3EJYC

Structure of e203h mutant of e.coli cl-/h+ antiporter, clc-ec1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
221
structure length
221
Chain Sequence
b'VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Intracellular proton-transfer mutants in a CLC Cl-/H+ exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system/proton transport
total genus 34
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejyC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejyC01
1KPUB 1A8JH 4PJAF 1TVDA 5I1HL 5IHBA 5HGGS 1P84K 3O0RL 1UVQB 4P4KA 2FEDD 5KAQG 1KPVB 3MLWH 1MOEA 2NNAA 4XMLH 4G3YH 3TIEA 4MA1B 1W72A 1QQDA 2VTFA 2PXYA 3QUZA 1EO5A 5KG9B 4LCUA 2Q8BL 4YHIA 1T7ZA 3QH3A 2W65B 5D1XD 1JF1B 5BRZA 1JZ5A 3LKSA 5KSUB 5IVXF 4ELKA 4NWTH 1KSRA 3FT4A 1IKFH 2C7UA 4MCYB 3RVWC 4GKSA 4HKBB 4XBEH 2EXYD 4OUOA 4K3JH 4K8RC 4NSKA 2DQEL 3DI3B 4IOFC 2OTWB 5ID0A 3BP7B 1DDHA 3RU8H 1NGXA 2DQTL 4E0RB 1HWGB 2CKBB 3M8OH 4PBVC 4ZDHB 1R3HA 1FFQA 1H3TA 1KIQB 4PTTB 5F9DC 1OCWL 3MRQA 4QRRE 3FCTB 3HPJA 4XCFL 2C4FT 1KCKA 2QADD 1CL7H 1T1ZB 3P9WB 4M5YL 4K9EC 4NN7B 4OV6F 3WSQH 1ED3B 4WIQA 1KNOA 1T4KB 1R3LB 2FJHB 2P5WA 5ILTL 1I4FA 3B5HA 5B22A 4JRYA 4PRPE 1R24B 2OK0L 5CBEB 4PJ8D 5BZWB 2CXGA 2V2TB 1RZ7H 3ET9F 1D3CA 4IRSB 3HMXA 5L0QC 5C0CA 5FO7A 3ZKNC 4OLUH 2UY7A 1AP2B 5GSVB 2DD8H 3I50L 3EFDL 1EXUA 5JDJA 4Z7WB 5A43C 3OAUL 3QUXB 3TGXA 5IB1B 3GHBH 4DZ8A 4YHKH 4MA8H 2WBJB 1DANU 2E5EA 4ZUVA 5E8EA 3VGAC 5E70A 4GW4A 1X5FA 1K4CB 4X4XB 1OAZH 1FFPB 3FFCD 1WBZB 4KROD 4JFQA 2I60H 3FMGH 3DO7B 4M6OH 5D7SL 1NFDA 1T2QL 3MRCB 4L5FH 2YR3A 4OI8A 3BGMA 3IAGC 3PGCB 5HI4D 1DUYB 4WENB 1H15A 1DEEA 1JHTB 5C08D 4FQXA 3SE3A 4TVPL 3RZCA 1G0XA 3LS5H 2EDEA 4HW6A 3H3PH 1KELL 1WWAX 3L95A 3OJDA 3ZT6A 5D1QB 4HT1H 4W70A 1T66D 4G6FD 3EJYC 5FM4A 4I0PA 1CK0H 4Z7QF 5GS1B 1BQHG 1N64H 1B9ZA 1JNLH 2EZ0C 4QGYA 2OM5A 5F7DB 3TO4A 5J6HB 5ELIA 2IG2L 1QYGH 3JSSA 5DQJB 3TA3D 4HH8A 4HX1A 5ESQA 3NPZB 4TSBL 5TGBB 3UEZA 3Q1SL 3RY6A 4QRUB 5KVGL 1HHIB 4ZUUB 1LO3L 5HHXH 1PZ5B 5B4MC 2QR0B 3TCLB 4IJ3B 3S4SA 1KENL 5EOCJ 3MNVB 2F54B 4NQTA 2XACC 2R69H 5BQ7A 1PD6A 1F6AA 3C8KB 4LL9A 1CGTA 3NPSB 5FUCC 4Q6IB 5CD5D 3GSQB 1S8DB 2F5AL 3VDBA 3ZLQC 1WCQA 5IB5A 5C0AB 2ZCLH 4XHJC 5F9OH 1CCZA 3MFFB 1SM3H 4KRPB 1P6FA 3ZDZE 3QUYB 2BCKB 2ZUQB 1CD9B 3Q48A 3SQBA 5HYEA 5DF0A 5HYFA 1TJIH 4AIZB 3CH1A 3CX5J 4N8VA 4ISVB 3BEVB 1MWAL 1DL7H 3MUGB 4HKXA 1EUUA 4HZLA 4LSUL 2PO6C 2HKFH 1A21A 2MCPH 3H0TB 3FQXB 2ZJSH 1OF2A 3K4AA 4XPBL 2F53E 3LKNA 2HFEB 2Z9TA 2JIXA 3D18A 1SMAA 2IMNA 3K8KA 4J6RL 2AJ3B 4PJDB 1UA6H 1OM3H 3VGHA 2J6EL 1JZ4A 4QCIB 2IALA 5ICZB 2A0LC 1NGWB 2VISA 3ESUF 1X5LA 4I2XE 2VDLL 1B0GB 4MXVF 1KF9B 2YHGA 3SKMA 1ADQH 4MNQD 5K59E 3WN5C 1KJ2A 5BJTA 4RNRA 1GZPB 2FB4H 1U6AL 4NGHL 2UWEA 3VGBA 5JUEH 3V7AE 1TQBC 4GBXC 2ORBH 4R8WH 2E27H 3O9WB 3RWDA 4HJJL 4WEBL 5MI0C 1RIUH 1QP1A 1F6FB 3IFLL 1JZ8A 5DJZA 4PY8J 5IVNA 3HZVB 2ZCKH 4TUOA 1HZHL 1ZVYA 2YSSA 1CLOH 3KXFD 5C2BL 1C08A 5F7LB 1R5WB 4KKCC 1XMWA 4AIOA 2IQ9H 3QDMD 5JXAL 4XXDB 4QXTA 2V2XB 5GGVH 1DUZA 3CCHB 4LQFH 4BFIA 4GRWE 2J5LB 1UYWL 4YHYB 4JGUA 3RVWD 3SDCA 1GIGL 4DFIA 1FRGL 4F58L 4D0BA 3ARDB 2DLHA 5HGDB 3VWJC 3LDBC 4MHHG 3T8XA 3M1BB 3MJ9L 5ISZB 3S37X 2VITB 4IRJB 1A9EB 3PWJA 3CFCL 4UV4L 5E6ZA 3G5VB 2DM4A 5I73C 3PQYB 1NDGA 1SY6L 1B2WH 3OAYH 2PTTA 4NQVB 4JCLA 4EUPA 5T5FH 2X4OB 3J8F7 4DKEL 5JQ6L 3N1MC 1WWWX 1FNEA 2EDLA 3OPZH 4IS6B 4QTIL 2VE6B 1KYOK 4D0DB 5J6GB 1FYTA 5FKAB 4ZXBD 3THMH 2ICEA 3QG7H 1YPZF 3ARFA 2IH1B 3WE6A 3LVEA 2BSSB 4GAYB 1PLGL 2AJZB 4ZUWA 4L8BA 4QHNA 1X7QA 1TCRA 4U0QB 3ZKND 4GH7B 4PUBH 5D1XB 5L9DL 2VWEE 3FO9A 2NX5A 5HJ3A 4RFNB 1UM6L 3CXDL 1N3NB 3MGAA 5I1KL 2AEQL 4LU5L 3CMOL 3IT8D 3MA9H 1VEMA 3ZE0E 4MHHI 2KQNA 2QKIB 4P2OC 2QL1A 3UTTA 3VFVA 4R3SB 3CC5B 1OL0A 1QSEA 5EU3A 1QBLL 4M48L 1RFDL 3V0WH 3Q0HA 5F8QC 2DKUA 1YEIL 3NA4A 4HPOH 4U2YA 1G0DA 3T4YA 3WUWA 3TBWB 2C1PB 3KDMB 5HGBB 3OF6D 2IAND 3F7QA 4XVJL 2DICA 4I1NB 5T3ZL 2COQA 1WZMA 2H8PA 3K2UL 3QP3A 2QBWA 12E8L 4OUUB 4KKAC 3L3IA 2AQ2A 4QRQB 3EJYD 4U1JA 1BX2A 5D7IE 2OP4L 1LP9E 5C9KA 5MP6H 3FL7A 3UJTL 3KPPB 1IC4H 1UWGL 2CDEA 1JPTH 1RZJC 1S7QA 4PJGA 3UJIH 3FT3A 1NUFA 5ESAB 4H88L 3NAAH 5FF6B 3V9FA 4GQ9H 2ZUXA 3GBMH 5DMKB 1EGJH 1W72H 5GJSH 4YAQA 5A2FA 4W4NA 4UU9B 1OP3K 3CMGA 1GGCL 4ZUTB 1JBJA 1I7ZA 5IQ7L 3L5WA 3FFCB 3UBXA 1LO2H 5CMAB 3P0VL 1OQOA 1X5KA 3PHOB 2XKSA 2UUDK 2XOTA 3GSNB 3VXSA 1X5HA 2HVJB 3DROB 5F6IB 5L7XL 4G80A 1QBBA 5C08B 2YPVH 1A1NA 2PETA 4JB9L 5LAXA 5MEOB 4JJHA 5MERA 2DDQL 4PGEA 3D39A 4KMTL 4JPVH 1G7MA 3NIDE 4R97B 3OG6B 1E4WH 4ZNEA 1HH6A 3VW3L 3P30L 2EE3A 4AEHH 5KZCB 2PO6D 5GRJL 1F3RB 4JFFD 2C1OB 4L4TA 2P5ED 1RURL 5JW4M 5TQ0H 1RUAH 1UKTA 1YY8B 