3EJVA

Crystal structure of a cystatin-like protein (saro_2766) from novosphingobium aromaticivorans dsm at 1.40 a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
159
structure length
159
Chain Sequence
TMADETIILNVLGQYTRAHDRRDPDAMAALFAPEATIEIVDAVGGASRSISRLEGRDAIRVAVRQMMAPHGYRAWSQNVVNAPIIVIEGDHAVLDAQFMVFSILAAEVPDGGWPTGTFGAQGRIVPIEAGQYRLTLRTVADGWVISAMRIEHRLPMAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein with cystatin-like fold
publication title Crystal structure of protein of unknown function with a cystatin-like fold (YP_498036.1) from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.40 A resolution
rcsb
source organism Novosphingobium aromaticivorans dsm 12444
molecule tags Unknown function
total genus 37
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ejvA00
4IIAA 1NU3A 1U5OA 3G8ZA 3SEDA 1ASKA 1OGXA 1AR0A 3D9RA 3EQQB 3NXJA 1E3RA 1E97A 4H3UA 2Z7AA 3OWYA 2YFLB 4XBXA 1QJGA 5KP4A 4WYKB 2B24B 2Z77A 2RGQA 2RFRA 3FF0A 3Q90A 2GBXB 4XBYA 1O7HB 3F7SA 2HMLB 3DUKA 1Q40B 5DREA 5IEOA 5AIGA 3NM2A 3KZTA 3BLZA 3EF8A 3DM8A 1GY7A 4HZ9B 1DMMA 4PEJA 1VZZA 4XM4A 4HZBB 3T8NA 3STDA 3B7CA 3GZRA 2XRXB 1QMAA 1A2KA 1Q42A 4R9KA 2YFJB 5AIHA 3MG2A 2GXFA 2STDA 1TUHA 2GEXA 3OWSA 3SOAA 1OHOA 1W6YA 3T8UA 3JUOA 4OUQA 4HKVB 3S5CA 3EC9A 3JUMA 5G2GA 5AEUB 4HM1B 3MKIA 5D81A 2R4IA 5KP3A 4MJDA 2BMQB 4FCMA 3DZLA 3B4OA 1OGZA 2JQ5A 3NBRA 1OUNA 1JB4A 4HM6B 4WYKA 4XBTA 2QGUA 3GZXB 4OVMA 5BVBA 5TGNA 2HMOB 4XDWA 2XSHB 2UX0A 3KE7A 4N3VA 4STDA 2BMOB 3EJVA 1JB2A 1W00A 3GRDA 5IEPA 4HM7B 1HKXA 1Q40A 3K0ZA 3MSOA 4RZMA 1O7PB 3I0YA 3NV0B 1OF5B 2INXA 1ZX2A 4KVHA 2Z76A 3IPTA 1GS3A 3MHEA 3H51A 3VGNA 1OHPA 1DMNA 5JPPA 2CHCA 3DMCA 1C7HA 2XSOB 4X2HA 4FCJA 4HVNA 3UJMA 2K54A 4HM2B 3NUVA 5EVHA 3EX9A 3HX8A 5AI1A 4HJLB 1JN5B 3EBTA 1Z1SA 4Q53A 1ISKA 1GY6A 1OHSA 5HGRA 4L7KA 5D83A 5DRVA 1IDPA 4LMIA 4CDLA 3FLJA 1UUVB 5JPUA 3JUQA 3E99A 3G0KA 3MG3A 1JB5A 5CF1A 2QIYA 3F8XA 4HM0B 5CK6A 4L8PA 4HM8B 1S5AA 2BNGA 3FH1A 3JUNA 1ULIB 3MG1A 1CQSA 3VSYA 2B1XB 4WP5A 4GB5A 2GEYA 4I4KA 3NV0A 1OF5A 2F99A 3LZAA 2HMMB 3HK4A 2OWPA 2W2CA 1TP6A 3FKAA 3UNLA 4X2OA 1O7WB 3GZBA 3BB9A 1STDA 4LGQA 1NDOB 4HM5B 5D82A 1W02A 5CLKA 3CPOA 2HMJB 2YFIB 1SJWA 3DXOA 5CF2A 1OH0A 1DMQA 3G16A 1E3VA 4XDVA 3FZWA 5AEWB 1JN5A 3EN8A 7STDA 3B8LA 2IMJA 3CU3A 3EN1B 3KKGA 2GBWB 3CNXA 3WMDA 3ER7A 4K1VA 5IG3A 1NWWA 1O7GB 3CNMA 4L8OA 3RGAA 3FF2A 3ECFA 3OWUA 5IERA 1OCVA 5IG5A 5IG0A 1JKGB 4HM3B 2HMNB 5BXQA 3JUPA 1EG9B 1BUQA 1OPYA 4R1KA 1EA2A 5AIIA 4LEHA 2XR8B 4WWUC 1W01A 1GY5A 3M8CA 4J8TA 5IG4A 8CHOA 4J9AA 3OX9A 5IF6A 3LYGA 4K1UA 2HMKB 3EHCA 4R9LA 6STDA 4ORLA 3A76A 3RGRA 3GWRA 2PZVA 3OXAA 2BMRB 3F8HA 3ROBA 3KSPA 1K41A 3SOYA 1UUWB 3MYTA 5AIFA 4HM4B 4U13A 2I9WA 2F86B 3F40A 3F7XA 3NHXA 5FW5A 4XB5A 3EBYA 3H3HA 1O7MB 2RCDA 3F9SA 3FSDA 2CKFB 5STDA 5CXOA 5IENA 2A15A 3F14A 3GZYB 2F98A 1GYBA 1ZO2A 1ULJB 5KP1A 1O7NB 1JKGA 3OV4A 3K7CA 3B4PA 3HZPA 1WQLB 3FGYA
chains in the Genus database with same CATH superfamily
4IIAA 1JJ22 1NU3A 2SBLA 3DGYA 3X3XA 1U5OA 2E2UA 2F4YA 1BSBA 2XF3A 3G8ZA 1RLSA 3SEDA 1LNIA 1ASKA 2ZA4A 5IW9A 1OGXA 1AR0A 3D9RA 3G6E3 3BIRA 3EQQB 3NXJA 4FMDA 1I3FA 1SARA 3J7Yd 1BRJA 1FGOA 1JBSA 1RSNA 4MMXB 4BU4A 4RNYA 1TFOA 1T2IA 5BU4A 7RNTA 1E3RA 3URPA 3L0RA 1E97A 1IV7A 3WA2X 1IVWA 1RGHA 2MF7A 1LXEA 1MWSA 4H3UA 3LOYA 4CPKA 4HAAA 2Z7AA 5LC6A 3OWYA 3WA3A 4FMCA 2H0IA 1RRHA 1FUSA 1WTHA 2CFGA 2YFLB 4XBXA 1QJGA 1SPUA 3A5EA 3FG4A 3UL6A 1BGSA 5KP4A 4WYKB 4AEQA 2CFKA 2B24B 5ELUA 3WOFB 1PFPA 1QAFA 2OQEC 2Z77A 1W7CA 4N6UA 2RGQA 3PCRA 1B2UA 1C54A 4BTYA 2RFRA 3FF0A 1G96A 3Q90A 3ALAA 3BNDA 4O3VA 2GBXB 4XBYA 1U8CB 2IUJA 9RNTA 1O7HB 4MEIA 3F7SA 2HMLB 2F5WA 3DUKA 1Q40B 1PYLA 5DREA 3N9HA 4FMAA 2WO0A 1CYVA 5IEOA 3BNEA 5AIGA 3NM2A 3KZTA 1UI8A 1MGWA 3FCSB 1DE3A 3BLZA 3EF8A 3DM8A 1RTUA 1GY7A 3CC73 4HZ9B 1VQP3 1DMMA 1TJDA 4EC6A 4PEJA 3D4AA 2OCTA 1OACA 1VZZA 1RCLA 4HZBB 4XM4A 1WMNA 3T8NA 3K5TA 4BTWA 1VQ43 1B2SA 1BRSA 3STDA 3B7CA 3MWZA 1WMPA 3X42A 3GZRA 1LNHA 2XRXB 1BNJA 1QMAA 3WODG 1A2KA 5FGOA 3KIIA 1Q42A 2WGQA 2RSXA 3SLUA 4R9KA 1BAOA 1N8R4 2YFJB 3CCV3 3MG2A 5AIHA 2GXFA 2STDA 3DH2A 4BTXA 3N54B 1TUHA 3KCHA 2OTJ3 1PU4A 2GEXA 2P38A 3OWSA 3LXUX 1OHOA 3SOAA 3CCR3 2XGLA 1JZOA 2BHMA 1W6YA 3WOEB 3NBBA 6RNTA 1I2GA 1RHLA 1R4CA 2CH9A 2F56A 3JUOA 3T8UA 2LYXA 1W2ZA 3S29A 4OUQA 