3EJVA

Crystal structure of a cystatin-like protein (saro_2766) from novosphingobium aromaticivorans dsm at 1.40 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
TMADETIILNVLGQYTRAHDRRDPDAMAALFAPEATIEIVDAVGGASRSISRLEGRDAIRVAVRQMMAPHGYRAWSQNVVNAPIIVIEGDHAVLDAQFMVFSILAAEVPDGGWPTGTFGAQGRIVPIEAGQYRLTLRTVADGWVISAMRIEHRLPMAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein with cystatin-like fold
publication title Crystal structure of protein of unknown function with a cystatin-like fold (YP_498036.1) from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.40 A resolution
rcsb
source organism Novosphingobium aromaticivorans dsm 12444
molecule tags Unknown function
total genus 37
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ejvA00
1QMAA 3KZTA 3B4PA 3EF8A 3EC9A 4HM4B 2Z77A 1DMQA 4L8OA 2XRXB 1OCVA 2QIYA 2GBWB 1GY7A 1JN5B 2CHCA 1UUWB 3LYGA 2OWPA 4XBYA 1U5OA 3HX8A 4LGQA 4XM4A 3MG1A 3GZRA 3H51A 4X2OA 2BNGA 1GY6A 1GYBA 3F14A 4HM5B 3RGAA 4HZ9B 5FW5A 1DMNA 1W00A 2GEXA 3CPOA 2XSOB 3KKGA 3MKIA 4XDVA 5HGRA 3EBTA 3A76A 3EN8A 2HMJB 3NXJA 4X2HA 4OUQA 1ZO2A 3S5CA 1Q42A 4I4KA 4HM6B 1STDA 4STDA 3JUMA 2QGUA 2BMQB 4WYKA 4Q53A 5CK6A 1O7PB 1Q40A 4FCJA 3Q90A 4HM2B 2UX0A 3G16A 2K54A 1VZZA 1OUNA 1CQSA 3OXAA 5IG4A 5JPUA 2CKFB 1W02A 2JQ5A 1A2KA 4WWUC 2W2CA 1Z1SA 5AEUB 2I9WA 3JUPA 3M8CA 1O7GB 3FF2A 3IPTA 3MSOA 4HJLB 1O7MB 8CHOA 2HMMB 2PZVA 6STDA 1AR0A 3F8XA 2HMOB 3MHEA 2B1XB 3I0YA 3RGRA 3CNXA 4GB5A 4HVNA 2A15A 5DREA 3F7XA 2STDA 5AI1A 7STDA 3NV0A 1TP6A 1BUQA 4MJDA 4HM7B 1NU3A 4J9AA 5D82A 1UUVB 3F9SA 3SEDA 3OWUA 3GWRA 1ZX2A 4ORLA 2RFRA 3BLZA 1DMMA 5IEPA 5D83A 3FSDA 5EVHA 4XDWA 1EG9B 3JUNA 3EX9A 3OX9A 3FKAA 3LZAA 1NDOB 2F98A 4HM1B 4WYKB 1Q40B 4J8TA 3DXOA 3VGNA 3OWSA 5IEOA 3GZYB 1OF5A 1O7NB 3JUQA 3HK4A 5KP3A 5IG3A 4LEHA 5IG0A 5BVBA 3EBYA 2RCDA 3DM8A 5CF2A 3DMCA 3FLJA 1IDPA 3MYTA 2GEYA 3F7SA 2Z7AA 2Z76A 1K41A 3KSPA 2YFJB 3EJVA 3NM2A 2XR8B 3WMDA 3NV0B 2F86B 1GS3A 5G2GA 4R9KA 3OWYA 5KP4A 1OHOA 4R9LA 3G0KA 1JKGA 1OHSA 1JB5A 2RGQA 4R1KA 3ROBA 3UNLA 3FZWA 2HMNB 2GBXB 1S5AA 2F99A 5AIFA 1JB4A 3GZBA 1TUHA 4K1UA 4HKVB 5CXOA 3STDA 5IERA 4IIAA 3VSYA 3SOAA 2B24B 3DZLA 3ECFA 3E99A 4WP5A 1OF5B 1W6YA 3MG3A 3MG2A 3NBRA 2XSHB 4H3UA 5IG5A 2BMOB 4LMIA 4KVHA 4L8PA 4U13A 5AEWB 2GXFA 3CNMA 4L7KA 1E3RA 3K0ZA 1OGXA 5STDA 2HMLB 3T8UA 3H3HA 4FCMA 2IMJA 3F40A 4HM8B 1HKXA 1JB2A 5DRVA 3NUVA 4RZMA 4CDLA 3ER7A 3B4OA 5IENA 1O7WB 5CLKA 1OHPA 3BB9A 3EN1B 3F8HA 1C7HA 3GRDA 3JUOA 1JKGB 1SJWA 3EQQB 1E97A 1ULJB 2INXA 3T8NA 3G8ZA 5BXQA 3DUKA 1JN5A 3KE7A 5IF6A 5KP1A 1NWWA 1ASKA 4HM3B 5AIIA 3SOYA 5CF1A 5JPPA 1OGZA 1GY5A 5AIGA 2BMRB 2YFLB 1ULIB 2HMKB 3EHCA 5AIHA 4PEJA 1OH0A 1O7HB 2YFIB 3B7CA 3CU3A 4OVMA 3B8LA 3FF0A 3GZXB 1QJGA 3NHXA 1E3VA 1ISKA 1WQLB 5D81A 4HZBB 1OPYA 3HZPA 5TGNA 3FH1A 3K7CA 3FGYA 1W01A 2R4IA 4XBXA 4XBTA 3D9RA 4K1VA 4N3VA 1EA2A 4XB5A 3OV4A 4HM0B 3UJMA
chains in the Genus database with same CATH superfamily
1N9EA 1LOYA 3ZG5A 4CJNA 1BNJA 1I2GA 3D79A 1MWSA 1QMAA 2CH9A 1GMPA 4GHOA 3UL5A 4ZM8A 3KZTA 1ZGXA 3B4PA 3EF8A 3EC9A 4N6UA 1BRSA 2CIUA 1RNTA 3FG3A 2CFLA 3A5EA 2H0GA 4HM4B 4O2HA 4FMBA 3D5IA 2KF4A 3DH2A 2Z77A 1DMQA 1FGMA 1I0VA 4L8OA 4N6TA 2WOFA 1OCVA 2QIYA 2XRXB 1MGWA 2GBWB 3KIIA 3ZG0A 2H0HA 4N6OB 1GY7A 1JN5B 2CHCA 1LXEA 1D6YA 2QA43 1DVDA 1N5HA 2CWUA 1UUWB 2R41A 3X41A 1A2VA 5LC7A 1CYUA 4K61A 2ZL8A 3LYGA 2OWPA 4XBYA 1I2FA 1JZDA 2D1WA 1IQ8A 1G02A 1U5OA 4LZIA 1RGEA 2SBLA 4WFOA 2CFDA 1RGKA 1L5GB 5ELJA 3HX8A 4LGQA 1UI8A 4XM4A 1Q7HA 1US1A 1DVCA 3MG1A 1AY7A 2XFSA 3GZRA 1IQXA 2C10A 3H51A 1RCLA 1UGIA 1X1UA 4X2OA 3T0UA 2BNGA 2F56A 1GY6A 3X3ZA 1VQM3 1GYBA 3O8YA 4LYLB 2OQEA 3TDGA 5HOHA 3CCQ3 3S27A 1HU9A 2XF3A 4R4KA 3F14A 4HM5B 2WGQA 3RGAA 4KFFA 1FGTA 2Z6BA 1JBRA 4HZ9B 5AYSC 2HOHA 5FW5A 1DMNA 2CX1A 1W00A 1R4YA 1LQMB 2GEXA 3UB1A 1VQ63 3CPOA 5M18A 2XSOB 3KKGA 4O3VA 1VQO3 3MKIA 2W9PA 1KWIA 3BNEA 3PCSA 4XDVA 2P0XA 1QALA 3X40A 3CCU3 1Q814 3SLUA 2P38A 1VQ53 2E2VA 5HGRA 1W5ZA 1IVXA 3EBTA 1EKMA 3DGYA 3A76A 3EN8A 2HMJB 3N8BA 3NXJA 2W56B 4X2HA 4JF8A 1YI23 3D5GA 4OUQA 1RNBA 2XFTA 3VF1A 1ZO2A 1IYYA 5AYRB 3V92A 1BNGA 3ALAA 3CCV3 1K734 1YNVX 3S5CA 3CC73 1Q42A 5M19A 2KCDA 1LNIA 4KZ1A 4KT3B 4I4KA 4RNZA 4HM6B 2AAEA 3N9HA 1STDA 1D6UA 1B2XA 1TU5A 1PY3A 4STDA 3PGBA 3JUMA 2QGUA 1QAKA 1N9JA 2BMQB 4WYKA 4Q53A 5CK6A 