3FTGB 4EBQL 3KYOB 3MRKA 1DANT 5D2NE 2NY6D 5CEZD 4XAKE 3TA3B 3U6RA 3M45A 4K3GA 4ZS6C 4DZBB 5DUMH 4F33A 2FBOJ 3HNVH 5DZOA 4L29A 3HMXH 5CUSL 5E24E 4D0CA 4BJLA 3M07A 4JZOA 4APQC 4H25A 3MLRL 3OKNB 4Z7NE 5IEKA 4EXKA 2RCSL 4KHTL 5H94B 5TPWL 1A2YA 3EFFA 1NCTA 1HKFA 4GBXD 1SYSA 5HYJD 2BNUA 2J4WH 4FQQA 3U7YH 2C3VB 7CGTA 4FRWA 3BAEL 2A9NH 4HWBL 4O58H 5TE6L 1G1YA 3KPRA 3WYRA 1CU4H 1IARB 3D0LB 5T3XD 1KJMA 1TNMA 3EOAA 1KN4H 4JREB 5HY9A 2VC2H 4MS8D 1F6LL 3UROR 2YUVA 2BOBB 3F7PC 4LSTH 4ALAH 4LVNC 4CADA 3PWPB 5H35A 1F3DH 5SX4H 3VDCA 2H6PA 4TULL 5D5ME 1U8HA 5GSRB 1BD2D 4BZ1L 2KZ1B 3W82A 5IB2B 4IIQA 4GRLC 1WSST 2HYMA 3BI9X 4WRLA 1U3YA 4BYHA 1RPQA 1A7NL 1RK1A 2NQCA 4PJCE 5DD6B 3TH4T 2ATPA 5E7FA 2YPKA 5I17A 1CGSH 4MNGE 5EA0L 2ED9A 1TXKA 1QLRA 2AERT 1OOAA 4NUJA 3QJFB 4X6CA 1KPUA 4ODUB 1HNGA 4OZFG 1T03H 3EYOB 3MV8A 1UVQA 1KPVA 1R3JB 1I8LC 2N4IA 5CKGA 4WW1A 1YEFH 1K3ZA 2HJLB 4KJQD 2ERJC 5TF1H 5KG9A 1CWVA 3GI8H 2AV1A 3KXFB 1XGTA 3MLZL 4E41E 3DSNA 1OAYL 1QD0A 1AGBB 2X1PA 3LEYL 2W65A 4GO6B 5KSUA 3N06B 2CIKB 2XRAH 5EC2A 4E42B 2ADFH 5IB4B 2KL6A 4MCYA 1OW0C 4HKBA 4NOBA 1XIWA 3VFOB 5H37H 2ZZUT 1MFNA 4PGZA 5J3HC 5C0RH 1R5IB 3QDJE 2OTWA 3BP7A 4NZUL 2V9QA 4XPGL 1ZVSB 5GZOD 4E0RA 4AY0A 2CKBA 4FXKA 1EEQA 4ZDHA 4PTTA 3TN0C 3GHEH 2A9ML 1T6WA 1PEZA 3T2QA 1T1ZA 5HI3D 5IGXL 1ED3A 5IV2B 1FHGA 4NO3A 2VZOA 4OBSA 4PLJC 5EZOH 3DBXA 3DYMA 1CS6A 4RZCB 3U4EA 4CAGA 3VG0H 1UC6A 1R24A 5BVPH 5BZWA 2PF6A 4QOKD 5LG1A 3QA3B 4WNQA 2V2TA 1FG2A 4X6DB 4IRSA 3EZ8A 3NMEA 3QEQE 3BPNC 4N0UE 1QO3B 4NCC2 1YA5A 3PABA 5L0QB 1ZLSL 3KPSA 1HQRA 1RU9H 2CRZA 1MFAH 5GSVA 4Z5RA 2VN4A 1EAPA 1AQDB 3OGOE 4MA7L 1I1AC 1SBSL 4Z7WA 4WY7L 5FGBC 4R0LC 3QUXA 5FYLH 2BDNH 5IB1A 2YMXH 4GG8B 1MY7A 5F96H 1AR1C 3ULVH 2WBJA 3TPKA 4Z77B 2J6EA 3VGAB 4YBLB 1K4CA 2J8UE 2R9HD 4FG6C 2AEPL 3H2WA 1P4IH 4QXWA 2E7LA 5F7MC 1WBZA 5FUZL 3ARED 1MNUH 5A2JH 4PJ5A 1T83A 4O4YL 4OD1L 1T7XA 1DUYA 4LPWA 2VZTA 5C07E 3V4UH 3CPLB 3WFDL 1URLA 1T3FA 5FCUH 1BLNA 5CJBA 2HVKB 2KKQA 3VXRA 4KI5F 1NFDF 2JK5A 2VDOH 1R5VB 1JNHB 2AJVL 2NW2B 2QQNH 3DIFB 1NCDH 2O5XL 1ZHBB 5E1AB 4U2ZA 3QR2A 4XRCB 1Q0XL 1U3HC 4B50A 2HFGH 3QCTL 5GS1A 5JOPE 3ZT7A 5F7DA 4KY1H 4K94H 5J6HA 4EUPH 1IC5H 4F57L 1KCVH 4G6JL 2YEZA 5F93C 5EPMB 1BJ8A 1FO0B 4KFZC 5EUOB 2E3VA 2V7NB 1CE6A 1YJDH 4M5ZH 4Y8DC 1HHIA 2DOCA 4ZUUA 1PZ5A 3GSRB 3BMWA 4FNLL 3EGSB 4K7PH 5BMFL 5BVJB 5C0EA 3FQRB 4GG6B 3TCLA 2VH5L 1EA9C 1BMGA 1FG9C 2F54A 3CVHB 1UM4L 4W4OA 3AC0A 3R1GL 2AJYH 3C8KA 3RGVD 2EC9T 4FFWC 1SY6A 4R7NB 1Q9KB 1LE5B 4EDWL 3GSQA 3T2NL 1S8DA 2P8MB 4L3ED 3IFPB 3T3PF 5C0AA 4OAWB 4AQ1B 4PRDB 5FIEA 4R4FH 1ZEAH 1XGQB 1WK0A 1JF6A 3CJJA 3SJVA 3BHBB 4MAUL 5T1DL 1A3LL 3G08B 2CR6A 4M1CD 5EU4B 4ISVA 3FAXA 3VXNA 1FIEA 5EO0B 3S37L 5C3LD 2PO6B 3H0TA 3V6OA 3FQXA 3EYQC 3LV3B 4OF7A 2M26A 5IWLC 1NC2D 3GIVA 3K1DA 2FX8H 3N85H 4GQPH 4H20L 2R0ZL 4XH2B 4PJDA 3IDXH 1UG9A 4WFGD 2BZDA 4MJ5B 2Y9RT 5FYJE 2KQMA 1D6EB 1J1PL 1MCLA 5ICZA 1FP5A 1NGWA 3E8UH 3BT2L 1B0GA 1HHGB 1O0VA 4E5XA 5FOJA 1ZT4A 3ROOB 1SMOA 1TQCC 1FL3B 1QTYT 1VPOH 3SE9L 3MMEB 2K1MA 3D3VE 4WUUE 4GBXB 1GVIA 2AABH 2NY5C 4XAWH 4RAVA 3IKCB 2RBLA 5FV1L 5HYJB 3KLDA 2GT9B 1WISA 1P2CA 5JHLH 4QHMA 4Y4FA 5AYUL 3V2AR 4KTDL 1KXTB 2QHLA 2UWEF 1A3RL 4XXCC 1HXYA 1YQ2A 1R5WA 4ZTOH 1ZS8B 1U8MB 2VKWA 2I9TB 4XXDA 3CFKB 2V2XA 4D8PB 1KGCD 3CCHA 5I1HH 1LK3H 5D6CB 4DFHA 1INDL 3O0RH 2GAZB 5DYOA 3ULVF 1ZLVK 3ARDA 1BD2B 1X44A 3MTRA 1CFTB 1IE5A 3VXUE 3VWJB 3LDBB 3M1BA 5ISZA 3C09C 3HE7D 3WNMA 2OTPA 2JF1A 3HNSL 4IRJA 3STZB 2P49B 3G5VA 3TN0D 1CD0A 3BRDA 5D7LB 3PQYA 5I73B 1AGEB 4U1KB 4OFDA 2AK4E 1IGIL 5FFLA 5AD0B 2X4OA 4S1QL 2ZUVA 4PREA 4U1GC 3A67H 4IS6A 2VLJD 1D5MB 4CN4A 1AR2A 2VE6A 4L8SC 2DQTH 4D0DA 5J6GA 5FKAA 4LIQL 1FZJB 5I2IA 1CGWA 5I66B 3FKUS 2XQBL 1OCWH 1MCWW 1W0YT 5TDNB 2CD0A 4XCFH 3ULUD 2BSSA 3I6LD 2AJZA 4M5YH 1X6NA 5D7JD 4M6NH 5D1XA 2NY4D 1S7WB 2NY7L 5ILTH 3FO0L 3LPFA 4HIIB 5AYQA 2OK0H 5IKCB 2BXZA 3HN3A 4EN3C 4G8FB 1M71A 5I8EB 3F7VB 2QKIA 4HBCH 4OCNC 4YUEL 2WBKA 3PL6C 3CC5A 2GY5A 5D2LB 4JGJA 1N7ML 1NSNL 3I50H 3EFDH 4Z7OE 3OAUH 1AGDB 1YEKL 1FZMB 2X6MA 4KKLC 4X80H 3ZTJH 1JGEB 1WJ3A 4PGDA 3WS3B 1KC5L 2C1PA 3KDMA 5F72S 3BPCA 2OL3L 3U7AA 4M9OA 1JVKA 2XZAL 4PJ8A 4OUUA 5D7SH 4QOKB 1T2QH 4I0KA 2VQ1B 5JNYB 2GJ6D 5SV4A 4QRQA 2IPKB 1OP5K 2EDXA 2GUOB 3I3DA 4PJEB 4MD4B 4LCCC 2XFXB 3NCMA 3F7YA 1MELA 2XICA 3LEXB 3KPPA 3C5SA 4JRWA 1IAII 4BH7B 4IEFB 3GMOB 5B39B 4Q2ZB 4LFHG 5FF6A 3O11A 4DN4L 2QQKL 5I8CA 3K46A 2OR7A 4UT9L 5C6PB 4NQCE 1UEMA 4UU9A 2BVOB 1Q72L 4ZUTA 3MOAH 1QKZL 1ZOXA 2HP4A 3FFCA 4GLRI 4WDIA 2NY3D 4PJGF 5IBUG 1VEPA 1KCRL 3TV3L 2B5IC 3AREB 1UCBL 3U9PL 4NM4L 4LCIL 5EOCL 1YMMD 3RUGE 2N7AA 5IMOB 4TSBH 3Q1SH 