4FMBA 4HKVB 2UGIA 4K90B 1MNLA 2P0XA 1KSIA 1D6YA 3IJEB 4JRFA 4CJNA 3S5CA 3EC9A 3SXXA 1YJ93 5GSPA 1IT7A 3JVCA 3JUMA 1NJI4 1I70A 5G2GA 1W6CA 4EBGA 5AEUB 1BRHA 1UCJA 3TDGA 4HM1B 1J2BA 3MKIA 3T0UA 3AMOB 5D81A 2AADA 1D6ZA 1HYFA 2R4IA 1GD4A 1VQQA 2OOVC 4MJDA 5KP3A 3LMLA 1BANA 2BMQB 5M18A 4FCMA 1VQ73 1LOYA 1B20A 1X1WA 1UCLA 3DZLA 3B4OA 3RNTA 4BL2A 1V58A 2KRTA 5G1LA 1OGZA 2KXGA 3O8YA 4N6OB 3U97A 3CCM3 1S723 2JQ5A 4R4KA 3NBRA 1OUNA 1D6UA 1AVKA 1JB4A 2RNTA 2W56A 2KF3A 3QK9A 4HM6B 4WYKA 4O8SA 4XBTA 1G02A 2QGUA 1IQYA 2C11A 3GZXB 1ROAA 2GU3A 1L5GB 4OVMA 1RGAA 5BVBA 1N5PA 5TGNA 1VQ83 2HMOB 1I2EA 2CFDA 1PY3A 1Y4KA 4XDWA 1BNEA 1WNHA 2XSHB 1VQO3 1SIHA 1DVCA 1JV2B 2UX0A 3KE7A 4N3VA 4AKYA 4STDA 3D5IA 1DVDA 2BMOB 3EJVA 1JB2A 1RNTA 1W00A 2CWUA 3GRDA 5IEPA 1GMRA 3D3LA 4HM7B 1HKXA 1Q40A 3CMA3 1VQM3 3CCE3 1BNGA 1TU5A 3ZG0A 3K0ZA 3MSOA 4RZMA 1O7PB 3I0YA 1RJOA 3PCSA 1IVUA 3NV0B 4OK0A 2WOHA 1OF5B 1ROVA 5LC7A 3WR2A 1BRNL 1STFI 1BNIA 3U1WA 1RKYA 1T2HA 2ML5A 2INXA 1ZX2A 3K9MC 4KVHA 3V92A 3CPW2 2CWTA 1YIT3 3KFQC 3RDEA 4KFDA 1TRQA 1BSCA 1BOXA 2L4VA 1YI23 1GD3A 3HIGA 1B27A 1GMQA 4O02B 3S27A 4EV5A 1F8NA 2Z76A 5M19A 3IPTA 1GS3A 1VQN3 3MHEA 1V74A 3H51A 1UW1A 1GOYA 2CFLA 3DGNA 3GAXA 3VGNA 3X41A 1JBRA 2OQEA 1OHPA 1N5HA 1UGIA 1DMNA 5JPPA 2CHCA 4I5QA 3DMCA 2KCDA 1W2B2 1C7HA 2XSOB 2V1LA 1YIJ3 1X1YA 1N9JA 3AGOA 3S67A 4X2HA 6GSPA 2K0MA 3KSED 3PS8A 3UB1A 4FCJA 3D5GA 1EQKA 4LZIA 1IYYA 2Q07A 4HVNA 1RGCA 3FG1A 3DY5A 3UJMA 3DGOA 1RMSA 2CX0A 3NQZA 2K54A 4HYZA 4EV2A 4HM2B 3NUVA 4AKZA 1EKMA 2C10A 1Q814 1YNVX 5EVHA 3SX1A 1I0XA 1JZDA 3EX9A 1IT8A 2P09A 3HX8A 2Y74A 1RGKA 5AI1A 2BU4A 4HJLB 1JN5B 3EBTA 4KT3B 1FYSA 3CME3 1I3IA 1B3SA 1DYUA 1YJN3 1Z1SA 2H0GA 4Q53A 1T3BA 1ISKA 1GY6A 1LOVA 1OHSA 5HGRA 2CG1A 4L7KA 1QALA 1KD14 5D83A 5DRVA 1IDPA 4LMIA 4CDLA 3FLJA 1UUVB 5JPUA 1A2VA 5AYRB 3X40A 4FR9A 3JUQA 2H0HA 1MWRA 1TIJA 1I0VA 3E99A 3G0KA 3MG3A 4MMZB 1JB5A 1IK3A 5EEOA 1X1XA 3QRDA 3CC43 5CF1A 2QIYA 2IA7A 1M1XB 3F8XA 1BRKA 3CD63 1R4YA 3BNCA 4HM0B 1B21A 1Q9EA 5CK6A 3CXC2 4EW5A 4L8PA 1UDII 4KZ1A 4HM8B 3PGBA 1S5AA 3WHOA 2CW9A 2W03A 2BNGA 1BSEA 3FH1A 3ZG5A 3JUNA 2CC3A 1ULIB 3MG1A 4WFOA 1EUIC 2BT3A 2CG0A 1CQSA 3VSYA 2PNCA 2B1XB 3K63A 4WP5A 4J5KA 2D1WA 2JDIH 8RNTA 1Q864 1FGTA 4IPBA 3X3ZA 4GB5A 3LT8A 1HZ1A 2GEYA 3BU4A 5AYSC 2W6JH 1RN4A 4I4KA 3NV0A 1GSPA 1OF5A 2F99A 2OOVA 3V98A 3LZAA 2RBIA 1RGLA 1BVIA 2HMMB 1JRQA 1BIRA 1I2FA 3HK4A 4NREA 1GMPA 2OWPA 2W2CA 3ZFZA 1TP6A 1KC84 1K8A4 3FKAA 4O2HA 3G4S3 7GSPA 2FGTA 2UUGC 3UNLA 4X2OA 1RNBA 4N6NB 4EXRA 3CCJ3 1O7WB 1BRIA 3D79A 4H61A 1UI7A 3GZBA 1YGEA 1FW7A 3BB9A 1STDA 1HU9A 1UUGB 2IYJA 4LGQA 2QA43 1GOVA 1N9EA 1NDOB 3N8BA 4HM5B 5D82A 4LYLB 4ZM8A 1W02A 3AHWA 3DGLA 4JF8A 1NB5I 5CLKA 2XEPA 3CPOA 1UCKA 2HMJB 2HOHA 1FGRA 3FG3A 1V57A 1VQ63 1EEJA 1CEWI 2YFIB 1SJWA 2F5MA 1FUWA 1ZGXA 3DXOA 5CF2A 1N8QA 1VQK3 1MOLA 3S28A 2P05A 4K61A 1OH0A 1DMQA 3AHSA 2FXTA 4GHOA 3Q2PA 3G16A 1E3VA 2D42A 3VF1A 4XDVA 3FZWA 5AEWB 3GSPA 3X3YA 1RN1A 1VQ93 1JN5A 3EN8A 2GSPA 1A2PA 1I8VA 4N6TA 7STDA 3B8LA 1RCKA 5G1KA 2J8XB 2IMJA 2L1SA 3CU3A 3EN1B 3KKGA 4NPBA 2GBWB 3Q1CA 4RNZA 3CNXA 3WMDA 5RNTA 1BSAA 2CFWA 1ZS7A 2BIRA 2K3DA 3ER7A 3HOHA 3BNBA 1M904 1B2MA 2XFTA 3HI7A 4NHFA 5M1AA 1RGGA 1TRPA 4KFFA 4K1VA 1QVG2 4MMYB 5IG3A 1NWWA 1VQ53 1LQGC 3SVAA 2KF5A 5BIRA 2QEX3 1O7GB 3CCQ3 1BNFA 3CNMA 1YVSA 1BNRA 4L8OA 1RGEA 3RGAA 3FF2A 1JNQA 2W56B 1B2ZA 3PYJA 1IQXA 4N6MA 3ECFA 2O9UX 3OWUA 4FCZA 3LTCA 1LRAA 5IERA 1OCVA 5IG5A 5IG0A 2KF4A 3NX0A 3EB8A 4LSOA 2ML6A 2OTL3 1JKGB 4HM3B 2ZDJA 1FGQA 2HMNB 1IVVA 1BNSA 5BXQA 4HOHA 1AQZA 1MWTA 2P0MA 3AMOA 3JUPA 1BU4A 3PZWA 1EG9B 4CCVA 5HOHA 3CCS3 1BUQA 1OPYA 4R1KA 2XH9A 3V99A 1EA2A 4QWTA 1NB3I 5I97A 5AIIA 4LEHA 1MGRA 1KQS2 1T5YA 2XR8B 4WWUC 4BIRA 1TTOA 2W9QA 3HIIA 1W4NA 1M9GA 3SYUA 1W01A 1IVXA 3LTBA 1LQMB 4GSPA 1NO3A 2WOFA 1GY5A 1YVBI 2XGNA 2KF6A 3M8CA 2W9PA 4HBRA 3G713 2O3OA 2IUKA 4J8TA 5IG4A 1YHQ3 2YX9A 8CHOA 4G1MB 4J9AA 3PXMA 3OX9A 5IF6A 1AV4A 2W0QA 1Q824 3LYGA 4R80A 1RN7A 4K1UA 2HMKB 4RNTA 1K734 3NBJA 3OW22 1UGHI 3EHCA 3WDGB 1GOUA 4R9LA 1FZUA 1LOXA 2CK3H 3IMAB 3CCL3 2FNQA 5A0OB 6STDA 2M7OA 1W6GA 4KFEA 4ORLA 3A76A 3RGRA 1KWIA 1IV9A 2LQVA 3GWRA 4GL6A 4EYCA 5JBSA 2E2TA 1VQL3 2GU1A 1IU7A 2PZVA 1Q7HA 2BMRB 3KN4A 3OXAA 4BL3A 1BUJA 2IY2A 1AVLA 1CH0A 2KAAA 1LVNA 3F8HA 4N6LA 3ROBA 1UCIA 1RRLA 3LT9A 3I563 