3EIWA

Crystal structure of staphylococcus aureus lipoprotein, htsa
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
292
structure length
292
Chain Sequence
b'ASTISVKDENGTVKVPKDAKRIVVLEYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSVGTRKQPNLEEISKLKPDLIIADSSRHKGINKELNKIAPTLSLKSFDGDYKQNINSFKTIAKALNKEKEGEKRLAEHDKLINKYKDEIKFDRNQKVLPAVVAKAGLLAHPNYSYVGQFLNELGFKNALSDDVTKGLSKYLKGPYLQLDTEHLADLNPERMIIMTDHAKKDSAEFKKLQEDATWKKLNAVKNNRVDIVDRDVWARSRGLISSEEMAKELVELSKKEQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HtsA protein
publication title Characterization of staphyloferrin A biosynthetic and transport mutants in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transport protein
total genus 102
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3eiwA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3eiwA02
2PS0A 1QGUB 1KAHA 4WZBB 2M6LA 2QI9F 3ZKAA 4B8YA 4TKUA 4ND8B 2M6KA 3TNYA 4TKVB 3K1AA 1N2CB 3R5SA 1M34A 3U7QB 3HXPA 2AFHA 1FP4A 5JOQA 4HMOA 1QH1B 3UJPA 3CX3A 3PSHA 2RG7A 1G20B 4ND8A 4INPA 4M7OA 4TKVA 5JPDA 1N2CA 4MO9A 3AETB 3U7QA 3AESB 5CR9A 4MX8A 2OSVA 1QH1A 4UTOA 2MINB 1G20A 2X4LA 3AEQB 5GGXA 3AETA 3PDIB 1M1NA 2PS3A 3LI2A 3K1AB 3ZK8A 4UDOA 3AESA 3MWFA 2WHYA 5BVHA 2OV1A 1FP4B 2MINA 3G9QA 1KARA 1KAEA 3BE5A 3AEQA 3HJTA 3EIXA 3GI1A 3LHSA 3PDIA 1ESZA 4HMQA 5GGYA 2OGWA 4FKMA 4WESB 4BBPA 2PRSA 4HMPA 2AFIB 3AEUA 1PSZA 3TEFA 3BE6A 3EIWA 1M1NB 3MD9A 5JJ5A 2YNMC 5BVHB 4WESA 1QH8A 2WI8A 1G21B 2AFIA 3HH8A 4K3VA 4WZAA 3MINA 3AERA 4HN9A 5HX7A 2PHZA 4LS3A 2XH8A 5M29A 4INOA 3ZK9A 5AFSA 1K0FA 2O1EA 4PM4A 1G21A 4MLZA 4H0FA 5KOHB 1XVLA 1K2VN 4NNPA 3AEUB 2XY4A 2OV3A 2ETVA 5KOHA 3R5TA 1QH8B 5BVGB 4H59A 1H1LA 4CL2A 1N4AA 4WNAA 4FILA 4WZAB 3MINB 3AERB 1TOAA 4XPIB 5I4KA 4N01A 2XV1A 5M2QA 1K7SN 4GICA 4FI3F 5BVGA 3PSAA 5HDQA 2XUZA 4IRMA 4G07A 3MFQA 4XPIA 5KOJB 3ZTTA 3ZK7A 4WN9A 3NU1A 1K75A 1L5HB 1PQ4A 2R79A 5CX1B 2YNMD 4UDNA 3AEKA 1EFDN 1N4DA 2XQVA 2PS9A 5KOJA 1H1LB 2R7AA 4LJSA 2XDQA 4WNAB 4MDYA 4WZBA 1QGUA 4OXRA 1L5HA 1N2ZA 5FLYA 5CX1A 5B58T 5M3BA 5KHLB 2Q8QA 4OVKA 3MWGA 1MIOB 3TLKA 4FNAA 5JG7A 1M1YB 4WN9B 4NNOA 5M34A 4PAGA 4TKUB 1MIOA 4UTPA 3AEKB 4OXQA 4DBLE 2Q8PA 1M34B 4G09A 2AFHB 2XDQB 1M1YA
chains in the Genus database with same CATH superfamily
2WLTA 1GNVA 5BMOA 4OSPA 1O95C 3JPYA 3GFBA 3UWKA 1V0JA 1V9LA 2JLRA 1PVVA 1JQ5A 1X7GA 2AI3A 3AUJB 3CR8A 4JH0A 2FYTA 3OZCA 1H94A 3C5EA 4BFSA 4PLYA 1VL8A 5DYWA 3ZU6A 2WB4A 2J1LA 1NRIA 4ZAFA 5A2QA 1TJ4A 2IYSA 3ZD7A 2BM9A 3EVDA 3WGUA 1PZGA 3NG1A 4S35A 1GV0A 1U0EA 3SZOA 1PT9A 1QG2A 1X8JA 4WEOA 1UBUS 2D5IA 2PCJA 1GGJA 2VG8A 3KIPA 2H1CA 4LWZA 5AUQA 2C84A 4NFHA 1B42A 2CDCA 3ZU3A 1L5MA 3MRVA 4R1NA 5B3KA 3AL3A 5B3JA 4HNHA 1DBIA 4J2TA 4RV9A 3IT2A 3CM0A 4Z4QA 3NB0A 2KLBA 3AWDA 3MTJA 3PUYA 5HDBB 2GNPA 4C5CA 1K89A 2PQMA 4GKBA 4JKIA 2YQ5A 4QEDA 3V4SA 3ANLA 3A1DA 1VL2A 4J29A 4V0ME 5DBFA 4EO4A 4YRBA 1YJCA 1N3IA 4AY2A 2C1XA 3AOEC 4LY9A 4DR1B 3KUDA 5I48A 1B23P 1V8BA 3EF3A 2HRDA 4RFSA 3TSWA 3X1JA 4AG6A 1C7FA 2PL1A 1FFCA 1TT5B 2C1ZA 2VNHA 2VP2A 3I6YA 4YRTA 3H8SA 4MGZR 4W7HA 3T7CA 3UKOA 4H1WA 3O3NB 3FUXA 1RT9A 2QQ5A 2AL7A 1APBA 3AERA 3EXIA 3TRHA 3B1VA 3VR4H 1M3SA 2ZQYA 1UWKA 4B35A 5IKMA 5EE3A 1SBTA 1HURA 1U5BB 2CXPA 3PUKA 2BZ0A 1G64A 1H2XA 3HJCA 4OREX 1YOBA 5HGJA 1L4KA 1JHUA 2XMDA 3HBLA 1XEXB 2BBTA 4GE0A 1XEAA 1AUVA 4TL7A 3RRMA 1A98A 2I3GA 1GKIA 4PIPA 1H9BA 5TS3A 3MRTA 4FMCF 3ME5A 2JAPA 5I6DA 1R9JA 2GCPA 4UHHA 2WWGA 1KZHA 3WYGA 2AKEA 4F60A 4A8HA 3OU7A 4RK7A 5I7OA 1ISJA 3OZAA 4PX3A 4Y2YA 1O94A 1R6DA 2JIZA 4PS1A 2GYUA 2O3UA 2QXYA 2JK0A 4C87A 2IS2A 4FZ5A 4FR5A 5JROA 1RAHA 4XPIA 3JARA 3OBIA 1YGYA 4AUNA 4C88A 4EM6A 1E3SA 4OK5A 2AOWA 3HXLA 3OU2A 4MRNA 3DZHA 2QLJA 1AQIA 2AZTA 1EWRA 2MSEB 3DL7A 2ANBA 1R8XA 4O8ZA 1DNPA 4QPJC 5EIAA 5K4AA 1WXXA 4MULA 1T3SA 5I9TA 1XALA 1ZC4A 3GQBB 3QEAZ 1ZICA 1C9KA 2EZTA 2PD4A 1CQIB 2A9KA 1LQ2A 3R0XA 4J0QA 3Q41A 4TWJA 5A02A 1O5OA 3I4LA 3L40A 5I7EA 1G2PA 1T1IA 3BJIC 1P2FA 4LJ7A 4DLTA 1UXKA 2AA3A 2VDRB 3EEYA 4UUAA 5HF6A 4OA8A 3OZSA 1BX1A 4A0RA 3M5PA 3PE3A 3VOSA 3KL2A 1LDYA 1GNRA 2YY6A 1GCUA 1YU9A 3RKSA 4HAVA 3FNRA 1VP3A 4RV5A 5AVRA 3LBNA 3A3NA 4IDPA 1RAGA 1SCDA 2IS1A 5ALJA 1UZAA 2ZRMA 1ZD5A 1U2TA 2D4AA 2VTDA 3C5VA 3DBHB 2B21A 3EW7A 3KRTA 3KOYA 3PC6A 3PUHA 4GVLA 3SP1A 3H19A 3CTMA 4QXAA 3T06B 1JJ7A 2P2LA 1G98A 2PVSA 3UAWA 4EFMA 5EMKA 3T9FA 4DMRA 2RHCA 1SA0B 3FTPA 4FFBA 4G0NA 4OUKX 4C30A 4YXWD 3AONB 3EOZA 4GOJA 5D8DA 5HK8A 1Y3CE 2ID8A 4E11A 2JNWA 3M4ZA 1NY5A 3LT2A 4DYHA 3F7OA 1K4MA 4MR9A 4L0DA 3LOPA 4DG8A 1V3UA 1FNNA 4NMMA 1CR0A 2Z3VA 3WRWA 3V7FA 2GBCA 4R40A 1R5OA 7ABPA 4JUDX 4DQXA 1VLLA 5D1HA 2PS3A 1GLNA 1MOZA 5C9ZA 3OQNA 1L1EA 2R65A 3I8OA 4HR7A 4GMKA 2AF4C 4YLGA 1B0AA 4TL6A 4D92A 1FYXA 1IUNA 4JJ6A 3ZS8A 1K2WA 2ZANA 4QU0A 2JGDA 2IL1A 1U1GA 1O9BA 2ACKA 2EJTA 1I4EB 3T54A 1HI9A 2JH9A 1FXWF 1NNSA 4RYLA 3PFKA 3OIFA 1JHPA 2IQIA 4HKTA 5J47A 3IOYA 5DULA 4A1FA 1NQAO 4N8SA 2ZRGA 4CTMA 1Q0QA 2GASA 1LQUA 3FWPA 3E7PA 3IMEA 3I12A 2MT9A 3IQIX 2Q7XA 3KJQA 4IF6A 4LYYA 3TCKA 3OJWA 5EG5A 2KBEA 4ND2A 5KQSA 1O54A 3GJXC 5DASA 1Z4QA 2RI0A 2W9XA 1SHUX 