3COWA 1Z0AA 2VTBA 4IICA 2ZB2A 1XZBA 2VO1A 4MITA 3CVVA 1EDEA 2VF4X 3BFVA 3FAZA 4N0QA 1TADA 4YK7A 4FHFA 3WLKX 1JR6A 2OHXA 3R8FA 4G9BA 2CFTA 5CDFA 4CBVA 4ZAXA 2I4NA 1HTBA 1A5SB 1YDWA 3IKLA 3P9RA 3DL0A 4CMIA 4EY5A 3K6RA 4JC5A 2A5FA 4JX8A 3AX6A 4KGVA 4HAXA 4K9QA 4LYYA 5DN6A 5IZCA 2IS6A 4TV8F 4NBNA 5TF4A 1A9RA 3GXBA 1XSEA 2BGTA 3IERA 4TRMA 4OX9B 1OLXA 2Z8ZA 1FDIA 3CTMA 5JI2E 5AOAA 1XV5A 2VATA 2R86A 2PMKA 3AGQA 4KMOA 3LYLA 3Q3EA 1FP4B 2IGTA 4AJEA 2BY4A 2WC1A 2XIQA 4UM9D 5E2IA 2EKLA 1M7GA 2R8ZA 1U2DC 4UTZA 4EFDA 1TEZA 1U0EA 2ENUA 3BMQB 1ZW6A 2WBLC 4RHFA 1X1TA 5AJYA 2OHJA 1OC2A 3MJCA 4A8PA 1QG4A 2CFRA 1G6OA 2FPXA 1Q12A 1S2IA 2R6ZA 3BH7A 3U48A 4EYSA 4F6CA 5CUQA 4IHJF 1ZKMA 4MQUA 4OAOA 2FHSA 4R1OA 3WZ2A 3ZXSA 4BEWA 3T5GA 3AXTA 2IUSA 3O8QA 3P9QA 5AK5A 4Z2AA 2OZEA 3SHWA 3FMVA 3MJFA 4ZRDA 3ZBPA 4RTLA 2VHQA 1J4AA 4A0GA 1WOMA 3VR6A 1DUSA 1K8ZB 3IMFA 4NE2A 1IZZA 2ZVPX 5M3BA 2UYYA 3IDFA 4H7FA 5KTRA 5GZ3A 4RIHA 4CUZA 2ZCUA 3ZVMA 3G89A 4AXXA 2PRZA 2NU8B 2GNPA 4WNYA 2OV8A 1E7MA 3IEIA 4KE7A 5E4TA 5HQ3A 1GOTA 2J41A 4F6RB 5A04A 4RKYA 4RD2A 1RHQA 5EWMA 1I7LA 3PL1A 5EA2A 2VYND 2CBGA 2V98A 3AEYA 1VLVA 3OE7D 4OHRA 1L5QA 3FSEA 4LRQA 3P19A 2VTDA 4OMCA 4A82A 5E4FA 4WVLA 4AIIA 3VPDA 3TLJA 2FGKA 1R4MB 4FMPA 4GI5A 4GKVA 4RL4A 5JV5A 3KAQA 2AWNA 1JIVA 1MJHA 4G26A 1SKYE 1KZHA 3T99A 4NJOA 5AW1A 1P4RA 1UFRA 2JLBA 1BHSA 5KOHB 1GITA 1PQPA 2A5GA 4UVEA 4QLAA 3CF6R 3OJLA 1LI7A 2RHOA 4FKMA 3WKBA 1YKGA 4DNQA 2DVMA 4P31A 2J0EA 4HWRA 2Z95A 4KFCA 3A6ZA 3HV0A 1ZX1A 3DVLA 2HCJB 3L5OA 4W8GA 1NUPA 3K09A 1QO9A 2YN4A 5DBFA 5PGMA 2R1TB 4TVKA 2J4CA 1SCNE 2NYRA 3QE2A 1V8FA 2IITA 1R4AA 3WDKA 3X1WA 2ZT7A 1SVLA 2JGMA 4XLZA 3LLSA 5BN1A 1W96A 1M2HA 2PA0A 3G85A 2WMOB 1JILA 3KVOA 3KEQA 1X0VA 4E4TA 3W3AD 1WMFA 4BU0A 4CM8B 5CBKA 1PT6A 4PC2A 4CMBA 1JHPA 4NCNA 4E30A 3HN7A 4YI3A 3G9ZA 2DX7A 3LCCA 2RI6A 3QUTA 4UZSA 5L4LA 5DEOA 1CEEA 3TSYA 1JNXX 1ISGA 2JFVA 4AZ0B 3THYB 2NVUA 5AYVA 1P39A 2Q4EA 1RYBA 4IR7A 3PDJA 5IZCC 4NWIA 4O4IF 3WI7A 5TT1A 3R9IA 2VJAA 4K46A 1X7YA 2H1OA 2PMBA 3OY2A 2QPTA 3JQ7A 2IOHA 3C8ZA 3QIVA 3ZGZA 1EESA 1RBYA 1VP9A 1JALA 3H2HA 3FYUB 3ECSA 3KXIA 5BMVF 5C80A 1BW9B 2BFOA 3KALA 2NO1A 3M6UA 4G5OA 2Q4OA 4NMHA 3UWKA 5AUPB 5ADWA 1YFZA 2MT9A 2O2XA 3P97A 1Y5MA 5TSDA 1LVUA 4BJ6A 3MRVA 4GBJA 4K9LA 3RC8A 2GJ4A 1JDSA 3CBQA 4KB5A 1DBRA 2J1LA 3IAM6 4HAZA 4K1XA 1UZLA 2FB9A 2PGJA 5FHQA 2YHIA 4MR9A 2YVQA 3UXEA 4UCFA 3EDCA 5AI5A 3NGXA 4TOIA 4KR7A 2F8TA 2V9PA 1E3EA 1VL0A 3ZG6A 1O95C 1I7SB 5AHRA 4GR9A 1DJNA 1ZH4A 4LXUA 4JOBA 5HTKA 3HI4A 4ZI2A 2IPMA 1GAXA 1J1UA 1G5QA 3KXKA 4E03A 1MRSA 1G16A 4FP9A 2XXAA 4FEYA 4C6SA 2HDOA 3ABRB 3PITA 2GFQA 5D1NA 3ZHRA 4X3OA 4D8WA 4L4YA 1KI2A 3SBOA 4K9NA 1G8SA 4CF4A 3EGXA 1V8PA 1E5VA 3ETEA 3WQQA 4BRSA 3JQAD 3VR0A 1RHJA 3QUBA 4LISA 3OC0A 1MCZA 2V7GA 4UUQA 1QYXA 1XTVA 3SP1A 5JTUA 1U7ZA 3IAFA 1UJMA 4MV0A 1IQPA 1Y42X 1ZU5A 1K27A 2XA1A 3FX2A 3JYOA 4FGWA 2Z8YA 1A0OA 1U6IA 4JKYA 1NV9A 1ZNYA 2W2MA 5EHGA 3OG9A 1OX5A 4B75A 4XYMA 1OF1A 1A5AB 1PVVA 3EVZA 3TS1A 4B0PA 4BWVA 5KYUB 4LBVA 1UBCA 4RIIA 3VVBA 4NCXA 1YFKA 1M2FA 3ZD7A 3W05A 4LWPA 1PJ3A 1JKIA 