3KSPA 2W04A 1G0TA 1K41A 3SOYA 1K9M4 1BSDA 4ILFA 1UUWB 3DGMA 4WHAA 1FUTA 3Q3FA 3MYTA 4HM4B 4U13A 5AIFA 2CX1A 1QAKA 2I9WA 3NM7A 1YGWA 2F86B 3F40A 3F7XA 4IT7A 2E2VA 2Y73A 3NHXA 1A67A 5FW5A 1JBTA 2R41A 2SARA 3CCU3 1B2XA 3I553 1LOWA 1CYUA 1RDSA 4RBNA 4XB5A 1FA3A 1NNVA 4J5GA 1RGFA 3EBYA 1BRGA 3H3HA 1QVF2 3LTDA 3LTAA 4TX4A 1TFKA 2MC8A 1O7MB 2ZHXB 3CC23 5ELJA 5EQLA 2RCDA 2Z6BA 3F9SA 3FSDA 1SQWA 2CKFB 3EE1A 1MWUA 3LH4A 5STDA 2WGOA 3UL5A 5CXOA 5IENA 1SIIA 2A15A 3F14A 3GZYB 2F98A 3MPHA 1YJW3 1Q7Y4 1US1A 1M1K4 1IQ8A 1GYBA 3NQYA 4N6V0 1ZO2A 1ULJB 3AGNA 2CWVA 5KP1A 1DETA 2C4BA 2CIUA 1O7NB 1JKGA 2BO9B 2ZL8A 3OV4A 1WMOA 1W5ZA 1X1UA 1FGMA 3B4PA 3K7CA 2XFSA 3HZPA 2AAEA 4DKIA 1WQLB 1K28A 3FGYA 1A90A 1AY7A
chains in the Genus database with same CATH topology
4IIAA 1JJ22 1NU3A 2SBLA 3X3XA 1U5OA 2E2UA 3G8ZA 2XF3A 3SEDA 5IW9A 1ASKA 1OGXA 1AR0A 3D9RA 3G6E3 3EQQB 3NXJA 4FMDA 3J7Yd 1FGOA 4MMXB 4RNYA 1TFOA 1E3RA 3WA2X 3L0RA 1E97A 1IV7A 1IVWA 2MF7A 1LXEA 4H3UA 3LOYA 2Z7AA 5LC6A 3OWYA 3WA3A 4FMCA 1RRHA 1WTHA 2CFGA 2YFLB 4XBXA 1QJGA 1SPUA 3FG4A 3UL6A 5KP4A 4WYKB 4AEQA 2CFKA 2B24B 5ELUA 3WOFB 1PFPA 1QAFA 2OQEC 2Z77A 1W7CA 4N6UA 2RGQA 3PCRA 4BTYA 2RFRA 3FF0A 1G96A 3Q90A 3ALAA 3BNDA 4O3VA 2GBXB 4XBYA 1U8CB 2IUJA 1O7HB 4MEIA 3F7SA 2HMLB 3DUKA 1Q40B 5DREA 3N9HA 4FMAA 2WO0A 1CYVA 5IEOA 3BNEA 5AIGA 3NM2A 3KZTA 1UI8A 3FCSB 3BLZA 3EF8A 3DM8A 1GY7A 3CC73 4HZ9B 1VQP3 1DMMA 4EC6A 4PEJA 2OCTA 1OACA 1VZZA 4XM4A 4HZBB 1WMNA 3T8NA 3K5TA 4BTWA 1VQ43 3STDA 3B7CA 3MWZA 1WMPA 3X42A 3GZRA 1LNHA 2XRXB 1QMAA 3WODG 1A2KA 5FGOA 3KIIA 1Q42A 2WGQA 2RSXA 3SLUA 4R9KA 1N8R4 2YFJB 3CCV3 3MG2A 5AIHA 2GXFA 2STDA 4BTXA 3N54B 1TUHA 2OTJ3 1PU4A 2GEXA 2P38A 3OWSA 3LXUX 1OHOA 3SOAA 3CCR3 2XGLA 2BHMA 1W6YA 3WOEB 3NBBA 1R4CA 2CH9A 3T8UA 3JUOA 2LYXA 1W2ZA 3S29A 4OUQA 4FMBA 4HKVB 4K90B 1MNLA 2P0XA 1KSIA 1D6YA 3IJEB 4JRFA 3S5CA 3EC9A 3SXXA 1YJ93 1IT7A 3JVCA 3JUMA 1NJI4 5G2GA 1W6CA 4EBGA 5AEUB 3TDGA 4HM1B 1J2BA 3MKIA 3T0UA 3AMOB 5D81A 1D6ZA 2R4IA 1GD4A 2OOVC 5KP3A 4MJDA 3LMLA 2BMQB 4FCMA 1VQ73 3DZLA 3B4OA 2KRTA 1OGZA 2KXGA 3O8YA 4N6OB 3U97A 3CCM3 1S723 2JQ5A 4R4KA 3NBRA 1OUNA 1D6UA 1AVKA 1JB4A 2W56A 3QK9A 4HM6B 4WYKA 4O8SA 4XBTA 2QGUA 1IQYA 2C11A 3GZXB 1ROAA 2GU3A 1L5GB 4OVMA 5BVBA 1N5PA 5TGNA 1VQ83 2HMOB 2CFDA 1Y4KA 4XDWA 1WNHA 2XSHB 1VQO3 1SIHA 1DVCA 1JV2B 2UX0A 3KE7A 4N3VA 4AKYA 4STDA 1DVDA 2BMOB 3EJVA 1JB2A 1W00A 2CWUA 3GRDA 5IEPA 3D3LA 4HM7B 1HKXA 1Q40A 3CMA3 1VQM3 3CCE3 1TU5A 3K0ZA 3MSOA 4RZMA 1O7PB 3I0YA 1RJOA 3PCSA 1IVUA 3NV0B 4OK0A 2WOHA 1OF5B 1ROVA 5LC7A 1STFI 3U1WA 1RKYA 2ML5A 2INXA 1ZX2A 3K9MC 4KVHA 3V92A 3CPW2 2CWTA 1YIT3 3KFQC 3RDEA 4KFDA 2L4VA 1YI23 1GD3A 3HIGA 3S27A 4O02B 4EV5A 1F8NA 2Z76A 3IPTA 1GS3A 1VQN3 3MHEA 1V74A 3H51A 1UW1A 2CFLA 3DGNA 3GAXA 3VGNA 3X41A 2OQEA 1OHPA 1N5HA 1DMNA 5JPPA 2CHCA 3DMCA 2KCDA 1W2B2 1C7HA 2XSOB 2V1LA 1YIJ3 1N9JA 3S67A 4X2HA 2K0MA 3KSED 3PS8A 3UB1A 4FCJA 1EQKA 4LZIA 2Q07A 4HVNA 3FG1A 3DY5A 3UJMA 3DGOA 3NQZA 4HYZA 2K54A 4EV2A 4HM2B 3NUVA 4AKZA 1EKMA 2C10A 1Q814 5EVHA 3SX1A 3EX9A 1IT8A 2P09A 3HX8A 2Y74A 5AI1A 4HJLB 1JN5B 3EBTA 3CME3 1DYUA 1YJN3 1Z1SA 4Q53A 1ISKA 1GY6A 1OHSA 5HGRA 2CG1A 4L7KA 1QALA 1KD14 5D83A 5DRVA 1IDPA 4LMIA 4CDLA 3FLJA 1UUVB 5JPUA 1A2VA 5AYRB 3X40A 4FR9A 3JUQA 1TIJA 3E99A 3G0KA 3MG3A 4MMZB 1JB5A 1IK3A 5EEOA 3QRDA 3CC43 5CF1A 2QIYA 2IA7A 1M1XB 3F8XA 3CD63 3BNCA 4HM0B 5CK6A 3CXC2 4L8PA 4KZ1A 4HM8B 3PGBA 1S5AA 2CW9A 2W03A 2BNGA 3FH1A 3JUNA 2CC3A 1ULIB 3MG1A 4WFOA 2BT3A 2CG0A 1CQSA 3VSYA 2PNCA 2B1XB 3K63A 4WP5A 2D1WA 2JDIH 1Q864 1FGTA 4IPBA 3X3ZA 4GB5A 3LT8A 2GEYA 5AYSC 2W6JH 4I4KA 3NV0A 1OF5A 2F99A 2OOVA 3V98A 3LZAA 2HMMB 1JRQA 3HK4A 4NREA 2OWPA 2W2CA 1TP6A 1KC84 1K8A4 3FKAA 4O2HA 3G4S3 2FGTA 3UNLA 4X2OA 4N6NB 4EXRA 3CCJ3 1O7WB 4H61A 1UI7A 3GZBA 1YGEA 3BB9A 1STDA 1HU9A 4LGQA 2QA43 1N9EA 1NDOB 3N8BA 4HM5B 5D82A 4ZM8A 1W02A 3DGLA 4JF8A 1NB5I 5CLKA 2XEPA 3CPOA 2HMJB 1FGRA 3FG3A 1VQ63 1CEWI 2YFIB 1SJWA 1FUWA 3DXOA 5CF2A 1N8QA 1VQK3 1MOLA 3S28A 2P05A 4K61A 1OH0A 1DMQA 2FXTA 3Q2PA 3G16A 1E3VA 2D42A 3VF1A 4XDVA 3FZWA 5AEWB 3X3YA 1VQ93 1JN5A 3EN8A 4N6TA 7STDA 3B8LA 2IMJA 3CU3A 3EN1B 3KKGA 2GBWB 3Q1CA 4RNZA 3CNXA 3WMDA 2CFWA 3ER7A 3BNBA 1M904 2XFTA 3HI7A 4NHFA 4KFFA 4K1VA 1QVG2 4MMYB 5IG3A 1NWWA 1VQ53 3SVAA 3CCQ3 2QEX3 1O7GB 3CNMA 4L8OA 3RGAA 3FF2A 1JNQA 2W56B 