1RJOA 1O7PB 1KSIA 1Q40A 1SQWA 1UCJA 2KXGA 3Q90A 4FCJA 2UX0A 4HM2B 5EQLA 6GSPA 2D42A 3G16A 3SYUA 1PYLA 2K54A 1IT7A 3HIIA 4FMAA 2OOVA 3EB8A 3NBJA 1VZZA 1OUNA 3D4AA 8RNTA 1CQSA 2Q07A 4NPBA 3PS8A 4DKIA 3OXAA 3G6E3 3Q1CA 5IG4A 1PU4A 1BOXA 3L0RA 3QRDA 1T2HA 1GD3A 3IMAB 2LYXA 2CKFB 2UUGC 5JPUA 1W02A 2JQ5A 1NJI4 3V99A 1LOWA 1A2KA 4WWUC 1GOVA 1MWTA 2W2CA 2FNQA 1GMRA 1Z1SA 3HOHA 3LTDA 5AEUB 1BUJA 2I9WA 3JUPA 3M8CA 3N54B 1O7GB 2CFKA 5ELUA 3FF2A 3IPTA 1IVUA 1GSPA 3AMOA 3MSOA 2OTL3 3CPW2 4HJLB 1O7MB 3BIRA 2WGOA 3DGNA 1Q7Y4 4MMZB 1M1XB 4EYCA 8CHOA 2HMMB 2PZVA 6STDA 1AR0A 3I553 4BTYA 3F8XA 1QVG2 2HMOB 3MHEA 1V57A 1BSDA 4AKYA 2B1XB 3I0YA 2MF7A 3RGRA 3WDGB 1TFKA 1N8R4 3CNXA 4GB5A 4HVNA 3G4S3 2A15A 5BIRA 3IJEB 1CH0A 5DREA 3WOEB 1S723 3F7XA 2STDA 4N6MA 5AI1A 7STDA 3NV0A 1TP6A 3MPHA 1BUQA 1IK3A 4MJDA 3V98A 4HM7B 1NU3A 4J9AA 5D82A 2IUJA 4FR9A 1UUVB 3F9SA 3SEDA 1I0XA 3ZFZA 4BTXA 2BO9B 3NQYA 1AQZA 3OWUA 3GWRA 1YJW3 2GU1A 4OK0A 1ZX2A 4ORLA 2RFRA 3MWZA 4EXRA 2F5MA 1YIJ3 1GOYA 1I8VA 3BLZA 1DMMA 2O3OA 1GMQA 1NB3I 1NB5I 3X42A 5IEPA 5D83A 3FSDA 5EVHA 1BRJA 1RGAA 4XDWA 1EG9B 3JUNA 3EX9A 1BNEA 1KD14 3OX9A 3FKAA 4NHFA 1I2EA 3LZAA 1BSAA 2KF6A 3LMLA 4IT7A 3NM7A 1BAOA 2ZHXB 4GL6A 1W6GA 1NDOB 1QVF2 1RGFA 2OOVC 1JV2B 1Q9EA 1A2PA 2F98A 1B20A 4HM1B 1VQL3 2F5WA 3URPA 3PXMA 1TTOA 1N5PA 1SIIA 1IT8A 1STFI 1JBTA 2YX9A 3X3XA 4G1MB 4WYKB 2KRTA 1YGWA 1Q40B 1ROAA 4J8TA 2P0MA 1BRGA 3DXOA 3VGNA 1A90A 3BU4A 1B2UA 2XGNA 3OWSA 3I563 3BNCA 5IEOA 3GZYB 1OF5A 3U97A 1O7NB 1LOVA 2XH9A 1Q824 3JUQA 2K3DA 2GSPA 1BRKA 3HK4A 3HIGA 5KP3A 5IG3A 4LEHA 1UI7A 5A0OB 1R4CA 1RDSA 1RCKA 2W03A 1VQ73 3QK9A 3BNDA 4QWTA 5IG0A 5BVBA 1RGCA 3WA2X 3CCJ3 4CPKA 3EBYA 2RCDA 3DM8A 3EE1A 5CF2A 3AGOA 1MNLA 3CC43 3NBBA 3CCM3 3X3YA 1W6CA 2L1SA 3DMCA 4ILFA 1BU4A 3AMOB 3FLJA 1IDPA 2P05A 3MYTA 1GD4A 1VQ83 2WOHA 2ML5A 4MEIA 1BNRA 3UL6A 2GEYA 3LXUX 1OACA 1B2SA 3F7SA 1HYFA 1IV9A 3RNTA 3SVAA 4AKZA 2Z7AA 2Z76A 4TX4A 1VQP3 3FG1A 1M904 1DYUA 1K41A 4N6NB 2CFWA 3KSPA 2YFJB 1BANA 1CEWI 1N8QA 2OTJ3 2W04A 3JVCA 3EJVA 3LT8A 2BU4A 3CXC2 3NM2A 2XR8B 3SX1A 3WMDA 1DE3A 3NV0B 1W7CA 1QAFA 1I3IA 1BRNL 1UCKA 3KSED 7GSPA 1RHLA 1I3FA 1LOXA 2F86B 1GS3A 5G2GA 3DY5A 2JDIH 4R9KA 7RNTA 4EW5A 3OWYA 5KP4A 1JBSA 1OHOA 4R9LA 3WODG 4H61A 1B27A 1I70A 3G0KA 3BNBA 5IW9A 1YJ93 3SXXA 1BSEA 2AADA 1VQN3 2IA7A 1JKGA 1RN4A 1OHSA 1JB5A 1WMNA 2RGQA 1ROVA 5EEOA 3CCE3 1EQKA 3AGNA 2CFGA 1UGHI 2RSXA 5RNTA 4R1KA 3AHSA 2MC8A 3ROBA 2OQEC 4FCZA 1TJDA 2SARA 3FZWA 3UNLA 3KN4A 1JNQA 5G1KA 2CG1A 2RBIA 4EV5A 1TIJA 1B2MA 1YVSA 2HMNB 2UGIA 2ZDJA 2GBXB 1S5AA 5GSPA 2F99A 3S29A 1FUWA 2W6JH 1M1K4 4KFEA 1ZS7A 5AIFA 1B2ZA 1JB4A 1FZUA 2C11A 2KF5A 4FMDA 3GZBA 1TUHA 1DETA 4K1UA 2LQVA 2Y74A 3LOYA 4HKVB 4BTWA 3DGOA 5CXOA 4I5QA 1KC84 2E2TA 5FGOA 1BSCA 1FUTA 1KQS2 3STDA 5IERA 4IIAA 2E2UA 5G1LA 1BNSA 3VSYA 1BNIA 1BRIA 3WHOA 3CCR3 3SOAA 1UUGB 2B24B 2BT3A 1FGRA 3DZLA 3ECFA 5LC6A 4BU4A 4MMYB 3E99A 3D3LA 4WP5A 1EEJA 4RNTA 3KFQC 1J2BA 1MOLA 3FG4A 1OF5B 1T3BA 6RNTA 1W6YA 4HAAA 4K90B 4NREA 1YIT3 1FGOA 3MG3A 3MG2A 3NBRA 4WHAA 1BRHA 2XSHB 3KCHA 1TFOA 4H3UA 4BL2A 1VQ93 1BSBA 1Q864 1MWUA 2BMOB 4LMIA 5IG5A 4KVHA 4L8PA 1RKYA 4U13A 1NNVA 3RDEA 5AEWB 1UW1A 2CWVA 2GXFA 1RMSA 1K8A4 2IUKA 1W2B2 3CNMA 4L7KA 2XGLA 1E3RA 2C4BA 3K0ZA 1C54A 1OGXA 1LQGC 3S67A 1VQ43 4BL3A 5STDA 1YJN3 2HMLB 1CYVA 1BIRA 1WNHA 1X1YA 1M9GA 3PYJA 1AVKA 4IPBA 2CX0A 1AVLA 3T8UA 3H3HA 1VQQA 4FCMA 2FXTA 2IMJA 1TRQA 1UCIA 3F40A 4HM8B 5JBSA 2CC3A 3CME3 3CC23 1GOUA 1YHQ3 2FGTA 1G96A 1T5YA 1HKXA 4HOHA 1JRQA 3CCL3 2O9UX 2H0IA 2CG0A 1X1WA 1JB2A 1YGEA 5DRVA 3WA3A 1FUSA 1BNFA 3NUVA 4RZMA 3CD63 4CDLA 1SPUA 2ML6A 1PFPA 1SARA 1LRAA 1T2IA 4MMXB 3ER7A 1A67A 3B4OA 5IENA 1BVIA 1O7WB 1IVWA 1U8CB 2PNCA 5CLKA 1K9M4 1OHPA 1YVBI 2K0MA 3K5TA 3BB9A 3GAXA 1IVVA 3EN1B 3PZWA 4HBRA 2CWTA 3F8HA 1IQYA 1C7HA 2BHMA 4EC6A 2WO0A 5I97A 3GRDA 3JUOA 1JKGB 3Q2PA 4O02B 3G713 1SJWA 3EQQB 1AV4A 1TRPA 1E97A 2IYJA 1MGRA 3WR2A 1ULJB 3CCS3 1WTHA 1RLSA 2INXA 3DGLA 1FW7A 1X1XA 3K9MC 4AEQA 1UCLA 1JJ22 4J5KA 4RNYA 4JRFA 4LSOA 4O8SA 3T8NA 1FYSA 3G8ZA 3AHWA 2J8XB 5BXQA 3DUKA 1JN5A 3KE7A 1RGHA 4BIRA 5IF6A 5KP1A 3J7Yd 1NWWA 1D6ZA 1ASKA 1G0TA 3K63A 4HM3B 5AIIA 1NO3A 3SOYA 5CF1A 3Q3FA 2L4VA 1RRHA 5JPPA 2KF3A 3PCRA 1OGZA 1WMPA 4RBNA 1GY5A 5AIGA 1UDII 2IY2A 3LT9A 1K28A 4KFDA 3GSPA 2BMRB 2YFLB 1RGGA 1ULIB 