4PJBA 4XWOC 5KTEL 5C08A 5MEOA 4KXZH 2Z4QB 4LLVB 1FH5L 1KB9J 1LO3H 3UTPD 2ITCA 1ES0A 4MLSA 5IM7B 1KENH 2CKBH 3ARXA 1PG7H 1XCQA 3BRGC 1F4XL 5SWSE 1U8NB 4Y19D 5AUMB 2C1OA 2F5AH 4U3XA 4KC3B 3FTGA 5IW6A 2WLYA 3EJZC 1AJ7L 2OI9C 5EN2B 3U83A 1HXMB 5M95B 1WIPA 3TA3A 2BHZA 4ZOEA 3TFKC 4P99A 3MLTB 4GKOA 4HWEL 2BVEA 3ARQA 4DZBA 3DX6B 2FEEI 3BZFA 4CL7A 3JV0A 4NKDB 4LSUH 4NQDE 4P2QD 5DVMA 2XV6B 4APQB 3DMMD 4AYFA 4XPBH 5M94B 5IBTH 1SEBB 3OKNA 4V2BA 4J6RH 3UX9B 5H94A 4OF5A 3KYMB 3OB8A 2W0KA 1X6LA 2LU7A 4L3EB 4UILL 1Q9LB 5C0FA 2FHFA 2J6EH 4TTDC 2C3VA 1BZ7B 2VDLH 3WL9A 2HJFB 4WI7A 4HLZH 4P57B 5I75C 2O5YL 1CXHA 3D0LA 4UIMB 1U6AH 4JQVA 4NGHH 2QHRL 3QUKB 3MV7E 5C8JB 3HG1D 3U82B 2XXCB 2Y1VA 1KTRL 4LCWD 3E3QE 5E7BA 1NC2B 1J9CT 2FH6A 2BOBA 1U8KA 3FZUD 3O81A 4HJJH 4WEBH 4XP4L 3IFLH 4NZRL 4HUWA 2E9BA 4BK5A 4KGLA 2X44D 5GSRA 3IU4L 5IB2A 1S7XB 1HZHH 3ABZA 2P46B 1J88A 5C2BH 4X6BA 5GS2D 4JHZA 1MHHB 2JELH 4R4ND 5EO1B 3AM8A 5DD6A 5JXAH 4MNQA 4PR5B 4HGKC 5HHPB 5ADOL 3PWNB 3UPRB 3G5YB 2AEWA 5E99L 1UYWH 4HF5L 4F58H 2DBLH 1GIGH 3QJFA 1FRGH 1EHNA 4ONHB 3P4MB 4MDJB 4BSVB 1J87A 3MO1B 3MJ9H 3LQAC 3EYOA 4F3FB 4H26B 3ALPA 1R3JA 2IBZX 4ZUSB 3CFCH 1U8QA 3BKYL 5MEQA 2HJLA 1SY6H 1MCKA 3KXFA 3W9EB 4X6CF 3KR3L 4K3EL 1AGBA 3TWCL 1TTFA 1VSCA 4MB4A 3QDMA 2VLRD 4DKEH 5JQ6H 2CIKA 2BSRB 4RISL 4E42A 1T04A 4QTIH 5IB4A 3EYUL 4RMTA 3F58L 4TSCH 3LPGA 5BW7A 1Y18B 1FSKC 3VJ6B 3AY4C 1ZVSA 3PL6D 3MRNA 3O6LL 3ZHKA 1HCFX 5L9DH 4JAMA 3TN0B 4QY8B 1CYGA 3L3OB 4QGTA 1UM6H 4KUZL 3MV9D 4JZJB 4KKLD 2ILLA 4ETQB 3BDYH 5I1KH 2NXYC 1U8PB 2AEQH 3CXHK 4LU5H 3CMOH 2APVA 4RZCA 2D4DA 4LAQL 1OTSC 4DVBB 3O2DA 2VLJB 1LDPL 4N9GB 4CGTA 43C9A 3QA3A 4OD2B 3ZE2E 1GOHA 2YN5A 4OZGB 3IKKA 1P7KB 4JFDE 1CDIA 1QO3A 3BPNB 1JRHI 5DVLA 4JQXC 3ZSSA 2XTJE 4F8TA 1Z3GL 2B1HL 2NY4B 1RZKL 2XA8L 4XVJH 4YPGB 2CR3A 5T3ZH 4R0LB 1MUJB 1D5ZA 4XT1C 2CIIA 1E0OB 3K2UH 12E8H 4GG8A 4U6TA 2AI0L 5C7XL 4X6EB 4Z77A 2A83A 5DJCB 1VACB 3SDYL 3X14B 5F7YC 4OZIA 2OP4H 5B8CA 2J88H 5EULV 3W0WE 3DARA 1UWGH 4Z7WF 3IGAB 3PV6B 2UZXB 4I8DA 3QIUC 4JHWL 1II4E 3CPLA 4GOSA 5GRXG 1XGUB 1L0XA 1QEWB 2W07A 3D6GA 4QYOA 3QEGL 2LVEA 2HVKA 4ODBD 1GGCH 3OF6A 2IANA 5IQ7H 4K7FA 4MYWB 4A2MA 1R5VA 2NW2A 3DIFA 5TJWK 1W0VB 4WI2A 1RZFL 3P0VH 3OL2A 1ZHBA 5E1AA 2X42A 1HNFA 2L4OA 5FDWB 4M8QB 1U3HB 3DV6B 3NZHL 3DVIA 5L7XH 4DKAA 2APFA 3IF1B 7FABL 3MNZB 5JQHC 4JB9H 3EJZD 2FEEL 3W2DH 4GUPA 1Z9OA 5EPMA 3CH8A 3K7UA 3F62A 4KMTH 2R1WB 5EUOA 2C3WA 2NTFB 3BW9B 4RDQF 3REVA 3VW3H 4BZYA 4QF1A 2DLTA 3EGSA 5BVJA 3FQRA 2UZIL 1QOKA 4YFLI 8FABA 4GG6A 4N0YL 4WFHD 1JCKA 1RURH 3BJLA 3CVHA 4Q9BA 5D72L 4EBQH 2GKIA 4JG1L 5I15L 5ENWB 1N5YL 4R7NA 1Q9KA 3EHBC 1XF4A 1LE5A 3MOQA 1WF5A 2BVYA 2P8MA 3RPKA 1HE7A 4CNIB 1J1XL 4JY4B 4OAWA 4XGZB 5IF0B 3FOMB 4PRDA 5CD3B 2DQCH 3EIFA 4NO0D 4U1IA 1QG3A 5CUSH 8CGTA 2W38A 1WIUA 4QLRA 4JDTL 1YMHB 3BHBA 3WIFB 3MLRH 3G08A 2OJEB 4OSUL 5FYKU 1NBYB 5EU4A 3OAYK 3GMQA 3ULUL 2PO6A 4Y19B 2RCSH 2QTEA 1ZSDB 1F00I 3OTTA 4JFFA 3KLAB 5TPWH 2PCPB 4M6ML 5EIVA 3TNMB 4MXVE 5F44A 4Z0XB 1FAIL 2BC4B 5F7EH 1NDMA 1WICA 3B8SA 1NUGA 4HKZB 4ZO6A 3BAEH 2QEJA 1ZAGA 4HWBH 5TE6H 3CLFH 1FNLA 4MJ5A 3O4LD 2FD6H 2NW3B 1D6EA 3MROB 3HI1B 4NO5B 1HHGA 2OZ4A 3ECBA 3AXLB 4P2QB 4U6HB 2NLJB 1QFWM 3LMJL 4OQTL 3DMMB 4TUJB 4PJDF 2OBGA 3H9SD 2A2QT 4NQUA 1FL3A 5J12C 1R6VA 1FFOB 4LCYB 4TULH 2MKWA 2Z8VC 1I8KB 3G9AB 3OKKB 4GBXA 1EV2E 5HYJA 2MNUA 2GT9A 1T22B 2AJXH 2AJUL 1IM3B 3CXHJ 3H42L 4NPYB 5E4EC 3FQWB 1EIBA 1RAMA 2I9LB 4P4RB 5CCKL 2W9LA 5EA0H 4YDKL 1TLKA 5E2VL 3HG1B 2CO7B 3RIFF 1SHMA 1JPFB 3S98A 4JM2D 1ZS8A 1U8MA 4JFZL 2I9TA 3CFKA 4D8PA 4JR9L 5D4QA 3D69B 2HMIC 3DX8B 4PRHB 5JIHA 3ALXA 1D9KC 1MCIA 2YRPA 1BD2A 1T2XA 1CFTA 1RI8A 3NFSL 1X5XA 1C7TA 4I3SL 3MLZH 1TMCB 1OAYH 3STZA 3O4OC 4P23C 4QXUL 4YWGL 4CN1A 1FJ1B 3LEYH 4KPHL 3N9GL 1OSPH 3CSGA 1NAML 4U1KA 5JMRA 3O3EB 4RGND 3PHSA 3RVVC 1G7IB 5DO2C 5AD0A 5FA3B 2NY1D 3G6JB 2VSDA 1A7OL 1OTSD 4U1GB 1D5MA 3ARGD 4NZUH 4XPGH 1JRHL 1FZJA 5I66A 4MZ2A 4LNRA 5F7KC 5CEXB 4PJIF 1NH6A 2A9MH 5TDNA 3VE0B 4CRPA 5IGXH 4J3WA 4D2NA 1BJ1J 2MQCA 2HN7A 1ZK9A 4BK4A 2VLRB 4MCZB 4OI7A 4MD0B 5HHVL 4HIIA 3VFMB 5IKCA 1X9QA 1P6AB 3V95A 4ZFOB 4EN3B 3OHXB 4UQ2A 3QPXL 3P0YL 3IDMB 5EZIL 4HFWB 5I8EA 4KMQA 4NO2A 5E9DB 3EJJX 5EWIL 1EERB 1ZLSH 3PL6B 1EO8H 4K3HA 2GHWB 5D2LA 3QIWC 4WU7B 4LPYA 4MA7H 3I02B 1SBSH 3K4DA 4QRRD 4DOHE 4WY7H 1AGDA 2BNQD 1FZMA 2DQUL 3MV9B 3QIUD 3ILQC 1JGEA 1GC1C 3WS3A 2UY6A 1JGVL 1BWWA 3QNXB 2LABA 4M62L 2AEPH 4GXUN 5FGSA 1ZGLP 5EBLA 4PRPD 5FUZH 4QOKA 2VQ1A 5JNYA 2HTKC 1I1CA 5FXCH 2IPKA 3HAEA 4OD1H 2GUOA 1CG9B 1BIIB 2ARJQ 2KDGA 2Z93B 4TOYH 3QHZL 4PJEA 4MD4A 5GGRB 4LCCB 3WFDH 3LEXA 3WXWL 1FCCA 2KPNA 4KJPC 