1MEJA 3NHMA 4S2EA 3SVTA 4FFBB 1XQYA 1AMNA 1ZIOA 4BNJA 1MORA 2XDWA 3NIWA 1P77A 1XAHA 4EO7A 5JYBA 4PXYA 1ANKA 2QTWB 4X95A 4L5CA 2E3JA 4KHZA 2Q1TA 3VI4B 1N1EA 3H3JA 1E2NA 3E23A 4UMVA 2XECA 1P2GA 2E49A 1P29A 3EF0A 4ZT3A 2UXDB 3HKBA 1T4CB 4U2DA 4G2NA 3M1AA 3H05A 4CEHA 3UFXA 1UZMA 1YS1X 3PE6A 4HK4A 5KVCA 4ZCIA 3T5PA 2C2XA 4AUMA 5EMJA 4DVGA 5G1PA 4AMVA 5EJ5A 1PDOA 3EH2A 1BX1A 1T9CA 4GWKA 4HUQA 4R2WA 5EC8A 1GTSA 2FJ0A 4IDCA 4DREA 2TRSB 4FCTA 1N0VC 3BK7A 2FQWA 2B9VA 3H5AA 3IBCA 4RIFA 3SQLA 2YX1A 5D7NA 4CM4B 2PMFA 4KLZA 2GDJA 4INAA 2CN1A 1YHZA 1CZLA 2XUAA 4YV1A 3CIFA 4GPZA 1RI1A 3QE9Y 2FDCA 3PUWA 1IEWA 1ZESA 1N8KA 1BVYF 1JX6A 5JSZA 1JXAA 1R6BX 4GZ3A 4A8JA 4K0KB 1ESCA 4H77A 4L72A 5EJ4A 3AO0B 2ONJA 1NMSA 2GZAA 2OFWA 1O9BA 1RWVA 1QYIA 3GEIA 1Y6RA 3IBGA 2OBFA 1EVZA 3JSAA 5GWXA 3I9LA 1TD9A 2C04A 5JJCA 4ZI7B 3RQSA 2NQTA 3M4NA 5JPDA 1Z6PA 1FP7A 1RPJA 2RHJA 3ZUPA 4EUFA 3FUUA 1T8TA 1Q5PA 3G9XA 4KV9A 4RK1A 1GCUA 5KWSA 1IHXA 2FSSA 2FUEA 2QA5A 2V03A 3KPWA 4W5HA 3BA1A 1E60A 1IBCA 1UL1X 4RPIA 1E2IA 3PD1A 5CBPB 2FQQA 1GSIA 3A3YA 4PNZA 5H1YA 4P0PB 1QRRA 4D9GA 2IFTA 3KVYA 4A0RA 4J0IA 3D7LA 1CY8A 4A10A 4JBGA 1YBMA 3OF5A 4ZK6A 1VL1A 1BN7A 5FLXA 2AJLI 1RLUA 1E9FA 4IQ0A 3BBPA 4C0JA 3LU1A 1G6Q1 2ZM5A 1K08A 2Y1GA 2B92A 1O96B 3NORA 2H65A 2J3QA 5FFNA 1WABA 3I9OA 3NRBA 2AR7A 4HDOB 3DAOA 4QL3A 2ZU6A 3N0TA 4CTKA 2DFDA 4W8OA 2GR9A 1OBHA 3NBXX 4I4LA 4AJ2A 2WFAA 2HA7A 1DJLA 2OO5A 3QBJA 4JMPA 4BE7B 1XJCA 3F6CA 4EPXA 3JV7A 3PXDA 3NG1A 3AJRA 1PNQA 2WWWA 4P2GA 3JWIA 2JH9A 2GZ3A 2AD1A 4N76A 3WDSA 4E21A 1INLA 4TN1A 3C3YA 4D0RA 3UPUA 1SKYB 4V0QA 2G4CA 2R8PA 1UBUS 3EQ9A 4C5CA 2JGNA 1DC6A 1QS0B 2CZCA 4QBKA 2OB2A 4R9VA 4DKJA 1AGRA 1OFGA 3G79A 3U5ZB 3TPCA 1EJ2A 5BV8A 3LX8A 3WB2A 3UKOA 4JK3A 1XU4A 2V7BA 4YRCA 1GT6A 1E2KA 4KR6A 2Z3ZA 3PVZA 4CE6A 4CUKA 1RZRD 4BN4A 1C7RA 3MT0A 1EMDA 3DBHB 3IVCA 3WWOA 1N34B 2C2OA 4WNAA 2VWPA 1Z4KA 1AGPA 4JLPA 3PFGA 1WNTA 1XZLA 3IE2A 3IDSA 3VHQA 4O2BF 4EY8A 5JHGB 2WFLB 4ZCTA 2AOTB 1MO3A 4B71A 1U0HC 3I72A 5FNVF 1DRWA 2P79A 1EWYA 1SAYA 3VA7A 4E33A 1WD5A 3GC6A 2ECKA 2PA3A 4PVCA 1IMOA 1O6CA 1YC5A 3G59A 1AKUA 3KD2A 2VJPA 4P3OA 4F8JA 5BYBA 3PYXA 3HXOA 2HA2A 2ZB7A 1FSFA 3DZ8A 4LHZA 3KETA 4OYLA 3P45A 1BEUB 1QORA 4YRFA 3PEVA 2JJ2D 2WVGA 3JWGA 1QHXA 5IDWA 2VBGA 1XD2B 1TZ2A 2VDOB 2O5VA 2F3PA 1OHHA 3QXJA 4OHZA 4K2AA 1SUDA 4D8XA 3NM6B 1QVWA 1RWXA 4GAEA 3UK1A 3OTHA 4FIDA 4LFBB 2IP2A 1DT3A 3L92A 1C3EA 3TNJA 3LFTA 3CLUD 1DEXA 4XGNA 3GLRA 1TKBA 5BVGA 1PFKA 4YS6A 1MHPA 3ZWXA 2YJZA 4KPUB 1BQEA 2PK3A 4TS3A 5AI6A 5HXAA 1QAQA 3IIMA 1VYHA 1T3GA 1WL8A 3PTLA 1WF3A 1X9IA 5IAGA 4Z1OA 2X0RA 3AV3A 4PYRA 4A8JC 4AT1A 1DTSA 3W5CA 3SDBA 3IV7A 1K6EA 3C4JA 3C45A 5JD3A 1BRTA 1IXKA 2B8JA 3QEMA 4N65A 2IZ5A 2C9YA 2IZOA 4KUGA 2DCUA 3OM9A 2OXFA 1KPHA 1G2PA 4RXTA 5DJ5A 5ERYA 1H2BA 3F97A 1CULC 1EZZA 1I1NA 4J0KA 4HDNA 4QDZA 4ZHQB 2M32A 5ICGA 2CV0A 1ZY2A 3AJDA 4FBMA 1Z8HA 5DXFA 2P65A 5JJLA 1SCDA 1XZAA 4DTCA 3H8JA 2C9ZA 3AM4A 2Q29A 3PE4A 3CGWA 1XRMA 2G71A 2PGDA 3EIHA 1LH0A 3HYLA 3QVTA 3WYDA 2D8AA 1AT1A 1D3AA 3ESXA 2LW7A 5DCWA 3HM2A 4C7MA 4D7AA 4PAGA 1CETA 1R15A 2DLNA 