2HMKB 3LH4A 3EHCA 5AIHA 4PEJA 2F4YA 1RRLA 1OH0A 1O7HB 3WOFB 1IV7A 3LTAA 1HZ1A 2YFIB 2P09A 1BGSA 1EUIC 1V74A 3B7CA 3U1WA 2M7OA 3OW22 1LNHA 3CU3A 4N6V0 5M1AA 4OVMA 1LVNA 3B8LA 1RN7A 4EV2A 3FF0A 4J5GA 3HI7A 3UJMA 2V1LA 1W2ZA 2CK3H 2XEPA 3GZXB 9RNTA 1QJGA 3NHXA 5BU4A 1E3VA 2ZA4A 4R80A 1ISKA 3NX0A 1IU7A 4GSPA 2Y73A 3NQZA 1WQLB 4FMCA 4EBGA 1B21A 1B3SA 1VQK3 5D81A 1V58A 4HZBB 1OPYA 3HZPA 2KAAA 2RNTA 2W56A 4N6LA 5TGNA 3CMA3 3LTBA 3LTCA 3FCSB 2W0QA 1MWRA 2OCTA 3FH1A 1Y4KA 1RN1A 1WMOA 3K7CA 3FGYA 1F8NA 2CW9A 1RSNA 1W01A 2R4IA 4XBXA 1RTUA 4HYZA 1FA3A 4XBTA 3D9RA 1W4NA 1RGLA 4K1VA 1SIHA 4N3VA 2GU3A 1EA2A 4XB5A 4CCVA 1FGQA 3OV4A 4HM0B 2QEX3 3S28A 3DGMA 2W9QA 2BIRA 1JZOA
chains in the Genus database with same CATH topology
1N9EA 1QMAA 2CH9A 3UL5A 4ZM8A 3KZTA 3B4PA 3EF8A 3EC9A 4N6UA 2CIUA 3FG3A 2CFLA 4HM4B 4O2HA 4FMBA 2Z77A 1DMQA 1FGMA 4L8OA 4N6TA 2WOFA 1OCVA 2QIYA 2XRXB 2GBWB 3KIIA 4N6OB 1GY7A 1JN5B 2CHCA 1LXEA 1D6YA 2QA43 1DVDA 1N5HA 2CWUA 1UUWB 3X41A 1A2VA 5LC7A 1CYUA 4K61A 2ZL8A 3LYGA 2OWPA 4XBYA 2D1WA 1IQ8A 1U5OA 4WFOA 4LZIA 2SBLA 2CFDA 1L5GB 5ELJA 3HX8A 4LGQA 1UI8A 4XM4A 1US1A 1DVCA 3MG1A 2XFSA 3GZRA 1IQXA 2C10A 3H51A 4X2OA 3T0UA 2BNGA 1GY6A 3X3ZA 1VQM3 1GYBA 3O8YA 2OQEA 3TDGA 3CCQ3 3S27A 1HU9A 2XF3A 4R4KA 3F14A 4HM5B 2WGQA 3RGAA 4KFFA 1FGTA 2Z6BA 4HZ9B 5AYSC 5FW5A 1DMNA 1W00A 2GEXA 3UB1A 1VQ63 3CPOA 2XSOB 3KKGA 4O3VA 1VQO3 3MKIA 2W9PA 1KWIA 3BNEA 3PCSA 4XDVA 2P0XA 1QALA 3X40A 3CCU3 1Q814 3SLUA 2P38A 1VQ53 2E2VA 5HGRA 1W5ZA 1IVXA 3EBTA 1EKMA 3A76A 3EN8A 2HMJB 3N8BA 3NXJA 2W56B 4X2HA 4JF8A 1YI23 4OUQA 2XFTA 3VF1A 1ZO2A 5AYRB 3V92A 3ALAA 3CCV3 1K734 3CC73 3S5CA 1Q42A 2KCDA 4KZ1A 4I4KA 4RNZA 4HM6B 3N9HA 1STDA 1D6UA 1TU5A 4STDA 3PGBA 3JUMA 2QGUA 1QAKA 1N9JA 2BMQB 4WYKA 4Q53A 5CK6A 1RJOA 1O7PB 1KSIA 1Q40A 1SQWA 2KXGA 3Q90A 4FCJA 4HM2B 2UX0A 5EQLA 2D42A 3G16A 2K54A 1IT7A 3HIIA 4FMAA 2OOVA 3EB8A 3NBJA 1VZZA 1OUNA 1CQSA 2Q07A 3PS8A 3OXAA 3G6E3 3Q1CA 5IG4A 1PU4A 3L0RA 3QRDA 1GD3A 3IMAB 2LYXA 2CKFB 5JPUA 1W02A 2JQ5A 1NJI4 3V99A 1A2KA 4WWUC 2W2CA 2FNQA 1Z1SA 3LTDA 5AEUB 2I9WA 3JUPA 3M8CA 3N54B 1O7GB 2CFKA 5ELUA 3FF2A 3IPTA 1IVUA 3AMOA 3MSOA 2OTL3 3CPW2 4HJLB 1O7MB 2WGOA 3DGNA 1Q7Y4 4MMZB 1M1XB 4EYCA 8CHOA 2HMMB 2PZVA 6STDA 1AR0A 3I553 4BTYA 3F8XA 1QVG2 2HMOB 3MHEA 4AKYA 2B1XB 3I0YA 2MF7A 3RGRA 3WDGB 1TFKA 1N8R4 3CNXA 4GB5A 4HVNA 3G4S3 2A15A 3IJEB 5DREA 3WOEB 1S723 3F7XA 2STDA 4N6MA 5AI1A 7STDA 3NV0A 1TP6A 3MPHA 1BUQA 1IK3A 4MJDA 3V98A 4HM7B 1NU3A 4J9AA 5D82A 2IUJA 4FR9A 1UUVB 3F9SA 3SEDA 4BTXA 2BO9B 3NQYA 3OWUA 3GWRA 1YJW3 2GU1A 4OK0A 1ZX2A 4ORLA 2RFRA 3MWZA 4EXRA 1YIJ3 3BLZA 1DMMA 2O3OA 1NB3I 1NB5I 3X42A 5IEPA 5D83A 3FSDA 5EVHA 4XDWA 1EG9B 3JUNA 3EX9A 1KD14 3OX9A 3FKAA 4NHFA 3LZAA 3LMLA 4IT7A 3NM7A 4GL6A 1W6GA 1NDOB 1QVF2 2OOVC 1JV2B 2F98A 4HM1B 1VQL3 3PXMA 1N5PA 1SIIA 1IT8A 1STFI 2YX9A 3X3XA 4G1MB 4WYKB 2KRTA 1Q40B 1ROAA 4J8TA 2P0MA 3DXOA 3VGNA 1A90A 2XGNA 3OWSA 3I563 3BNCA 5IEOA 3GZYB 1OF5A 3U97A 1O7NB 2XH9A 1Q824 3JUQA 3HK4A 3HIGA 5KP3A 5IG3A 4LEHA 1UI7A 5A0OB 1R4CA 2W03A 1VQ73 3QK9A 3BNDA 4QWTA 5IG0A 5BVBA 3CCJ3 3WA2X 3EBYA 2RCDA 3DM8A 3EE1A 5CF2A 1MNLA 3CC43 3NBBA 3CCM3 3X3YA 1W6CA 3DMCA 3AMOB 3FLJA 1IDPA 2P05A 3MYTA 1GD4A 1VQ83 2WOHA 2ML5A 4MEIA 3UL6A 2GEYA 3LXUX 1OACA 3F7SA 1IV9A 3SVAA 4AKZA 2Z7AA 2Z76A 4TX4A 1VQP3 3FG1A 1M904 1DYUA 1K41A 4N6NB 2CFWA 3KSPA 2YFJB 1CEWI 1N8QA 2OTJ3 2W04A 3JVCA 3EJVA 3LT8A 3CXC2 3NM2A 2XR8B 3SX1A 3WMDA 3NV0B 1W7CA 1QAFA 3KSED 1LOXA 2F86B 1GS3A 5G2GA 3DY5A 2JDIH 4R9KA 3OWYA 5KP4A 1OHOA 4R9LA 3WODG 4H61A 3G0KA 3BNBA 5IW9A 1YJ93 3SXXA 1VQN3 2IA7A 1JKGA 1OHSA 1JB5A 1WMNA 2RGQA 1ROVA 5EEOA 3CCE3 1EQKA 2CFGA 2RSXA 4R1KA 2MC8A 3ROBA 2OQEC 4FCZA 3UNLA 3FZWA 4EV5A 3KN4A 1JNQA 2CG1A 1TIJA 2HMNB 2ZDJA 3S29A 2GBXB 1S5AA 1FUWA 2F99A 2W6JH 1M1K4 4KFEA 5AIFA 1JB4A 2C11A 4FMDA 3GZBA 1TUHA 4K1UA 2LQVA 2Y74A 3LOYA 4HKVB 4BTWA 3DGOA 5CXOA 1KC84 2E2TA 5FGOA 1KQS2 3STDA 5IERA 4IIAA 2E2UA 3VSYA 3CCR3 3SOAA 2B24B 3DZLA 2BT3A 1FGRA 3ECFA 5LC6A 4MMYB 3E99A 3D3LA 4WP5A 3KFQC 1J2BA 1MOLA 3FG4A 1OF5B 1W6YA 4K90B 4NREA 1YIT3 1FGOA 3MG3A 3MG2A 3NBRA 4WHAA 2XSHB 1TFOA 4H3UA 1VQ93 1Q864 5IG5A 2BMOB 4LMIA 1RKYA 4KVHA 4L8PA 4U13A 3RDEA 5AEWB 1UW1A 2CWVA 2GXFA 1K8A4 2IUKA 1W2B2 3CNMA 4L7KA 2XGLA 1E3RA 3K0ZA 1OGXA 3S67A 1VQ43 1YJN3 5STDA 2HMLB 1CYVA 