6FABL 3PV7A 1Q9WB 5B39A 1FBIL 3MQIA 2AJVH 1QHPA 2VXSH 4Y2DC 1F4WL 1N6VA 4L1HA 2O5XH 1S9WB 5ALCL 4JVPA 1Q0XH 4Z7VB 3UZQA 3QCTH 3RWGA 4NRZB 4NOFA 3LKPA 4HUUB 3AREA 2VLME 4F57H 2B5IB 3BN9D 4G6JH 1OTUC 3TVMD 4YQXH 5INCB 1FFNB 2X09A 3HZYB 4LEXL 5CFHA 4EI6A 1J8KA 3TJEH 2JE8A 1B90A 2Z4QA 4PD4J 1RUQL 2LVCA 4OCWL 4FNLH 1U91B 2XY2A 2VH5H 3D2UD 5IM7A 4GMTL 5DUPL 4Z18A 1CXLA 1UM4H 2JCCB 3R1GH 5F1SA 2YD7A 1QFPA 4ZQKB 4PJBF 4OZHB 5AUMA 3GBNH 1CGYA 4EDWH 3T2NH 1J05B 1PKQB 2EKSB 5C86A 4LLYB 3DVNA 5EN2A 1HXMA 5EO9A 3TLRA 4F9PC 1PQZB 2DMKA 1XGRB 4MAUH 4PJ7B 5T1DH 3DX6A 1A3LH 4FZEL 1LEIB 2CJUL 4NKDA 3IRZA 3DECA 3Q3GB 1VDGA 1N0XL 4M4RA 3TIDB 4P5MB 1SEBA 1FGVH 2DQDL 2VB5A 2WUBL 4KTEH 2HTLC 4H20H 4OIIL 3RGVA 5IFAL 1ZT1A 2NPLX 2R0ZH 3FB6B 1CLYL 3KYMA 4L3EA 3WO3B 1W2KT 4G8EB 1MIEL 3TC9A 4ETYA 1J1PH 1QUNA 4NO0B 5TDOB 2J3SA 4CVZB 1BZ7A 3BT2H 2FL5B 1LQSR 4P57A 5I75B 3LQMA 5CINL 2HG5B 1ORQA 1A3QA 3QUKA 4WEMB 5C8JA 1KACB 1YEDB 3SE9H 1WV7T 32C2A 3HI6H 1KT2A 1NC2A 3PWPE 4YC2B 2F53D 5KS9F 1T1XA 4POZD 5B38G 1KFAL 3IU3B 5AYUH 5ICXB 4KTDH 1S7XA 1A3RH 1SYVB 4PJHB 4M02A 2YD2A 2DMCA 1BBDL 2V9TA 1MHHA 2I27N 2FNBA 3EO0B 1IL1B 4F2MB 4KU1A 3MJ7B 5HHPA 3IVKB 3PWNA 3H9SB 2RFXB 3UPRA 4G43A 1WCBB 1INDH 3G5YA 5LVEA 2V5TA 4N5UA 3F12B 5HXMA 1AY1L 4ONHA 3P4MA 2XKUA 2Z91A 4MDJA 4BSVA 3P40A 4XCCL 3NIGE 4F3FA 4QTHA 3HNSH 5FHBL 1LDSA 4F7MB 3CVHH 3QXDA 3V52L 1NCBL 3T09A 1M05B 3EYSL 5JPMB 1JF5A 5TE7L 4MZ3A 3W9EA 4X4ME 3T0WA 2VL4A 3KPLA 1IGIH 3LN5A 4R2GD 4JM2B 5INDB 1S7UB 4S1QH 2A6IB 2DL9A 5I74B 2BSRA 1NQBA 1CFQB 5I1DB 2YA1A 1HDMA 3QFJE 3QWRA 4LIQH 2HT4D 3VGDA 3SHSA 4FQ1L 1A6TA 1FSKB 4X8JB 1L6XA 4X7FC 2P8LB 1G6RL 5I6XC 3HE7A 1S5IL 4H0IA 4HC1L 4O2CA 1JI1A 5TF0A 3TN0A 4XNYL 3EO9L 2NY7H 3L3OA 3B2UD 3FO0H 5CEZH 4JZJA 4RGNB 4ETQA 5D93B 5EB9A 1U8PA 5B21A 3ELAT 3QSKB 3I6KB 2OYPA 3T2PA 2WV3A 3TBYB 4DVBA 2VLJA 4XX1E 4X6DE 1G7PB 4HWNA 5EORL 5TH2B 4CKVX 1XGPA 4M61B 2E7HA 4U1LA 1P7KA 5DRNB 1NSNH 4M4PA 2ZPKL 1YEKH 2NY2D 3LQZB 5D7JA 3RI5F 3IDGB 3PJSB 1DN0A 2R29L 1KC5H 5IR1B 2X4UB 4KJPD 1BPVA 2OL3H 4YPGA 2DM7A 1S9KC 5FGBA 2WP3T 3D9AH 1MUJA 1FIGL 4R0LA 5E8OB 2XZAH 3LB6C 5DFVC 4X6EA 2FYYB 4KVCL 4WHCA 1VACA 4YDVB 3X14A 3EDEA 3QPQC 4NRXB 4W68A 4OQTA 3JTSB 3IGAA 4FXGB 3ROLA 4V1DB 4PG2A 2BNQB 1AXTH 3B9DA 4XNUL 3QIUB 4DN4H 2QQKH 1CGVA 1RJYB 1XGUA 2ICWJ 3HR6A 1QEWA 5CZXD 4UT9H 1Q72H 4OZIF 4JZNA 2WW8A 3DGCR 1QKZH 2ZOKA 1KCRH 1W0VA 3V6BR 2YC1B 1UCBH 3U9PH 2VLKE 2GJ6A 4LCIH 5EOCH 5FDWA 4UQ3B 2P42B 2QJDA 3DV6A 3RWEB 5KTEH 1CVRA 3MNZA 1H3VA 1TVBB 1FH5H 1DQLL 4TRPL 1YY9C 4JO3H 2IWGA 3GSUB 4N5EC 5EUOE 4UBDC 1RZGA 5DHVB 2R1WA 1L7IL 2NTFA 3SE4A 3BW9A 3SKNB 1F4XH 3V5HA 1CL7I 3T3PE 1F4AA 1LD9B 1KLFA 1UZ6E 1AJ7H 3TVMB 5FUCE 5A3IC 2HTLD 3K2MC 1YMMA 4FHBD 2WBWB 3MOBL 4HWEH 4CU7A 4CNIA 3EBAA 1I9RL 4JY4A 4XGZA 5IF0A 4RMVA 3FOMA 5D96C 4UT7L 2NMSA 1TZGL 5CD3A 4GG6F 3BP6A 2DQHL 4WVRA 5K9KB 4B7LA 3BKML 2EDNA 1EHXA 3D2UB 1FL6B 3BYTA 3RWJA 1YMHA 3WIFA 1NBYA 1WZ1H 1RZ8B 1A1OB 1KTDB 4Y19A 1ZSDA 3HC4L 3KLAA 2PCPA 3V6ZB 4GT7A 3TNMA 4UILH 4I3RL 3WJJC 3L5IA 4OLXL 3MCLL 4Z0XA 5GISH 4HKZA 3INUL 3GSOB 1KULA 4EQ3A 3U1SL 4XAKD 3BDXA 2O5YH 4O2EB 2WIMA 2EKJA 2G5RA 3HAEH 5EU6B 3L3GA 2XTLA 3HI1A 2E9WA 2QHRH 4NO5A 4MB3A 4P2QA 4U6HA 1MHEB 5I30L 3HNTL 3DMMA 1J0YA 4TUJA 4KWUA 2ZG2A 2XKNB 4LF3B 4RWYL 5GS0D 4XP4H 4LCYA 1KB5B 4NZRH 5SX5K 1MFCH 2GFBA 1I8KA 3N0PB 1O5DT 1DVFD 3IU4H 3RL2B 2X1XR 2JTDA 4DTGL 4O9HL 1T22A 1BFSA 1G9NL 1IM3A 1DQQA 4NPYA 5FYLE 3FQWA 5E4EB 4Y4KD 5FO8A 5ADOH 1JZ2A 4P4RA 4HIJB 4OKVB 3ULVE 2EECA 2VUOA 3PDOB 2IH3B 1X5JA 5E99H 2ID5A 3SOBL 4HF5H 1I7UB 3HG1A 4OGAD 5TE4L 1JPFA 3FO2B 3RWIB 4LCWA 2IAMC 5J56B 3BD3A 4B5EA 2VR4A 1ZV5A 2F53B 3MBXL 3D69A 4BFGA 3G6AB 1DQJA 3LY6A 1D9KB 4P5KB 4P3WA 5E03A 4IMLB 4UV7L 3A6CL 3CDFA 2UV3A 4JO2L 3SKUD 1A6ZB 1FDLL 3KR3H 3QQ4B 4K3EH 4NN6C 5D7LE 3C8DA 3TWCH 4P23B 1FJ1A 3VFPB 4YDIL 3S35H 2R8SL 4RISH 3BWAB 4XI5C 4UNVA 3O3EA 3EYUH 1KJVB 2IQAA 1G7IA 3NN8B 4IDJL 5FA3A 1W8OA 2J7LA 3G6JA 4ORGB 4JPKL 1J1OL 4NNXB 4U0RC 3T77A 4YHZL 3O6LH 1LEKA 1RULL 1MFEL 5CEXA 3DHMA 5J7CC 3C5ZC 3VE0A 3B9KC 3QUZD 1ZANH 4KUZH 4CDGC 3SGKA 5AAMA 1MRCL 4E41D 5E2WL 5HYIA 1CI5A 1QSVA 2VLRA 4LAQH 4MCZA 5GZNC 1J0KA 1JZ6A 2QSCL 4MD0A 1JWSA 4IOSD 3RQ3A 4LLMB 3OV6A 4ZFOA 1Y0LB 3OHXA 4BQBA 2P48B 1E28B 3FRPG 3WIHL 4HFWA 4PLOB 3L3HB 1AFVL 4KV5F 4CDHA 1EJ6A 3B4NA 5EOQL 3PL6A 3QDJD 3QPQD 4XMLL 5J89A 4WU7A 3D25B 2B1HH 2P1YA 2ZUUA 3QIWB 1RZKH 3I02A 4A6YL 3MV9A 4CMHB 1FYHB 4HUKB 5DJDA 3BVNB 2AI0H 3QNXA 3P4NB 5C7XH 1FPTL 4XPAH 4Y5VA 3BH8B 3SDYH 4HIHA 5HVWA 5HHOE 3B9VA 3ZHDA 4WWKC 5DURB 1CG9A 3P73B 1BIIA 3GSVA 2NY2B 5GGRA 2B7DT 4JHWH 3QEQD 4QT5A 2HLFC 1DBKL 3GMRB 