3M4YA 1K7EB 1T35A 2ERCA 3EIUA 1P73A 2XTMA 2FW9A 1Z83A 2C4MA 2QMHA 2XGGA 2JDID 3BGWA 2HRBA 4MVJI 4GE0A 2GBCA 3L02A 4WK6A 5KWEA 5IYZB 1UBSB 2I4LA 2UAGA 2Z04A 3O8LA 4ND2A 2JH3A 1IAVA 3VNSA 4IUCS 3FOEC 4AWXA 2VKTA 4HDAA 5JMPA 2ODAA 1GWNA 2OO5C 2X9NA 5GMOA 3SYMA 4F3KA 4BY9E 1TVKA 5FL7D 1O94A 4BWFB 3B3FA 1VTKA 4LOKA 2GN1A 4ENVA 1WQ4A 2YWHA 2XVYA 1CVLA 2FEKA 2AQIA 4FXPA 3FG9A 3PYLA 5LLTA 1VCNA 3OZSA 2EXXA 1NR1A 2ZUWA 4N3AA 3T4UA 3LY8A 5LQDA 3BMNA 4RTKA 5L40A 2O1XA 4O5OA 2F3RA 5KDLA 4RK5A 1ADGA 4AUNA 421PA 1GDTA 1WXDA 1R64A 1WZNA 4KXXA 2VJOA 3V00A 4WCFA 5JEEA 4RH3A 5LZ9A 1U5AA 2R5FA 1ZGZA 3BREA 3DBVO 2GARA 3N86A 2Q1SA 2X3UA 3R7WB 2FGJA 3OFNA 5B6JA 4AMGA 1Y4UA 1ZMXA 1RAIA 5G40A 5KTYA 2A9KA 2XEXA 4IJWA 1ZRNA 5MF6A 4PBRA 1QH9A 3QXGA 4JJEA 5DTEA 3KQPA 2QD4A 4HDMA 4ANFA 1V95A 5ALUA 4DF3A 2ZZNA 4KQIA 4QD3A 5EUCA 1DRKA 1KQPA 1TYDE 1YDFA 1YONA 1TCVA 3Q8WA 3R6GA 3HUTA 5K8IA 4GZ6A 4WW0A 2SCUB 3QMMA 1F38A 2YBEA 1L4KA 5SY9A 4F3NA 2GF0A 4JI6B 4OQDA 5FPSA 2ZFUA 2DPGA 3NAZA 2CXNA 3UTCA 1LV8A 1P7VA 5AM4A 2VCYA 1EK1A 4JQZA 1VXOA 3NGMA 4WBNF 2BN4A 1ECJA 1K9SA 2PRSA 4BX8A 4DSZA 1RKBA 5CDHA 1Z4MA 3RYFB 4MP6A 2OR3A 2ZJYA 1QAMA 3LK6A 2ATEA 3EC1A 5AI0A 1W5FA 3O4RA 1AF7A 1VMEA 1ZDMA 3WNCA 4G0QA 1CY0A 1BJRE 1NUUA 4OUDA 3S4YA 4JLBA 3PNKA 3TI9A 3H75A 3CNBA 5JC1A 3OSUA 4HX2A 3FDJA 4PRLA 4DT1B 2VHCA 2XE4A 1C3XA 3K2IA 5EWLA 2BFDB 4RVCA 1XXHA 3SF8B 4ZVSA 1EDOA 4GFDA 2I2DA 2GBFA 3TRIA 1TU0A 1MOSA 1P61B 2I3GA 2X76A 1NBAA 1VI6A 2V6GA 2R00C 3M4ZA 3N7AA 4DLUA 2VTKA 4G97A 3NHRA 1ZMTA 1E62A 1ODSA 2VRCA 4I1OA 3IAAA 3R7NA 5JZOA 1YBVA 2OLKA 4ZVTA 2HSEA 4PTZA 3MAGA 4F1WA 2BSXA 3AEUA 4EPYA 2FVYA 2IXBA 3ELUA 4NZZA 4JN6B 5CT5A 4XYLA 2YY6A 5K5EA 4OQ4A 3INRA 4K81B 3VHXA 3MS4A 3GGPA 4F4CA 1GNLA 3FM9A 4LA4A 1KJIA 2HPAA 4HDCA 2C4KA 3EOBI 4HNSA 4LKRA 3TTSA 1KHTA 1Z9BA 4OOEA 2R62A 3S7ZA 2HNAA 1XE3A 3H2BA 1EA5A 4R7GA 2ZWIA 4EZEA 2P8JA 3Q11A 4FCVA 2I54A 3FY4A 2XUJA 3FFXA 3QRWA 4FDLA 4I4IA 3Q10A 3RS9A 2C5HA 1WQ3A 3IP7A 2DQSA 5GJVC 4QHTA 1PN3A 3K96A 4M37A 3SKXA 1J7KA 3NUZA 1I3MA 4JNCA 3AI7A 2JVJA 3KPVA 2V7QA 3BMCB 4JQCA 5CGZA 5CAEB 3ZWDA 4BC0A 1WG8A 3GHYA 4ZRMA 3GWGA 2XMZA 2E85A 1NUAA 1EM8B 1COWA 2BMVA 3Q72A 3D7MA 1VBNA 3A1TA 3ZZ1A 4DLVA 1D5CA 1GCGA 4QO8A 2RCYA 5DNVA 5JZMA 2JJ1D 5FQNA 1KFBB 4B6RA 2Q5OA 1FDUA 3O73A 1YE8A 2D0OB 4RTJA 3R20A 1ICEA 3ZQKA 3E4DA 4CU2A 3KZXA 3SYKA 1S9HA 2AOVA 2XH8A 2D2XA 1GQQA 2Q5IA 3S40A 1YQ9A 3D9QX 3PQ6A 1BO6A 3W8NA 4OB7A 2FN3A 3QA3E 1DKRA 5JCOA 4ZQEA 3TZLA 2IOFA 2NSHA 2ORIA 1C3LA 3AM5A 4MVJM 3EXG1 4PX5A 1TKRA 2J48A 4ZZ1A 2PL3A 4JOCA 3VX4A 4F3YA 5IAEA 5JH7F 4ZT4A 1B8VA 1RMQA 3NNDA 5K6RA 2R7NA 1Z88A 1A7KA 8OHMA 1GTMA 2N3ZA 3DKKA 4DQVA 1ZEMA 3R7LA 3NOXA 1M0EA 1YULA 3NBQA 4PRKA 3NFRA 1HDRA 3C6MA 4Z9AA 4QU0A 3ZHQA 3WHIA 5KNDA 1HQDA 5IU6A 4GOLD 4DA4A 4NV0A 1YOBA 4XX0B 2PAFA 3RVOA 4LJ4A 4XLLA 1TEHA 3VOBA 1G5IA 4UNPA 1A4UA 4IH9A 2ZJ5A 5E6SB 4B3FX 5IASA 16PKA 3DZCA 4A1FA 3AMVA 3HCAA 2WLTA 2NXJA 4F12A 4OHOA 1LDNA 1QMGA 3DPUA 4GPBA 4Y2XA 1P81A 1LV7A 4XVRA 2J31A 1F6DA 5CA0F 2YDXA 1N4DA 3FFWA 2POQX 4MV4A 4F9GA 3NDRA 4H08A 5SZIA 1H9CA 3IUSA 