4H1VA 1F2DA 4HN9A 5A5VA 5HX7A 4R1PA 3H2ZA 2RHHA 3MGGA 4NOKA 1Z75A 3TL3A 5LQRA 1C3EA 5TVKA 4FGSA 5T6BA 1FTGA 5FD8A 1SXJA 2JZNA 4LJAA 4BCCA 2HRBA 4DDKA 3LJKA 2H6EA 5IFLA 1NVDA 2W6JA 3GVCA 2P5UA 2W4MA 1PJSA 3FYHA 2EP5A 5KJEA 5BMVF 4IDCA 5IHXA 2B0JA 1LK7A 4YMTA 4EKYA 1QCCA 2JFQA 4LBZA 2OBLA 3R20A 3DF9A 3BXOA 1VB5A 3L6OO 4FOLA 4IH4A 3WA6A 3PTZA 3GG2A 3BJEA 2I6XA 4L0CA 1JR3E 4KVFA 4ZAZA 4QO8A 1ORVA 2FWAA 1F8GA 2VJCA 4IXTA 4KRGA 1K27A 1R3DA 1KR5A 1RWPA 2W4IA 3HCWA 3HPQA 1L5NA 1DARA 3USES 4ZIRA 1O0BA 2WMDA 4FFRA 4WN9A 4EQZA 2YVUA 4RF5A 4MV4A 1U9CA 3CWZA 3V8NA 4BX9A 1P2SA 3EA0A 1BGWA 1ULAA 2GPBA 5EKDA 5DHAA 3VUFA 1QP4A 4JI1B 1RQGA 4NFLA 1NSFA 2HKIA 3H3JA 4I4TF 4S1NA 1JDSA 4A8JC 1CJKC 3FJOA 1DTEA 3F71A 3G88A 3ISJA 1LSOA 3F3YA 1V2GA 3VTAA 2JCYA 5C8YF 2AT1A 1X0VA 4F4DA 1DAFA 3GLSA 4IAOA 6GPBA 1GQQA 2ZTSA 3EZYA 3R7DA 4YAKA 3GRAA 1E79A 3SS7X 1QZUA 1N7GA 3IQDB 5B2ZA 4AUKA 1FP6A 1QTIA 10MHA 1ISMA 1QB7A 3HFRA 2Z30A 3NHYA 3O84A 2ZSUA 5IK2D 2ZYAA 2VQFB 1I3NA 1V26A 3VR5H 2QN9A 4PLVA 3WS7A 1HBJA 1K8XB 1A88A 2PWZA 3G0IA 3HZHA 4O6VA 2GYVA 3ZDRA 3UUGA 3OEHD 1XRRA 3MHTA 2W37A 2AD1A 5LU9A 2OCIA 1EI9A 1NF8A 2NUTB 4UEOA 4L4SA 4BFXA 4DANA 4BC0A 3Q3VA 2IS4A 1XRLA 1LI4A 3M82A 1BX0A 1FZQA 1RXYA 5LP6A 3U7IA 1B6SA 3DS8A 4JIGA 2VSXA 5F1YA 2XLCA 2YUTA 3FWHA 4HCJA 1LF0A 4M46A 5ALYA 4EKNB 3STWA 3I92A 4ERXA 1JLSA 1SC4A 2QRVB 3AIKA 4TQ9A 5AMXA 3SQLA 3H84A 5DO9A 1SKQA 3WC4A 1JBKA 1S9HA 2Z4SA 1S8FA 3BE4A 1TFUA 5HK9A 2WHRA 2XECA 3PNKA 3SOPA 2GYYA 4XQ0A 4E08A 3PL1A 1Z12A 4WBXC 4YONB 3ILXA 4UBLA 1E0AA 4N1AA 2CLHB 5HKKD 3G9QA 3PHGA 2HRZA 5JYCA 1PI3A 4DV6B 2X6QA 3QVVA 2QBYA 1LPSA 4KXWA 3CRQA 4EHBA 5C7YA 2Q50A 4G0QA 4GYJA 4BZZA 3H5TA 5JH7A 4ISCA 4RQUA 3PPVA 1UINA 1V4VA 2ZRDA 3UAOA 4IFTA 1R15A 2WMOB 4HVTA 5K03A 3GZNA 1V7ZA 4MUXA 1YKGA 4DLZA 4P8RA 3RAGA 3ZLUA 2UV8A 4B2IA 2Y76A 5KJFA 2VJMB 4MMXB 1CU1A 2V7QD 4D81A 1KVTA 1U8EA 3VR1A 1SQFA 3QXJA 1XZJA 3LVRE 4JITA 1II8A 5TDHA 1DELA 5M29A 3U9TA 1M76A 2J9FA 1H2BA 2V0GA 1XYVA 2W5UA 5A05A 4V1CA 1EFAA 4IIDA 4HDSB 1CUIA 1E59A 2G9QA 1K97A 1GNQA 1NVVR 3V7NA 2C4UA 2VJKA 4INZA 1JSZA 3H86A 5FI3A 4TSFA 3TD9A 4WNYA 1QH9A 3L41A 1A9TA 3F73A 3HY6A 1SQGA 3UOAB 1U3WA 1BWSA 4NBNA 1Q44A 4D8WA 3F1KA 4ZTZB 4RK0A 1NVTA 3ONFA 1TD1A 1IYZA 3E0QA 2X7XA 2E6UX 2EP7A 1S7CA 4EBBA 2MU1A 3RPEA 3IEIA 5T41A 2G4VA 1TM1E 5CYGA 2UVPB 2BE7A 3PWZA 4Q18A 4X45A 2IPXA 1VSBA 1UMDB 3PGKA 2ZUUA 4AKEA 4E5YA 2QJRA 1MPTA 1P4HA 2BGUA 2C0PA 4QUIA 4E5DA 1TZMA 1E64A 4JEUA 4TLEA 1OV6A 4HH3C 2FEWB 1XAJA 1ULUA 2ZK7A 1NXQA 3OD5A 3QEJA 4TL8A 4YMHA 4QJ5A 1G7RA 1R74A 1HTBA 3VKUA 3ZLVA 1NUUA 1UWCA 3GLHE 5E3JA 2EKBA 3VRHA 2DFTA 1ZIPA 2MOKA 5BV2P 3I72A 2JFHA 4E1AA 2H1LA 2W93A 3WLOA 1ZQ9A 3OE7D 1Z7EA 2E82A 1TEVA 2EQAA 1HYQA 2W6PA 1SEPA 2WTMA 3NOQA 2XMCA 3DKKA 3DZIA 3MB8A 3H6KA 3NEAA 1ACJA 2YWXA 3I37X 1NBOA 3G6WA 3DVAA 5CT6A 4FDLA 1Z4MA 5F1OA 2X2EA 4XQCA 5BSTA 3MGBA 1SCIA 5I45A 2HADA 2J6CA 2ZXUA 2FQQA 4UTNA 3S40A 3K1ZA 5CBPA 2BCGY 3LGSA 2PN1A 1SNYA 4IIJB 3BJMA 3DW1X 2B6HA 3E03A 5FJIA 5K01A 2J87A 1NZDA 4UE3S 2A6PA 1ADFA 3WO1A 1VG1A 4GI3A 1IK4A 2FX3A 3NKLA 4OXIA 5A7FA 4KVZA 3B7PA 3FBTA 4TTSA 5EVCA 2XQJA 3M1IA 1QO0D 2KLHA 3ZV3A 5K0ZA 2I6SA 3K9HA 1FU4A 5D86A 2OAGA 1I1NA 2PAAA 1RKBA 1YZKA 5FTJA 3QP9A 4I4NA 3IOMA 3LBIA 3PUJA 4MUIA 4JA2A 4QHSA 2A5DA 3SJZA 2BFDB 4WADA 3L7YA 1BMTA 1FU7A 3LUBA 1AIPA 2IEBA 2WWWA 9ATCA 1A1VA 1XPRA 4G0WA 3EXG2 2YWBA 2CXTA 3N2NA 2R8XA 1YHYA 1KF0A 1O96B 1WCIA 3DCJA 2X8WA 4JLJA 2P5YA 1U90A 3RC2A 5IBPA 4PO8A 2ZWOA 1UJ6A 4UJ3A 3W5SA 4CDRA 4DQKA 2OZLB 4LXIA 1OPXA 4H9GA 4AJEA 2C0QA 3OQMA 3LDGA 4FINA 2PO7A 3ASZA 2WQ7A 4J0GA 1HLFA 2MSDB 3Q7EA 3BCSA 1PFWA 1C9JA 1E3IA 2AJLI 3EUEA 4LNUB 2P6NA 3HWRA 1PSWA 2GLTA 5ALNA 3S3TA 3SMVA 4KBGA 4XWYA 1P8AA 1ESCA 4UCFA 4OJYA 3AEZA 4MUMA 2HW8A 2D1RA 4R5HA 1W4BA 4EHHA 3NJ8A 2WNSA 3SLKA 3PL5A 4F56A 1QJCA 5A9RA 3UH1A 3RC3A 2J7PA 1FNBA 3ILYA 3A1WA 4QHTA 3NAQA 4YRAA 2O4UX 1IRIA 2Z08A 1UFVA 4QRDA 1TVCA 4GMDA 1P7PA 5IJ9B 4DEXA 1HFEL 4EPWA 2XBUA 3DE7X 4II2A 4K9PA 4D42A 4EI7A 1J5XA 1X7ZB 3P5BA 2MMCA 2DHQA 4X7PA 2VDWA 3M1YA 4QOHA 3NBFA 1EP1B 1SU8A 1QZTA 2O8CB 1PGPA 3IQEA 1KQGA 1UAYA 5E95A 2QUHA 3HA7A 2JVIA 2A9OA 4Q19A 3CVWA 4RJTA 4ND7A 5E2BA 4DZTA 4M0MA 3SFVA 2FLVA 1E7MA 2RJ3A 3OP1A 5JAHA 1A5AB 2I87A 3PCTA 1AOXA 1D8AA 3DTVD 3OLQA 4LN1A 3GLVA 5EZ5A 1EFDN 1DEXA 3DFMA 3KWMA 1Y33E 1Y6RA 1YBVA 1J33A 2BDUA 2VTKA 4OGLA 4TZ6A 1EINA 4R6XA 2WJYA 3DP9A 3GEHA 4DJEC 1EX6A 1PTKA 3E5NA 3SKXA 1KI3A 4ACAA 5JSFA 5KHOC 5FA5A 3X43A 3E4CA 2VDUE 4QUDA 4BMSA 5KNCH 2VVTA 2RGWA 2PZAA 1TL7C 4BATA 5K6AC 1AS2A 4DXAA 1PT5A 3E5HA 4K6FA 1DIRA 1ISSA 3AGQA 4OXNA 2DHRA 3O3OB 2O8FB 1VPWA 4H7JA 2Z56A 1PJ2A 1QVRA 2YCLA 3U9SA 2JRLA 2G76A 3LWDA 1P1KA 3FVWA 4DMMA 2DT5A 4PRKA 1UXOA 1QP0A 1FP2A 2Y9PB 4DMLA 2I4TA 1Z73A 3AZQA 4Z9XA 1VKRA 1YAJA 3VZQA 4OQZA 4FMBB 2AG6A 2FEOA 4CMEA 1X2EA 1P17A 2P9QA 3TLXA 1DBQA 5BN5B 2WUEA 3ETCA 3WGTA 1W8DA 2R6CA 1I13A 2HTEA 4R51A 4NZNA 4J4BA 3DLHA 3P2MA 5DV9A 3CRVA 4LYGA 2R4UA 4CQLB 1DLIA 1BVUA 2QVXX 1SB9A 3Q3EA 4BEVA 1KVRA 1FTYA 3AR4A 1F2UA 4Y9DA 1XRMA 2XNKA 3EOBI 1NQOA 1ZGJA 3G7SA 2CXQA 1E7QA 3EXHA 4JEMA 