4LCCA 3L3JA 2V7HB 5JHDE 4I48A 3F5WA 4B53A 3I75B 3QEGH 3ZHLA 3SBWC 2JJSC 1Q8MA 3WSQL 1MQ8A 1Q9WA 1M7DB 4Y2DB 5KSBB 1RZFH 1S9WA 3DGGA 4Z7VA 1OARL 2Q3ZA 3VFUB 7FABH 4HUUA 5EBMA 5INCA 5IIEA 2EIDA 3HZYA 1OAQL 2EXWC 1X3DA 1HK6A 5C07D 1DZBA 2A74A 4Q9QL 5KVEL 3C6LD 5HGAB 2UZIH 2NR6C 4M7LL 4N0YH 1CGXA 4Y5XC 4X0KB 2NYYC 5F7NC 5D72H 4PTUB 3I2CL 2JCCA 4JG1H 5I15H 4J3UA 4ZQKA 2OTUB 1N5YH 4OZHA 2Q8AL 4XTRC 4LRNL 4JM4L 1J05A 1QSZA 5J1SC 4ODWB 3FMGL 2XQYK 1J1XH 2EKSA 4L5FL 5JOPD 2W60B 4LLYA 1NGPH 3PP4L 3OKMA 4NCC1 5CLTA 3T2OA 2D7PA 1TPXC 1WBYB 1MCBA 4MDIA 4AEFA 1OAUH 2CUHA 1QRNE 1LO5B 3HRZB 4Q9CA 1XGRA 4LVOB 4PJ7A 1LEIA 4OSUH 5DD3H 43CAA 3OXSA 3ULUH 3Q3GA 3REWB 2C9AA 3UYOD 2FO4B 3O3UN 3R06B 4HC1A 4OLYL 1FAIH 3FB6A 4L3EE 1CK0L 3CZJA 2HWZL 2Q86B 1JHLL 4JE4B 4UIKL 1JNLL 1YNLL 4CN6A 3K1KC 4ELMA 1WFUA 3WMSA 5DK0B 1X5IA 4NO0A 5TDOA 2B39A 3CU1A 2DKSA 4LARL 1VB9A 1NLDL 35C8L 3O2VL 4OQTH 2DRUA 1LO0H 3P9LA 1IAKB 2OQJA 4OT1L 1RQ5A 1N6UA 1XH3B 1CN4A 3JZ7A 4YHLL 2WINB 5E6IC 2BRRL 2JB6B 1OGAE 4UB0L 4JANA 4MA3B 5JOFA 3DUHA 1CXIA 3B5GA 4MQXD 4NRYA 2ZOLB 5D2NB 3IU3A 4OFPA 3H42H 3O3AB 5ICXA 2WZPD 3O4LA 2OR9L 1DSFL 1OTTC 5CCKH 4Y1AB 2FX9H 1SYVA 3BRFA 1T0MB 3U46B 4PJHA 5FYJD 5HDBF 1KEGL 3RAJL 4GS7C 4YDKH 2AGJL 5DUBB 2CMRL 4HXBH 3RIFK 2ZUWA 5E2VH 2UYLB 3EDJA 5ECJE 1IL1A 4PJXB 4JFZH 3WNKA 1CDJA 4F2MA 3MJ7A 5L88L 4JR9H 5DJXB 5IJKC 3IVKA 1FNAA 4PJFE 3H9SA 2RFXA 4HZAA 1WCBA 5DQDL 2MCPL 3NZ8B 3MRDB 3F12A 2C3HA 4TVPE 3BP5B 4H8WC 3D3VD 4WUUD 1RY7B 3NFSH 4I3SH 3S7GA 4UOW1 4TN9A 1WLHA 1UA6L 1OM3L 1X4YA 4QXUH 4YWGH 4F7MA 2YD8A 4KPHH 3BYYA 3N9GH 1HI6B 5FDYA 1M05A 5JPMA 3B9KD 4PLKD 1F11B 2FGZA 3LPWA 3OR6B 3GK8L 4KK8D 1IEHA 4JM2A 5INDA 1S7UA 2ED7A 1A7OH 5IROC 5I1DA 1JRHH 2ZG1A 3ZE1F 2CKNA 2ORBL 1UXSB 4R8WL 2EH8L 3GMNB 4G7VL 1D5XA 5CJ5A 4HPYL 5DFTA 4ZPTA 4X8JA 1IEAB 2MJWA 2DJ4A 3VXUD 5I6XB 2Y7QB 5T1LD 3IJHB 1F3JB 4UDTB 2WQ8A 5I8KH 2XZQL 4G6AC 5HHVH 4PJCB 4XPHL 3ARYA 4KJWC 5B3JE 1A6VL 3S4SG 4PB0L 3N50A 4WI8A 3RDTC 4OJFL 4YO0B 1OHQA 2F74B 2AK4D 3I6KA 1MAKA 2VLJE 3P0YH 5EZIH 4MXQD 5GGVL 1HSBA 3TBYA 3KLHC 3KPOA 5EWIH 3ARGA 1YDPB 1G7PA 4OZGE 1EZVY 3GMLB 4YBQC 1NEZB 3SO3C 1IEBA 2NTSP 5SX4I 2DQUH 3LQZA 3IJYA 4YX2L 4JQXA 3IDGA 4G6ML 1B0RB 5H37G 3DXAE 2PYEB 1JGVH 4N8VG 2X4UA 3HR5B 5HDLA 3WLWD 4M62H 3MZGB 1B2WL 1C12B 2FH8A 5E8OA 3ULUF 1BVKB 3QIBC 5FM8A 2R39A 2FYYA 3TBTB 3BJ91 3O45B 3NFPB 4YDVA 2OCFD 2X10A 3LN4B 3QHZH 4NRXA 3OAZK 5EZLB 3THML 1INQB 4LSPL 2N7BA 3WXWH 5ACMA 1KCUL 4EIGB 1K8DA 4FXGA 6FABH 4BQ6A 5GGTL 5GS0L 2BNQA 3QYCA 4UOW0 4Z0BL 4XCNA 1FBIH 3QIUA 1F4WH 4UINL 1RJYA 1U93B 5K9QI 3V0VA 2D0FA 2NCMA 5ALCH 1YUHB 1EEUA 3QUMB 4KQ4L 5GS2H 4N90E 5D1ZD 3VMPA 4PRPA 5HVHC 2YC1A 1T5WA 2XPGB 2H1PL 4UQ3A 3QO0B 4LEXH 3WNPA 4QHUB 3RWEA 4XTRD 3TYGL 2H32B 2DQFB 4B7IA 1S5HB 3OWEA 4O02L 3X12B 1FV1B 1TVBA 4OCWH 3O8XC 2XTJC 3ARZA 3G5XA 3ZDYF 5DUPH 5DHVA 3NCBB 3IFNL 3MLXL 1FNHA 5I1JL 2AW2A 2PUQT 3DNKA 1NKOA 4J7RA 2Y5TB 4URTB 2YWZA 5J11C 2A38A 4NQCD 1LD9A 3CSPA 2J8UB 5E08L 3MRHA 2Q1EA 4OFKA 4HMDA 3B6SB 3TVMA 5LGHL 3JV4B 5DRXB 1B4RA 4R4BB 4IM8A 4JN2B 3SDAC 5IMLB 1HIML 4FZEH 1QLEH 5C07B 5D96B 3MYJB 3PIQA 1H8OA 5K9KA 3JXAA 3D2UA 5FA4B 1N0XH 1TVHB 1TTUA 1FL6A 4L8CB 4EUPG 1AHWB 2DQDH 2EIEA 2WUBH 4GAJL 4QNPF 5IFAH 4XCYB 2X4RB 1KTDA 5SWSD 3WNLA 4F7CB 1TETL 1WAAE 3V6ZA 1N4XL 5E2JA 3EAKA 2DYPD 4H1LB 5CIPB 1LK2B 5E6ID 1MIEH 2ZSWB 1E6OL 2F5BL 5DR5L 5IJVB 5F7UA 3GSOA 3HZKB 4Q6YA 4WU5B 4CVUA 4HGMA 4O2EA 5CINH 1UGNA 2X9XA 4P2QE 2YD1A 1V3JA 5GGSY 3SN6N 3DX9B 4J8RB 3VI3E 1MHEA 3PE9A 4NQDD 1EUTA 1E4WL 2KBGA 1T6VN 3D0VA 2QQQA 2XKNA 4LF3A 4P46C 4AEHL 5CGYD 3W39B 5GGUB 3I6GB 4YR6B 4A6YA 5BV7L 1KB5A 3JUZA 5IBLD 3QEHB 2CRMA 1KFAH 3WBDA 2EYSB 4Y16D 1DEDA 1VCAA 1BBDH 1BEYL 3WUWG 3VI4E 3B9AA 2M8XA 5JO5B 4HIJA 3C60C 4OKVA 2A1WL 2F8VA 3OX8A 2IH3A 1I7UA 1AY1H 3FO2A 5KSVB 3MV7D 4OKDA 4P3CL 2IAMB 3I3BA 4XCCH 4PRHE 2F53A 5A2IH 2FCBA 2VKXA 5FHBH 4Z78B 3G6AA 3BE1L 3V52H 1TCMA 4P5KA 3S97C 2YPLE 4B41A 3GSWB 1YN7B 3EYSH 4IMLA 4J4PD 5TE7H 2J4WL 1IAMA 2WQRA 3S9DB 2WWKT 1A6ZA 5JW4R 3QQ4A 4FQHB 3C6SB 4NN6B 4I2XA 3DETC 1C7SA 5DK3A 4DVRL 4Q9RH 3F7RA 4G6AD 1IKNC 3KHOA 3BWAA 3C87A 3DWTA 2FDBP 4PJIE 1KJVA 1R3KB 4UUJB 3G6JE 1YNKL 3UBXG 3NN8A 4LGSB 3FQTA 5D6DA 1XF1A 2IF7A 4LSTL 3D3VB 4WUUB 3KLHD 1G6RH 1IC7L 3H3KA 1S5IH 5F3HA 3F6LA 4U0RB 5BS0E 3KYNB 2R1XA 4LSRL 4HC1H 1WTLA 1TZHB 3T3ME 1PG7X 4HXAH 1NJ9B 4XNYH 2H3NA 3EO9H 3B9KB 1JZ7A 2ATKB 5JXEC 2ARWA 3GM8A 3HKFA 5C0BE 1I8MB 5TQ2L 1BZQK 3HUJB 6CGTA 1IGYA 5K33A 4LLWA 1PG7W 4OM1H 5E5UB 3TBSB 3B43A 1YZZA 1EFQA 1OY3B 1Y0LA 1MCFA 4LBEB 4NC0B 3QWOA 3P9MB 5E9DE 1E28A 5E00B 5C71A 1SEQH 3QIBD 3E6FB 3BIKA 2VZSA 5ALBL 2W9EL 