3PYJA 1IQXA 4N6MA 3ECFA 2O9UX 3OWUA 4FCZA 3LTCA 5IERA 1OCVA 5IG5A 5IG0A 3NX0A 4LSOA 3EB8A 2OTL3 2ML6A 1JKGB 4HM3B 2ZDJA 1FGQA 2HMNB 1IVVA 5BXQA 2P0MA 3AMOA 3JUPA 4CCVA 3PZWA 1EG9B 3CCS3 1BUQA 1OPYA 4R1KA 2XH9A 3V99A 1EA2A 4QWTA 1NB3I 5I97A 5AIIA 4LEHA 1KQS2 1T5YA 2XR8B 4WWUC 2W9QA 3HIIA 1W4NA 1M9GA 1W01A 1IVXA 3LTBA 1NO3A 2WOFA 2XGNA 1GY5A 1YVBI 3M8CA 2W9PA 4HBRA 3G713 2O3OA 2IUKA 4J8TA 5IG4A 1YHQ3 2YX9A 8CHOA 4G1MB 4J9AA 3PXMA 3OX9A 5IF6A 1AV4A 2W0QA 1Q824 3LYGA 4R80A 1RN7A 4K1UA 2HMKB 1K734 3NBJA 3OW22 3EHCA 3WDGB 4R9LA 1LOXA 2CK3H 3IMAB 3CCL3 2FNQA 5A0OB 6STDA 2M7OA 1W6GA 4KFEA 4ORLA 3A76A 3RGRA 1KWIA 1IV9A 2LQVA 3GWRA 4GL6A 4EYCA 5JBSA 2E2TA 1VQL3 2GU1A 1IU7A 2PZVA 3OXAA 2BMRB 3KN4A 1AVLA 1LVNA 3F8HA 4N6LA 3ROBA 3I563 1RRLA 3LT9A 3KSPA 2W04A 1K41A 3SOYA 1K9M4 1UUWB 3DGMA 4WHAA 3MYTA 4HM4B 4U13A 5AIFA 1QAKA 2I9WA 3NM7A 2F86B 3F40A 3F7XA 4IT7A 2E2VA 2Y73A 3NHXA 1A67A 5FW5A 3CCU3 3I553 1CYUA 4RBNA 4XB5A 1FA3A 3EBYA 3H3HA 1QVF2 3LTDA 3LTAA 4TX4A 1TFKA 2MC8A 1O7MB 3CC23 5ELJA 5EQLA 2RCDA 2Z6BA 3F9SA 3FSDA 1SQWA 2CKFB 3EE1A 3LH4A 5STDA 3UL5A 2WGOA 5CXOA 5IENA 1SIIA 2A15A 3F14A 3GZYB 2F98A 3MPHA 1YJW3 1Q7Y4 1US1A 1M1K4 1IQ8A 1GYBA 3NQYA 4N6V0 1ZO2A 1ULJB 2CWVA 5KP1A 2CIUA 1O7NB 1JKGA 2BO9B 2ZL8A 3OV4A 1WMOA 1W5ZA 3K7CA 1FGMA 3B4PA 2XFSA 3HZPA 1WQLB 1K28A 3FGYA 1A90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIA A;  1NU3 A;  1U5O A;  3G8Z A;  3SED A;  1ASK A;  1OGX A;  1AR0 A;  3D9R A;  3EQQ B;  3NXJ A;  1E3R A;  1E97 A;  4H3U A;  2Z7A A;  3OWY A;  2YFL B;  4XBX A;  1QJG A;  5KP4 A;  4WYK B;  2B24 B;  2Z77 A;  2RGQ A;  2RFR A;  3FF0 A;  3Q90 A;  2GBX B;  4XBY A;  1O7H B;  3F7S A;  2HML B;  3DUK A;  1Q40 B;  5DRE A;  5IEO A;  5AIG A;  3NM2 A;  3KZT A;  3BLZ A;  3EF8 A;  3DM8 A;  1GY7 A;  4HZ9 B;  1DMM A;  4PEJ A;  1VZZ A;  4XM4 A;  4HZB B;  3T8N A;  3STD A;  3B7C A;  3GZR A;  2XRX B;  1QMA A;  1A2K A;  1Q42 A;  4R9K A;  2YFJ B;  5AIH A;  3MG2 A;  2GXF A;  2STD A;  1TUH A;  2GEX A;  3OWS A;  3SOA A;  1OHO A;  1W6Y A;  3T8U A;  3JUO A;  4OUQ A;  4HKV B;  3S5C A;  3EC9 A;  3JUM A;  5G2G A;  5AEU B;  4HM1 B;  3MKI A;  5D81 A;  2R4I A;  5KP3 A;  4MJD A;  2BMQ B;  4FCM A;  3DZL A;  3B4O A;  1OGZ A;  2JQ5 A;  3NBR A;  1OUN A;  1JB4 A;  4HM6 B;  4WYK A;  4XBT A;  2QGU A;  3GZX B;  4OVM A;  5BVB A;  5TGN A;  2HMO B;  4XDW A;  2XSH B;  2UX0 A;  3KE7 A;  4N3V A;  4STD A;  2BMO B;  3EJV A;  1JB2 A;  1W00 A;  3GRD A;  5IEP A;  4HM7 B;  1HKX A;  1Q40 A;  3K0Z A;  3MSO A;  4RZM A;  1O7P B;  3I0Y A;  3NV0 B;  1OF5 B;  2INX A;  1ZX2 A;  4KVH A;  2Z76 A;  3IPT A;  1GS3 A;  3MHE A;  3H51 A;  3VGN A;  1OHP A;  1DMN A;  5JPP A;  2CHC A;  3DMC A;  1C7H A;  2XSO B;  4X2H A;  4FCJ A;  4HVN A;  3UJM A;  2K54 A;  4HM2 B;  3NUV A;  5EVH A;  3EX9 A;  3HX8 A;  5AI1 A;  4HJL B;  1JN5 B;  3EBT A;  1Z1S A;  4Q53 A;  1ISK A;  1GY6 A;  1OHS A;  5HGR A;  4L7K A;  5D83 A;  5DRV A;  1IDP A;  4LMI A;  4CDL A;  3FLJ A;  1UUV B;  5JPU A;  3JUQ A;  3E99 A;  3G0K A;  3MG3 A;  1JB5 A;  5CF1 A;  2QIY A;  3F8X A;  4HM0 B;  5CK6 A;  4L8P A;  4HM8 B;  1S5A A;  2BNG A;  3FH1 A;  3JUN A;  1ULI B;  3MG1 A;  1CQS A;  3VSY A;  2B1X B;  4WP5 A;  4GB5 A;  2GEY A;  4I4K A;  3NV0 A;  1OF5 A;  2F99 A;  3LZA A;  2HMM B;  3HK4 A;  2OWP A;  2W2C A;  1TP6 A;  3FKA A;  3UNL A;  4X2O A;  1O7W B;  3GZB A;  3BB9 A;  1STD A;  4LGQ A;  1NDO B;  4HM5 B;  5D82 A;  1W02 A;  5CLK A;  3CPO A;  2HMJ B;  2YFI B;  1SJW A;  3DXO A;  5CF2 A;  1OH0 A;  1DMQ A;  3G16 A;  1E3V A;  4XDV A;  3FZW A;  5AEW B;  1JN5 A;  3EN8 A;  7STD A;  3B8L A;  2IMJ A;  3CU3 A;  3EN1 B;  3KKG A;  2GBW B;  3CNX A;  3WMD A;  3ER7 A;  4K1V A;  5IG3 A;  1NWW A;  1O7G B;  3CNM A;  4L8O A;  3RGA A;  3FF2 A;  3ECF A;  3OWU A;  5IER A;  1OCV A;  5IG5 A;  5IG0 A;  1JKG B;  4HM3 B;  2HMN B;  5BXQ A;  3JUP A;  1EG9 B;  1BUQ A;  1OPY A;  4R1K A;  1EA2 A;  5AII A;  4LEH A;  2XR8 B;  4WWU C;  1W01 A;  1GY5 A;  3M8C A;  4J8T A;  5IG4 A;  8CHO A;  4J9A A;  3OX9 A;  5IF6 A;  3LYG A;  4K1U A;  2HMK B;  3EHC A;  4R9L A;  6STD A;  4ORL A;  3A76 A;  3RGR A;  3GWR A;  2PZV A;  3OXA A;  2BMR B;  3F8H A;  3ROB A;  3KSP A;  1K41 A;  3SOY A;  1UUW B;  3MYT A;  5AIF A;  4HM4 B;  4U13 A;  2I9W A;  2F86 B;  3F40 A;  3F7X A;  3NHX A;  5FW5 A;  4XB5 A;  3EBY A;  3H3H A;  1O7M B;  2RCD A;  3F9S A;  3FSD A;  2CKF B;  5STD A;  5CXO A;  5IEN A;  2A15 A;  3F14 A;  3GZY B;  2F98 A;  1GYB A;  1ZO2 A;  1ULJ B;  5KP1 A;  1O7N B;  1JKG A;  3OV4 A;  3K7C A;  3B4P A;  3HZP A;  1WQL B;  3FGY A; 