3S2EA 2D00A 4ZDJA 5LP6F 5K0EA 2FAXA 1N6PA 1ETUA 5HKOA 2PWYA 1P60A 2ZQ5A 5D51S 4P83A 5H70A 1QG0A 2ZRHA 3ELWA 4AECA 3W5AA 1XZNA 5WRFA 2VBCA 4PBRA 3GY0A 1S2IA 3KUCA 5JSQA 4WA8A 3KT6A 2ZBFA 3QTLA 1A9PA 3O82A 2HLDD 4KN6A 1H4TA 2BFMA 3KT3A 5ICMA 3OZUA 3FRIA 3E15A 3DYIA 1KEEA 1XKQA 3TLEA 4ZI2A 4O4IA 1N0IA 2PUGA 2IHVA 1FB5A 2RG1A 2X3YA 4XM2A 3L4BC 2PZ8A 1ES9A 3C1AA 2V74B 3DKPA 5CIYA 1QP7A 1YE8A 3SHWA 3EZ9A 2EKZA 2JA2A 5JH7F 1PJ3A 3IIJA 3D54D 4JJFA 1SG9A 3CQ9A 1P2UA 2X1VA 2G77B 4LS3A 1HDOA 4HEA1 3ZY6A 3VU1A 4KMOA 5CLLA 1XTIA 1NVVQ 3T7TA 2VOEA 2IEYA 2D0IA 3QHPA 3W2GA 4PM4A 3TYXA 2VH1A 1VSQA 2Q29A 3TKLA 1OFUX 1I3MA 2BFEA 4PLCA 2X0KA 2WUGA 3UMBA 4ZVNA 5JAZA 2E5WA 2NXWA 2YRFA 3C3JA 1JAZA 5FRDA 4YY3B 2ZVQX 1N25A 1IIRA 1Z82A 3MTGA 5BYJA 1IHXA 1SULA 1PGJA 1V39A 3N5KA 1XVVA 1J39A 5IN4A 3VYSB 2JCVA 5A4KA 1QOPB 9MHTA 1NC1A 2FZLA 2GILA 1GL7A 2NQ8A 3T5DA 4CG0A 4NULA 4H6XA 3PE4A 4O1IA 2EKPA 1DXHA 2C9ZA 2FPOA 4QX6A 4MQEA 1NYRA 3SXPA 3KBBA 5JVDB 3AEKA 4D4GA 1G0OA 4PZLA 4ZVLA 1NVMB 1TUEA 3FPBA 3LFUA 4AFNA 3THSA 2ZSKA 4M37A 1NUAA 4R2MA 1YZVA 1E2DA 3A4TA 1M33A 2L17A 4FVTA 4ZVQA 2C96A 3K9BA 3IV7A 1EFKA 1VYHA 2CMDA 3P9KA 3BAZA 4XD7D 1VL5A 4QASA 2NIPA 1M83A 1WU7A 1Z4IA 2QKYA 3PUZA 4BV2A 4H27A 4EGQA 5CT5A 1AMOA 1OC4A 1J7KA 4LOLA 3WMEA 1F4LA 3IJEB 1MB3A 4AZ0A 1YDFA 3KL4A 1IJBA 1S4MA 1E66A 2XXBA 5JWOA 3BFKA 1EXMA 3A2KA 5BN4B 2IXDA 3GELA 5DLQC 3EUWA 1IBMB 2XQFA 1NFQA 3R3UA 2I76A 3IDSA 2C31A 3NDPA 3FGZA 3SR4A 2MWMA 3U7QB 3PNPA 2WTXA 2RHOA 2AXPA 4KGVA 4IIHA 1VYUA 4HI0E 4OMDA 1R9MA 4FMPA 4N5HX 2CXUA 3AJEA 5ENVA 5BURA 3VZDA 5EVJA 2HYIC 1HEIA 2C99A 4LHWA 3ROMA 4A2QA 5BUSA 5TNXA 3OSUA 3R5KA 4WOPA 4LJRA 5LZ7A 3ROGA 3ZBQA 2PR2A 1J2YA 1GGMA 3HR7A 3Q6MA 3IDFA 1CLUA 3JY6A 3DWFA 3H11A 4M53A 1JDJA 4BO7A 3ZKWB 3T1YB 1ODLA 1UPCA 1AKUA 2PEYA 5J59A 4D4JA 3OY2A 4WCFB 4AJKA 3RC8A 3O90A 3EXFB 2VHCA 1FVXA 5CJPA 3KPYA 4JFAA 5DM60 3OMWA 1NQXA 2EQBA 3OQIA 4YNBA 1EDDA 4M76B 3TPZA 2I55A 3UKDA 1ZNYA 3OZTA 2NGRA 2YXDA 3N8DA 3ONEA 1NP3A 4KN8A 4LSGA 3Q8LA 1LUAA 4CKXA 3IMFA 5AIBA 3OOSA 1JZSA 5LMNB 1HSOA 1ZSVA 4YASA 5J4HA 1P39A 1D04A 5DSZA 2R8ZA 1FS5A 3WWZA 5EJ7A 3BMNB 1PJ4A 4FSDA 4CG3A 3I1FA 3KYDA 5L3QB 2OV6A 4PGGA 2F9MA 4BMOB 3KQLA 3B20A 3PHJA 4XI9A 4BNIA 3PX2A 2KYRA 1E1QA 2PIDA 2R84A 4COKA 4JWKA 4ECAA 1GRQA 3KEQA 3UNXA 3STYA 3JR3A 1UOPA 1SY7A 4JD5A 1GOTA 2X4IA 4YMLA 4QOSA 2PSDA 1LPMA 4ZALA 4BDSA 1SKMA 1U0FA 5JJLA 2OORC 5CXSA 2VF2A 4RA6A 1PV1A 3V46A 6LDHA 5LZ2A 4QYSA 2FZCA 4BASA 3A0RB 2W2KB 2IBSA 2QD5A 1RACA 4ITRC 4C4TA 1GR1A 1BCRB 2CHVA 2JAOA 5ALPA 4AZ3A 2P77A 3F96A 1GPBA 1GA6A 1Z0UA 1CSEE 2ID9A 4PAWA 1KPHA 2O2SA 5KOJB 4F2HA 3Q12A 4KWEA 2X41A 5IXJA 2BTOA 3RUIA 3KTAB 2XODA 4Z5XA 5MN4A 1RR6A 2OG2A 2Y1WA 2WFZA 3QGMA 3R0QA 4KBYA 4RO0A 1JS1X 2WV7A 3PU6A 2JAQA 5CK5A 4ENQA 1E32A 2C00A 3H5RA 5HE9A 4G5SA 1VA5A 3HDHA 2DFVA 2WF7A 1WDTA 3E22B 3BGOS 3R41A 4YRLA 1DJMA 1MU0A 4KIFA 4HQ0A 3USCS 2GO1A 2JFFA 3B7GA 3KWFA 1GTL1 4IQ4A 5KSYA 3O91A 4RHCA 2GAFA 4LYHA 2VBFA 2CYBA 1YE3A 5JCOA 1T5LA 2DM6A 3E48A 1K5GA 3EZNA 1H0HA 3A6PC 4IQ0A 4M9UA 2IZ5A 4GM4A 3PC8C 3OF2A 5ALLA 1B7GO 3ZQ4A 3EXEA 4EZEA 1R0CA 2DWUA 2XTNA 2WLSA 3IP1A 5A3VA 3RASA 1XNRB 1EE1A 2NZUG 5DLEA 2NLOA 4FFMA 2IODA 1Z2EA 5EE5B 1R4MA 1G3RA 2IIQA 3HLTA 3KZXA 4UE6A 3KETA 3K6JA 2MSLA 3CRZA 5GZ6A 4DSAA 2AVDA 3KDAA 2BZGA 1PEAA 5JFTA 2F1HA 1KERA 2GARA 3THXB 4AKIA 3FI9A 3HB0A 3BS4A 1X86B 1K7CA 4HN2A 1YR2A 4LBVA 1RJEA 1TYBE 3N2KA 5H9WA 5AW4A 4AZWA 1GPKA 3B1JA 5TMEA 3QVSA 4R2IA 3E2IA 2FW9A 1JBEA 2O0JA 3U4IA 3KZVA 3T3HA 4HO1X 1AD2A 1LPAB 3I6MA 3TNDA 2DR2A 1N0WA 1M2EA 1OR8A 2ZB7A 2I4OA 3ZJ4A 2LNDA 5DISB 5EP4A 2M2IA 4TXLA 1MAVA 3DB2A 3OLCX 4UZEA 1IL0A 3VFDA 4ARZB 3EGOA 4CM9A 4ZDIA 2ASEA 2GM5A 1UZMA 3K3PA 3N0TA 1USKA 2XMGA 1G8FA 1YVEI 4XPZA 5F2KA 1E1YA 4V0KA 1WOYA 3M4JA 4FDVA 5AKLA 3PHLA 4IV5A 2PJZA 1TA9A 4KSYA 1SBCA 4LRYA 2WJJA 5C46F 1QIHA 2D5CA 2WTNA 2NVOA 4I2VA 4KXVA 4HGPA 1EVLA 2WI8A 4K1XA 1JQDA 3WAGA 2VRCA 4JNKA 4QPZA 3CSSA 4O4IF 1I3OA 2BFFA 3IIEA 3WNQA 5HJ7A 5JS1A 2FDRA 3AJ9A 4TYYA 1X19A 4H1UA 1W48A 4ARVA 4PG5A 4KR6A 1B8OA 4MVJA 3W5DA 3KPVA 2JJ1A 3LQFA 3KD2A 4K87A 4XYGA 2OHGA 1D2GA 3EW9A 4MV6A 1UOQA 3OP4A 5HW0A 1JHMA 3L84A 4Q05A 5L9AA 2ZLBA 1G3MA 1OIXA 3L8DA 4Y6LA 4MVJI 4QU5A 4DSUA 1ZJYA 1ZA1A 2W6CX 2JANA 3IBFA 1EJ2A 2EW2A 3FIUA 4UDYX 4B3DA 1QZZA 3QXCA 1SXJD 3G2KA 3NBQA 2XKAA 1QAMA 2X9GA 3HWSA 2I8LA 4RNDB 1T0IA 5BSFA 3ZGZA 1SVLA 2VJYA 3UJCA 3T5CA 8ABPA 5A9SA 4OY3A 4NU5A 1GZ4A 3A6DA 1BN6A 3BHNA 3GRFA 3RFTA 1VOTA 1RYZA 4FFNA 1PFQA 2PQ6A 4KFUA 5KU7A 2IYXA 4DMUB 1IJEA 2AOXA 2Q3DA 4WJZA 2KW5A 1A9RA 2Q3MA 1SRRA 1F12A 4G85A 1K4KA 4JJ8A 2P9ZA 2XQVA 5AK6A 4RTKA 2X8JB 2VDLB 3PJRA 1PL8A 2BEWB 1JA9A 3LC0A 3RK0A 1CS0A 3GLHB 1Q0PA 3K53A 2R7MA 1NT2A 3I64A 4W5JA 1D09A 2VWPA 1BIFA 1VTKA 2PCLA 4O02B 4XWAA 4MMYB 1FFXB 3NTLA 5ALIA 1N9ZA 3KB6A 1EUCB 1Y7PA 4DIFA 2QE7A 3KTFA 1RFGE 5I3ZA 3WMGA 1UC4B 3OM0A 4FZVA 1SD5A 3D3WB 1DIBA 4RJ2A 5H59A 1YXMA 3WXMA 1NVAA 4BEJA 3ZDCA 4US0R 1MJHA 1E79D 2XZDA 2WSBA 1GCIA 1GQFA 3PYMA 3MWYW 5BSWA 1FF9A 4IOJA 4JJGA 3LAWA 2CNLA 2WDPA 1CRWG 3DO8A 1M8PA 4J9UE 2XXJA 4FZRA 4ENTA 3IEKA 1UMCA 