1GZ3A 3UCFA 3BSFA 3CX4A 4L28A 2ZM6B 1NFFA 2OGZA 3PHIA 4LDQA 1N2BA 2P0EA 3FPGA 4CQMB 2VSFA 1F14A 1D09A 4BFCA 3I4CA 4LF8B 4M8NE 1E8DA 2V5VA 4WXYB 1E32A 4O8CA 5H7XA 4NXNB 4Y2QA 2AG8A 3M82A 1DWOA 5KEIA 4DV3B 1QE5A 5CHEA 3B6IA 3PX7A 1P2FA 5BRAA 4AD8A 3FPAA 2GVNA 3IPYA 2A1UA 2HRCA 4YCAA 3KQQA 2CF5A 5KYVA 3ZI7A 1E8NA 4I55B 2NV2B 3RU3A 1ZM9A 3H5LA 3KZNA 1D0VA 3G8BA 3R76A 4YWHA 4KR3A 4A8TA 4LF7B 2WTEA 4LF4B 5DU2A 5IC5A 5A2QA 4M60A 3D4OA 4NYIR 5JBNA 1YJBA 1KSHA 2YDYA 1IEXA 2J9FB 4E88A 5I01A 4X1KA 5HM8A 2AUMA 4AS3A 4JJKA 1PL6A 1SOVA 3HR4A 4E6PA 2BSQA 2P4SA 3KLPX 2DPYA 5KNCD 3AY0A 4BO1A 3E8XA 2X0EA 1Z2CA 1QRAA 1SB8A 5DCLA 2QTCA 4TS9A 3KU1A 4IG9A 2F55A 3B52X 4KQJA 1ZOOA 1V26A 2NADA 2VPYA 3E5NA 2WJHA 1B2RA 1YMQA 2A30A 4DCPA 1WOYA 3ETGA 5CH8A 3UKJA 3E9QA 2HBYA 4DG5A 2JBWA 5ADUS 2AEEA 2WOJA 3RHSA 2BMEA 3IDAA 2WB2A 1T5HX 2HI0A 3GFSA 4HYTA 3VPFA 4JBLA 3SYLA 2IIPA 5HZMA 3OECA 3HXMA 4FGLA 1E1QA 2WK1A 1L5MA 1KOLA 1CYDA 1WDLA 2YW9A 1RHKA 3JTMA 3LCUA 4ND6A 1JI0A 4Y1GA 4ESVA 5JSKA 4ERXA 4KCGA 3ENVA 3RAJA 3W4KA 4EVIA 1TCUA 1ONBA 2LCIA 1IC6A 1FLDA 1NAIA 1V4VA 3GUVA 6CHYA 4M1OA 2FQXA 2DR2A 5HCUA 1KYWA 3GJQA 1R4NA 1ZD5A 1QIIA 3AVQA 3PEYA 1OBVA 4HEA1 1CQIA 4C0QC 3UT5A 5CFRA 4M9CA 1VRCA 1G59A 4JC8A 3SOZA 1BA3A 1CS0A 2HA0A 1X15A 3LBIA 2VDVE 5JCOC 1NPDA 1M2OB 5DMXA 8LDHA 1VBKA 3CH5A 4DW8A 2FZ5A 4ZYUA 1QO7A 4H4EA 1EFCA 4CKXA 2DC1A 2JLRA 1Z15A 3QVGB 3PEWA 1EVQA 1K0UA 2BELA 5EUMA 2O8FA 4Y6LA 3VKWA 3ABSB 2PL1A 4YLEA 2Q1UA 5KX5B 3H11A 1EGQA 4AG3A 1U0OC 3WGLA 1ZISA 3GNTA 2W93A 2GT1A 1Q0RA 2ZT8A 4TS1A 5EN4A 1O03A 4ZDIA 3QEBZ 1QMPA 2Y1XA 1VPLA 4H7JA 4XCXA 2ADFA 2I65A 3D8UA 3GVHA 3SN6A 2HWXA 1FFWA 2WRZA 4HQLA 1T5OA 4N4AA 4XTCS 5BR8B 4HT3B 2OHFA 5DHFA 4XJSA 4P83A 1HDIA 2BBSA 4YX9A 4Q3NA 3KOWA 3R0JA 2P9JA 4UVHA 3ELWA 1E3LA 1KDPA 4RGVA 5TQJA 4KR0A 3UK7A 1FSGA 4I3FA 3KUXA 3G9QA 4FWBA 4QTTB 4U6NA 1ZSVA 3EGVA 1JEYA 4ZV9A 1GLVA 3H9JA 2OQRA 3O8DA 3KAKA 1RZUA 3ODPA 3OM0A 4ZOLA 5FHRA 3QHQA 3VR3A 2PS9A 2QX8A 4L75A 5BUQA 4LNUB 2AZ4A 5J9FA 4RTRA 1HG1A 5A7HA 1HE1C 3D0OA 4O02B 2PZFA 3UT6A 3GV0A 3UGQA 3W7VA 5A9SB 1KEEA 3R1IA 3DH0A 5LZ4A 2E55A 3ZDBA 5GVRA 1Z4LA 1Z5PA 4CMEC 2PBRA 2YV1A 5JNSA 3BPSA 1CUZA 2EV9A 3K9WA 1KTIA 4TYQA 3TQOA 1S2LA 3QFSA 4MVJD 3HB0A 2XCUA 3NKLA 2AA3A 4PC6A 5KKAA 2X5OA 3WAKA 3ZJVA 4YVFA 1TK3A 1OASA 5DTRA 5CIYA 4DQKA 1CRZA 5LFAA 5LNK1 1CUUA 5KNBD 3LO5A 4JWKA 4LE2A 4Y0VA 2ZXFA 3WL6A 3HSYA 1BE1A 4NPHA 2H5EA 4R4JA 2HCFA 1TF2A 3PA6A 1NVVQ 2QZSA 4FE3A 1EWVA 4MV5A 4Z0HO 3K0AA 1YOVB 3E5HA 1JHDA 2GEBA 1M6EX 3FB1A 3DS8A 4JP1A 4JYBA 3KELA 1KXZA 3IA7A 4AMUA 5IHXA 4LDNA 1JDBC 1I4OA 2ENWA 5CGQB 1SBIA 2VF2A 5TVGA 3SU8A 3DEAA 3AKEA 3EZYA 5DRTA 1F12A 2GN4A 3LVFO 4YJDA 5AMXA 3KLMX 2Q4RA 2EIHA 2C5SA 1NBEA 4GDMA 3A1EA 3WO0A 4F56A 5H3LA 3EWAA 4C0WA 4C3ZA 4GRIA 4QJIA 3TD6A 4C89A 1ABFA 5CEEA 2FPSA 1PNVA 4IDDA 3KLOA 2B83A 4C0HA 5LPNA 3RC9A 1SQFA 1VLZA 4QTXA 4BX2A 4DSNA 1SXPA 3LGXA 5J2UB 1T1IA 2Y2VA 5DHAA 5I7UA 3K6SB 1WLYA 2QUKA 3V4PB 1G19A 1ZJZA 3DAYA 3AG6A 1HKHA 3PCXA 4FJ2A 3CSDA 3AEKA 4JDUA 1VMDA 1TQ4A 3KHUA 3IBTA 3ORYA 4PPNA 3UMJA 2QB5A 5DM60 2E2WA 