1M9GA 1WNHA 3PYJA 4IPBA 1AVKA 1AVLA 3T8UA 3H3HA 4FCMA 2FXTA 2IMJA 3F40A 3CME3 5JBSA 4HM8B 2CC3A 3CC23 1YHQ3 2FGTA 1G96A 1T5YA 1HKXA 1JRQA 3CCL3 2O9UX 2CG0A 1YGEA 1JB2A 5DRVA 3WA3A 3NUVA 4RZMA 3CD63 4CDLA 1SPUA 2ML6A 1PFPA 4MMXB 3ER7A 1A67A 3B4OA 5IENA 2PNCA 1O7WB 1IVWA 1U8CB 5CLKA 1K9M4 1OHPA 1YVBI 2K0MA 3K5TA 3BB9A 3GAXA 1IVVA 3EN1B 3PZWA 4HBRA 2CWTA 3F8HA 1IQYA 1C7HA 2BHMA 4EC6A 2WO0A 5I97A 3GRDA 3JUOA 1JKGB 3Q2PA 4O02B 3G713 1SJWA 3EQQB 1AV4A 1E97A 1ULJB 3CCS3 1WTHA 2INXA 3DGLA 3K9MC 4AEQA 1JJ22 4RNYA 4JRFA 4LSOA 4O8SA 3T8NA 3G8ZA 5BXQA 3DUKA 1JN5A 3KE7A 5IF6A 5KP1A 3J7Yd 1NWWA 1D6ZA 1ASKA 3K63A 4HM3B 5AIIA 1NO3A 3SOYA 5CF1A 2L4VA 1RRHA 5JPPA 3PCRA 1OGZA 1WMPA 4RBNA 1GY5A 5AIGA 3LT9A 1K28A 4KFDA 2BMRB 2YFLB 1ULIB 2HMKB 3LH4A 3EHCA 5AIHA 4PEJA 1RRLA 1OH0A 1O7HB 3WOFB 1IV7A 3LTAA 2YFIB 2P09A 1V74A 3B7CA 3U1WA 2M7OA 3OW22 1LNHA 3CU3A 4N6V0 4OVMA 1LVNA 3B8LA 1RN7A 4EV2A 3FF0A 3HI7A 2V1LA 1W2ZA 2CK3H 2XEPA 3GZXB 1QJGA 3NHXA 1E3VA 4R80A 1ISKA 3NX0A 1IU7A 2Y73A 3NQZA 1WQLB 4FMCA 4EBGA 1VQK3 5D81A 4HZBB 1OPYA 3HZPA 2W56A 4N6LA 5TGNA 3CMA3 3LTBA 3LTCA 3FCSB 2W0QA 2OCTA 3FH1A 1Y4KA 1WMOA 3K7CA 3FGYA 1F8NA 2CW9A 1W01A 2R4IA 4XBXA 1FA3A 4HYZA 4XBTA 3D9RA 1W4NA 4K1VA 1SIHA 4N3VA 2GU3A 1EA2A 4XB5A 4CCVA 1FGQA 3OV4A 4HM0B 2QEX3 3S28A 3DGMA 2W9QA 3UJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QMA A;  3KZT A;  3B4P A;  3EF8 A;  3EC9 A;  4HM4 B;  2Z77 A;  1DMQ A;  4L8O A;  2XRX B;  1OCV A;  2QIY A;  2GBW B;  1GY7 A;  1JN5 B;  2CHC A;  1UUW B;  3LYG A;  2OWP A;  4XBY A;  1U5O A;  3HX8 A;  4LGQ A;  4XM4 A;  3MG1 A;  3GZR A;  3H51 A;  4X2O A;  2BNG A;  1GY6 A;  1GYB A;  3F14 A;  4HM5 B;  3RGA A;  4HZ9 B;  5FW5 A;  1DMN A;  1W00 A;  2GEX A;  3CPO A;  2XSO B;  3KKG A;  3MKI A;  4XDV A;  5HGR A;  3EBT A;  3A76 A;  3EN8 A;  2HMJ B;  3NXJ A;  4X2H A;  4OUQ A;  1ZO2 A;  3S5C A;  1Q42 A;  4I4K A;  4HM6 B;  1STD A;  4STD A;  3JUM A;  2QGU A;  2BMQ B;  4WYK A;  4Q53 A;  5CK6 A;  1O7P B;  1Q40 A;  4FCJ A;  3Q90 A;  4HM2 B;  2UX0 A;  3G16 A;  2K54 A;  1VZZ A;  1OUN A;  1CQS A;  3OXA A;  5IG4 A;  5JPU A;  2CKF B;  1W02 A;  2JQ5 A;  1A2K A;  4WWU C;  2W2C A;  1Z1S A;  5AEU B;  2I9W A;  3JUP A;  3M8C A;  1O7G B;  3FF2 A;  3IPT A;  3MSO A;  4HJL B;  1O7M B;  8CHO A;  2HMM B;  2PZV A;  6STD A;  1AR0 A;  3F8X A;  2HMO B;  3MHE A;  2B1X B;  3I0Y A;  3RGR A;  3CNX A;  4GB5 A;  4HVN A;  2A15 A;  5DRE A;  3F7X A;  2STD A;  5AI1 A;  7STD A;  3NV0 A;  1TP6 A;  1BUQ A;  4MJD A;  4HM7 B;  1NU3 A;  4J9A A;  5D82 A;  1UUV B;  3F9S A;  3SED A;  3OWU A;  3GWR A;  1ZX2 A;  4ORL A;  2RFR A;  3BLZ A;  1DMM A;  5IEP A;  5D83 A;  3FSD A;  5EVH A;  4XDW A;  1EG9 B;  3JUN A;  3EX9 A;  3OX9 A;  3FKA A;  3LZA A;  1NDO B;  2F98 A;  4HM1 B;  4WYK B;  1Q40 B;  4J8T A;  3DXO A;  3VGN A;  3OWS A;  5IEO A;  3GZY B;  1OF5 A;  1O7N B;  3JUQ A;  3HK4 A;  5KP3 A;  5IG3 A;  4LEH A;  5IG0 A;  5BVB A;  3EBY A;  2RCD A;  3DM8 A;  5CF2 A;  3DMC A;  3FLJ A;  1IDP A;  3MYT A;  2GEY A;  3F7S A;  2Z7A A;  2Z76 A;  1K41 A;  3KSP A;  2YFJ B;  3EJV A;  3NM2 A;  2XR8 B;  3WMD A;  3NV0 B;  2F86 B;  1GS3 A;  5G2G A;  4R9K A;  3OWY A;  5KP4 A;  1OHO A;  4R9L A;  3G0K A;  1JKG A;  1OHS A;  1JB5 A;  2RGQ A;  4R1K A;  3ROB A;  3UNL A;  3FZW A;  2HMN B;  2GBX B;  1S5A A;  2F99 A;  5AIF A;  1JB4 A;  3GZB A;  1TUH A;  4K1U A;  4HKV B;  5CXO A;  3STD A;  5IER A;  4IIA A;  3VSY A;  3SOA A;  2B24 B;  3DZL A;  3ECF A;  3E99 A;  4WP5 A;  1OF5 B;  1W6Y A;  3MG3 A;  3MG2 A;  3NBR A;  2XSH B;  4H3U A;  5IG5 A;  2BMO B;  4LMI A;  4KVH A;  4L8P A;  4U13 A;  5AEW B;  2GXF A;  3CNM A;  4L7K A;  1E3R A;  3K0Z A;  1OGX A;  5STD A;  2HML B;  3T8U A;  3H3H A;  4FCM A;  2IMJ A;  3F40 A;  4HM8 B;  1HKX A;  1JB2 A;  5DRV A;  3NUV A;  4RZM A;  4CDL A;  3ER7 A;  3B4O A;  5IEN A;  1O7W B;  5CLK A;  1OHP A;  3BB9 A;  3EN1 B;  3F8H A;  1C7H A;  3GRD A;  3JUO A;  1JKG B;  1SJW A;  3EQQ B;  1E97 A;  1ULJ B;  2INX A;  3T8N A;  3G8Z A;  5BXQ A;  3DUK A;  1JN5 A;  3KE7 A;  5IF6 A;  5KP1 A;  1NWW A;  1ASK A;  4HM3 B;  5AII A;  3SOY A;  5CF1 A;  5JPP A;  1OGZ A;  1GY5 A;  5AIG A;  2BMR B;  2YFL B;  1ULI B;  2HMK B;  3EHC A;  5AIH A;  4PEJ A;  1OH0 A;  1O7H B;  2YFI B;  3B7C A;  3CU3 A;  4OVM A;  3B8L A;  3FF0 A;  3GZX B;  1QJG A;  3NHX A;  1E3V A;  1ISK A;  1WQL B;  5D81 A;  4HZB B;  1OPY A;  3HZP A;  5TGN A;  3FH1 A;  3K7C A;  3FGY A;  1W01 A;  2R4I A;  4XBX A;  4XBT A;  3D9R A;  4K1V A;  4N3V A;  1EA2 A;  4XB5 A;  3OV4 A;  4HM0 B;  3UJM A; 