1Z6QA 5H3LA 4A0HA 5C35A 2IY8A 3OT1A 1IZYA 4CMGA 1BQ3A 4CIDA 1VHTA 4BZWA 3LD9A 1U2GA 3QKTA 2A8YA 3T3NA 4MH0R 1O9GA 3KUKA 4MUFA 3O9ZA 4RWEA 1N9GB 5M5BA 2VHZA 4QDZA 4ZT3A 1MVLA 4B3TB 1QFZA 1KVQA 1XMIA 2J3KA 1J1UA 1OV4A 2X15A 2QM3A 1U3VA 1X7YA 1LF5A 1VSTA 3HA5A 1R6UA 4TRJA 3MWFA 4MAMA 4KQIA 1XU4A 4N48A 2OV1A 2BIFA 4D79A 2B92A 2WF9A 4KQEA 1VFNA 4DC0A 5KNLA 3QXGA 3DJFA 3UENA 2BGKA 1OQAA 3FLBA 3D2BA 1M7BA 3G9ZA 4WY2A 2EG5A 5GAJA 3RYHB 2P91A 3PFBA 4DKXA 4W9NA 1D2NA 4KPUA 2JL1A 3TLMA 3UJBA 1KQNA 4FWTA 4B45A 4TTJA 1QYCA 2CCJA 4J7CA 3GB9A 2PFGA 4HAIA 1CFJA 1MH9A 2JFYA 5AK4A 2EAUA 2QY9A 3HKCB 1AQNA 1MX5A 1D07A 5ELXA 2R5WA 3SC4A 3M9LA 1PNQA 4BQRA 4D4HA 3M5WA 1KJWA 3OZIA 3BULA 2HUPA 3E9EA 5CU7A 5DK4A 1XTKA 5EESA 5F2NA 3P20A 1OMOA 3IPXA 5DRTA 3WK4A 4R71A 2Q4RA 2A2ZA 1XPUA 2INGX 3N39C 1MRZA 4F91B 3F1LA 1N2EA 5HM8A 4PFJA 3VSCA 1IZ9A 2ZBVA 1EP3B 1CIPA 4HDAA 2ZCVA 3S2SA 3WWYA 1NOIA 1TLFA 3LUJA 3UJDA 3QPBA 5C0OE 1Y8RA 4CR7A 4ME6A 1P0MA 4G9EA 4TL9A 4K7JA 4MWCA 4TSFD 4MUJA 5BOSB 2O5RA 1FFBA 3GAMA 3O2SB 5TVGA 4FNOA 4OXKA 4HLCA 1I2CA 1RRVA 1TVEA 3GL9A 4XVUA 5E2AA 1KIAA 3I73A 3QOYA 1WAMA 1C7RA 3X1DA 1T8SA 3DFKA 1QRUA 1U7XA 5T6MA 2ZS7A 5FR1A 1Z5OA 1M2VB 2JGNA 1JLLB 1M7HA 2ZJ8A 4BV8A 4FX5A 5CB4A 5EJ9A 1YB4A 1B4DA 1YA4A 3IAS6 4HN4B 3DGEC 3QBEA 1A5BB 2BSXA 2FJ0A 2OV8A 3HABA 2BT4A 3BILA 5AVWA 4XGIA 3VR2D 3DQQA 3HMKA 3Q8WA 1RYNA 2Q2NA 4BP3A 2IPOA 3MUFA 2O8DA 4GGPA 5ULLA 5FFFA 1ZEJA 1CUEA 3JWHA 2Z04A 2F9LA 4U2DA 2EJCA 5T8KA 2FEPA 4XCXA 3TEMA 4DMGA 3KZMA 5BW4A 3KQHA 2PT9A 3TMKA 1A4XA 2CLMB 3RU7A 1V37A 4J16C 1CUYA 2WEKA 5B55A 5JQGA 2DULA 1KS9A 2VSNA 3D5TA 4KE7A 4GNKA 4WD3A 2PSSA 1OZFA 3V5NA 2QLBA 4WOCA 1MXHA 2P9TA 3HHPA 2C61A 3QUTA 4GMXA 4ZOEA 3R5FA 4I5IA 4EKEA 3BSSA 4IZHA 1GHTA 2XZOA 3ER8A 2AKAB 5G53C 6REQB 1GKKA 2CNKA 3G2IA 3K4HA 3RS2A 4C03A 2HREA 1UBOS 3VU0A 4D2IA 5IWAB 3GFPA 1ZIDA 2QS9A 5EXTA 3C3MA 4QDUA 5L3SA 1X9GA 3NC4A 2W6MA 3NWBA 4BLUA 2WA1A 3UXMA 3ZJUA 1U1CA 5TX7A 2CKDA 2QNIA 1JAYA 2W2MA 4N9WA 1QK4A 1U11A 4JT2A 1J99A 3CXUA 4R8MA 3B6ZA 3D8HA 4OHMA 2WTBA 4ZANA 2CHGA 2HJSA 3TOVA 1I7LA 1SHKA 4ZAYA 3T34A 4YRGA 1HYBA 4C4SA 2QAGC 4GQIA 4UTOA 2YJNA 1RM5A 2JI7A 3DOHA 1YACA 1PDOA 3DTYA 3RJZA 1XA3A 2FWRA 2C95A 3PRKE 1TQDA 1W96A 1XZKA 1ZGAA 4LFCB 1YTUA 3SM9A 1UEXC 4FLFA 4TMZA 2NWQA 1J56A 3SIRA 4HV4A 2IXFA 1WHTA 4KP7A 4KKVA 2UYGA 5HZHA 2ZB2A 1KDYA 3A3OA 4LDJA 1WXQA 3WLIA 4DEYA 1B8VA 2NU9A 1BCSA 2BKAA 1U9ZA 2YHIB 1XVAA 2DJIA 3MVEA 3PBKA 4OHCA 5AI5A 4ZT6A 2GKSA 2PRKA 5EEGA 4BMPB 3ET5A 3P9XA 2WR8A 3WB1A 1JHXA 5TPZA 4KPFC 1QE3A 1KDVA 1BNCA 1TZKA 2GETA 1YC5A 3HB5X 4RZSA 1KGDA 1XD9A 3PZRA 4YJGA 2DBRA 4W5RA 2ZYIA 3MWDB 3JQBA 3OZWA 5JYBA 1Y4DE 4OP1A 2WDZA 3KT0A 5J3JA 5C1OA 1ZJ5A 5DGHA 4L5AA 5FLKA 4Q1AA 4UHJA 5FWYA 2A92A 1ONNA 3NBYC 4OQYA 1E4VA 5GM1A 1NBME 3KDSE 1GQSA 1PQUA 4KV7A 2G83A 1XQYA 3PGJA 2CFRA 1G21A 5E1OA 2PGDA 4L9AA 4REOA 5EERA 1P1IA 2QYHA 4XX0A 3WKAA 5I7WA 1TPZA 1XKLA 1LTQA 2REXB 3UB4A 3TAXA 3X0DA 3G0DA 3FKJA 4NZZA 1Z07A 5G1PA 1TAQA 5EXPA 1C4KA 4TS4A 2Q41A 2F43A 5L7TA 2ZSEA 2G82A 3C7KA 2J7PD 1QKJA 2D13A 1WXDA 1JRLA 2JFBA 3OJXA 4MVJF 4OGFA 5CHYA 3GRVA 4F3YA 3WL8A 3LP8A 2WE7A 3ESCA 4Z86A 4NIMA 3QPDA 1VHQA 3AHDA 4LVCA 2HHLA 2ONJA 1DQNA 5HRUA 2QD2A 1CZHA 1QMPA 4LQCA 4IDOA 5BSEA 3T1HB 1Z7GA 3ZWMA 3LRTA 3RUPA 1TDJA 4PYLA 5F9HA 2V1UA 2D2IA 3OX3A 2PJDA 5CXUA 3E3LA 3VR4A 3JZIA 4F06A 3C3PA 2CXRA 4N8DA 3QVGA 4WE3A 1XBTA 1T4DA 1J2RA 3VNRA 1BROA 4YX9A 3LU1A 5EAIA 3CJRA 3D1JA 1Y6GA 2ZB8A 4JB8A 121PA 1Z8HA 3Q88A 4FMDF 4URYR 1GAXA 5AW6A 3K4QA 4JC0A 3RREA 1BHO1 1DWOA 1YFJA 2NU6A 1N78A 3P9CA 1HEUA 3W6NA 1DCFA 5JAMA 4DBZA 4H1HA 4V0QA 4LPSA 1T8RA 4ID9A 3M5CA 3SC3A 4CGYA 4MP6A 2R6ZA 3ROTA 1UFKA 3QE9Y 5LQJA 1UZNA 3M4YA 1AHHA 5FB3A 2BBSA 1RQ7A 2JJMA 1LWNA 4YCJA 1OB5A 1E9SA 1K63A 1PFUA 5HF9A 4D5GA 4GLJA 1M2WA 4QOJA 1M5TA 2QVGA 3PEFA 1CNEA 2YN4A 4E3WA 4IV8A 3KAJA 4GS5A 4TTQA 4BV3A 1TO2E 4CEHA 1JJFA 4TMYA 4E5SA 2PLWA 3K9LA 3RFXA 1QH1B 5GM2A 3VVMA 4C4OA 4L78A 4MRMB 1JQEA 3IAM6 3ZJ5A 1DXQA 3RK4A 2DPHA 2FSVA 1OCEA 2HV8A 2J0SA 1E3MA 3L6UA 3AL2A 2XCTB 4LWQA 3U5TA 3HU2A 3IAFA 2QL5A 3IESA 1Q0HA 2VHQA 3G2PA 3KB8A 4NZMA 4RKWA 4BQOA 4RANA 2GGSA 3MN1A 4KQ1A 3A05A 4MKXA 2GTHA 1JDBC 1XZHA 1J2JA 2WWHA 5ALXA 3L1KA 5HUHA 2RE8A 2ODEA 1GSHA 2ZJZA 4WLVA 1QR2A 3O0DA 1O2DA 1XLWA 1BKDR 1NXTA 1U1EA 4FT4A 3EFBA 3E7FA 3R5HA 2YFYA 1OX4B 2P3OA 2GCOA 3S68A 1DJPA 4BX2A 2P6PA 4ZHQB 5ER9A 5T5QA 1WY7A 1KPIA 2YVAA 3JQAB 4WKGA 3WZLA 4QUAA 4FM9A 1W85B 3HVKA 4DXHA 4ROTA 2BGWA 1T26A 4G0XA 2YZ2A 4PR3A 4E2YA 4PNEA 1H2YA 3QKSA 4HQFA 3VZRA 4D82A 1GU7A 2GOYA 4CF5A 1MX1A 1IUPA 1XPOA 2AUTA 3QWFA 3AM3A 1KI7A 1V6CA 3EDQA 4E6EA 1QQBA 1JA1A 3KYCB 3L06A 2XA9A 3M1AA 3UAYA 5FWXB 2PHZA 2JD0A 3PF8A 5ENZA 2HR1A 4CXMA 5HCNA 2C2HA 2R6GA 1L5KA 1GPYA 2A5LA 4GH5A 1UKAA 2DRIA 2GHIA 3K16A 3LPCA 3PC3A 4YROA 2VCEA 4J75A 1NW6A 1UM9A 3FPKA 1A9XB 4D8XA 3MUEA 2ADOA 5FFMA 3EULA 2FVXA 2NNWB 3RYIA 2CJFA 1G5QA 2H2DA 1U9IA 4QDJA 1J97A 5AXAA 2XBMA 5B5SA 1WDWB 1QWOA 5D3MA 1ZGBA 2TMGA 5B7GA 2HYDA 3E9NA 1EFPA 3MD0A 4NU0A 3NGXA 2ZS9A 1RXSA 4OHKA 5GP1A 3SGLA 1QGED 3OEEA 1XJ5A 3NUZA 4OK6A 5ALRA 3UT6A 