#chains in the Genus database with same CATH topology
 4IIA A;  1JJ2 2;  1NU3 A;  2SBL A;  3DGY A;  3X3X A;  1U5O A;  2E2U A;  2F4Y A;  1BSB A;  2XF3 A;  3G8Z A;  1RLS A;  3SED A;  1LNI A;  1ASK A;  2ZA4 A;  5IW9 A;  1OGX A;  1AR0 A;  3D9R A;  3G6E 3;  3BIR A;  3EQQ B;  3NXJ A;  4FMD A;  1I3F A;  1SAR A;  3J7Y d;  1BRJ A;  1FGO A;  1JBS A;  1RSN A;  4MMX B;  4BU4 A;  4RNY A;  1TFO A;  1T2I A;  5BU4 A;  7RNT A;  1E3R A;  3URP A;  3L0R A;  1E97 A;  1IV7 A;  3WA2 X;  1IVW A;  1RGH A;  2MF7 A;  1LXE A;  1MWS A;  4H3U A;  3LOY A;  4CPK A;  4HAA A;  2Z7A A;  5LC6 A;  3OWY A;  3WA3 A;  4FMC A;  2H0I A;  1RRH A;  1FUS A;  1WTH A;  2CFG A;  2YFL B;  4XBX A;  1QJG A;  1SPU A;  3A5E A;  3FG4 A;  3UL6 A;  1BGS A;  5KP4 A;  4WYK B;  4AEQ A;  2CFK A;  2B24 B;  5ELU A;  3WOF B;  1PFP A;  1QAF A;  2OQE C;  2Z77 A;  1W7C A;  4N6U A;  2RGQ A;  3PCR A;  1B2U A;  1C54 A;  4BTY A;  2RFR A;  3FF0 A;  1G96 A;  3Q90 A;  3ALA A;  3BND A;  4O3V A;  2GBX B;  4XBY A;  1U8C B;  2IUJ A;  9RNT A;  1O7H B;  4MEI A;  3F7S A;  2HML B;  2F5W A;  3DUK A;  1Q40 B;  1PYL A;  5DRE A;  3N9H A;  4FMA A;  2WO0 A;  1CYV A;  5IEO A;  3BNE A;  5AIG A;  3NM2 A;  3KZT A;  1UI8 A;  1MGW A;  3FCS B;  1DE3 A;  3BLZ A;  3EF8 A;  3DM8 A;  1RTU A;  1GY7 A;  3CC7 3;  4HZ9 B;  1VQP 3;  1DMM A;  1TJD A;  4EC6 A;  4PEJ A;  3D4A A;  2OCT A;  1OAC A;  1VZZ A;  1RCL A;  4HZB B;  4XM4 A;  1WMN A;  3T8N A;  3K5T A;  4BTW A;  1VQ4 3;  1B2S A;  1BRS A;  3STD A;  3B7C A;  3MWZ A;  1WMP A;  3X42 A;  3GZR A;  1LNH A;  2XRX B;  1BNJ A;  1QMA A;  3WOD G;  1A2K A;  5FGO A;  3KII A;  1Q42 A;  2WGQ A;  2RSX A;  3SLU A;  4R9K A;  1BAO A;  1N8R 4;  2YFJ B;  3CCV 3;  3MG2 A;  5AIH A;  2GXF A;  2STD A;  3DH2 A;  4BTX A;  3N54 B;  1TUH A;  3KCH A;  2OTJ 3;  1PU4 A;  2GEX A;  2P38 A;  3OWS A;  3LXU X;  1OHO A;  3SOA A;  3CCR 3;  2XGL A;  1JZO A;  2BHM A;  1W6Y A;  3WOE B;  3NBB A;  6RNT A;  1I2G A;  1RHL A;  1R4C A;  2CH9 A;  2F56 A;  3JUO A;  3T8U A;  2LYX A;  1W2Z A;  3S29 A;  4OUQ A;  4FMB A;  4HKV B;  2UGI A;  4K90 B;  1MNL A;  2P0X A;  1KSI A;  1D6Y A;  3IJE B;  4JRF A;  4CJN A;  3S5C A;  3EC9 A;  3SXX A;  1YJ9 3;  5GSP A;  1IT7 A;  3JVC A;  3JUM A;  1NJI 4;  1I70 A;  5G2G A;  1W6C A;  4EBG A;  5AEU B;  1BRH A;  1UCJ A;  3TDG A;  4HM1 B;  1J2B A;  3MKI A;  3T0U A;  3AMO B;  5D81 A;  2AAD A;  1D6Z A;  1HYF A;  2R4I A;  1GD4 A;  1VQQ A;  2OOV C;  4MJD A;  5KP3 A;  3LML A;  1BAN A;  2BMQ B;  5M18 A;  4FCM A;  1VQ7 3;  1LOY A;  1B20 A;  1X1W A;  1UCL A;  3DZL A;  3B4O A;  3RNT A;  4BL2 A;  1V58 A;  2KRT A;  5G1L A;  1OGZ A;  2KXG A;  3O8Y A;  4N6O B;  3U97 A;  3CCM 3;  1S72 3;  2JQ5 A;  4R4K A;  3NBR A;  1OUN A;  1D6U A;  1AVK A;  1JB4 A;  2RNT A;  2W56 A;  2KF3 A;  3QK9 A;  4HM6 B;  4WYK A;  4O8S A;  4XBT A;  1G02 A;  2QGU A;  1IQY A;  2C11 A;  3GZX B;  1ROA A;  2GU3 A;  1L5G B;  4OVM A;  1RGA A;  5BVB A;  1N5P A;  5TGN A;  1VQ8 3;  2HMO B;  1I2E A;  2CFD A;  1PY3 A;  1Y4K A;  4XDW A;  1BNE A;  1WNH A;  2XSH B;  1VQO 3;  1SIH A;  1DVC A;  1JV2 B;  2UX0 A;  3KE7 A;  4N3V A;  4AKY A;  4STD A;  3D5I A;  1DVD A;  2BMO B;  3EJV A;  1JB2 A;  1RNT A;  1W00 A;  2CWU A;  3GRD A;  5IEP A;  1GMR A;  3D3L A;  4HM7 B;  1HKX A;  1Q40 A;  3CMA 3;  1VQM 3;  3CCE 3;  1BNG A;  1TU5 A;  3ZG0 A;  3K0Z A;  3MSO A;  4RZM A;  1O7P B;  3I0Y A;  1RJO A;  3PCS A;  1IVU A;  3NV0 B;  4OK0 A;  2WOH A;  1OF5 B;  1ROV A;  5LC7 A;  3WR2 A;  1BRN L;  1STF I;  1BNI A;  3U1W A;  1RKY A;  1T2H A;  2ML5 A;  2INX A;  1ZX2 A;  3K9M C;  4KVH A;  3V92 A;  3CPW 2;  2CWT A;  1YIT 3;  3KFQ C;  3RDE A;  4KFD A;  1TRQ A;  1BSC A;  1BOX A;  2L4V A;  1YI2 3;  1GD3 A;  3HIG A;  1B27 A;  1GMQ A;  4O02 B;  3S27 A;  4EV5 A;  1F8N A;  2Z76 A;  5M19 A;  3IPT A;  1GS3 A;  1VQN 3;  3MHE A;  1V74 A;  3H51 A;  1UW1 A;  1GOY A;  2CFL A;  3DGN A;  3GAX A;  3VGN A;  3X41 A;  1JBR A;  2OQE A;  1OHP A;  1N5H A;  1UGI A;  1DMN A;  5JPP A;  2CHC A;  4I5Q A;  3DMC A;  2KCD A;  1W2B 2;  1C7H A;  2XSO B;  2V1L A;  1YIJ 3;  1X1Y A;  1N9J A;  3AGO A;  3S67 A;  4X2H A;  