4LKCB 3VXUB 3RI5K 1IGTB 5T1LB 4EIZC 1FZOB 3UTQB 2R29H 3D25A 3ZZ1A 3NFNB 3UDWC 2YWYA 3EYVA 2BVQB 5E6YA 5T33L 1FIGH 3UBXI 3QXWA 4W6WB 4Y2OA 3ARUA 1V3LA 4GRMB 3QQ9C 3P4NA 4KVCH 3B3IB 3BH8A 5EIQA 3TZVC 3VMNA 5E8DL 1PSKL 5KSAC 4OF8A 5F1NA 4V2CB 1KTKE 2Q87A 5IG7B 4LGPB 2YKLL 4ENEC 1CICD 5C0RL 1C8PA 2VOTA 2EDJA 1WZKA 1P7QD 4HG4K 5HPMB 1JV5A 2R2CA 4JFDD 4XNUH 3MLYH 1PJ9A 3GMRA 1H9VA 2V7HA 4JO4L 3I75A 3NCYS 4I18C 3O8XD 1NFIB 2XTJD 1BF2A 4JJ5B 3QUXD 1P1ZB 3HB3C 4NC2B 4DEPC 3ZKMD 1M7DA 2O61B 1RHHB 4Z7VE 1FL5B 5KSBA 1WZLA 2XNAB 1PX3A 4JFOB 3VG0L 3W11C 4AENB 1MJJB 5J8OA 1HEZB 2X40A 3VFUA 3ZTJG 1A6WL 1DQLH 4TRPH 4LHUD 1KJ2L 3W0WD 4WTZA 1U41A 2LFGA 2X4PB 3Q5TA 2CUIA 1L7IH 3P4LA 2FWOB 3SDAD 2EDWA 2DQGL 5HGAA 3BEWA 4MX7B 4MQ7A 1M7IB 2Y25A 1F45A 2YMXL 3BZEB 4Y5XB 1MLBB 5D1QD 4PTUA 1F02I 4ACPA 1VENA 5FYKE 4S10A 2OTUA 1PKQE 3BQUC 4ZAKD 3MOBH 2EE6A 3EW3B 4ODWA 3TO2B 3UAJC 1CBVL 2CGRL 1EPFA 4OLWL 1I9RH 3KWWB 5D7IA 2W60A 4UT7H 4XNZC 1NCCL 2DQHH 3NIFE 3G04B 2HRLA 1HH9A 1TPXB 1RSFA 5SWZE 4XPTL 2JCCF 4F9PA 3HRZA 3Q2CA 1FC2D 1PW3A 5JW5B 4OZHF 3SKJL 2ADJB 1K8IB 1IFHL 3QDHA 3CFJB 4NQCB 3REWA 1ZHNA 2FO4A 4OV5A 1PEWA 3ZYJA 4KK9C 4ODSL 5CJOL 3VRIB 3GO1L 4I3RH 4RA0C 4OLXH 4R96B 1PZUB 2AP2A 1B6UA 3INUH 2Q86A 3O41B 4PJ7F 3U1SH 3MA7B 3RUGB 4KY1L 4K07A 1RJZA 1U36A 5DK0A 1A1MB 3QUYD 3LZFL 4M7JL 1IQDB 2B1AH 4AL8H 5LJYH 4HJ0C 1A4KB 4XVUD 5DFWH 2H9GB 1DFBL 4P5TC 2XZZA 2R4SH 1YC8A 1F4YL 3HNTH 5I30H 4OLEA 1FCGA 3MLSH 4PY7B 5KS9E 2EEBA 3U0PB 1IAKA 3O6FC 1S7TB 4PYGA 3C60D 4RWYH 3V0AC 1CIUA 1XH3A 2BFVH 2VO5A 4ELMF 5GGSB 2WINA 3H3BC 1P4LB 3MXWL 2JB6A 3SKOA 5E6IB 4YEEA 5I18L 2AJYL 5JORB 4MA3A 1AIFB 4HKJA 5DT1L 5I1LB 4DTGH 4O9HH 1G9NH 4WHDA 2ZOLA 4RX4D 5D2NA 1FLTX 3O3AA 4MLIA 1IILE 1AQKL 3V5KA 3HC3H 1T0MA 1JYXA 1RIVL 2BOCB 1BZ9B 4AEEA 5HBBA 3SOBH 3V6FB 4HK0B 2W0FA 3JWNC 5TE4H 4KXZI 4NQDB 2JB5L 4OCSL 4FFVD 3BO8B 3QRFM 3ORJA 3L9RB 3MBXH 5IMKB 5GGTA 1JTPA 4U1NB 5DHVH 3MRDA 2EDTA 1DLFH 5DK2B 1G84A 2X4TA 4HLZG 4HMCA 1CDUA 3O9WD 1U8IA 1I1YA 2FX8L 4PJHF 1DVFA 3N85L 1JPSL 3BP5A 4UV7H 1WTGT 4Y16B 4Z7UE 4I5BB 4JO2H 3OB0H 1FDLH 2VAJA 2MTPA 2DAVA 4YDIH 1HI6A 1A7PL 1KEML 4Y4KA 1HILA 2D7TL 3QXTA 2R8SH 1F11A 3CFEA 5JXED 3WFZA 4DKFH 4Z76A 4PG9A 3JTTA 4IDJH 3MV7B 3T0DA 3VA2C 2VABB 4JPKH 4RDQG 1J1OH 3VH8B 3IDNA 4PRNB 4QWWD 1ULVA 4YHZH 4K55A 2Z8RA 5CZVL 1U42A 2H2SC 2X70B 4UTBL 1RULH 2FO1A 1MFEH 1UXSA 3GMNA 5E8NB 1MHCB 3FQNB 5D5MA 1AD9B 5I0ZA 1IEAA 4PRIE 3OKYA 4JM2F 1MRCH 3IJHA 1F3JA 4YHPB 4UDTA 5E2WH 5LGJB 4LGRB 4PJAB 2XQYG 2QSCH 4PJCA 1Q38A 3BD5A 4MNGA 5HYQA 3RDTB 4H0GA 2F74A 3QQ9D 3CX5K 3WIHH 3T65A 1GAFL 1LK3L 2MMXA 1AFVH 4RQQB 2XZCL 1U92B 4CW1B 5DJYB 1YDPA 4M93C 5EOQH 4IMKC 4XZUB 3GMLA 1NEZA 4P4KC 2DLGA 4ENED 3RVUC 3SO3B 4A6YH 1KB5H 3CUPB 1ZTXL 2DBJA 5I1IL 2PXYC 2CXKA 4E41A 1B0RA 1EFXB 2PYEA 4POUB 1FPTH 1SJHA 4P9HL 1MJ7L 5FCSH 2AXJA 3HHRB 4GW5B 1C12A 5CS7A 3BN3B 5GGQL 4F15B 1YYLL 3VD3A 3H9ZA 3OGCB 2A6KB 3QIBB 3TBTA 3O45A 3W11D 3A67L 2KH2B 3NFPA 2DL2A 3LN4A 1NUDA 3LRSB 1IC1A 1DBKH 3QDJA 5EZLA 4MMXC 1INQA 4ZO9A 1N6QL 4V1DE 3TPUA 2EDFA 4XP1L 3T08A 2BNQE 5FGRA 1Z9LA 1XR9B 2W1NA 4TSAL 2ZUSA 2F8OA 4M6NL 4TPRL 1U93A 1CLCA 3SGDH 1OARH 3TH3T 3V8OA 2ZCHL 3P77A 1DLHA 5HVHB 5DD5L 2XPGA 5F70A 4G7YL 1CICB 4EI5C 1LO4H 3QO0A 4F7TB 1OAQH 4QHUA 4HBCL 1P7QB 5CSBA 3VWKD 5E56A 1IAIM 2DQFA 4JFDB 1S5HA 3QEQA 2WWKO 3UAJD 3X12A 4N0UA 3VCLB 4KZEL 1BJMA 4U7SA 5ANMB 4Q9QH 5KVEH 1ZE3C 2OLDA 3O8XB 4PLNC 2XTJB 4MJ6B 4M7LH 5C0NC 4X80L 4PGCB 2VNCA 3NCYP 1AXSB 4ZSOB 1PKOA 3I2CH 1F90L 2Y5TA 1I8IB 2HFTA 2VR5A 2Q8AH 4JFPB 3DX7B 4LRNH 4LPTA 1KTLB 5J11B 4JM4H 1UWEL 2J8UA 1ZVHA 3VGGA 1ZWIB 3RNKB 4UAOC 3ZT5A 1CDYA 1MCJA 5DC9B 4KI5C 4LHUB 3PP4H 3W0WB 3JV4A 5DRXA 1HHJA 2VLMD 2HLAA 3RWCA 1Z0MA 4GRWH 4JN2A 5E2TL 5GRVL 5IMLA 2DIJA 3SDAB 4DK3A 5C07A 5C6TL 4FP8L 3MYJA 3C6LA 4FQXC 4OFVA 4RMRA 3RZCC 5FA4A 4P5TD 1YNTB 5I1AA 4HDIA 4L8CA 1EDQA 1AHWA 2EYRB 3E1F1 2GTWB 2KUTA 4OLYH 4XCYA 5KZCD 1IGFL 1LMKA 2SEBA 1MRFL 2MFNA 3MOAL 2HWZH 1H5BA 4ZAKB 3RJDA 3NABL 1JHLH 2Q76A 4UIKH 4RRPA 1YNLH 3MV11 3JWDL 4I0PC 1MI5E 4H1LA 1LK2A 5IJVA 3S5LB 3HZKA 5DQ9B 5IMMB 5J06A 4LARH 2L7JA 4KHXL 1NLDH 2FLRT 2WIIB 2W0LA 35C8H 3O2VH 3MCG1 5EU6E 1IT9L 1G7QB 3RKDC 3RY6C 4OT1H 2CO6B 3DX9A 4J8RA 4U6XB 4YHLH 2CKBL 1PG7L 2BRRH 4UB0H 3DSFL 3WIIL 4RAUB 3MACL 4P46B 5GGUA 3I6GA 1ONQB 5I9QC 3QEHA 2ENYA 5L2KD 4ORZC 3U0TB 3UC0L 4PGBB 1LNUB 2EYSA 5HHQA 2OR9H 5J9PB 1DSFH 3ZKSD 1RVFL 1KEGH 1PYWB 2ICWA 5HGHA 3RAJH 2AGJH 2CMRH 4A2LA 3N1QC 1A7RL 1Y6NR 2LU3A 4PJ9D 2WNGA 5L88H 2B2XL 1HHKB 1ORSB 4P2YA 3C60B 1G9MH 5DQDH 4WV1A 4GXUM 1JHKL 1F13A 5KSVA 3ARBD 2YBRA 5IBTL 3ZDZF 1GOFA 3PWPD 2R2HB 2GIYA 