3WK5A 2A0FA 3ZIAA 3GCZA 1WKVA 3IQZA 3KK0A 1HX7A 4NG4A 4QG3A 5CH8A 3A9UA 3D2LA 4KH0A 4UREA 1IN5A 1E1CB 1V4BA 2FN9A 2ZJBA 1PQWA 4X44A 4AB1A 4J1TA 3QVKA 4HX9A 4R3UC 1GNLA 3WLRA 4CHTA 4CEJB 1P29A 4UBNA 3H13A 5HIIA 4S24A 1I0IA 5IJAA 4HNVA 1BE6A 1J8MF 2UZAA 4OOEA 2DR0A 1ZD3A 2CJWB 2CFTA 1R8SA 3I52A 4OIFA 5KYYB 1MHTA 2O2XA 1FXUA 1KSFX 2CHQA 2XB8A 3PVSA 3R1IA 2AJCA 4ZO8A 4B3RB 3EXAA 4N5LA 2H8GA 2QI9C 3R7SA 1ULBA 1JG6A 2G7ZA 721PA 3RF6A 3PX3A 3FOAA 5AVQA 4OGGA 5AVTA 1L7PA 1EHIA 4QAJA 4LXHA 1F5NA 3AJRA 5A5GA 1IQ0A 2OCYC 1OD6A 4JR2A 1G291 2PS0A 4TOIA 1JILA 4H18A 5KTMA 3TGPA 2BELA 1E3EA 1C50A 1D2CA 2J30A 3JQFC 2ZPTX 2G28A 3E05A 4GNRA 2YV2A 3K1AA 5TGZA 4KR3A 5JQGF 3QQ5A 5EJ5A 1KEWA 3ESDA 1E2IA 2B1GA 2AZMA 3A1FA 5G1OA 3E9DA 4DRXA 4DADA 5HMLA 3T12A 4MZDA 1K3UB 3IMKA 4HNAB 1WM1A 1L7OA 1U6JA 2W0MA 2PRYA 3OHMA 3F8SA 2OKGA 2H9YA 3OO1A 1GKYA 1HC7A 4KCGA 4R2HA 4QAQA 1YDGA 2HWUA 1UPBA 2MSKA 3BD8A 3K0AB 4PLFA 4RHEA 4YRDA 1J00A 2H1VA 1FCJA 3BX1A 3FZQA 4FKZA 5BSKA 4WHMA 1RU3A 5B64A 3G2MA 3AKYA 1NDHA 3VR5A 3ZV5A 1XEFA 4ML3A 2SKEA 3T52A 4TT3A 4UEKA 1TJYA 2WT4A 4B7CA 5KVVA 4MVYA 3MILA 1IDN1 3BFXA 4KYUA 1XCJA 2XRZA 2C7OA 1DFGA 2XDWA 4HS9A 1P0IA 3EY9A 2BD0A 3MC1A 3ZY3A 1XELA 4A10A 4Q9AA 1GGNA 3ELBA 3FMOB 2FPPB 2A0YA 2R6JA 4HTFA 1YK0A 5BNIA 4LJ6A 4FUQA 1ZR4A 1WBBA 3VI4B 3AB3A 3QLUA 1GY8A 3CN9A 1WXGA 4P82A 3SKVA 2X3FA 1Z62A 2RHBA 5CLFA 1OFUA 1F2TB 5ECYA 1RYMA 2ZRIA 5I8WA 1MO4A 4IINA 4QVKA 1OIVA 2AMLA 3HS3A 4ON9A 4Z0TA 3U4DA 1TEZA 1H23A 3H9UA 2UXCB 2DH5A 2ZJFA 1ID1A 4C4RA 1VDZA 3AYZB 1TCBA 3H9BA 1PNOA 2CY0A 1TUGA 4LXYA 4PGAA 3R76A 1P7VA 1ZIOA 1W6RA 3T3GA 4Z7NB 4V0RA 1E1QD 1EWYA 1PJZA 2X2OA 2Y8EA 4H59A 3WY9A 4DMFA 2O3RA 3FFAA 3QVJA 3RIXA 1OBFO 1L5RA 3L0DA 1MKYA 2OD2A 3QV2A 3A2LA 4KLZA 4WUTA 2RGEA 1ZK1A 4ZGBA 4FHZA 2W43A 2ENWA 2V0CA 3IVRA 4KC0A 2V4ZA 3K0BA 4BIMA 1G59A 5EIFA 1G8GA 4JU9A 3O38A 5EMLA 2HA7A 5BN3B 5EHZA 1XCPA 2MYPA 4TMXA 4YP5A 3SD7A 5IMSA 3V42A 1YVPA 3SQWA 2YQZA 1T1JA 2Q4EA 1UDRA 2JZOA 2VSFA 3EGXA 3FMFA 4OYRA 2HCBA 4W8OA 1D4AA 1DC4A 5F77A 2JGFA 4DBVO 4D6YA 1MV5A 4YMVA 3SHQA 3OQOA 2R8YA 3DHEA 3WGLA 5F98A 3SVLA 2WTEA 3ICCA 3ZIUA 4Z4IA 1Z08A 3GX1A 1IWBB 4G24A 3C85A 4OVKA 1OW3B 2NYUA 4X90A 3JASB 3NVKI 4Y7CA 4TZ0A 2A57A 2OO3A 3AHFA 1EFHA 4IXWA 1EUZA 5TEVA 4AMGA 3AHIA 1R12A 5LDGA 1BW9A 7YASA 1S02A 5GIPE 2DPLA 1E3WB 1RHJA 5M34A 3DTNA 4UNPA 2BONA 4BAUA 4B73A 3MTDA 4BZQA 5EJ4A 1TLLA 4KQWA 3DAFA 1N5MA 1B76A 3A6KA 1U7WA 4EY8A 3G5MA 1X2BA 3WRVA 2FV8A 1YVRA 3GPDG 3MJRA 4I1OA 2HF9A 1FUIA 1T15A 3ETEA 3IUBA 4E33A 1PT6A 4LF9B 2CK3A 5FAKA 4PBSA 3B1WA 3R24A 4OHYA 3CF0A 4UNQA 3B3QA 5DK6A 4CF3A 4DZRA 5CM8B 3H8JA 5CRIA 5KMGB 1ZMXA 3R3HA 2JK1A 1T9BA 2ATEA 2PKQP 3RIGA 1J8VA 4CUZA 4TKVA 5JPDA 1Q2XA 4UZSA 1VJ1A 1ARZA 4OSEA 3W05A 4CM7A 2V7XA 1U99A 3ZI0A 1SOUA 1SU7A 2XITA 5CR9A 4AK9A 4YR7A 5KX5B 1QF9A 1RYHA 4MCJA 4ZYUA 3GCXA 3EPHA 4TT8A 4ZEMA 1EXDA 4MWGA 3OWOA 1ZZGA 4YHBA 2EARA 3OIYA 4B47A 1KI8A 1FRFS 3CH5A 1VZ3A 3EH1A 2VJLA 5K3AA 5BVHA 3F2IA 4INAA 3TTUA 1KHTA 1GFWA 1DQZA 4J0FA 4CM1A 2R0QC 2FGKA 3E5MA 3IILA 3OESA 4PNPA 2UU9B 4TZKA 2W6ZA 1UZUA 2Z6VA 4Y2UA 4D3DA 4PN3A 1DCTA 2IH4A 3ESRA 5THXA 4DDHA 2PR7A 1YDMA 5JSHA 1DBWA 1TCCA 1YA6A 4W5NA 3WLHA 2C5FA 4WK4B 3GLRA 1KAGA 2HDHA 4UTXA 3DJYA 3EPPA 1PT7A 1KYXA 4ES6A 2Q1YA 2EFEB 3W04A 1GWNA 4QFDA 4EMUA 4PC3A 4CM9D 1OZGA 4I2NA 5D2CA 1E2UA 2WP0A 3NPAA 1PHRA 3IMCA 1NSTA 1N2GA 3C3WA 3H4VA 2RHMA 1HL7A 3RKUA 2LCQA 4ENSA 2GVDC 3OETA 3HQ4O 4LQDA 5BQFA 4KVGA 5LQKA 3DKRA 1ACMA 3IIMA 3PA8A 4YAFA 3UMFA 2XR1A 3EVEA 5AFSA 4ZEWA 3ORHA 1RKVA 5I8ZA 3V48A 4UEQA 1UFOA 5IDWA 1XDBA 2HK9A 4EGCB 5LVAA 1U7OA 2VRCD 2ZRKA 3IL2A 1G8AA 1ECBA 2FFBA 1EX7A 2HL6A 2XRYA 4BQNA 2SNIE 4L28A 3BMXA 1JXMA 3VH4A 1AS3A 2AEFA 4E31A 4OHPA 5EKTA 4WJLA 1E5LA 4R83A 2JJ1D 1IUOA 4JASB 4ZKDA 1KZ9A 5B30A 4UD2A 4HFRA 1PGQA 5SY4A 1KH2A 2IOFA 4DUYB 1F48A 4QLAA 2IV3A 1S7GA 3GJ6A 1G3IA 2QG4A 1WHSB 4ESHA 3H8WA 2RIRA 1Z26A 2EQ5A 3GV0A 4KBFA 2AWNA 4OXXA 1C9DB 1E77A 4E2WA 1G4UR 3P0HA 1CUFA 4AQYB 2RHRA 1YQEA 3HHEA 2VZEA 3I9V6 3LUHA 1TIPA 4ITUA 1HPLA 1L4NA 2PXHA 1BYUA 4I9FA 4I3FA 3OURA 4JJEA 2WM3A 5EWMA 2VDPB 1ZUNB 5A4JA 4Q3LA 2G1PA 3EZGA 3AR2A 4RKQA 1WZCA 4O4HB 1VSUA 2B3TA 3ANXA 5A6VA 3OTWA 1IM8A 5LXTA 1IXKA 2HQSA 1US8A 1TZJA 2H29A 1Q91A 4BHTA 1ORWA 4ZKEA 3HXKA 3MJDA 4ZJPA 5CD9A 1L5YA 3VU9B 2CE2X 3AV3A 1QV7A 1B14A 2Q0QA 4IVPA 5KSOA 1RBMA 1Z34A 3VSDA 4HDMA 4NYJR 4R8RA 1ZCFA 2JAHA 1DJQA 1N6LA 1WJGA 2GAJA 1I4LD 1IZ8A 1RAFA 5JYEA 5KTKA 3F67A 5CM9C 2SKDA 1JHAA 3B89A 5ICSA 3NJ4A 1WTCA 1VGQA 2ZYDA 1IY9A 3ED1A 4LOKA 1H0SA 4E6PA 4M8KA 2MDTA 1YQGA 1XEWX 2RGXA 3BMOB 1O6BA 3ZHUA 2D0OB 1OXKB 1WMSA 5CTJA 5IMBA 4ZU3A 2QRLA 4BP9A 1EX9A 1GZHB 2O07A 3GLIA 3IUNA 3P0RA 3IE0A 2XVZA 3QJYA 4XCVA 3NBAA 5TT0A 4LF6B 2FN7A 3B9QA 5DM1A 5KNCA 1P7ZA 4J0JA 1U2EA 2AFHE 1GUDA 2YWHA 1D2AA 2ISCA 3F9CA 3N2ZB 4IX1A 3WDMA 2F8TA 3DPIA 3TEJA 4QTXA 3FSGA 3L6CA 1QYWA 1RWKA 4PANA 2NM0A 5SZKB 5HS4A 4RMNA 3O26A 1X70A 1HT1E 4HQKA 5JFGA 1K08A 3QWIA 3ADDA 3HDYA 4DLAA 5FI0B 4BYMA 1QCDA 1VYTA 2GYWA 1E8MA 2E49A 3W1WA 3AL0C 1JIIA 1JZQA 1O0SA 1IHOA 2DHEA 5L7WA 5CHEA 1Y3FE 3FM9A 4DXDA 4E09A 3ROFA 3TL6A 4MPRA 3U56A 3NIDB 3QMMA 3P2YA 1GAJA 3BWCA 3ZDEA 3L77A 2L82A 4EPYA 1W8IA 4M8IA 4U7TB 1IEQA 1XI2A 4XJTA 5HOEA 5EL0A 3R0VA 2FF7A 2V7EA 3UJAA 1CZKA 3E4DA 3A6GA 3NHMA 4F9FA 4RE6A 3TTVA 5FBWB 4BO9A 4ZT7A 2BGGA 5IT5A 4H7HA 1HDYA 2JLWA 4L50A 3Q7PA 3NLLA 1U4SA 4H31A 4A82A 2H08A 2ODPA 3EMVA 3EWAA 2PKRA 4LWPA 2ZRJA 5E3IA 1CQJB 3TBKA 4D4IA 4YMUA 3MMNA 3HXTA 4K03A 1CRQA 4NPHA 2RJOA 2GZ3A 4KHZA 4EATA 3KT8A 3DOJA 4HC4A 1DUSA 1EQAA 3QX9A 1B0ZA 2XAAA 2HFKA 2R6HA 2HT1A 3ZXUB 1RLOA 2IZZA 1YD7A 2QTBA 3JZDA 3OF3A 3SHVA 1ESEA 5AESA 2HK7A 3EYAA 4P0QB 2PPLA 2DG2A 4U1RA 4CCWA 1V11A 2ZRFA 3NC0C 1VJTA 4I5DA 4N0DA 2HZBA 3NPMA 2DT8A 1IN8A 3DV0B 3C6KA 1PDVA 2W4QA 4IGAA 3T94A 5IJ9A 1IHUA 3BD6A 2C82A 3LPAA 4MVCA 4QTTB 4Q4JB 3RNLA 4QULA 2QTAA 1GQOA 1OIWA 3AHJA 1Q1EA 2ABWA 3IFSA 1GUFA 4X8MA 1TK9A 4H7EA 3M33A 4RK4A 4CR6A 4Z2YA 1JFSA 1JR4A 4YO7A 5J1TB 3FPCA 4EB6B 1DFHA 2GA9A 4X3PA 4AY6A 2FPIA 3D8BA 2AX3A 4G5FA 1EVZA 5K0NA 2J33A 1L5SA 4R05A 5F2OA 4JFRA 1XRPA 5CJJA 5IVDA 4X54A 3CLSD 4ZOLB 1KRWA 1II9A 4KGXA 1IAQA 3RW9A 2AOUB 3GUZA 2VJDA 3H18A 2C4MA 2RC6A 3G89A 3I3SR 4ZO6A 3WBBA 4BB6A 1MZPA 1EK6A 3IR6A 3VJRA 3EVZA 3HGTA 1YRWA 5JC8A 2XOKD 1HDIA 2JLCA 3GAAA 4OH1A 1E4OA 5CW2A 2WIJA 1NLMA 1UXIA 3HN2A 4P33A 5K4HA 1QVVA 2FEMA 1RQPA 2N0SA 1VJRA 4O2BB 2FY8A 4PYJA 5C8XA 1FQJA 1GQYA 2GEVA 1K98A 3NBMA 1TCUA 1NV9A 4W99A 1IE3A 3LXUX 3TQIA 3ZQUA 4KNYA 4ZYVA 4I4CA 3FLAA 2ILTA 1X6VA 4O1MA 4WXRA 8ATCA 2KQUA 3GLUA 3P9YA 4M0FA 3W5UA 4X7BA 3SF8A 5TQVA 2QIOA 4MR7A 2IWHA 3T8YA 1A1SA 1U31A 1E7YA 5EE9A 3NTRA 1BA3A 4XOIA 2FG6C 4A5OA 1G5PA 1PV4A 4DV5B 2FQWA 1OROA 1PZMA 1L0BA 4LCJA 2CFIA 4NHOA 1V8PA 1IWPB 1AK2A 1HKHA 2DPMA 4C4XA 1WABA 4H4EA 5C53B 3FKQA 4G8CA 3ZS9A 5P21A 4G23A 3L1IA 1HDXA 5AVJA 3G8BA 2P2DA 4GECA 1XDGA 3SNKA 3TW6A 1UBNA 2GM9A 2VDJA 2IIPA 5BWCA 1EFVA 1TYDE 4DM7A 3UHAA 3CLHA 4CIVA 3SG0A 4FB4A 4YI5A 1QFJA 2YN2A 4GM0A 5FNZA 1SZJG 1PKXA 1JSCA 3MOSA 4EEXA 2N9UA 4IIBA 1YCHA 4O0LA 4JI4B 2DAPA 1U2DA 5KTPA 1QQ5A 4ZAXA 3VISA 4Y67A 2O6LA 4BU1A 2QN3A 2VJNA 3DNPA 5IANA 5TPZD 2BFBB 3WI7A 4JYZA 2CB9A 5K1ZA 2X0EA 2GN1A 3KLPX 2IOYA 4ZVMA 1LLQA 1WX1A 4C0BA 1VRWA 1Y89A 2WJWA 3GLGE 1EVQA 3MCZA 5HQ3A 5HOQA 1M9NA 5ED0A 2ZAYA 4NHEA 1QGOA 2E85A 4X92A 5HIJA 3SC2B 1R1DA 1LDGA 1ZN8A 3KX2A 5CXXA 3KJZA 3MS7A 4YAIA 3MELA 1CZRA 3SIWA 2QN1A 1DXOA 1DE0A 1K86A 1RI3A 2W6QA 3QOXA 3ZE1B 5CFQA 1DL5A 4C7VA 3DWEX 3SEZA 3GP8A 4KU4A 3B5JA 3SICE 2Y4NA 1U7UA 2IQ5A 1Y1LA 3QEKA 4WN3A 3C7AA 3U0VA 3WSVA 1HE1C 1KH1A 1SZCA 1EGHA 1IEVA 2OLKA 3BKWA 3KJGA 2A67A 3DKIA 3P4UA 1I1OA 2YDXA 4L27A 2B83A 1EK0A 2FW6A 4Q9KA 3T7SA 5JEEA 2Q0XA 5F5NA 3EX7C 1WXWA 1SVSA 2QN8A 3WGOA 3ZQ6A 4RVSA 4R9RA 3ZG6A 2C2BA 1FBNA 2W6ID 4DEVA 3TG8A 5TF4A 3DUFA 1N4DA 5E4TA 5BQOA 1T1GA 1I2AA 3NWPA 3E8MA 3GJTA 1XCGB 4WSOA 1EESA 1CR2A 1N2ZA 2R1TB 3IOBA 3PFNA 4TVOA 3DAOA 3GEBA 1DQPA 1DTSA 2KM1A 3ISVA 3VR4D 3ZUGA 4HAZA 3ETNA 2Y67A 1XR3A 3ZNNA 2IHYA 4ZO4A 3FDZB 5CB6A 1TTPB 2J5XA 5ED4A 1XROA 3LYUA 4L8LA 3RK1A 2JS7A 2D7JA 2JRCA 4J0KA 2WHQA 4UW9A 4TKUB 4K2HA 4E2XA 3QMVA 5IULC 2Y2UA 3HZZA 5C52B 2HLNA 5LXTF 3FFBA 1FE8A 5AQEA 4LV6A 2HMYB 2XQKA 2R7LA 3V8RA 1CERA 2GK3A 3KAKA 3O47A 4IWXA 4PGFA 4OI2A 4W1SA 5E6RB 5C5IA 2QLTA 1MMFB 3FPJA 2VPZA 4O4JB 4L15A 4L7VA 3TO5A 5IAOA 2I99A 1P5HA 4YTEA 3LG2A 4LY3A 1KZGB 1Z5UA 4BQEA 1NG1A 4HJXA 2JZCA 2RH9B 4E1VA 4QDTA 1T3TA 3G0BA 3JQ8B 3WGNA 2C8LA 4K9MA 1SURA 1VG8A 2J9GA 4PZDA 1CZOA 4X1IB 6PFKA 3QITA 3ZZUA 1CJCA 5A03A 5K0TA 3KLBA 4QXQA 5JD4A 4BO2A 1FMLA 1Z5VA 3GFSA 4JBHA 4YHHB 3S27A 3D0OA 5ICFA 3NKVA 3DZ8A 4DIMA 3LOQA 1G42A 5BORA 4CE6A 2WYVA 3B6EA 5IAKA 1ZHFA 2ZTMA 3T38A 4D98A 1I6LA 1P74A 4HQOA 4TLDA 2YJ5A 2JKVA 4KFSA 5CA1B 1NXSA 3H4TA 3GOHA 1SBIA 3D7NA 5GOTA 3VHLB 3NFYA 3VJKA 3H1BA 3WYBA 1JIQA 5DNUA 3L7JA 4H7FA 3VPDA 4ETNA 4DCUA 2ZM5A 4NKRA 5DX0A 1H42A 1DOAA 1M0EA 2MMGA 4AJHA 3SVTA 1J49A 4M7PA 1B0PA 4R9UC 2WW8A 4LYJA 1NKTA 1SB8A 2FOXA 1KY4A 1EUDA 4U2GA 4RVGA 5DGIA 4KIWA 4D8UA 1E6WA 5EYPA 3AU9A 4E5MA 4Q1VA 1LSSA 4OL9A 3TXYA 1F14A 1YI0A 2GKGA 3BMCB 3RAJA 4YQFA 4UMVA 2IT1A 3GJSA 3OZGA 3PKIA 4OFWA 1M2OA 7AT1A 4YR9A 4U39A 2CL5A 1HWYA 2D74A 2DC1A 1EA5A 1LC3A 2QRGA 3BDAA 3HCAA 1XF9A 1Z38A 3NZEA 2OCDA 3E1KA 1OWLA 3GGCA 2WWVD 5B58C 3TBFA 5B6IA 3AG5A 1L4UA 4FEEA 1E9FA 1P0PA 2D1TA 4ZU1X 1J20A 4CQMA 4DDWA 4I1YA 3ZDDA 3HTXA 3L7DA 1JAXA 3P97A 4YRZA 3WHIA 3HYSA 1KYQA 3H2JA 5H80A 1T6YA 1HLDA 3A9VA 1FRNA 1W49A 3B3GA 4JKYA 1RVDA 3QNWA 4W5OA 3PHCA 4P32A 3ZWWA 4EPRA 5KYWB 3B7WA 1J09A 2G5TA 1V96A 2QGZA 3GHHA 4JS0A 5CA0F 1JJIA 2AYZA 4RVUA 2R8RA 4IWNA 4CZ2A 2WIDA 3AF0A 5L3VA 1R8YA 3ZIAD 4F3KA 2SECE 1T34A 3FYUA 2CDRA 4LXGA 2O2GA 3U60B 2XE4A 1KH3A 3PXAA 1JALA 2EYQA 5GJCA 5I7SA 4FLEA 3IDZA 3G1WA 5HJ2A 2WK1A 1QLJA 5HILA 4PC2A 1MABB 3I05A 4G4IA 4BPBA 1ICIA 2EDCA 1PCXA 4K86A 4FNAA 4Q7MB 2YBEA 1O97D 3HRIA 1DPGA 4DA8A 2PLNA 3AY6A 4RA9A 3VKHA 3BGSA 3BIWA 3DV9A 3U80A 4LVUA 4MUBA 2OOKA 4Q16A 4PAGA 5HUQA 1L5WA 1QYVA 1TU4A 2F8MA 2JVKA 2P6MA 3H0KA 3S7ZA 1AT1A 5D7NA 4XWKA 3OWHA 1YVUA 4MKHA 2V59A 3A4IA 2AN5A 1KIFA 2VLBA 4K1LA 1A50B 3M6UA 2BEUB 5J9FA 1YVDA 2AN1A 1A04A 1TVKA 2GZHA 5THQA 2XSZD 1ZVQA 