#chains in the Genus database with same CATH topology
 1N9E A;  1LOY A;  3ZG5 A;  4CJN A;  1BNJ A;  1I2G A;  3D79 A;  1MWS A;  1QMA A;  2CH9 A;  1GMP A;  4GHO A;  3UL5 A;  4ZM8 A;  3KZT A;  1ZGX A;  3B4P A;  3EF8 A;  3EC9 A;  4N6U A;  1BRS A;  2CIU A;  1RNT A;  3FG3 A;  2CFL A;  3A5E A;  2H0G A;  4HM4 B;  4O2H A;  4FMB A;  3D5I A;  2KF4 A;  3DH2 A;  2Z77 A;  1DMQ A;  1FGM A;  1I0V A;  4L8O A;  4N6T A;  2WOF A;  1OCV A;  2QIY A;  2XRX B;  1MGW A;  2GBW B;  3KII A;  3ZG0 A;  2H0H A;  4N6O B;  1GY7 A;  1JN5 B;  2CHC A;  1LXE A;  1D6Y A;  2QA4 3;  1DVD A;  1N5H A;  2CWU A;  1UUW B;  2R41 A;  3X41 A;  1A2V A;  5LC7 A;  1CYU A;  4K61 A;  2ZL8 A;  3LYG A;  2OWP A;  4XBY A;  1I2F A;  1JZD A;  2D1W A;  1IQ8 A;  1G02 A;  1U5O A;  4LZI A;  1RGE A;  2SBL A;  4WFO A;  2CFD A;  1RGK A;  1L5G B;  5ELJ A;  3HX8 A;  4LGQ A;  1UI8 A;  4XM4 A;  1Q7H A;  1US1 A;  1DVC A;  3MG1 A;  1AY7 A;  2XFS A;  3GZR A;  1IQX A;  2C10 A;  3H51 A;  1RCL A;  1UGI A;  1X1U A;  4X2O A;  3T0U A;  2BNG A;  2F56 A;  1GY6 A;  3X3Z A;  1VQM 3;  1GYB A;  3O8Y A;  4LYL B;  2OQE A;  3TDG A;  5HOH A;  3CCQ 3;  3S27 A;  1HU9 A;  2XF3 A;  4R4K A;  3F14 A;  4HM5 B;  2WGQ A;  3RGA A;  4KFF A;  1FGT A;  2Z6B A;  1JBR A;  4HZ9 B;  5AYS C;  2HOH A;  5FW5 A;  1DMN A;  2CX1 A;  1W00 A;  1R4Y A;  1LQM B;  2GEX A;  3UB1 A;  1VQ6 3;  3CPO A;  5M18 A;  2XSO B;  3KKG A;  4O3V A;  1VQO 3;  3MKI A;  2W9P A;  1KWI A;  3BNE A;  3PCS A;  4XDV A;  2P0X A;  1QAL A;  3X40 A;  3CCU 3;  1Q81 4;  3SLU A;  2P38 A;  1VQ5 3;  2E2V A;  5HGR A;  1W5Z A;  1IVX A;  3EBT A;  1EKM A;  3DGY A;  3A76 A;  3EN8 A;  2HMJ B;  3N8B A;  3NXJ A;  2W56 B;  4X2H A;  4JF8 A;  1YI2 3;  3D5G A;  4OUQ A;  1RNB A;  2XFT A;  3VF1 A;  1ZO2 A;  1IYY A;  5AYR B;  3V92 A;  1BNG A;  3ALA A;  3CCV 3;  1K73 4;  1YNV X;  3S5C A;  3CC7 3;  1Q42 A;  5M19 A;  2KCD A;  1LNI A;  4KZ1 A;  4KT3 B;  4I4K A;  4RNZ A;  4HM6 B;  2AAE A;  3N9H A;  1STD A;  1D6U A;  1B2X A;  1TU5 A;  1PY3 A;  4STD A;  3PGB A;  3JUM A;  2QGU A;  1QAK A;  1N9J A;  2BMQ B;  4WYK A;  4Q53 A;  5CK6 A;  1RJO A;  1O7P B;  1KSI A;  1Q40 A;  1SQW A;  1UCJ A;  2KXG A;  3Q90 A;  4FCJ A;  2UX0 A;  4HM2 B;  5EQL A;  6GSP A;  2D42 A;  3G16 A;  3SYU A;  1PYL A;  2K54 A;  1IT7 A;  3HII A;  4FMA A;  2OOV A;  3EB8 A;  3NBJ A;  1VZZ A;  1OUN A;  3D4A A;  8RNT A;  1CQS A;  2Q07 A;  4NPB A;  3PS8 A;  4DKI A;  3OXA A;  3G6E 3;  3Q1C A;  5IG4 A;  1PU4 A;  1BOX A;  3L0R A;  3QRD A;  1T2H A;  1GD3 A;  3IMA B;  2LYX A;  2CKF B;  2UUG C;  5JPU A;  1W02 A;  2JQ5 A;  1NJI 4;  3V99 A;  1LOW A;  1A2K A;  4WWU C;  1GOV A;  1MWT A;  2W2C A;  2FNQ A;  1GMR A;  1Z1S A;  3HOH A;  3LTD A;  5AEU B;  1BUJ A;  2I9W A;  3JUP A;  3M8C A;  3N54 B;  1O7G B;  2CFK A;  5ELU A;  3FF2 A;  3IPT A;  1IVU A;  1GSP A;  3AMO A;  3MSO A;  2OTL 3;  3CPW 2;  4HJL B;  1O7M B;  3BIR A;  2WGO A;  3DGN A;  1Q7Y 4;  4MMZ B;  1M1X B;  4EYC A;  8CHO A;  2HMM B;  2PZV A;  6STD A;  1AR0 A;  3I55 3;  4BTY A;  3F8X A;  1QVG 2;  2HMO B;  3MHE A;  1V57 A;  1BSD A;  4AKY A;  2B1X B;  3I0Y A;  2MF7 A;  3RGR A;  3WDG B;  1TFK A;  1N8R 4;  3CNX A;  4GB5 A;  4HVN A;  3G4S 3;  2A15 A;  5BIR A;  3IJE B;  1CH0 A;  5DRE A;  3WOE B;  1S72 3;  3F7X A;  2STD A;  4N6M A;  5AI1 A;  7STD A;  3NV0 A;  1TP6 A;  3MPH A;  1BUQ A;  1IK3 A;  4MJD A;  3V98 A;  4HM7 B;  1NU3 A;  4J9A A;  5D82 A;  2IUJ A;  4FR9 A;  1UUV B;  3F9S A;  3SED A;  1I0X A;  3ZFZ A;  4BTX A;  2BO9 B;  3NQY A;  1AQZ A;  3OWU A;  3GWR A;  1YJW 3;  2GU1 A;  4OK0 A;  1ZX2 A;  4ORL A;  2RFR A;  3MWZ A;  4EXR A;  2F5M A;  1YIJ 3;  1GOY A;  1I8V A;  3BLZ A;  1DMM A;  2O3O A;  1GMQ A;  1NB3 I;  1NB5 I;  3X42 A;  5IEP A;  5D83 A;  3FSD A;  5EVH A;  1BRJ A;  1RGA A;  4XDW A;  1EG9 B;  3JUN A;  3EX9 A;  1BNE A;  1KD1 4;  3OX9 A;  3FKA A;  4NHF A;  1I2E A;  3LZA A;  1BSA A;  2KF6 A;  3LML A;  4IT7 A;  3NM7 A;  1BAO A;  2ZHX B;  4GL6 A;  1W6G A;  1NDO B;  1QVF 2;  1RGF A;  2OOV C;  1JV2 B;  1Q9E A;  1A2P A;  2F98 A;  1B20 A;  4HM1 B;  1VQL 3;  2F5W A;  3URP A;  3PXM A;  1TTO A;  1N5P A;  1SII A;  1IT8 