3GJFA 3ES6A 4FTVE 4QHKJ 4Z78A 4G8GB 3GSWA 2EDYA 1MCWM 1I1FB 2FJFB 3GK8H 4PRAB 4FQHA 3C6SA 3RHWF 4MGXA 2R2EB 4JFXB 1AGCB 1U3ZA 1BJ1H 4NUGL 4P9ML 2JLLA 1Q94B 1KCLA 4L9DA 1NLBL 1R3KA 4UUJA 4ZPVB 3G9VA 3LKRB 5DHXB 1I85A 4U6YB 2EH8H 4G7VH 4HPYH 1FVCB 3D3VA 4WUUA 3OR7B 3KYNA 3H7BB 2D7NA 3K0WA 1TZHA 5K59F 2XZQH 4YXHL 3B9KA 2ATKA 4XPHH 4YDLC 3KPQA 3RVUD 1A6VH 4PB0H 3ULVC 3VA6A 1RMFL 4UT6H 1I8MA 2DIAA 2JELL 4KV5E 4OJFH 3CDYA 4OQ1A 1FVDB 4L8DB 3TBSA 5DS8A 3VU2A 3SGEI 2GK0B 2DBLL 4AH2A 2YXFA 3QFJD 5EIIB 3E6FA 4HD9A 1NGYB 3SDCC 4K8RD 3AFLA 2CQVA 4IOFD 4LKCA 4YX2H 1A6UL 4R90L 3VXUA 2VSCA 1IGTA 4UNUA 5T1LA 1FZOA 3UTQA 4G6MH 4QRSA 2M2DA 1BVLB 5HPOA 4ZS7H 4GRWF 2OJZL 3BX7C 5E5RB 4YZFE 1MQKL 5CSZB 3PGFH 3MRGB 4NKOB 2X7LB 4GRMA 1OD7A 1YPZB 2AK4A 4MXWL 4I9WE 3G6DL 1E4JA 2PW1B 4K94C 3TZVB 1MFBL 4TSCL 4LSPH 3RY4A 2Q3AA 1KCUH 1IGCH 1S9YB 5DI8B 5IK3B 4WHYH 4EI5D 1YJDC 5GGTH 3QNZB 5GS0H 5HPMA 4OTXH 5ADPL 3ARFC 2O93L 4LPCA 4Z0BH 4LMQI 2EDKA 5MENE 4Y89A 4UINH 1OVZA 4P59L 5JMOC 4LOUC 1UH3A 3SBWA 3JUYA 4ZG1A 3WCYA 4KQ4H 5C0ND 5KSBE 1P1ZA 3BDYL 4MJIE 3ARPA 1FL5A 5HYSB 1L9NA 3X17A 5E0QA 4OD3H 2H1PH 4AENA 2CUMA 4QHLA 1MJJA 1HYSC 3QI9C 1HEZA 3TYGH 1FNGB 4O02H 1DBML 2BVPB 1CGUA 1N2RB 3T0AA 2ADGB 3RBSA 2AV7B 3IFNH 1G7HB 3MLXH 4YNYA 3IDIB 4QXGL 4ZD3L 4CMMB 5I1JH 2FWOA 4DOHB 3BP4B 3MCKB 1SJEB 3ZE0F 3IDYC 4FQPA 4L4JA 4U3HA 3RZWA 5BZDA 1M7IA 1OWRM 1N26A 5D1ZA 1L6ZA 3BZEA 4Y5XA 1QNZL 1MLBA 5E08H 3VFNB 3FB8A 1MH5B 3TESA 4FMKA 1QFUL 5IFJB 1DQML 3UTZB 3U30C 5LGHH 4LEOB 2VLKD 2OSLB 3BQUB 1CVSC 3O2WL 1WWCA 3VWKB 3T0VA 2HH0L 5L2JB 2H2PC 2EZ0D 2J88L 4L9LA 2RHEA 1WVZA 1HIMH 1AO7E 1E4KC 2VLLA 1N59A 1MCRA 3MLUL 1AE6L 1TDQA 2D0HA 4WWID 4X5XB 1EAJA 2W91A 2D9QB 2ZKHL 1QSFB 3BUYA 1KIPB 4JPWL 5JW5A 3N1FC 4OZ4B 2ADJA 2HAZA 4GAJH 5B4MD 1P5UA 1K8IA 1JFQL 2AXFB 2JJWA 2WMPA 4NQCA 5D7IF 4BFBD 1TETH 1N4XH 1LP9F 2VN7A 3VRIA 1E6OH 2F5BH 3NH7H 4R96A 5DR5H 3S88L 5T5NF 4KK6C 4RMUA 4LASH 4DW2L 3RUGA 1E4XI 1I1RA 3VXOB 4XHJD 4X5WA 1IQDA 1R3IL 4RMQA 3W2DL 4QRPB 5KVFL 4EJ1C 2DTML 2H9GA 2PKDA 3TF7C 1X5ZA 3U9UB 4P5TB 4YIQB 4PY7A 2HA1A 1S7TA 5JA9A 2J8HA 3VGFA 4HUVB 2X9WA 4C54A 5LGKA 5SWSA 2CRYA 5BV7H 1RK0A 1ZA3B 1BBJB 1P4LA 2DYPA 5E6IA 5JORA 1AIFA 3DYOA 5I76B 1XF5B 2VL5B 4H5SB 3GRWA 4NN5C 2V6HA 3T0EE 3L5JA 3PWUB 1BEYH 4Y1AE 4KRLB 3NIDF 1AC6A 3IXTB 1NCUA 2DQCL 1K4DB 2A1WH 3BH9A 2A0LD 1IM9B 3QZWB 3K8LA 2MPAL 4PJXE 3V6FA 4HK0A 4C4KT 5DD1L 1B4JL 4PS4L 4P3CH 4NQDA 3VFTA 3VXQB 1KCSH 3BO8A 4TNWF 5IMKA 2XN9E 3DURB 1HSAA 1QLFA 3T1FB 5DK2A 5L2KB 3BE1H 1QFWI 1WEJL 4PB9H 4Y16A 2NXZC 5F7EL 4I5BA 4XP9H 3QFDB 3AAZB 3CLFL 4X99B 5L8LB 3MRPB 4C56E 4DVRH 4PJ9B 1Z9MA 2FD6L 2J8OA 2W92A 4P0DA 4F7EB 4N8CL 4Z7NF 5FYLD 1FORL 3QHTC 4RMSA 3ULVD 4X4YB 4KVNL 1YNKH 1QFHA 3JWOL 4KKCD 3MV7A 1JWUA 3ARBB 2FJGB 3UZEA 5SWQA 1QVOA 2CLRA 2VABA 3RX8A 3ZKXC 3VH8A 2YA0A 2F9BT 1IC7H 5IROA 3GJEB 4HQQL 5IQ9B 2AKRB 4LSRH 3FQNA 3VWJD 4J4PA 4WFEE 2AJXL 5TQ2H 5IOPB 5FO9B 2B0SL 2P4AB 3TYFB 3ZDXE 3C2AH 5LGJA 5D7LD 3SDDC 2B4CL 2MOVA 1U2CA 3GSNL 1UB5B 2FSEB 3MODL 2DLEA 5D5MF 4MMZC 3LSOB 3GM0A 5IHZB 4PYHA 5ALBH 4RQQA 1U92A 2W9EH 4CW1A 5DJYA 2FX7H 2RR3A 4M93B 2VMFA 2AXHA 3SGJA 3Q6FB 2GJJA 2XA3A 1CDHA 1K6QH 4QRTB 3CUPA 5T33H 2PYEE 1MCOL 1T0PB 1JF1A 1OSPL 4WI4A 3BSZL 3UO1H 5E8DH 1PSKH 5BRZB 3MUY1 1NCWH 4RBPH 2P7TB 3FT4B 1HHHB 3K8MA 3OGCA 2A6KA 4EDXB 3QFJB 2P24B 2YKLH 3QIBA 2C7UB 1XIWC 2BMKB 4P2OD 2OXGA 1U95B 1HYSD 3QI9D 4S1SH 3LRSA 4K7PY 3TM6A 4JO4H 1KIQA 3KVQA 5ID0B 1DDHB 3FCTA 1JL8A 1MCSA 2VUYA 3HLAB 3GJFH 4XNQB 1BVZA 3MRQB 1T4KA 2H45A 3HPJB 3MJ6A 1R3LA 1XAUA 2FJHA 1CXFA 2ESVE 1KNOB 1UCTA 5CBEA 2P5WB 4JGMA 1A6WH 4KKAD 1EMTL 5HHOD 1KJ2H 1CICA 1AGFB 4EI5B 1P7QA 3MRFB 4JFDA 4DN3H 2H2PD 5GHWL 1EO8L 2D0GA 1AP2A 4Q58C 3U4AA 2DQGH 5C0CB 5JHDD 3O8XA 5FO7B 4MJ6A 3ARSA 3TT3L 5IP4A 1EBPA 1AXSA 4P2CG 1YEJH 2LU4A 4C59B 1H0DB 4X4XA 4JFPA 1FFPA 3DX7A 4X83A 1KTLA 2L0DA 3MJ8B 4ZOAA 1CBVH 2CGRH 4OLWH 3DO7A 1E4XL 1ZWIA 3RNKA 3MRCA 4S2SB 5HVGB 4UAOB 2E7LC 3PGCA 4Z95H 4LHUA 1EX0A 1NCCH 3W0WA 2CRIA 3S35X 4HJGB 1P7HL 4TOYL 1JHTA 3BGMB 1MHPL 3RIAF 1T83C 4XPTH 2JJTC 5FAAA 3SDAA 3LHPL 4G6KL 3P4OB 3SKJH 1IFHH 2HT2C 3KPMB 2J8UF 3RZCB 5DGQA 1YNTA 4ODTL 5DJ8B 2VXSL 4ODSH 5D1QA 2EYRA 5CJOH 3WDJA 2GTWA 3GO1H 1WT5A 1PY9A 2CK2A 3OJDB 2BY1A 2VLKB 4ZAKA 4PRBB 2V17L 1FNFA 1P53A 2F8XC 1JZ3A 3ISWA 4JY5L 4M7JH 3LZFH 4DAGL 5IW3A 4YQXL 4G42B 3S5LA 5DQJA 3TJEL 5TGBA 2VXVH 1DFBH 5IMMA 4QRUA 2DKMA 3F8UB 1BM3H 1F4YH 2WIIA 4ZS6D 1J8HE 1DQDL 1QRND 5CSGA 4K8RL 4FN0A 2QR0A 4JHBA 4U6XA 4APQD 3MNVA 3MXWH 1QFWL 5I18H 3S4SB 5DT1H 4K9EL 4W4OC 3GBNL 1ONQA 4Q6IA 1VKXB 5I9QB 1F6AB 2X4QB 3N1PC 1A22B 4J3OC 4PGBA 3MFFA 5J9PA 