1ZOPA 1GL3A 4ZT5A 4X65B 3GARA 3GH1A 4ID3A 3TZQA 1CVLA 3H1TA 3O5AA 2XZLA 3QIVA 2RH8A 4L2IA 4OLFA 1I51A 1IU9A 4ZCIA 2H2AA 4R8VA 1GNTA 3AI3A 5BW6B 2ZYHA 4EY5A 4MO2A 3ZZTA 3D4OA 2W98A 2G0NA 3WX0A 2IZ7A 2PAFA 3G82C 4HDNB 5BNWA 4JLSA 2RK6A 2H0QA 3BKXA 3ASYA 3FHOA 3RDPA 3TRIA 4D57A 2ZIFA 3AVYA 2WD7A 4MWTA 4DYVA 3OTOB 4QRIA 2C92A 3WJ7A 5LKRA 2P4SA 4FOOA 2ODAA 4A36A 1KARA 1P4SA 1T8TA 4XE5A 5DX1A 2VK1A 1KL7A 3EBOA 1BO6A 1Z8FA 4I55B 4L76A 3S8MA 4YT2A 1IRXA 3MGCA 1ECPA 5IT0A 2PGOA 4QBKA 4RZUA 2KWIA 1HO3A 1M6HA 1USWA 2G1UA 4UEJA 5EHQA 5FCDA 3ZWDA 1WDLA 2FU5C 3EBPA 3NDIA 2HRRA 4WV3A 1RM4A 2FFRA 3VR5D 3ZHQA 1X7WB 5DH9A 2F1OA 2VTEA 2Y77A 3MCUA 4TT3D 1TE2A 3OVMA 3WLKX 2NZ2A 2WJHA 1P6QA 4EH1A 4S1TA 4B6JA 1T13A 1JJAA 4P22A 4QJIA 4YYZA 4K9QA 4QYWA 1RHQA 4EOGA 4J0EA 1VGRA 2LZ0A 2W2VA 4FHFA 1CIVA 3RLIA 5D87A 1X7XB 1XSEA 3RS7A 4Z9AA 4IG9A 1QONA 3VHRA 5KQRA 3KQKA 1ODSA 4HFMA 3WQQA 1QIFA 2X19A 5K7SA 4NP6A 2JB9A 2HRCA 1JG1A 2W8BA 2XQGA 2OLJA 4QA9A 3TIIA 4ETIA 4HADA 5EKUA 1NR5A 3MS2A 4MUKA 4EG5A 4DBLC 4JLWA 1QFXA 5G40A 1RNLA 1TUIA 3CWQA 4RK6A 5G0UA 4ARAA 1ZPDA 5JUWA 3LHFA 5CVVA 1XZFA 2J45A 3L07A 2OORA 4NG5A 4WNCA 5CDFA 4Q4AA 5IKEA 3LWBA 4Q15A 5BPHA 3TZCA 3ZCRA 3SBXA 4ZI5A 4H0NA 3IXLA 1RW4A 2QZ4A 3OKCA 3TSYA 4EFLA 5BSGA 3UWPA 1PEKE 3BGVA 3HBJA 3JALA 4RHFA 3OBBA 1LDMA 2OFOA 3P5SA 3UAVA 1ZIXA 5DDIP 2HHJA 1EPUA 2E1RA 4TWRA 5AM1A 5AKKA 1E1MA 5HMMA 5KWJA 4ZI7B 1B0UA 1E3DA 1YZQA 3K0FA 3WV5A 2QLMA 3HB9A 3CT6A 5LOVB 1MLDA 2XOEA 1G16A 2CMGA 1YH3A 4ZPXA 4S2EA 1T5SA 2BR4A 1F5SA 3FWKA 2QWXA 2X1LA 2PL5A 4RC9A 1C29B 1G60A 3FLEA 3QY0A 2Y6UA 4XJVA 3WNVA 2NADA 3FMIA 2HHCA 5DT2A 2QF7A 4F6RA 1WB5A 3TM5A 4DDTA 1ENPA 1OPRA 1Y8AA 2X5KO 3D6HA 2AFRA 1B26A 1VC2A 2J3EA 4M38A 4DDMA 4DLUA 2H4XA 1YQWA 4MYDA 4F38A 2GM4A 2QT9A 4DBLE 1KWGA 2FSSA 3OCCA 4OKNA 1L5OA 3D7KA 3F5FA 4O0MA 1TPYA 4RFLA 1GA4A 5G02A 2NV6A 3CUWA 2DPYA 5LYJA 3QEMA 2OBYA 4UVDA 5YASA 4NJMB 1K7EB 5T4BA 1Y48E 5AYVA 1XKTA 1QX3A 2P3SA 4MKIA 4URZR 2WJ6A 4GLLA 1K68A 3FNIA 2HWKA 5AVVA 1YTLA 4MQ6A 1D3AA 4EDFA 2EWVA 2I2XB 2B78A 2XMBA 4C5BA 2JATA 2GTPA 4GWKA 3TQQA 3Q7TA 5FL7D 2BH9A 1LWOA 1G8PA 2JC3A 1ZWLA 3H9GA 4HB0A 5FOWA 2OPHA 5ESRA 4DUPA 1JSLA 4AJ4A 5JNVA 3QHQA 1M72A 1BEEA 1P19A 4Y1EA 4MI1A 4JUIA 1TRHA 4Q4LA 4F7DA 1U2ZA 4OOFA 2Q1WA 5AJXA 2XA1A 5BO5A 2J4DA 3JWGA 1UWLA 2OBNA 4B81A 4HXFB 1GXSB 3OCZA 1PJLA 1GLGA 5G4KA 2NZVG 1U94A 2HQ1A 2I1WA 3JVEA 1BD3A 4NATA 2G9RA 1E9CA 4NE7A 4Q1CA 5IC6A 4G37A 1E1RA 1QHYA 1TMOA 1RRGA 2IEZA 3K6SB 2B5VA 1OH7A 3RJTA 3QE3A 4UBMA 3VH1A 3TG2A 2X4GA 2OXCA 3LBAA 2I22A 4C1NA 2ZSAA 4I5EA 4JLMA 3CLRD 3AR8A 1XWIA 3WK9A 2I5PO 1B43A 1AXEA 2MYNA 5AJHA 1YS7A 2A59A 5EZSA 3EEFA 2NO7A 4Q82A 3HUTA 4M1MA 3V3KA 3W9YA 4RXTA 2PD3A 3E5RA 1YB6A 2J0EA 1TT5A 3IIIA 4KYTA 3VO1A 1GQRA 5DNAA 5AXDA 3ZK9A 4U02A 4ZMBA 2QRUA 4BUJA 4FFLA 3FOFC 3LLVA 2HXSA 3LL7A 2DFKB 4WLUA 1WW3A 1PJRA 1OXMA 1TU0A 1M75A 1UL1X 2BISA 2GNAA 3E7DA 3M8KA 2Q7OE 4O2AB 3KKNA 4Q7KA 1N92A 5LZ9A 2BOVA 4ROSA 4AYXA 4FI3C 3F7NA 1U5BA 2QQGA 3BYZA 1C1DB 4RPLA 1F8XA 1SHJA 4TTVA 4AG3A 5CFRA 3D6FA 5A62A 1Q5PA 2GF0A 2P79A 2R1UA 4MZXA 4IX9A 4PO9A 4EARA 2IHNA 1R0ZA 4CL0A 3FNFA 3LXRA 5H02A 4FGUA 3J7AC 2AG8A 5ADHA 1CDOA 1E2FA 5FPSA 3G1TA 4RORA 5ALOA 3DAYA 5J2TB 4MRSA 3TSCA 5JECA 2CF6A 3HI6A 4G1FA 4HXGA 3MFQA 2ZYGA 5A7HA 1C4OA 2NSLA 4Q1DA 3IV9A 4MRAA 2FGJA 2JHCA 2HA6A 1F9EA 1PK9A 2QSYA 3NRCA 3SEAA 4J2OA 3A4MA 3AH8A 4ZYLA 1NDUA 2ZG6A 4JLPA 2OVBA 3BWBA 2R4TA 5EZYF 2HJRA 2DQSA 2MTBA 1CF9A 5AKYA 3AINA 1KI4A 2LKCA 4OLHA 3U7GA 3EMBA 1AB6A 2OBXA 3DDOA 3E35A 3KQSA 1W2GA 5ECDA 5E6UB 5C8VA 2BFCB 2FFQA 3QLEA 4R7GA 1UJ4A 2PZMA 4OJNA 4FS3A 5ALTA 4ZDKA 5G3YA 2RGYA 2PUWA 4N0MA 5DYTA 3DHYA 1X9HA 1OAOA 1MCZA 3CZQA 2GB4A 1L3BA 3Q1KA 4IEFB 4BVGA 4PZCA 1CQIA 1LBEA 4OHXA 4OFXA 1VMKA 3LUKA 3Q11A 3V4OA 16PKA 5JAIA 4DHEA 1GV1A 3MOIA 3CX8A 1HDEA 2OK7A 3WL4A 1P1RA 2QMOA 3SE0A 4DWJA 2RARA 4OKIA 5JJKA 1KJQA 4JJKA 3AQ4A 4PSAA 4DCCA 1W75A 4EG0A 4LMAA 1OT3A 5BWMA 4IQ8A 3IEPA 3PRJA 4NICA 4XM0A 3KOWA 2EBFX 1M8GA 1SKYE 4J1NA 3PENA 3V6LA 2OUKA 2H63A 1X7HA 2NSHA 3IPRA 1FDWA 2CNWD 4YCNA 4U2EA 2G71A 3EPLA 4C21A 1T2EA 3DBHA 2X3UA 2D59A 4YJ3A 3FAZA 1SU6A 3W06A 4BNHA 3IC5A 2QK4A 3U3OA 3UK0A 1NW5A 2P0YA 3Q4GA 4L3OA 5AWFC 4DOMA 2YXNA 2G5GX 3C0KA 3DB1A 2Q07A 4I6EA 4ZO7A 1SA0A 4UM9B 1G2QA 4EZBA 2FX2A 4N8EA 1IN4A 3A4NA 2I2FA 4JGBA 1WBDA 3RUHA 1M6YA 1Q83A 2Q1XA 3ZLTA 4I9HA 2EOAA 4YP9A 4JI5B 1VCIA 2C5LA 5FDFA 3WZMA 5FUQA 5KNCD 1NXOA 1E61A 2G17A 3LTEA 1NOJA 4ER3A 5KPDA 4K6HA 3QWHA 4CKCB 3OIDA 2AFIB 2GM3A 1ZC3A 3L7MA 4C43A 2IW1A 5I9BA 4GR4A 1OI4A 1ZCAA 4PXYA 4QT4A 4KNWA 4EZIA 2M98A 4KDEA 3WSTA 1A9QA 4GKJB 4CIBA 3D2AA 2A4MA 4AW9A 4EA6A 1XL1A 1P9OA 1ORIA 2B6NA 4G67A 2DMRA 1MRSA 1NNLA 2E4VA 1IHDA 2IHKA 1NJ1A 2YHAA 4Y9SA 1L4YA 4HH0A 1P9WA 1DC8A 2IIBA 3O6VA 4DPKA 5D6OA 2CNBA 4KFTA 3V33A 3A9CA 1I36A 3SEFA 2DTEA 3EGVA 3OCJA 2R11A 2WSIA 1O8BA 4IJUA 1WV0A 1YSCA 4CVNA 3IE1A 1ZVJA 3GLGB 3NOOA 2FVYA 2F8LA 3TECE 2Z6QA 4F7WA 3C8MA 1FU8A 3L79A 4XIJA 5H81A 5LMCA 4QARA 4CKWB 1FC0A 2IZ0A 4MPDA 1WO8A 2ZIAA 3KM0A 4UARA 2EG9A 4N0QA 1CFZA 1OREA 3ESXA 4GUAA 3U7JA 3FWYA 2Z2KA 2JIRA 