A;  1STF I;  1JBT A;  2YX9 A;  3X3X A;  4G1M B;  4WYK B;  2KRT A;  1YGW A;  1Q40 B;  1ROA A;  4J8T A;  2P0M A;  1BRG A;  3DXO A;  3VGN A;  1A90 A;  3BU4 A;  1B2U A;  2XGN A;  3OWS A;  3I56 3;  3BNC A;  5IEO A;  3GZY B;  1OF5 A;  3U97 A;  1O7N B;  1LOV A;  2XH9 A;  1Q82 4;  3JUQ A;  2K3D A;  2GSP A;  1BRK A;  3HK4 A;  3HIG A;  5KP3 A;  5IG3 A;  4LEH A;  1UI7 A;  5A0O B;  1R4C A;  1RDS A;  1RCK A;  2W03 A;  1VQ7 3;  3QK9 A;  3BND A;  4QWT A;  5IG0 A;  5BVB A;  1RGC A;  3WA2 X;  3CCJ 3;  4CPK A;  3EBY A;  2RCD A;  3DM8 A;  3EE1 A;  5CF2 A;  3AGO A;  1MNL A;  3CC4 3;  3NBB A;  3CCM 3;  3X3Y A;  1W6C A;  2L1S A;  3DMC A;  4ILF A;  1BU4 A;  3AMO B;  3FLJ A;  1IDP A;  2P05 A;  3MYT A;  1GD4 A;  1VQ8 3;  2WOH A;  2ML5 A;  4MEI A;  1BNR A;  3UL6 A;  2GEY A;  3LXU X;  1OAC A;  1B2S A;  3F7S A;  1HYF A;  1IV9 A;  3RNT A;  3SVA A;  4AKZ A;  2Z7A A;  2Z76 A;  4TX4 A;  1VQP 3;  3FG1 A;  1M90 4;  1DYU A;  1K41 A;  4N6N B;  2CFW A;  3KSP A;  2YFJ B;  1BAN A;  1CEW I;  1N8Q A;  2OTJ 3;  2W04 A;  3JVC A;  3EJV A;  3LT8 A;  2BU4 A;  3CXC 2;  3NM2 A;  2XR8 B;  3SX1 A;  3WMD A;  1DE3 A;  3NV0 B;  1W7C A;  1QAF A;  1I3I A;  1BRN L;  1UCK A;  3KSE D;  7GSP A;  1RHL A;  1I3F A;  1LOX A;  2F86 B;  1GS3 A;  5G2G A;  3DY5 A;  2JDI H;  4R9K A;  7RNT A;  4EW5 A;  3OWY A;  5KP4 A;  1JBS A;  1OHO A;  4R9L A;  3WOD G;  4H61 A;  1B27 A;  1I70 A;  3G0K A;  3BNB A;  5IW9 A;  1YJ9 3;  3SXX A;  1BSE A;  2AAD A;  1VQN 3;  2IA7 A;  1JKG A;  1RN4 A;  1OHS A;  1JB5 A;  1WMN A;  2RGQ A;  1ROV A;  5EEO A;  3CCE 3;  1EQK A;  3AGN A;  2CFG A;  1UGH I;  2RSX A;  5RNT A;  4R1K A;  3AHS A;  2MC8 A;  3ROB A;  2OQE C;  4FCZ A;  1TJD A;  2SAR A;  3FZW A;  3UNL A;  3KN4 A;  1JNQ A;  5G1K A;  2CG1 A;  2RBI A;  4EV5 A;  1TIJ A;  1B2M A;  1YVS A;  2HMN B;  2UGI A;  2ZDJ A;  2GBX B;  1S5A A;  5GSP A;  2F99 A;  3S29 A;  1FUW A;  2W6J H;  1M1K 4;  4KFE A;  1ZS7 A;  5AIF A;  1B2Z A;  1JB4 A;  1FZU A;  2C11 A;  2KF5 A;  4FMD A;  3GZB A;  1TUH A;  1DET A;  4K1U A;  2LQV A;  2Y74 A;  3LOY A;  4HKV B;  4BTW A;  3DGO A;  5CXO A;  4I5Q A;  1KC8 4;  2E2T A;  5FGO A;  1BSC A;  1FUT A;  1KQS 2;  3STD A;  5IER A;  4IIA A;  2E2U A;  5G1L A;  1BNS A;  3VSY A;  1BNI A;  1BRI A;  3WHO A;  3CCR 3;  3SOA A;  1UUG B;  2B24 B;  2BT3 A;  1FGR A;  3DZL A;  3ECF A;  5LC6 A;  4BU4 A;  4MMY B;  3E99 A;  3D3L A;  4WP5 A;  1EEJ A;  4RNT A;  3KFQ C;  1J2B A;  1MOL A;  3FG4 A;  1OF5 B;  1T3B A;  6RNT A;  1W6Y A;  4HAA A;  4K90 B;  4NRE A;  1YIT 3;  1FGO A;  3MG3 A;  3MG2 A;  3NBR A;  4WHA A;  1BRH A;  2XSH B;  3KCH A;  1TFO A;  4H3U A;  4BL2 A;  1VQ9 3;  1BSB A;  1Q86 4;  1MWU A;  2BMO B;  4LMI A;  5IG5 A;  4KVH A;  4L8P A;  1RKY A;  4U13 A;  1NNV A;  3RDE A;  5AEW B;  1UW1 A;  2CWV A;  2GXF A;  1RMS A;  1K8A 4;  2IUK A;  1W2B 2;  3CNM A;  4L7K A;  2XGL A;  1E3R A;  2C4B A;  3K0Z A;  1C54 A;  1OGX A;  1LQG C;  3S67 A;  1VQ4 3;  4BL3 A;  5STD A;  1YJN 3;  2HML B;  1CYV A;  1BIR A;  1WNH A;  1X1Y A;  1M9G A;  3PYJ A;  1AVK A;  4IPB A;  2CX0 A;  1AVL A;  3T8U A;  3H3H A;  1VQQ A;  4FCM A;  2FXT A;  2IMJ A;  1TRQ A;  1UCI A;  3F40 A;  4HM8 B;  5JBS A;  2CC3 A;  3CME 3;  3CC2 3;  1GOU A;  1YHQ 3;  2FGT A;  1G96 A;  1T5Y A;  1HKX A;  4HOH A;  1JRQ A;  3CCL 3;  2O9U X;  2H0I A;  2CG0 A;  1X1W A;  1JB2 A;  1YGE A;  5DRV A;  3WA3 A;  1FUS A;  1BNF A;  3NUV A;  4RZM A;  3CD6 3;  4CDL A;  1SPU A;  2ML6 A;  1PFP A;  1SAR A;  1LRA A;  1T2I A;  4MMX B;  3ER7 A;  1A67 A;  3B4O A;  5IEN A;  1BVI A;  1O7W B;  1IVW A;  1U8C B;  2PNC A;  5CLK A;  1K9M 4;  1OHP A;  1YVB I;  2K0M A;  3K5T A;  3BB9 A;  3GAX A;  1IVV A;  3EN1 B;  3PZW A;  4HBR A;  2CWT A;  3F8H A;  1IQY A;  1C7H A;  2BHM A;  4EC6 A;  2WO0 A;  5I97 A;  3GRD A;  3JUO A;  1JKG B;  3Q2P A;  4O02 B;  3G71 3;  1SJW A;  3EQQ B;  1AV4 A;  1TRP A;  1E97 A;  2IYJ A;  1MGR A;  3WR2 A;  1ULJ B;  3CCS 3;  1WTH A;  1RLS A;  2INX A;  3DGL A;  1FW7 A;  1X1X A;  3K9M C;  4AEQ A;  1UCL A;  1JJ2 2;  4J5K A;  4RNY A;  4JRF A;  4LSO A;  4O8S A;  3T8N A;  1FYS A;  3G8Z A;  3AHW A;  2J8X B;  5BXQ A;  3DUK A;  1JN5 A;  3KE7 A;  1RGH A;  4BIR A;  5IF6 A;  5KP1 A;  3J7Y d;  1NWW A;  1D6Z A;  1ASK A;  1G0T A;  3K63 A;  4HM3 B;  5AII A;  1NO3 A;  3SOY A;  5CF1 A;  3Q3F A;  2L4V A;  1RRH A;  5JPP A;  2KF3 