6GSP A;  2K0M A;  3KSE D;  3PS8 A;  3UB1 A;  4FCJ A;  3D5G A;  1EQK A;  4LZI A;  1IYY A;  2Q07 A;  4HVN A;  1RGC A;  3FG1 A;  3DY5 A;  3UJM A;  3DGO A;  1RMS A;  2CX0 A;  3NQZ A;  2K54 A;  4HYZ A;  4EV2 A;  4HM2 B;  3NUV A;  4AKZ A;  1EKM A;  2C10 A;  1Q81 4;  1YNV X;  5EVH A;  3SX1 A;  1I0X A;  1JZD A;  3EX9 A;  1IT8 A;  2P09 A;  3HX8 A;  2Y74 A;  1RGK A;  5AI1 A;  2BU4 A;  4HJL B;  1JN5 B;  3EBT A;  4KT3 B;  1FYS A;  3CME 3;  1I3I A;  1B3S A;  1DYU A;  1YJN 3;  1Z1S A;  2H0G A;  4Q53 A;  1T3B A;  1ISK A;  1GY6 A;  1LOV A;  1OHS A;  5HGR A;  2CG1 A;  4L7K A;  1QAL A;  1KD1 4;  5D83 A;  5DRV A;  1IDP A;  4LMI A;  4CDL A;  3FLJ A;  1UUV B;  5JPU A;  1A2V A;  5AYR B;  3X40 A;  4FR9 A;  3JUQ A;  2H0H A;  1MWR A;  1TIJ A;  1I0V A;  3E99 A;  3G0K A;  3MG3 A;  4MMZ B;  1JB5 A;  1IK3 A;  5EEO A;  1X1X A;  3QRD A;  3CC4 3;  5CF1 A;  2QIY A;  2IA7 A;  1M1X B;  3F8X A;  1BRK A;  3CD6 3;  1R4Y A;  3BNC A;  4HM0 B;  1B21 A;  1Q9E A;  5CK6 A;  3CXC 2;  4EW5 A;  4L8P A;  1UDI I;  4KZ1 A;  4HM8 B;  3PGB A;  1S5A A;  3WHO A;  2CW9 A;  2W03 A;  2BNG A;  1BSE A;  3FH1 A;  3ZG5 A;  3JUN A;  2CC3 A;  1ULI B;  3MG1 A;  4WFO A;  1EUI C;  2BT3 A;  2CG0 A;  1CQS A;  3VSY A;  2PNC A;  2B1X B;  3K63 A;  4WP5 A;  4J5K A;  2D1W A;  2JDI H;  8RNT A;  1Q86 4;  1FGT A;  4IPB A;  3X3Z A;  4GB5 A;  3LT8 A;  1HZ1 A;  2GEY A;  3BU4 A;  5AYS C;  2W6J H;  1RN4 A;  4I4K A;  3NV0 A;  1GSP A;  1OF5 A;  2F99 A;  2OOV A;  3V98 A;  3LZA A;  2RBI A;  1RGL A;  1BVI A;  2HMM B;  1JRQ A;  1BIR A;  1I2F A;  3HK4 A;  4NRE A;  1GMP A;  2OWP A;  2W2C A;  3ZFZ A;  1TP6 A;  1KC8 4;  1K8A 4;  3FKA A;  4O2H A;  3G4S 3;  7GSP A;  2FGT A;  2UUG C;  3UNL A;  4X2O A;  1RNB A;  4N6N B;  4EXR A;  3CCJ 3;  1O7W B;  1BRI A;  3D79 A;  4H61 A;  1UI7 A;  3GZB A;  1YGE A;  1FW7 A;  3BB9 A;  1STD A;  1HU9 A;  1UUG B;  2IYJ A;  4LGQ A;  2QA4 3;  1GOV A;  1N9E A;  1NDO B;  3N8B A;  4HM5 B;  5D82 A;  4LYL B;  4ZM8 A;  1W02 A;  3AHW A;  3DGL A;  4JF8 A;  1NB5 I;  5CLK A;  2XEP A;  3CPO A;  1UCK A;  2HMJ B;  2HOH A;  1FGR A;  3FG3 A;  1V57 A;  1VQ6 3;  1EEJ A;  1CEW I;  2YFI B;  1SJW A;  2F5M A;  1FUW A;  1ZGX A;  3DXO A;  5CF2 A;  1N8Q A;  1VQK 3;  1MOL A;  3S28 A;  2P05 A;  4K61 A;  1OH0 A;  1DMQ A;  3AHS A;  2FXT A;  4GHO A;  3Q2P A;  3G16 A;  1E3V A;  2D42 A;  3VF1 A;  4XDV A;  3FZW A;  5AEW B;  3GSP A;  3X3Y A;  1RN1 A;  1VQ9 3;  1JN5 A;  3EN8 A;  2GSP A;  1A2P A;  1I8V A;  4N6T A;  7STD A;  3B8L A;  1RCK A;  5G1K A;  2J8X B;  2IMJ A;  2L1S A;  3CU3 A;  3EN1 B;  3KKG A;  4NPB A;  2GBW B;  3Q1C A;  4RNZ A;  3CNX A;  3WMD A;  5RNT A;  1BSA A;  2CFW A;  1ZS7 A;  2BIR A;  2K3D A;  3ER7 A;  3HOH A;  3BNB A;  1M90 4;  1B2M A;  2XFT A;  3HI7 A;  4NHF A;  5M1A A;  1RGG A;  1TRP A;  4KFF A;  4K1V A;  1QVG 2;  4MMY B;  5IG3 A;  1NWW A;  1VQ5 3;  1LQG C;  3SVA A;  2KF5 A;  5BIR A;  2QEX 3;  1O7G B;  3CCQ 3;  1BNF A;  3CNM A;  1YVS A;  1BNR A;  4L8O A;  1RGE A;  3RGA A;  3FF2 A;  1JNQ A;  2W56 B;  1B2Z A;  3PYJ A;  1IQX A;  4N6M A;  3ECF A;  2O9U X;  3OWU A;  4FCZ A;  3LTC A;  1LRA A;  5IER A;  1OCV A;  5IG5 A;  5IG0 A;  2KF4 A;  3NX0 A;  3EB8 A;  4LSO A;  2ML6 A;  2OTL 3;  1JKG B;  4HM3 B;  2ZDJ A;  1FGQ A;  2HMN B;  1IVV A;  1BNS A;  5BXQ A;  4HOH A;  1AQZ A;  1MWT A;  2P0M A;  3AMO A;  3JUP A;  1BU4 A;  3PZW A;  1EG9 B;  4CCV A;  5HOH A;  3CCS 3;  1BUQ A;  1OPY A;  4R1K A;  2XH9 A;  3V99 A;  1EA2 A;  4QWT A;  1NB3 I;  5I97 A;  5AII A;  4LEH A;  1MGR A;  1KQS 2;  1T5Y A;  2XR8 B;  4WWU C;  4BIR A;  1TTO A;  2W9Q A;  3HII A;  1W4N A;  1M9G A;  3SYU A;  1W01 A;  1IVX A;  3LTB A;  1LQM B;  4GSP A;  1NO3 A;  2WOF A;  1GY5 A;  1YVB I;  2XGN A;  2KF6 A;  3M8C A;  2W9P A;  4HBR A;  3G71 3;  2O3O A;  2IUK A;  4J8T A;  5IG4 A;  1YHQ 3;  2YX9 A;  8CHO A;  4G1M B;  4J9A A;  3PXM A;  3OX9 A;  5IF6 A;  1AV4 A;  2W0Q A;  1Q82 4;  3LYG A;  4R80 A;  1RN7 A;  4K1U A;  2HMK B;  4RNT A;  1K73 4;  3NBJ A;  3OW2 2;  1UGH I;  3EHC A;  3WDG B;  1GOU A;  4R9L A;  1FZU A;  1LOX A;  2CK3 H;  3IMA B;  3CCL 3;  2FNQ A;  5A0O B;  6STD A;  2M7O A;  1W6G A;  4KFE A;  4ORL A;  3A76 A;  3RGR A;  1KWI A;  1IV9 A;  2LQV A;  3GWR A;  4GL6 A;  4EYC A;  5JBS A;  2E2T A;  1VQL 3;  2GU1 A;  1IU7 A;  2PZV A;  1Q7H A;  2BMR B;  3KN4 A;  3OXA A;  4BL3 A;  1BUJ A;  2IY2 A;  1AVL A;  1CH0 A;  2KAA A;  1LVN A;  3F8H A;  4N6L A;  3ROB A;  1UCI A;  1RRL A;  3LT9 A;  3I56 3;  3KSP A;  2W04 A;  1G0T A;  1K41 A;  3SOY A;  1K9M 4;  1BSD A;  4ILF A;  1UUW B;  3DGM A;  4WHA A;  1FUT A;  3Q3F A;  3MYT A;  4HM4 B;  4U13 A;  5AIF A;  2CX1 A;  1QAK A;  2I9W A;  3NM7 A;  1YGW A;  2F86 B;  3F40 A;  3F7X A;  4IT7 A;  2E2V A;  2Y73 A;  3NHX A;  1A67 A;  5FW5 A;  1JBT A;  2R41 A;  2SAR A;  3CCU 3;  1B2X A;  3I55 3;  1LOW A;  1CYU A;  1RDS A;  4RBN A;  4XB5 A;  1FA3 A;  1NNV A;  4J5G A;  1RGF A;  3EBY A;  1BRG A;  3H3H A;  1QVF 2;  3LTD A;  3LTA A;  4TX4 A;  1TFK A;  2MC8 A;  1O7M B;  2ZHX B;  3CC2 3;  5ELJ A;  5EQL A;  2RCD A;  2Z6B A;  3F9S A;  3FSD A;  1SQW A;  2CKF B;  3EE1 A;  1MWU A;  3LH4 A;  5STD A;  2WGO A;  3UL5 A;  5CXO A;  5IEN A;  1SII A;  2A15 A;  3F14 A;  3GZY B;  2F98 A;  3MPH A;  1YJW 3;  1Q7Y 4;  1US1 A;  1M1K 4;  1IQ8 A;  1GYB A;  3NQY A;  4N6V 0;  1ZO2 A;  1ULJ B;  3AGN A;  2CWV A;  5KP1 A;  1DET A;  2C4B A;  2CIU A;  1O7N B;  1JKG A;  2BO9 B;  2ZL8 A;  3OV4 A;  1WMO A;  1W5Z A;  1X1U A;  1FGM A;  3B4P A;  3K7C A;  2XFS A;  3HZP A;  2AAE A;  4DKI A;  1WQL B;  1K28 A;  3FGY A;  1A90 A;  1AY7 A; 
#chains in the Genus database with same CATH homology
 4IIA A;  1JJ2 2;  1NU3 A;  2SBL A;  3X3X A;  1U5O A;  2E2U A;  3G8Z A;  2XF3 A;  3SED A;  5IW9 A;  1ASK A;  1OGX A;  1AR0 A;  3D9R A;  3G6E 3;  3EQQ B;  3NXJ A;  4FMD A;  3J7Y d;  1FGO A;  4MMX B;  4RNY A;  1TFO A;  1E3R A;  3WA2 X;  3L0R A;  1E97 A;  1IV7 A;  1IVW A;  2MF7 A;  1LXE A;  4H3U A;  3LOY A;  2Z7A A;  5LC6 A;  3OWY A;  3WA3 A;  4FMC A;  1RRH A;  1WTH A;  2CFG A;  2YFL B;  4XBX A;  1QJG A;  1SPU A;  3FG4 A;  3UL6 A;  5KP4 A;  4WYK B;  4AEQ A;  2CFK A;  2B24 B;  5ELU A;  3WOF B;  1PFP A;  1QAF A;  2OQE C;  2Z77 A;  1W7C A;  4N6U A;  2RGQ A;  3PCR A;  4BTY A;  2RFR A;  3FF0 A;  1G96 A;  3Q90 A;  3ALA A;  3BND A;  4O3V A;  2GBX B;  4XBY A;  1U8C B;  2IUJ A;  1O7H B;  4MEI A;  3F7S A;  2HML B;  3DUK A;  1Q40 B;  5DRE A;  3N9H A;  4FMA A;  2WO0 A;  1CYV A;  5IEO A;  3BNE A;  5AIG A;  3NM2 A;  3KZT A;  1UI8 A;  3FCS B;  3BLZ A;  3EF8 A;  3DM8 A;  1GY7 A;  3CC7 3;  4HZ9 B;  1VQP 3;  1DMM A;  4EC6 A;  4PEJ A;  2OCT A;  1OAC A;  1VZZ A;  4XM4 A;  4HZB B;  1WMN A;  3T8N A;  3K5T A;  4BTW A;  1VQ4 3;  3STD A;  3B7C A;  3MWZ A;  1WMP A;  3X42 A;  3GZR A;  1LNH A;  2XRX B;  1QMA A;  3WOD G;  1A2K A;  5FGO A;  3KII A;  1Q42 A;  2WGQ A;  2RSX A;  3SLU A;  4R9K A;  1N8R 4;  2YFJ B;  3CCV 3;  3MG2 A;  5AIH A;  2GXF A;  2STD A;  4BTX A;  3N54 B;  1TUH A;  2OTJ 3;  1PU4 A;  2GEX A;  2P38 A;  3OWS A;  3LXU X;  1OHO A;  3SOA A;  3CCR 3;  2XGL A;  2BHM A;  1W6Y A;  3WOE B;  3NBB A;  1R4C A;  2CH9 A;  3T8U A;  3JUO A;  2LYX A;  1W2Z A;  3S29 A;  4OUQ A;  4FMB A;  4HKV B;  4K90 B;  1MNL A;  2P0X A;  1KSI A;  1D6Y A;  3IJE B;  4JRF A;  3S5C A;  3EC9 A;  3SXX A;  1YJ9 3;  1IT7 A;  3JVC A;  3JUM A;  1NJI 4;  5G2G A;  1W6C A;  4EBG A;  5AEU B;  3TDG A;  4HM1 B;  1J2B A;  3MKI A;  3T0U A;  3AMO B;  5D81 A;  1D6Z A;  2R4I A;  1GD4 A;  2OOV C;  5KP3 A;  4MJD A;  3LML A;  2BMQ B;  4FCM A;  1VQ7 3;  3DZL A;  3B4O A;  2KRT A;  1OGZ A;  2KXG A;  3O8Y A;  4N6O B;  3U97 A;  3CCM 3;  1S72 3;  2JQ5 A;  4R4K A;  3NBR A;  1OUN A;  1D6U A;  1AVK A;  1JB4 A;  2W56 A;  3QK9 A;  4HM6 B;  4WYK A;  4O8S A;  4XBT A;  2QGU A;  1IQY A;  2C11 A;  3GZX B;  1ROA A;  2GU3 A;  1L5G B;  4OVM A;  5BVB A;  1N5P A;  5TGN A;  1VQ8 3;  2HMO B;  2CFD A;  1Y4K A;  4XDW A;  1WNH A;  2XSH B;  1VQO 3;  1SIH A;  1DVC A;  1JV2 B;  2UX0 A;  3KE7 A;  4N3V A;  4AKY A;  4STD A;  1DVD A;  2BMO B;  3EJV A;  1JB2 A;  1W00 A;  2CWU A;  3GRD A;  5IEP A;  3D3L A;  4HM7 B;  1HKX A;  1Q40 A;  3CMA 3;  1VQM 3;  3CCE 3;  1TU5 A;  3K0Z A;  3MSO A;  4RZM A;  1O7P B;  3I0Y A;  1RJO A;  3PCS A;  1IVU A;  3NV0 B;  4OK0 A;  2WOH A;  1OF5 B;  1ROV A;  5LC7 A;  1STF I;  3U1W A;  1RKY A;  2ML5 A;  2INX A;  1ZX2 A;  3K9M C;  4KVH A;  3V92 A;  3CPW 2;  2CWT A;  1YIT 3;  3KFQ C;  3RDE A;  4KFD A;  2L4V A;  1YI2 3;  1GD3 A;  3HIG A;  3S27 A;  4O02 B;  4EV5 A;  1F8N A;  2Z76 A;  3IPT A;  1GS3 A;  1VQN 3;  3MHE A;  1V74 A;  3H51 A;  1UW1 A;  2CFL A;  3DGN A;  3GAX A;  3VGN A;  3X41 A;  2OQE A;  1OHP A;  1N5H A;  1DMN A;  5JPP A;  2CHC A;  