4HRXA 2VSYA 1ZHHA 1MV8A 1ZU5A 2ZDGA 4MXDA 1OXXK 2ZAOA 3RHZA 2PGXA 1Q7TA 2FXIA 3EJWA 5E9QA 5LYYA 5GJBA 2EFCB 2ZYWX 2ZAMA 3V00A 3R7LA 1S01A 3PVCA 2AEJA 3OICA 4MS3B 1GYQA 2ILVA 4N40A 1BN7A 4R16A 5IDQA 2XTAA 1WQ4A 3G8YA 5HIKA 1MD9A 1YS1X 3I0MA 1DRJA 5DGXA 4Z9YA 3TJMA 3N2YA 4B85A 1X15A 2FZWA 3FFWA 2E18A 2O0LA 2HV9A 4ZYWA 4J16A 4DCSA 3ER9A 4OPMA 2PGNA 1R00A 4GX5A 4P08A 5JS7A 4AN4A 3G2HA 1KO7A 1OY1A 4P98A 1C1XA 3NTUA 2FPGB 3NUQA 1EZZA 3U09A 1XFAA 5C3MA 1C3OB 1RIFA 1FFHA 1TUBB 1YS6A 3G3EA 5B6PA 3GJ7A 3A36A 1BEUB 3O4GA 4O4LF 4YBZA 1P2BA 2G8LA 1UKZA 2V4MA 1NW7A 1AX9A 1U0SY 3L7OA 4CTJA 3NCHA 5JISA 4MR8B 1UIMA 5JMTA 4KPYA 1ZM3A 3O4JA 4KQMA 5FORA 1HM5A 1L4GA 3GJQA 3V4FA 3PEYA 4U3JB 1GRRA 1K8ZB 2G7MC 3PSHA 1ECJA 1MT3A 3K2BA 1W46A 2Y0BA 3E7WA 4RFVA 4JP2A 5KC8A 2IU0A 4AKTA 4CEJA 1RWWA 3O94A 2CHUA 1DRKA 3DDUA 4B48A 2QAGA 3T6KA 2OQ2A 2L69A 3DEIA 1HNZB 1R5NA 3PA6A 4MRVA 4ASUA 1YBHA 5IDXA 1VHWA 4NOLA 1U02A 1QHFA 4GZLA 2NPOA 4I4LA 4UUOA 3F8TA 3SSOA 3L8CA 2CLCX 1W47A 2QP3A 1S2GA 1SXJC 1EVYA 1ZW6A 2YXPX 3L02A 5FPPA 1K6JA 4NOMA 5AVZA 3OECA 1QYRA 1I1QB 4IHQA 3RTEA 1HFWA 4PQYA 4D0NA 1YC2A 3LYHA 3KSAC 3B1KA 4P4TA 1KMCA 1P4JA 3MLEA 1JIKA 1ZUIA 3TD2A 4YRSA 1K3FA 3AEUA 4E30A 2MSNA 3LY5A 3PUVA 4R0NA 2BMVA 2Q3FA 2JGEA 3SDBA 3BJRA 2YJGA 1VE6A 3IS3A 4FGLA 3EMKA 4GE3A 3EUAA 2OQVA 2CXHA 3FGNA 1NM5A 3RAPR 4JLNA 3IOCA 1G18A 4CTNA 4RCVA 1MTOA 3HBAA 5B37A 2DZDA 4AZVA 2PZJA 1BJKA 1QGYA 2PUTA 3GNQA 2C4TA 2X42A 3DFZA 3EVGA 3OE5A 5CX4A 1Y3HA 2V6JA 3R6LA 3GGPA 3GZ4A 3BL5A 2P5TB 4FE4A 3MTBA 1A7AA 1DX6A 3S2UA 2MSWA 5CDSA 3SVZA 1J9ZA 2LUOA 3S2FA 1BH2A 3OHPA 1FYFA 4REQB 3DDSA 3CA8A 4HDSA 2FPKA 4R3NA 5ALGA 4EITA 3L4SO 1J25A 2W48A 4M0KA 1ECFA 1SVWA 1JU3A 3E9MA 1EBFA 2I3ZA 3A28A 1NI5A 3K0EA 4Q5IA 3Q2IA 5DZSA 4WINA 3C5WP 1GYRA 2O8EA 3ZC3A 1SXJE 1L7RA 2P2SA 2OHFA 3KS9A 3X3HA 2IBMA 3IJ5A 3QOWA 1U8YA 1YR6A 2M1ZA 2PRJA 2R4QA 2Q9BA 1W1IA 821PA 3Q85A 4RACA 4MYTA 3VZCA 3SY8A 1Y5LA 3JVIA 2EEZA 1QLHA 1EGQA 4NCIA 4Y2GA 4TWZA 4O59O 4EJ6A 5I4KA 1DKMA 1H0KA 4G3XA 3VDQA 5CGZA 1TFRA 1AZSC 1VZ2A 1QPBA 2Q45A 4CM8B 3K70B 4JYPA 4JYAB 3TINA 1TM5E 1DIHA 4GRIA 3SHFA 5KQPA 3LS2A 4UATA 4Y2VA 5LP6C 4BIIA 4N18A 2I7DA 3FPGA 4LF5B 3F78A 1YT5A 2FEXA 2IW3A 4RTMA 3RSOA 4GOOD 4E15A 1G9SA 3I53A 4N6NA 1HUQA 3BC1A 2B5OA 4X6LA 5LZ4A 2BFNA 3TIFA 4DE5A 5HKBA 1L2TA 3GK3A 2X5JO 5IPFA 5ES4B 1QIGA 1YZNA 3ABSB 4S12A 1U5CA 1M34B 3KQVA 2WIGA 4DPMA 3U6BA 3MM4A 2FCAA 1RRPA 3AQIA 4XAQA 5F78A 1E2MA 2BFAA 1K06A 1E1KA 2XVAA 3E8XA 3V32A 5H7XA 2ZYTX 1XMSA 3OPYA 3H5OA 1YFZA 3CUKA 3C41J 1I24A 1PR4A 1RJGA 2B69A 2C8JA 1P9LA 1EIZA 3CG0A 4MWEA 3BGIA 2HIHA 3DC7A 4RJLA 3ZD8A 2RG7A 1WUTA 3CZPA 1IY8A 4QQ8A 3ZCUA 2XRFA 3GRUA 4BE4A 1UKCA 4FJ2A 5JANA 3CCBA 1X80B 1NW4A 5TQ0B 4GPZA 5FEMA 1QQAA 4DM4A 4MUEA 1QF7A 1SFRA 3PXEA 4CIXA 4CLOB 4EPXA 3DE4X 4O63O 3F98A 2IY7A 1WR8A 1XJCA 3UT0A 1QDLB 3AILA 1DDOA 2BFDA 4JQCA 4YJ3F 4JGIA 2G67A 5ADVA 1OILA 3CF4G 5JD5A 5BR1A 5AW8A 5CD1A 4PZYA 2XYRA 4F04A 3HE3A 1FUUA 2GXAA 4E07A 5DGTA 2Y92A 1NU6A 2P8SA 1KU0A 3B5IA 2QX7A 1XLTA 2CYCA 3T0IA 4KXQA 2YTZA 4MQUA 5GQSA 1PYDA 2ZSBA 3AX6A 1MX3A 1TYZA 2F90A 4OYLA 3RI3A 4EF5A 6ABPA 4N47A 1TM2A 2OZLA 1U98A 5ALEA 1XIVA 3LKZA 1EMDA 1SVIA 4F21A 3AOGA 4CPDA 4G2NA 4GQAA 1VG0B 3GXBA 4XDHA 4EHFA 3CYFA 2GS9A 1JT2A 4MS4B 4OXYA 3ABOB 2HIGA 4MJ3A 2G06A 3R4CA 1NLYA 1G6Q1 3R3ZA 4R2XA 2JHGA 4H2DA 2ADMA 1OLSB 1J2TA 4L02A 2QT0A 4EYQA 1GSIA 1PFKA 1SUFA 4KUHA 4JQSA 2YWRA 4IDQA 3IHWA 3UM9A 2YFHA 4C0HA 4G4GA 4GVPA 2VHXA 1REQA 1WE2A 2AXEA 4KLAA 4NQZA 4WECA 1MRNA 4NFYA 5A3JA 1B1CA 1SVOA 3QPVA 2VEOA 5TQ2B 1QRAA 3PXXA 1LNQA 5A5EA 1KC1A 2JH8A 5CDYA 4LC1A 3GRKA 3QYJA 3QZUA 4N5NA 4NCJA 1X7ZA 3JW8A 3AR9A 4FMCB 2JI9A 2CBGA 5EPEA 1UK6A 4EW1A 2AK3A 5C8DA 4J43A 1JXOA 5CJ2A 2B4KA 3KC2A 4CQMD 1GFSA 1W4CA 4BQQA 3HVJA 4HGZA 1E5XA 2OYRA 5DNCA 1MHPA 1L1RA 4I1VA 2PUHA 3CB4A 2CV0A 5CIQA 2YQ4A 4IUYA 1SD1A 1KKLA 1H22A 1Y9DA 1Z2NX 2X7HA 2Y71A 2ZVDA 1JE0A 2EKLA 3IODA 5HE8A 1RRKA 4XFDA 3PS9A 4KAXA 2J41A 3EH2A 1D0VA 4IXMA 1EFTA 5ELMA 4GI2A 5IKOA 1HORA 4ND6A 3P9SA 4RPCA 1D9XA 4CTKA 2YZNA 1M1YE 4HSGA 4GOXA 3EG9B 2ZYRA 4DVGA 1SAYA 2NU8B 5K3CA 1FJGB 4D43A 1ZHOA 1DEHA 4D26A 3BCRA 1B15A 4B17A 3B2EA 1F0KA 4B8ZA 1PNRA 5MHTA 1MO2A 4MJLA 4LJ9A 2VXCA 3EZ7A 4Q6BA 3MAGA 4IDDA 4QXRA 4RVDA 4Y1FA 5C37A 1CR4A 4PVCA 1U1DA 1Y1KE 3QKRB 2HI0A 1BQEA 4TV8A 3UFXB 5IJXA 3ZE6A 4D3XA 5JRDS 5LDHA 3ND5A 1XV5A 3JQFA 4ITVA 1RBYA 3L4KA 1JWLA 4OX9Y 5BWLA 5G0WA 3QPAA 3ZCSA 3EEQA 5BWOA 3FCEA 1Q6ZA 3QG1A 4OQMA 4S1VA 3A26A 4YJHB 4PYIA 4D41A 2ZE6A 3T0FA 4F1WA 3T3DA 2Y1XA 5BRNA 4UFPA 5B4VA 5MFPA 4LE2A 2A1IA 2ZBGA 1HDRA 4L8VA 1MP0A 2UUPA 3EASA 3OQJA 4MO9A 4P9NA 2BCJQ 4QBTA 1SC1A 5BY2A 5HXAA 2VF5X 2QG6A 5BN5A 1FDTA 1PN3A 3R77A 4AJLA 3U7FB 1FVHA 3FY4A 5A3SA 3PUXA 3OY7A 3RS4A 4CN8A 3QKWA 4XVRA 4CQLA 4EPVA 2I2CA 2FB9A 4RU1A 2HF8A 1DKNA 2GBLC 2FEKA 1Y9ZA 2FP4A 3AUAA 2QSZA 3LCJA 5DGCA 2RGBA 5BUZA 2UYCA 3UF0A 3PQCA 4FHCA 4FYWA 2BJWA 3N0WA 1PNVA 3KVRA 5DM70 2AEEA 3H5LA 3V6MA 2QD1A 4AKGA 2Q8NA 2AOTB 4RF3A 1O58A 1Y81A 3A6EA 3F3MA 4PYOA 4HUQB 2QN7A 1RHRA 1NPYA 2ERYA 3MOGA 4K81B 1QV6A 4KO2S 3AFMA 2A5FA 2AGVA