3AQ4A 1M67A 2R25B 5DGXA 5K3FA 4P58A 1VE6A 1Y1RA 2XKAA 4I1SA 4EELA 1DUIA 3GMSA 3DBRB 4B74A 6AT1A 4DDHA 2Y0PA 3C43A 1EINA 2F1JA 5E1DA 4JBYA 1M1YA 3BUSA 4PG4A 4F92B 1M8JA 3D5EA 1B0AA 4MVJF 5AI4A 2AYXA 1EK6A 3BE8A 3FZEA 3GZJA 4A2WA 1IUNA 4Q3CA 1WTAA 4NCAA 1RPNA 4NCIA 4H6WA 1IHUA 1K89A 2P30A 1R00A 3M5PA 1C41A 3O47A 3OMXA 3PHHA 5TEWA 3S68A 4CFYA 2QBYA 2JI6A 1W36C 4J1QA 4BNUA 1EUDA 3FNHA 1TJPB 3HU1A 1K3UB 3FCUB 4QDTA 4NIMA 1IYZA 4B32A 1VI2A 3C3AA 4N6NA 4ZVNA 3OTQA 4HQNA 3FR8A 1E3DA 2PZLA 1LBHA 2IYLD 4P3KA 4TQAA 3SSOA 5A03A 1R6XA 2WFZA 3OZGA 1K6IA 1KMIY 3VOAA 3K32A 1YVRA 1TAHA 1M5RA 2VQFB 4M8LA 3PFHA 1DXYA 1T3ZA 4UBNA 4M0LA 1ZRMA 3BTOA 1J33A 3OWOA 4YTEA 3GZ4A 2V5UA 4CMKA 1PFGA 2IS1A 5F5NA 5HF5A 4DKXA 1L9XA 3CZ5A 5F9MA 4K9MA 4JDPA 4OHKA 4FNGA 5LA6A 4JL5A 3RLFA 3PLAE 5GV7A 2Q6LA 1I6LA 1NR5A 2C7VA 3BICA 2IX9A 5EQFA 3STWA 3QY0A 5GINE 3GLIB 3LIIA 1OHHD 2FP4B 4LDZA 3UH0A 1VOTA 4J0HA 5FH9A 5K09A 3L40A 3M5CA 3LFHA 2XTZA 1H66A 2BLLA 4I99A 3MGKA 4TVSA 4HAYA 5T8KA 3RV3A 2QMEA 4YT8A 1WQ1R 2W6NA 3OHSX 3FUTA 3L0ZA 4X6YA 4D4IA 3IVMA 4YROA 1FRZA 5LOVB 4NEQA 721PA 1ORRA 2ANBA 1UAAA 1NMYA 3COVA 2XGJA 3HJAA 1XVUA 1IXZA 1OH5A 4G5HA 3IMCA 4BFZA 1XWFA 1GPLA 3C1TA 1ULUA 2R85A 2Z9CA 3QVUA 4HSEA 3DOJA 2QRZA 3J7TA 3EE6A 3JQBA 4PRYA 1PL0A 3BSSA 4LS3A 4KO8A 3QVVA 3DT9A 3RUCA 1PCXA 2QM8A 1CQWA 4PYKA 3Q2OA 3FFAA 1AS2A 4ZEMA 5YASA 1XCPA 4E3ZA 1D2RA 2VDRB 2NUAB 5DGDA 3DM5A 4ND7A 1O5OA 2R8BA 4KVZA 3RRZA 1U7WA 1JQDA 4M1KA 2HUPA 4I9GA 2G9RA 1JSRA 1SUIA 2C1XA 2I5PO 3AR8A 3EXHB 3HL4A 4KLAA 2IV3A 2AZTA 4RFSB 2B98A 3OZBA 3ZPXA 4BUJA 4YREA 3AFNA 1E2DA 1VHDA 1L7BA 5CYOA 2L19A 3LUKA 3ANMA 3S1AA 3TOVA 4EGAA 4IDPA 4HDRB 2X3YA 2YZ2A 4Q1FA 1VIAA 2N0SA 3NFYA 2PUHA 1JDZA 3FF4A 2Q6TA 3PHGA 5JG7A 1P9NA 1Y8AA 2HNKA 1FIUA 1G3UA 1RI5A 1S2DA 4YT2A 2JC3A 3GL9A 1VLMA 3DMFA 1A3CA 1F51E 2W2KA 3KZOA 4KLNA 2X8JB 3UAWA 3F4BA 2UVPB 4DBLE 2UXCB 3FTPA 1JLSA 2X8BA 5COBA 3K8QA 3WOHA 3HVIA 4JL8A 1O94D 4DARA 1QSGA 4FYPA 3IJEB 3KWFA 5D3KA 4CYMA 2ATXA 5CA1F 3F5MA 3EJ6A 1E7YA 2CYAA 1OWOA 1RM5A 1FFDA 2D13A 1G291 2GFHA 3HWSA 1L7QA 3ZCXA 5IT0A 2EL9A 1JQ5A 3QOXA 3WHPA 4E09A 3M6MD 1E0JA 1I1QB 3O31A 1W5BA 3GDGA 3L8HA 2ATCA 5JVDB 3BD8A 2V7UA 3ND6A 2OA0A 3VNRA 1K88A 3P2JA 1U1GA 3BA6A 1U94A 4NYJR 2PLAA 2ZRMA 1R66A 4TUYF 3ZYCA 4DCUA 4ZT7A 2C4TA 2R44A 4D0GA 1DC8A 1ISPA 3U3OA 4L3OA 1CXZA 4KHPB 3TI7A 4EHIA 1YI1A 1H2EA 2R6AA 3CLVA 4UTOA 5JROA 2VVTA 2VAWA 1KAQA 4FIZA 3S2FA 2C1ZA 1DFHA 5FI5A 3ZX5A 2XMBA 3DONA 5HRCA 4CLOA 1Z6QA 4PGHA 1MO2A 3QTLA 3RABA 1SJ9A 5JS6A 4IIJB 4LBZA 1DEKA 4LV5B 4U7JA 5IX8A 5CT8A 1LSUA 3BGDA 4UU0A 5JQWA 4QDUA 2PZBA 2FG5A 3E9CA 4EHHA 1PV4A 4QT4A 5LQJA 1QTNA 2LV8A 5K8LA 2JHGA 1J2TA 1PX2A 2D1SA 2ZRNA 4IHQA 1SCKA 3S8EA 3CUKA 1N3IA 1KAEA 3K92A 4WV3A 4TWZA 4G86A 4O2AF 5ALRA 2H57A 3A6KA 3T9DA 3U1BA 5CMLA 3K9NA 5AKJA 1C1XB 1TIBA 2OUKA 1ULBA 3NYRA 2H2FA 3VPGA 4CIWA 3HU5A 1E9VA 3DYIA 4K0RA 1RHMA 2GPSA 4EJ6A 4A6EA 1T6YA 3BWCA 4F5ZA 3PDIA 4NJEB 4IQ4A 4C4YA 5EMMA 3QVWA 5EHQA 1AHPA 3CUYA 2AC7A 1M8KA 2VRCD 3QE3A 4I8XA 4MGYR 3ZHXA 4GGPA 4INZA 3D1VA 3MXOA 1SBHA 5CJJA 4Q02A 4WZAA 1U7DA 