3DMC A;  2KCD A;  1W2B 2;  1C7H A;  2XSO B;  2V1L A;  1YIJ 3;  1N9J A;  3S67 A;  4X2H A;  2K0M A;  3KSE D;  3PS8 A;  3UB1 A;  4FCJ A;  1EQK A;  4LZI A;  2Q07 A;  4HVN A;  3FG1 A;  3DY5 A;  3UJM A;  3DGO A;  3NQZ A;  4HYZ A;  2K54 A;  4EV2 A;  4HM2 B;  3NUV A;  4AKZ A;  1EKM A;  2C10 A;  1Q81 4;  5EVH A;  3SX1 A;  3EX9 A;  1IT8 A;  2P09 A;  3HX8 A;  2Y74 A;  5AI1 A;  4HJL B;  1JN5 B;  3EBT A;  3CME 3;  1DYU A;  1YJN 3;  1Z1S A;  4Q53 A;  1ISK A;  1GY6 A;  1OHS A;  5HGR A;  2CG1 A;  4L7K A;  1QAL A;  1KD1 4;  5D83 A;  5DRV A;  1IDP A;  4LMI A;  4CDL A;  3FLJ A;  1UUV B;  5JPU A;  1A2V A;  5AYR B;  3X40 A;  4FR9 A;  3JUQ A;  1TIJ A;  3E99 A;  3G0K A;  3MG3 A;  4MMZ B;  1JB5 A;  1IK3 A;  5EEO A;  3QRD A;  3CC4 3;  5CF1 A;  2QIY A;  2IA7 A;  1M1X B;  3F8X A;  3CD6 3;  3BNC A;  4HM0 B;  5CK6 A;  3CXC 2;  4L8P A;  4KZ1 A;  4HM8 B;  3PGB A;  1S5A A;  2CW9 A;  2W03 A;  2BNG A;  3FH1 A;  3JUN A;  2CC3 A;  1ULI B;  3MG1 A;  4WFO A;  2BT3 A;  2CG0 A;  1CQS A;  3VSY A;  2PNC A;  2B1X B;  3K63 A;  4WP5 A;  2D1W A;  2JDI H;  1Q86 4;  1FGT A;  4IPB A;  3X3Z A;  4GB5 A;  3LT8 A;  2GEY A;  5AYS C;  2W6J H;  4I4K A;  3NV0 A;  1OF5 A;  2F99 A;  2OOV A;  3V98 A;  3LZA A;  2HMM B;  1JRQ A;  3HK4 A;  4NRE A;  2OWP A;  2W2C A;  1TP6 A;  1KC8 4;  1K8A 4;  3FKA A;  4O2H A;  3G4S 3;  2FGT A;  3UNL A;  4X2O A;  4N6N B;  4EXR A;  3CCJ 3;  1O7W B;  4H61 A;  1UI7 A;  3GZB A;  1YGE A;  3BB9 A;  1STD A;  1HU9 A;  4LGQ A;  2QA4 3;  1N9E A;  1NDO B;  3N8B A;  4HM5 B;  5D82 A;  4ZM8 A;  1W02 A;  3DGL A;  4JF8 A;  1NB5 I;  5CLK A;  2XEP A;  3CPO A;  2HMJ B;  1FGR A;  3FG3 A;  1VQ6 3;  1CEW I;  2YFI B;  1SJW A;  1FUW A;  3DXO A;  5CF2 A;  1N8Q A;  1VQK 3;  1MOL A;  3S28 A;  2P05 A;  4K61 A;  1OH0 A;  1DMQ A;  2FXT A;  3Q2P A;  3G16 A;  1E3V A;  2D42 A;  3VF1 A;  4XDV A;  3FZW A;  5AEW B;  3X3Y A;  1VQ9 3;  1JN5 A;  3EN8 A;  4N6T A;  7STD A;  3B8L A;  2IMJ A;  3CU3 A;  3EN1 B;  3KKG A;  2GBW B;  3Q1C A;  4RNZ A;  3CNX A;  3WMD A;  2CFW A;  3ER7 A;  3BNB A;  1M90 4;  2XFT A;  3HI7 A;  4NHF A;  4KFF A;  4K1V A;  1QVG 2;  4MMY B;  5IG3 A;  1NWW A;  1VQ5 3;  3SVA A;  3CCQ 3;  2QEX 3;  1O7G B;  3CNM A;  4L8O A;  3RGA A;  3FF2 A;  1JNQ A;  2W56 B;  3PYJ A;  1IQX A;  4N6M A;  3ECF A;  2O9U X;  3OWU A;  4FCZ A;  3LTC A;  5IER A;  1OCV A;  5IG5 A;  5IG0 A;  3NX0 A;  4LSO A;  3EB8 A;  2OTL 3;  2ML6 A;  1JKG B;  4HM3 B;  2ZDJ A;  1FGQ A;  2HMN B;  1IVV A;  5BXQ A;  2P0M A;  3AMO A;  3JUP A;  4CCV A;  3PZW A;  1EG9 B;  3CCS 3;  1BUQ A;  1OPY A;  4R1K A;  2XH9 A;  3V99 A;  1EA2 A;  4QWT A;  1NB3 I;  5I97 A;  5AII A;  4LEH A;  1KQS 2;  1T5Y A;  2XR8 B;  4WWU C;  2W9Q A;  3HII A;  1W4N A;  1M9G A;  1W01 A;  1IVX A;  3LTB A;  1NO3 A;  2WOF A;  2XGN A;  1GY5 A;  1YVB I;  3M8C A;  2W9P A;  4HBR A;  3G71 3;  2O3O A;  2IUK A;  4J8T A;  5IG4 A;  1YHQ 3;  2YX9 A;  8CHO A;  4G1M B;  4J9A A;  3PXM A;  3OX9 A;  5IF6 A;  1AV4 A;  2W0Q A;  1Q82 4;  3LYG A;  4R80 A;  1RN7 A;  4K1U A;  2HMK B;  1K73 4;  3NBJ A;  3OW2 2;  3EHC A;  3WDG B;  4R9L A;  1LOX A;  2CK3 H;  3IMA B;  3CCL 3;  2FNQ A;  5A0O B;  6STD A;  2M7O A;  1W6G A;  4KFE A;  4ORL A;  3A76 A;  3RGR A;  1KWI A;  1IV9 A;  2LQV A;  3GWR A;  4GL6 A;  4EYC A;  5JBS A;  2E2T A;  1VQL 3;  2GU1 A;  1IU7 A;  2PZV A;  3OXA A;  2BMR B;  3KN4 A;  1AVL A;  1LVN A;  3F8H A;  4N6L A;  3ROB A;  3I56 3;  1RRL A;  3LT9 A;  3KSP A;  2W04 A;  1K41 A;  3SOY A;  1K9M 4;  1UUW B;  3DGM A;  4WHA A;  3MYT A;  4HM4 B;  4U13 A;  5AIF A;  1QAK A;  2I9W A;  3NM7 A;  2F86 B;  3F40 A;  3F7X A;  4IT7 A;  2E2V A;  2Y73 A;  3NHX A;  1A67 A;  5FW5 A;  3CCU 3;  3I55 3;  1CYU A;  4RBN A;  4XB5 A;  1FA3 A;  3EBY A;  3H3H A;  1QVF 2;  3LTD A;  3LTA A;  4TX4 A;  1TFK A;  2MC8 A;  1O7M B;  3CC2 3;  5ELJ A;  5EQL A;  2RCD A;  2Z6B A;  3F9S A;  3FSD A;  1SQW A;  2CKF B;  3EE1 A;  3LH4 A;  5STD A;  3UL5 A;  2WGO A;  5CXO A;  5IEN A;  1SII A;  2A15 A;  3F14 A;  3GZY B;  2F98 A;  3MPH A;  1YJW 3;  1Q7Y 4;  1US1 A;  1M1K 4;  1IQ8 A;  1GYB A;  3NQY A;  4N6V 0;  1ZO2 A;  1ULJ B;  2CWV A;  5KP1 A;  2CIU A;  1O7N B;  1JKG A;  2BO9 B;  2ZL8 A;  3OV4 A;  1WMO A;  1W5Z A;  3K7C A;  1FGM A;  3B4P A;  2XFS A;  3HZP A;  1WQL B;  1K28 A;  3FGY A;  1A90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...