A;  3PCR A;  1OGZ A;  1WMP A;  4RBN A;  1GY5 A;  5AIG A;  1UDI I;  2IY2 A;  3LT9 A;  1K28 A;  4KFD A;  3GSP A;  2BMR B;  2YFL B;  1RGG A;  1ULI B;  2HMK B;  3LH4 A;  3EHC A;  5AIH A;  4PEJ A;  2F4Y A;  1RRL A;  1OH0 A;  1O7H B;  3WOF B;  1IV7 A;  3LTA A;  1HZ1 A;  2YFI B;  2P09 A;  1BGS A;  1EUI C;  1V74 A;  3B7C A;  3U1W A;  2M7O A;  3OW2 2;  1LNH A;  3CU3 A;  4N6V 0;  5M1A A;  4OVM A;  1LVN A;  3B8L A;  1RN7 A;  4EV2 A;  3FF0 A;  4J5G A;  3HI7 A;  3UJM A;  2V1L A;  1W2Z A;  2CK3 H;  2XEP A;  3GZX B;  9RNT A;  1QJG A;  3NHX A;  5BU4 A;  1E3V A;  2ZA4 A;  4R80 A;  1ISK A;  3NX0 A;  1IU7 A;  4GSP A;  2Y73 A;  3NQZ A;  1WQL B;  4FMC A;  4EBG A;  1B21 A;  1B3S A;  1VQK 3;  5D81 A;  1V58 A;  4HZB B;  1OPY A;  3HZP A;  2KAA A;  2RNT A;  2W56 A;  4N6L A;  5TGN A;  3CMA 3;  3LTB A;  3LTC A;  3FCS B;  2W0Q A;  1MWR A;  2OCT A;  3FH1 A;  1Y4K A;  1RN1 A;  1WMO A;  3K7C A;  3FGY A;  1F8N A;  2CW9 A;  1RSN A;  1W01 A;  2R4I A;  4XBX A;  1RTU A;  4HYZ A;  1FA3 A;  4XBT A;  3D9R A;  1W4N A;  1RGL A;  4K1V A;  1SIH A;  4N3V A;  2GU3 A;  1EA2 A;  4XB5 A;  4CCV A;  1FGQ A;  3OV4 A;  4HM0 B;  2QEX 3;  3S28 A;  3DGM A;  2W9Q A;  2BIR A;  1JZO A; 
#chains in the Genus database with same CATH homology
 1N9E A;  1QMA A;  2CH9 A;  3UL5 A;  4ZM8 A;  3KZT A;  3B4P A;  3EF8 A;  3EC9 A;  4N6U A;  2CIU A;  3FG3 A;  2CFL A;  4HM4 B;  4O2H A;  4FMB A;  2Z77 A;  1DMQ A;  1FGM A;  4L8O A;  4N6T A;  2WOF A;  1OCV A;  2QIY A;  2XRX B;  2GBW B;  3KII A;  4N6O B;  1GY7 A;  1JN5 B;  2CHC A;  1LXE A;  1D6Y A;  2QA4 3;  1DVD A;  1N5H A;  2CWU A;  1UUW B;  3X41 A;  1A2V A;  5LC7 A;  1CYU A;  4K61 A;  2ZL8 A;  3LYG A;  2OWP A;  4XBY A;  2D1W A;  1IQ8 A;  1U5O A;  4WFO A;  4LZI A;  2SBL A;  2CFD A;  1L5G B;  5ELJ A;  3HX8 A;  4LGQ A;  1UI8 A;  4XM4 A;  1US1 A;  1DVC A;  3MG1 A;  2XFS A;  3GZR A;  1IQX A;  2C10 A;  3H51 A;  4X2O A;  3T0U A;  2BNG A;  1GY6 A;  3X3Z A;  1VQM 3;  1GYB A;  3O8Y A;  2OQE A;  3TDG A;  3CCQ 3;  3S27 A;  1HU9 A;  2XF3 A;  4R4K A;  3F14 A;  4HM5 B;  2WGQ A;  3RGA A;  4KFF A;  1FGT A;  2Z6B A;  4HZ9 B;  5AYS C;  5FW5 A;  1DMN A;  1W00 A;  2GEX A;  3UB1 A;  1VQ6 3;  3CPO A;  2XSO B;  3KKG A;  4O3V A;  1VQO 3;  3MKI A;  2W9P A;  1KWI A;  3BNE A;  3PCS A;  4XDV A;  2P0X A;  1QAL A;  3X40 A;  3CCU 3;  1Q81 4;  3SLU A;  2P38 A;  1VQ5 3;  2E2V A;  5HGR A;  1W5Z A;  1IVX A;  3EBT A;  1EKM A;  3A76 A;  3EN8 A;  2HMJ B;  3N8B A;  3NXJ A;  2W56 B;  4X2H A;  4JF8 A;  1YI2 3;  4OUQ A;  2XFT A;  3VF1 A;  1ZO2 A;  5AYR B;  3V92 A;  3ALA A;  3CCV 3;  1K73 4;  3CC7 3;  3S5C A;  1Q42 A;  2KCD A;  4KZ1 A;  4I4K A;  4RNZ A;  4HM6 B;  3N9H A;  1STD A;  1D6U A;  1TU5 A;  4STD A;  3PGB A;  3JUM A;  2QGU A;  1QAK A;  1N9J A;  2BMQ B;  4WYK A;  4Q53 A;  5CK6 A;  1RJO A;  1O7P B;  1KSI A;  1Q40 A;  1SQW A;  2KXG A;  3Q90 A;  4FCJ A;  4HM2 B;  2UX0 A;  5EQL A;  2D42 A;  3G16 A;  2K54 A;  1IT7 A;  3HII A;  4FMA A;  2OOV A;  3EB8 A;  3NBJ A;  1VZZ A;  1OUN A;  1CQS A;  2Q07 A;  3PS8 A;  3OXA A;  3G6E 3;  3Q1C A;  5IG4 A;  1PU4 A;  3L0R A;  3QRD A;  1GD3 A;  3IMA B;  2LYX A;  2CKF B;  5JPU A;  1W02 A;  2JQ5 A;  1NJI 4;  3V99 A;  1A2K A;  4WWU C;  2W2C A;  2FNQ A;  1Z1S A;  3LTD A;  5AEU B;  2I9W A;  3JUP A;  3M8C A;  3N54 B;  1O7G B;  2CFK A;  5ELU A;  3FF2 A;  3IPT A;  1IVU A;  3AMO A;  3MSO A;  2OTL 3;  3CPW 2;  4HJL B;  1O7M B;  2WGO A;  3DGN A;  1Q7Y 4;  4MMZ B;  1M1X B;  4EYC A;  8CHO A;  2HMM B;  2PZV A;  6STD A;  1AR0 A;  3I55 3;  4BTY A;  3F8X A;  1QVG 2;  2HMO B;  3MHE A;  4AKY A;  2B1X B;  3I0Y A;  2MF7 A;  3RGR A;  3WDG B;  1TFK A;  1N8R 4;  3CNX A;  4GB5 A;  4HVN A;  3G4S 3;  2A15 A;  3IJE B;  5DRE A;  3WOE B;  1S72 3;  3F7X A;  2STD A;  4N6M A;  5AI1 A;  7STD A;  3NV0 A;  1TP6 A;  3MPH A;  1BUQ A;  1IK3 A;  4MJD A;  3V98 A;  4HM7 B;  1NU3 A;  4J9A A;  5D82 A;  2IUJ A;  4FR9 A;  1UUV B;  3F9S A;  3SED A;  4BTX A;  2BO9 B;  3NQY A;  3OWU A;  3GWR A;  1YJW 3;  2GU1 A;  4OK0 A;  1ZX2 A;  4ORL A;  2RFR A;  3MWZ A;  4EXR A;  1YIJ 3;  3BLZ A;  1DMM A;  2O3O A;  1NB3 I;  1NB5 I;  3X42 A;  5IEP A;  5D83 A;  3FSD A;  5EVH A;  4XDW A;  1EG9 B;  3JUN A;  3EX9 A;  1KD1 4;  3OX9 A;  3FKA A;  4NHF A;  3LZA A;  3LML A;  4IT7 A;  3NM7 A;  4GL6 A;  1W6G A;  1NDO B;  1QVF 2;  2OOV C;  1JV2 