4YJGB 4E08A 2FJPA 2IXEA 1PGPA 3EFOB 4Y9DA 4EARA 3D7KA 3UENA 4FFMA 3ON5A 3BRCA 5FOSA 4EHFA 4ZVUA 1R5OA 4IEFB 3JARB 4Q7LA 1W0KA 2YJTD 3S5JA 1WMBA 2VNJA 3TLXA 4N5NA 4R54A 3VSEA 3ZTWA 2NM0A 3IXMA 3OY7A 1TTPB 3M9LA 2Q21A 1YDHA 4TT8A 1SQ0A 3EOZA 4YQZA 1ZHFA 5CB4A 5E1MA 1YK1A 1KDTA 3GY0A 2O8DA 3VUFA 2HJHA 4IG4A 4CG1A 1ICIA 1Z2DA 4ASUD 1U0SY 2OORC 5BN5B 1AK1A 1A71A 1T2UA 3O75A 1BA2A 1FNNA 1DX4A 2WWXA 5KKCA 1H5NA 1R0YA 4HN2A 2QZPA 3M9XA 4BX0A 1E3IA 3T1YB 1EDBA 1JQKA 4B0OA 4W7HA 2H5LA 4B47A 1H0HA 2O3UA 2VN8A 5D8DA 4C88A 2FMXA 3QMWA 1I3LA 4I08A 4KO2S 1HGXA 1CKEA 2OXIA 1F06A 3CSSA 3UFBA 5BSFA 2WIAA 3EGWA 4YUZA 3T3GA 2QRMA 2HJ9A 2FQYA 1P0FA 3KBBA 4B7XA 4HADA 4D26A 4URYR 1RRMA 1WHSB 2C8VA 2WYOA 2A0WA 1PZMA 4BFWA 4QQNA 5BORA 5ALKA 4C87A 3NH6A 1CIPA 3BZUA 2GJKA 3K1AA 4N6GA 3SEQA 3O1LA 3KTAA 4URFA 3TWOA 2WDPA 2QN9A 5CD1A 2X19A 1YF3A 2RAFA 3FPFA 2Q9BA 1P2DA 2ORYA 5JQGA 1L7EA 3GLHA 2BFNA 3TNLA 1BEEA 3LPAA 4RH0A 1BCSB 4G8JA 4AG6A 5LYJF 1OVMA 1W5SA 1ZD9A 3JALB 5D87A 5AM3A 5MN6A 4DLKA 2PQ0A 3MWJA 3BMOB 2IYYA 4DLBA 4PIPA 2QR2A 3LPDA 2BW0A 1MNQA 1I4WA 3EDRA 5DYYA 1LS1A 3K8ZA 3AVXA 3LVRE 5MFZA 2QD5A 2Q99A 4EHAA 1JV2B 3D3JA 3RU9A 4B4KA 1EDZA 2QQFA 4EK9A 5JBQA 1KIAA 3Q2IA 4LVUA 1FUUA 3DW1X 4GIBA 1URPA 1KEPA 4M4SA 3IV9A 2FSHA 5LD2C 1JRLA 1PSZA 3TLKA 3OD5A 3OE5A 3RUPA 3KOUA 2NP7A 4OYRA 7MHTA 1W5TA 3OU6A 3WLJA 3H2KA 3OPVA 5CCDA 5C8ZA 3ISVA 3T7DA 4YPFA 1MH1A 1Y7TA 4F93B 1LK7A 2DWPA 3E3MA 3MFYA 1GYQA 2GBLA 4H7KA 3WADA 2EW1A 2GZMA 2Q1WA 3IPRA 2ZXUA 1W4ZA 1Z34A 4Z3DA 1YI0A 1Y5NA 1YJXA 4RSHA 4LJ5A 4LC1A 1ND5A 2JGEA 4R2KA 4W6QA 1MRNA 3EUFA 5A4JA 3JYLA 3BL8A 4AJ1A 1J42A 1THGA 2O2ZA 2UUPA 3AUTA 2JCVA 4Y1FA 3T6KA 3ZV6A 3A4LA 2LWIA 1QX4A 1GRVA 2WUWE 2AIRA 1P9WA 3M33A 4I9UA 4M55A 1EXDA 4W9MC 1JIUA 1ML4A 1XROA 1TGVA 2OSVA 3GN1A 2Q7OE 4FHZA 3RBXA 2O50A 5FBKA 3WX0A 3DEJA 5FWNA 3GPBA 2DQYA 2VXYA 5ARCA 5BT9A 3IX7A 3B6MA 4EM6A 5AVSA 5JASA 3JQ9C 1DXHA 1BHQ1 1NNUA 2BVNA 1GNRA 2AFVA 2X86A 3CB4A 4MROA 4NZYA 3ZNQA 2CT8A 4ALJA 4GPTA 2BZGA 3EZLA 3ZBTA 3P2OA 1R50A 4LVCA 1DJMA 1JW9B 4CKWB 5L3SB 1W1WA 3M6VA 1PG2A 1KO5A 1E1QD 1JQ3A 3DNPA 3VPXA 1E1RD 3ZDYB 2FMTA 4X93A 3E1GA 3OT4A 4ABYA 1GSOA 4BOYA 3GJ0A 1NLUA 3U3XA 4DOMA 1JEJA 2ZAOA 3KTOA 5D84A 3AI3A 4DJTA 3B8HA 4L4RA 1BDHA 4B1FA 4D99A 3REFA 4CG2A 2WM8A 3LF1A 4JELA 1KP3A 1GO2A 3ELYA 4IIFA 2OV4A 4COKA 5EZYB 1VJCA 1U8CB 4C20A 1C3VA 3E2MA 4RENA 3LO8A 5JDCC 2YVAA 3Q9NA 2IY7A 3HBAA 1G7CA 3K0KA 1FVOA 3KAJA 3L5KA 2H29A 4QUHA 4ZT6A 1WXGA 3AFOA 3ZGOA 3KR0A 3KWLA 5EMNA 3CUSA 1L4GA 4PZEA 4MUIA 4II7A 1D1PA 1W29A 3GA7A 1R6TA 2ZPAA 3Q4GA 4U7HA 5THQA 1BXGB 2A1TS 1GAQA 1KOFA 1DIOB 3H86A 4R7ZA 2QZZA 2WJPA 4CIBA 2BGGA 4DBZA 5FOWA 3CKLA 4B6FA 4EFLA 1TUBB 4HX9A 1VE9A 1VYUA 4RHEA 5E1BA 4MUGA 4XJTA 4YR9A 1B3BA 2BYTA 2EKQA 5DBHX 1C30A 5C7IO 5F1YA 2QLNA 4V1CI 1K4KA 2OZKA 2BEJA 621PA 5TARA 1VE3A 1XJQA 2QGFA 3WK5A 3W7BA 2DG2A 2A7QA 1SXJD 3MS2A 3O91A 2RBKA 3F49S 3AUYA 3GWZA 3OZUA 4YRBA 3KZCA 4O0MA 4DZRA 3KSAC 2ZJ1A 5HOEA 2RAVA 4U3JB 4DUZB 1UDBA 3ZLTA 3HJBA 4Q9HA 3W5HA 5FWXA 2WSBA 2NTEA 3HPQA 3VU9A 1K7SN 4G0YA 5CH5A 5A4FS 1O0BA 