B;  2F98 A;  4HM1 B;  1VQL 3;  3PXM A;  1N5P A;  1SII A;  1IT8 A;  1STF I;  2YX9 A;  3X3X A;  4G1M B;  4WYK B;  2KRT A;  1Q40 B;  1ROA A;  4J8T A;  2P0M A;  3DXO A;  3VGN A;  1A90 A;  2XGN A;  3OWS A;  3I56 3;  3BNC A;  5IEO A;  3GZY B;  1OF5 A;  3U97 A;  1O7N B;  2XH9 A;  1Q82 4;  3JUQ A;  3HK4 A;  3HIG A;  5KP3 A;  5IG3 A;  4LEH A;  1UI7 A;  5A0O B;  1R4C A;  2W03 A;  1VQ7 3;  3QK9 A;  3BND A;  4QWT A;  5IG0 A;  5BVB A;  3CCJ 3;  3WA2 X;  3EBY A;  2RCD A;  3DM8 A;  3EE1 A;  5CF2 A;  1MNL A;  3CC4 3;  3NBB A;  3CCM 3;  3X3Y A;  1W6C A;  3DMC A;  3AMO B;  3FLJ A;  1IDP A;  2P05 A;  3MYT A;  1GD4 A;  1VQ8 3;  2WOH A;  2ML5 A;  4MEI A;  3UL6 A;  2GEY A;  3LXU X;  1OAC A;  3F7S A;  1IV9 A;  3SVA A;  4AKZ A;  2Z7A A;  2Z76 A;  4TX4 A;  1VQP 3;  3FG1 A;  1M90 4;  1DYU A;  1K41 A;  4N6N B;  2CFW A;  3KSP A;  2YFJ B;  1CEW I;  1N8Q A;  2OTJ 3;  2W04 A;  3JVC A;  3EJV A;  3LT8 A;  3CXC 2;  3NM2 A;  2XR8 B;  3SX1 A;  3WMD A;  3NV0 B;  1W7C A;  1QAF A;  3KSE D;  1LOX A;  2F86 B;  1GS3 A;  5G2G A;  3DY5 A;  2JDI H;  4R9K A;  3OWY A;  5KP4 A;  1OHO A;  4R9L A;  3WOD G;  4H61 A;  3G0K A;  3BNB A;  5IW9 A;  1YJ9 3;  3SXX A;  1VQN 3;  2IA7 A;  1JKG A;  1OHS A;  1JB5 A;  1WMN A;  2RGQ A;  1ROV A;  5EEO A;  3CCE 3;  1EQK A;  2CFG A;  2RSX A;  4R1K A;  2MC8 A;  3ROB A;  2OQE C;  4FCZ A;  3UNL A;  3FZW A;  4EV5 A;  3KN4 A;  1JNQ A;  2CG1 A;  1TIJ A;  2HMN B;  2ZDJ A;  3S29 A;  2GBX B;  1S5A A;  1FUW A;  2F99 A;  2W6J H;  1M1K 4;  4KFE A;  5AIF A;  1JB4 A;  2C11 A;  4FMD A;  3GZB A;  1TUH A;  4K1U A;  2LQV A;  2Y74 A;  3LOY A;  4HKV B;  4BTW A;  3DGO A;  5CXO A;  1KC8 4;  2E2T A;  5FGO A;  1KQS 2;  3STD A;  5IER A;  4IIA A;  2E2U A;  3VSY A;  3CCR 3;  3SOA A;  2B24 B;  3DZL A;  2BT3 A;  1FGR A;  3ECF A;  5LC6 A;  4MMY B;  3E99 A;  3D3L A;  4WP5 A;  3KFQ C;  1J2B A;  1MOL A;  3FG4 A;  1OF5 B;  1W6Y A;  4K90 B;  4NRE A;  1YIT 3;  1FGO A;  3MG3 A;  3MG2 A;  3NBR A;  4WHA A;  2XSH B;  1TFO A;  4H3U A;  1VQ9 3;  1Q86 4;  5IG5 A;  2BMO B;  4LMI A;  1RKY A;  4KVH A;  4L8P A;  4U13 A;  3RDE A;  5AEW B;  1UW1 A;  2CWV A;  2GXF A;  1K8A 4;  2IUK A;  1W2B 2;  3CNM A;  4L7K A;  2XGL A;  1E3R A;  3K0Z A;  1OGX A;  3S67 A;  1VQ4 3;  1YJN 3;  5STD A;  2HML B;  1CYV A;  1M9G A;  1WNH A;  3PYJ A;  4IPB A;  1AVK A;  1AVL A;  3T8U A;  3H3H A;  4FCM A;  2FXT A;  2IMJ A;  3F40 A;  3CME 3;  5JBS A;  4HM8 B;  2CC3 A;  3CC2 3;  1YHQ 3;  2FGT A;  1G96 A;  1T5Y A;  1HKX A;  1JRQ A;  3CCL 3;  2O9U X;  2CG0 A;  1YGE A;  1JB2 A;  5DRV A;  3WA3 A;  3NUV A;  4RZM A;  3CD6 3;  4CDL A;  1SPU A;  2ML6 A;  1PFP A;  4MMX B;  3ER7 A;  1A67 A;  3B4O A;  5IEN A;  2PNC A;  1O7W B;  1IVW A;  1U8C B;  5CLK A;  1K9M 4;  1OHP A;  1YVB I;  2K0M A;  3K5T A;  3BB9 A;  3GAX A;  1IVV A;  3EN1 B;  3PZW A;  4HBR A;  2CWT A;  3F8H A;  1IQY A;  1C7H A;  2BHM A;  4EC6 A;  2WO0 A;  5I97 A;  3GRD A;  3JUO A;  1JKG B;  3Q2P A;  4O02 B;  3G71 3;  1SJW A;  3EQQ B;  1AV4 A;  1E97 A;  1ULJ B;  3CCS 3;  1WTH A;  2INX A;  3DGL A;  3K9M C;  4AEQ A;  1JJ2 2;  4RNY A;  4JRF A;  4LSO A;  4O8S A;  3T8N A;  3G8Z A;  5BXQ A;  3DUK A;  1JN5 A;  3KE7 A;  5IF6 A;  5KP1 A;  3J7Y d;  1NWW A;  1D6Z A;  1ASK A;  3K63 A;  4HM3 B;  5AII A;  1NO3 A;  3SOY A;  5CF1 A;  2L4V A;  1RRH A;  5JPP A;  3PCR A;  1OGZ A;  1WMP A;  4RBN A;  1GY5 A;  5AIG A;  3LT9 A;  1K28 A;  4KFD A;  2BMR B;  2YFL B;  1ULI B;  2HMK B;  3LH4 A;  3EHC A;  5AIH A;  4PEJ A;  1RRL A;  1OH0 A;  1O7H B;  3WOF B;  1IV7 A;  3LTA A;  2YFI B;  2P09 A;  1V74 A;  3B7C A;  3U1W A;  2M7O A;  3OW2 2;  1LNH A;  3CU3 A;  4N6V 0;  4OVM A;  1LVN A;  3B8L A;  1RN7 A;  4EV2 A;  3FF0 A;  3HI7 A;  2V1L A;  1W2Z A;  2CK3 H;  2XEP A;  3GZX B;  1QJG A;  3NHX A;  1E3V A;  4R80 A;  1ISK A;  3NX0 A;  1IU7 A;  2Y73 A;  3NQZ A;  1WQL B;  4FMC A;  4EBG A;  1VQK 3;  5D81 A;  4HZB B;  1OPY A;  3HZP A;  2W56 A;  4N6L A;  5TGN A;  3CMA 3;  3LTB A;  3LTC A;  3FCS B;  2W0Q A;  2OCT A;  3FH1 A;  1Y4K A;  1WMO A;  3K7C A;  3FGY A;  1F8N A;  2CW9 A;  1W01 A;  2R4I A;  4XBX A;  1FA3 A;  4HYZ A;  4XBT A;  3D9R A;  1W4N A;  4K1V A;  1SIH A;  4N3V A;  2GU3 A;  1EA2 A;  4XB5 A;  4CCV A;  1FGQ A;  3OV4 A;  4HM0 B;  2QEX 3;  3S28 A;  3DGM A;  2W9Q A;  3UJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...