3PNQA 4WLVA 1U81A 5L7WA 3QF7A 1VECA 1YVEI 3CLTD 1JXOA 2XYHA 5ERGB 4AAYA 2IDMA 2DJ5A 4N01A 1MFZA 2UU9B 4OQXA 3CCCA 3GIDA 1P0IA 4RMJA 4JXXA 4CF5A 2ZT5A 1ODIA 3B2NA 5FBVB 3OX4A 3VU0A 7GPBA 5LMNB 3TVDA 4UQOA 1JMYA 2VH5R 2VIIA 2P5SA 3OT5A 2CD7A 4I5EA 3RJ9A 2EWWA 4QM6A 2H17A 5CVUA 2AGVA 2VUTA 2JGFA 4O4JF 1S2NA 2FW1A 1J56A 3EDMA 2L82A 3IHWA 3A1WA 4TV8B 2PG3A 5EZ5A 3TSAA 3ZE1B 5CPFA 4YRMA 2UYOA 2RAPA 4GP9A 1KE2A 2XHZA 4BP8A 2BI7A 1US8A 1E9EA 3VJLA 3Q2KA 5F7JA 2JLSA 4HQRA 3B7PA 4PYQA 1W4LA 4DV7B 1KMHB 5DTMA 1ZMRA 1GZUA 2Y2UA 3DFUA 4KSBA 2HSJA 5HEKA 3RUDA 2ZCJA 3KB8A 5C0OE 2NNLD 2R6R1 1RWPA 1E2QA 1N2HA 1ZRHA 3BC1A 3DE1X 3SX2A 3ILHA 3WP0A 2CVZA 1T43A 2HYIC 1UJNA 3SXPA 1C7IA 4OD0A 3CB2A 3Q0EA 3I73A 4PQEA 4BX9A 1J6UA 2WVJA 3VSCA 4AP5A 4IHJB 5CEFA 2X13A 5I51A 2OKGA 3NOVA 1POWA 3RRFA 4LPKA 2PT6A 1PR4A 1CVIA 4RA6B 1AHHA 1UPUA 1CJCA 3WYFA 2PLFA 3VR4H 3E7WA 3P0IA 1M76A 4MLPA 3ZU3A 3LVBA 1I13A 1MTZA 4JP8A 3QELB 4FYJA 1T2EA 4Q05A 3DQZA 4OREX 1C2YA 5KTNA 4FPXA 1PGNA 4CT5A 5IT5A 1A4IA 4C76A 2WU8A 4J16C 4JVMA 2VHEA 1OJ7A 4OXIA 3TK1A 3SX0A 4LV8B 4C05A 1QHEA 1PWYE 1BTOA 1RI2A 3DE4X 3HDJA 4US2R 3LLCA 2BR3A 1G5FA 2CLFB 3BFXA 1GA4A 3QHAA 2PLNA 4JS0A 4TTAA 3RTDA 1VFNA 3I23A 3IALA 2QT1A 3KUCA 2O19A 1ZIXA 1MJNA 2C07A 5B5SA 3N2GB 2VF7A 5CDYA 1LLDA 3R77A 4L9SA 2EEZA 1JF8A 4JJFA 5I47A 3PA8A 2ZRLA 3N2KB 9GPBA 2XADA 3BB3A 3CLRD 3LY9A 3IKTA 1AU9A 1FYVA 2EC5A 4QQRA 1VPWA 1HEYA 5F3WB 2HN9A 2G1KA 2J45A 3L0SA 1GNVA 4GO1A 1LU9A 3SF0A 4YRAA 2DTXA 3RSQA 1NVBA 3EWSA 5BVHB 1ILEA 1MO5A 1Y89A 2VPZA 3PNMA 2ECQA 3IP1A 4KDCA 5JS2A 4LYGA 3NHYA 3RTEA 3QLEA 3RAGA 3UUFA 4KDRA 4NENA 4PLVA 2JHCA 1ISSA 1R10A 1H9BA 2PUJA 3BXXA 3GLUA 3HSSA 4FU0A 3S2SA 2OZVA 1Q0QA 3U7FB 2BCJQ 1ES9A 4EUHA 4GDFA 4YQFA 2BTEA 3VSAA 5ED4A 4OXQA 1H4TA 1RLTA 3L79A 1GZSA 1M6NA 2ZTMA 3V1TC 3OF2A 4C7JA 4CNBA 5IJ0A 1QJCA 2X9LA 1R4ZA 2GASA 1C1DA 3IAEA 4KPFC 4C6TB 1JLHA 4GX2A 3O1JC 4J4HA 3GMTA 2VWGA 4MZXA 2LP4Y 1LRLA 3FHJA 5GJCA 1QVZA 2J59A 1FU4A 2J8ZA 5EEGA 2ZR0A 1MVLA 4RVHA 2XVXA 4FINA 4O4IB 4RPCA 3VNAA 2FA9A 3LDHA 3Q5EA 5EXTA 4UEOA 1HYQA 4D57A 1Z5VA 3ZS9A 1XAIA 3NWEA 3NRJA 1II8B 1PKEA 3HNOA 1I3OA 2G63A 1JH9A 5D00A 1HE8B 1YS7A 2YQ4A 3C1OA 3PL5A 2B5VA 3A70A 5HMMA 3VPHA 5BMVB 4V0NA 2CMGA 2QW8A 4LZLA 3A3OA 3UWDA 4DUGD 3DMNA 1WTCA 2XEDA 5IBRA 3KQLA 2CK3D 2F9LA 2NVBA 3GFRA 1GPH1 3ICOA 1AQUA 2FUKA 4RY2A 1Z73A 4DHEA 2KPOA 1DDGA 2XSZD 2XMRA 3GRAA 2FMUA 4Q4JA 1AV7A 3UMBA 1OKKA 1M7BA 3TJRA 3PGMA 5C5EA 1ZVQA 2B21A 3CGGA 2A33A 3CF2A 1T5IA 1X7WA 1FMCA 4BRZA 3Q7IA 4ENSA 3EG5A 3NV7A 1PEYA 2J3DA 4DHWA 1FMLA 2WTMA 4PE5B 1KRWA 5I9IA 1OZAA 5B58T 4C0BA 1VHWA 2ABWA 2AN3A 4BB0A 3CYFA 1YUBA 3RJMA 2IU6A 2X1MA 3EQ6A 4EH1A 2Y05A 2VT3A 4E0BA 1ENOA 2BFCA 4H7PA 4C4XA 3U80A 4U63A 5GJWC 2WF7A 2CFSA 2WJIA 2Q3CA 1F2VA 1N6LA 5G0VA 2ZBPA 2PMDA 2QTVA 2WZDA 1UEJA 3A4TA 3R9XA 4G5XA 5D3MB 2K87A 3QLUC 1VYVA 2H54A 2X5NA 4LN1A 5CT4A 3QEJA 1DEOA 3G8CA 1GUFA 2YZNA 3KTFA 4LV6A 4BZWA 1K6XA 1N8TA 5E8RA 1C9DB 5HM6A 5KSZA 2PWBA 2CUKA 1RQXA 2Y1EA 3AG5A 5M5BA 2IDZA 4WE3A 4L85A 5ALGA 3GROA 5CW2A 4EA7A 3EYWA 3KVNA 4WK4B 4OL9A 5AK3A 1KIMA 1MD9A 2QROA 2QJFA 2WHPA 3OKCA 4I1RA 1WZUA 2XBMA 4OL0A 1C8LA 2BMAA 4LHVA 1G6KA 4GI2A 3GOHA 2ZIUB 2KWIA 3SZOA 4DCGA 2RGRA 3LHIA 1NJ6A 2ID7A 4AY5A 2QJOA 1XDUA 3MRXA 5CLIA 5FTWA 3FKJA 5FTNA 5H0IA 4M8IA 3SG0A 1DIAA 4YJ3F 2IGBA 2HT6A 2MINA 1BJTA 1WPRA 3PXUA 3P9CA 4EMTA 3OIYA 3OIUA 4B4VA 3UQZA 4BP3A 4YRPA 2MSWA 1DIRA 3PWTA 2ETVA 5C32A 4MLDA 2OMKA 1E1YA 3NWOA 4N5DA 1JPVA 1ETUA 2DQ4A 3MCAA 5E9QA 5FI1B 3CURA 2QP4A 1WB5A 5D3QA 2XT0A 3NJ4A 4FFSA 3RVPA 3QU9A 3OSZA 4TN5A 5U4XA 5DNWA 2YL2A 3DHNA 1NXTA 4NBLA 4W9RA 3ANYB 2X8LA 4ZQHA 2HEGA 2YN2A 4TWIA 3SZGA 4DBLC 1W25A 4N8DA 3WFJA 7REQA 3U9SA 4QXQA 3O2NA 1IBRA 1UOEA 2P1ZA 3EDYA 1JU3A 3H2ZA 4FS8A 5I5EA 1QH0A 1VG1A 2H1LA 3UJBA 3QU7A 3A36A 3ETHA 3KWJA 4FI3C 4MYDA 2C4NA 3RVRA 4HB0A 4IF4A 1OXTA 2H0QA 4KVGA 1Q83A 3U62A 1QRUA 1JFLA 4MYTA 1F6BA 4YFYA 2Q27A 5TDHA 4F85A 2CUZA 1KF0A 1OXKB 1SXIA 3A7DA 5DULA 3TCNA 3FCYA 2XAAA 5FUBA 2ZIXB 5IKOA 4Q3DA 2DFLA 3O26A 2WV9A 2XDYA 3JYPA 3CZQA 4I3GA 4GU5A 4PG5A 4UBIA 2OPBA 4UREA 1NBME 5B1DA 2WSSA 1WPXA 3REGA 2NUPA 4BKQA 3G7UA 1E20A 2FMHA 1KMQA 3A6EA 3EIXA 2GUWA 3NIGB 1GL3A 1I94B 2C98A 3C6XA 3I04A 1D5WA 1W4RA 4R9NA 1WEHA 1HDZA 3A9TA 5CLGA 1KVTA 1ZGBA 3HVKA 4P35A 3GJ4A 4R3UC 3L6EA 1DU4A 4B8ZA 2BHLA 4PZ9A 1KY3A 3I6BA 3ID6C 3S2YA 4RMNA 3CVYA 4XA8A 1TMOA 5LLSA 1H6AA 5I9MA 1PVOA 1UWCA 1JFFB 3IV6A 1TEXA 1BRMA 5TGDA 4B40A 3PPYA 4S24A 1NJ2A 5CJPA 4RJLA 3EVFA 1V45E 2P35A 3OPMA 4AJLA 4RUKA 4YMGA 3K15A 1SBTA 4M8SA 5ILQA 4ECEA 4EEXA 3HDTA 5JBIA 4CI0B 5K0SA 3SMVA 1VBFA 5I8WA 2EKDA 2RGUA 2HXSA 3INYA 3MUOA 3QE4A 4DR4B 1CW2B 4E5YA 3Q8XB 1FVXA 5CVDA 4AWAA 4HATA 1CZHA 2OCBA 4G8BA 3TMAA 5LN1A 4AZSA 2WY2D 4PAQA 5AKEA 3I8XA 4IM7A 4BLRA 3WLLA 3OIVA 3CW9A 4W1SA 3M6IA 2B2NA 1TU4A 4MKRA 4FJ0A 2ZWOA 4AYWA 1DELA 1R9MA 4EQ6B 2HGSA 4UVGA 3TX6A 1JFSA 3TQRA 3RFTA 2ZRGA 5FTKA 4XRRA 1E1KA 4P4LA 4QDXA 3RFVA 1F7UA 1XVVA 1B23P 2PD6A 2G6TA 2ODTX 4PZAA 2RGCA 1CY4A 1G9TA 5JY6A 1P74A 1JQBA 2I0FA 1D4ZA 2W83A 1R0BA 4ZYTA 5JXHA 3JASB 3N39C 2BDUA 4P5PA 5AVUA 4RSRA 4E1AA 1EUZA 3T95A 3H7IA 3FZGA 3QX7A 3L1UA 3ZLUA 2DWUA 3NT5A 3KOZA 4WDQA 5DLYA 2R47A 2FEPA 3QVXA 5KHLB 5DM70 3FBWA 1ZU4A 3SKYA 4EMBA 5A05A 5ALSA 1QHHB 3SQWA 1JR3D 3L93A 3TX2A 2M6RA 3RU2A 4AMBA 4B9EA 4P9NA 1KSGA 5K0LA 3C6KA 4WY8A 3AT1A 3L7IA 3R8XA 3M6WA 3UMVA 4TT3A 2NU8A 4OHVA 1J39A 4UEJA 1NDQA 3DE2X 4I5DA 2RKBA 3G13A 4LZOA 4PQRA 4Y2UA 4KR2A 1H05A 4HDKA 4L95C 4ZK2A 1TCBA 4OHMA 3GJ7A 1TUEA 1UBLS 3TNDA 2PH1A 3WIUA 1X38A 3P2MA 3VH4A 3I5MA 1JSCA 4FFNA 3HGQA 1B15A 4G0MA 3SYRA 4B4OA 3GGGA 4M9UA 1UXKA 5TS2A 3RR2A 3LT5A 5KUTA 4AYXA 5H02A 2G9UA 4HGZA 3PNSA 1AGYA 4Q9LA 3MXTA 1UMBB 2GEDA 3DXFA 2PFSA 1TVEA 4V0ME 3SGLA 5F1OA 1LLUA 3I32A 1T25A 4G4SO 4KQHA 5J3JA 4LHYA 3HJHA 5E9WA 1OXSC 1BHO1 1K68A 5B3KA 1WXEA 1E89A 1HZZA 3K1JA 1Q7GA 4ZO9A 2X15A 3FBGA 4FKBA 4MAAA 2X0JA 5G41A 1L8OA 1HDYA 4FE7A 3NMUF 3V7NA 2ZJBA 2R7LA 4QNMA 3N2EA 3UGTA 2P8SA 4L9AA 3RS7A 5K3EA 4Z4EA 3QKSB 1ZD1A 3HQ4O 2CWWA 3IULA 4TKMA 4YAEA 3SR0A 2R8RA 5TPZA 2PX3A 3V4SA 5H8WA 4LKOA 2R1TA 1GPNA 3JVEA 4JP3A 4JEUA 1CNFA 1TB4A 3EGEA 3R4VA 2GAFA 4L22A 3INNA 4CIXA 4FB5A 2XE7A