3QUYA 1AQKH 2BCKA 3O2DL 1PYWA 1WWBX 1QPPA 1RIVH 4JKLA 3KPNB 2ZUQC 3QCUH 4AIZA 3MRBB 2JB5H 1ORSA 3BEVA 3MUGA 1H3XA 4OCSH 4N1HB 3C60A 3O6KL 4HK3N 4O00A 4FABL 3GSXB 5EOTB 5GJTL 1BFVL 4ZMAT 3V6OC 3AS0A 1FN4B 1FGVL 2HFEA 1EVTC 4KTEL 1JPSH 4N1EA 3HAEG 1A47A 1OF2B 1OGAD 2X1OA 2AJ3A 3WFCH 4XB7A 2JIXB 4N9OB 4RX4A 2DB8A 4L3CB 1RD6A 2VDRL 5FHAL 1A7PH 1KEMH 4OM0L 2D7TH 5F6HJ 4QCIA 1MCPL 4GRLD 5B39G 2FJFA 3OJVC 4PRAA 2LTQC 4QHKI 3C08L 1KB9K 1AGCA 3BIAX 2VISB 3SDDD 4BSWB 3WN5B 2E8YA 3MRRB 1GZPA 1Q94A 2MWCA 1IKNA 4YBHA 2V5SA 1T7WA 5CZVH 3HI6L 2CLZB 4UTBH 4ZPVA 5I8OL 5JW3L 3LKRA 1TQBB 3VFWB 1DBAL 4U6YA 5KN5B 3O9WA 1FVCA 1QPXA 5F88B 4XWGL 4TVPD 2D2OA 3OR7A 1B0WA 5MI0B 3BDBA 3DHJA 1CDBA 5HD8C 3HZVA 3WHE1 4Y4FC 2X89D 3CZFB 3HUJE 4YDLB 5JXEA 3IFOB 5EG6C 4XHQA 5DMJB 3QAZC 3LOWA 2VZVA 4GKNB 2AK1H 4TUOB 2ARJB 4PP1C 5EDXA 4LLUB 5IFHL 2MQ0A 1GAFH 1FVDA 4L8DA 4PY8I 3SDXE 2XZCH 1FO0L 5DLMH 5F9JB 4QXTB 1MRDL 3QWRD 2GK0A 4BFIB 5HGDA 1NGYA 5J3HD 3SDCB 1OWWA 4IDLA 4NQED 3ARDC 2VITA 1ZTXH 1A9EA 1ETZB 5I1IH 3UCRA 3CVHL 4IRJC 4CU8A 1IAOB 4P9HH 3PWJB 3RVXC 1MJ7H 5I1CL 3GRWH 1T0NB 1TJHH 4Y8AA 4NQVA 3EDKA 5CSZA 5FKPB 4F9LA 3U2SB 4NKOA 5GGQH 1NDGB 2X7LA 4PLJD 1YYLH 1KPRB 2C4XA 2XI9A 3MBEC 5BCAA 3LIZL 2R2BB 1N6QH 4XP1H 1S9YA 2IH1A 2P43B 4U1HB 5DI8A 5IK3A 1FYTB 4GAYA 2ICEB 3NTCL 3W9DB 1BFOB 3STBA 3ARFB 2BHUA 4TSAH 3WE6B 3BISA 4TPRH 2BY3A 4C4KO 1VGKB 1M4KA 4KDTA 5F1IB 4QHNB 4KK5C 1X7QB 4HK3J 3DXAD 5CEZL 2QSQA 1I1AD 1N3NA 2ZCHH 4LNVA 2NX5B 4YGAB 5HYSA 5SX5H 1AR1D 4NKMB 5DD5H 4G7YH 4O2FB 4OF0A 4P2OB 4FG6D 4WJ5B 2OZ4L 3QI9B 4R3SA 4ZYKB 1FNGA 2Z35B 2Q7NA 2YUWA 4KZEH 2X41A 2ADGA 3HE6C 5A40E 1RV6X 1QSEB 1WGOA 5EU3B 1MCDA 4HEME 1T20B 2QADC 3BP4A 3MCKA 3TBWA 2C3XA 1F90H 4LPXA 5CJXA 5IW1B 5HGBA 1U8JB 2HT2D 3WHE0 3IDYB 3D9AL 1UWEH 5CZKA 3VFNA 4N90D 1MH5A 4FXLA 5IFJA 2VZ1A 3UTZA 5HHOB 4LEOA 4PJ8C 3SPVB 1U3HD 5T3XL 2OSLA 3BQUA 3P2TA 4Z7OF 3VWKA 5L2JA 5E2TH 2FLBT 4MJ4A 2E7BA 5C6TH 4ODHL 3OB0K 4FP8H 5JHDB 1GJIA 4X5XA 3FN9A 5ESAA 4NBYB 1AXTL 1S7QB 1ADQA 4ZFGL 2XT1B 1EK3A 1KIPA 5E8PB 3QXUA 3OQ3B 25C8L 4JPIB 5DMKA 4OZ4A 3QT2A 4AG4H 1T5XB 1IGFH 2AXFA 1MRFH 3RFZC 2G60L 3LH2L 3LN9A 3NABH 4YAQB 2YOCA 3JWDH 3U4BL 5CMAA 4BKLB 1I9EA 3L5WB 4KROC 3PHOA 4FFWD 5HHME 3GSNA 4WW2C 3DROA 2HVJA 1O7VA 4KHXH 3VXOA 1GHFL 1IT9H 2X05A 2APTA 4JO3L 3LKQB 3BPOC 1CFSB 4XPFL 3U9UA 4LRIA 4P5TA 5ETUB 4YIQA 1S7RB 3D39B 5F7HA 3DSFH 3WIIH 5DMYA 4HUVA 3MACH 3I3EA 3RUGF 1MJ8L 3HPLB 4LSDA 3CK0L 3EYQD 4Y4HC 1ZA3A 3UC0H 1YY8A 1W0WB 3KYOA 2BP3A 1E27B 1KIRB 5BOPA 1RVFH 2WAHA 4BUHA 1EJOL 3MRKB 1IQWL 1A7RH 3BZ4B 4W6XB 3TA3C 4HCRL 1MEXL 3EOBB 2B2XH 1QRNB 1UWXK 3PNWB 1K4DA 5JZ7C 4K2UL 3QZWA 1JHKH 1LE9B 5JR1L 4LK4A 1WZ1L 4JDZB 4JZOB 3DURA 3PXHA 3GUTB 1JPST 5DEFB 2MSPA 1YYML 5L2KA 1J5OH 5IEKB 3B9EA 5CD5C 5GISL 1KV3A 2NXZB 2AAVA 3RHWK 3QFDA 4X99A 3MRPA 3ARTA 2EDBA 3KG5A 4PJ9A 4NUGH 5HD8D 1EBAA 4P9MH 4BQ9A 4D9QE 5T3ZD 1GH7A 1BIHA 3KPRB 4DKDC 2FZ3B 1NLBH 3IYLW 2LQRA 5DVKA 3LKOB 3ARBA 5IVOA 1KJMB 1RZJL 4MNHB 5HY9B 5D8JL 4HV8B 4LVNB 3PWPA 3ZKXB 1OGAB 3AMKA 3GJEA 4PRHD 1MFCL 1P5VA 5IQ9A 3HZMB 3AROA 3A6OA 3RTQC 3I9GL 5I0DA 1RUKL 4YXHH 2YPLD 4GRLB 3WKML 1S9XB 1Q1JH 5H2BB 1RMFH 4PJAE 4X9GA 1KUMA 5IOPA 3FJTA 1YEEL 5FO9A 3TYFA 4J12A 5F97E 1NCAL 3SDDB 2FR4B 4K3DL 1UB5A 3AM8C 2IBBA 2P45B 4J3VA 3U79A 4PJFB 1KOAA 4XCEB 4ODUA 3ARWA 4KRNA 5IHZA 1YEGL 3MBED 1A6UH 2Z8WC 4R90H 5IVXE 4IMKA 4HLJA 5EBGA 4C55A 5BS0D 3MV8B 4DGIL 3Q6FA 4Z8FL 4JFYB 4ONFL 2ERJB 2A77L 2OJZH 4QRTA 4WW1B 1EGJA 1MQKH 4XC1L 4X4MA 1IZKA 2AV1B 4MXWH 1XGTB 5C0BD 3S35L 4KK5D 3G6DH 3AUVA 4O5LL 1J0JA 4JKWA 3V7AG 2P7TA 4EN3D 1MFBH 2BX5A 1ZLUH 1U2HA 5DRWB 1HHHA 5EC2B 4UOJA 1D5BB 3VFOA 1ITBB 4OF6A 4EDXA 3QFJA 2P24A 5DA4A 5K93A 3TH2T 4OB5L 1R5IA 5E9DD 1KN2L 4NQEB 1XIWB 2BMKA 1M1SA 5BW7C 1CFBA 1U95A 5ADPH 5FECB 4P59H 2VXUL 2P44B 3HE6D 3RL1B 1ZANL 4FXKB 3PXJA 3HLAA 5DMIL 3F65A 1OGTB 4XNQA 5F8RC 5IV2A 2DJSA 5LXGL 3ZSTA 3WJLC 4JQIL 4NO3B 3DBXB 3U4EB 3VMOA 1ZA6B 1DBMH 1MVUB 4U1MB 1MCHA 4X6DA 1JYVA 4TUKL 4ZXBC 1AGFA 2BJMH 4EI5A 4WNQB 1J18A 1T89C 3MRFA 1FG2B 4ZD3H 1S7SB 5ANME 4QXGH 1J0HA 1MWAB 4OCYL 1WFNA 2PN5A 3PABB 3KPSB 1HQRB 3EDFA 1AQDA 4M6AA 3DXAB 4ZSOE 4DUVA 3VDAA 1I1AB 5JIPA 4Z5RB 1EAPB 1QNZH 4XVTH 3ZE2F 1QFUH 1DQMH 5CLWA 1ROWA 4ZTPH 4XPAL 1JE6A 1H0DA 2VJXA 4HAFA 5LWYL 3O2WH 4L4VE 4R26L 3CDGB 2HH0H 3MJ8A 3FO1B 4YBLC 4S2SA 4HS6B 4NC1C 3MLUH 1AE6H 5B8CC 4PIRF 2R15A 2ICCA 4HJGA 2VDPL 4PJ5B 5GRWA 4XWOD 2ZKHH 3ARVA 4JPWH 3UYPA 4Z7QE 4BFEA 2FRGP 3P4OA 4TVSa 1U9KA 1C5DB 1JFQH 3KPMA 1HYRC 1T3FB 1BLNB 2VRAA 1NBQA 1JNHA 3O6ML 5DJ8A 3VXRB 4I77L 2XY1A 3QNYB 1C1EH 5JDSB 2JK5B 2BSED 4NJAL 3S88H 4XRCA 3RNQB 2VLKA 3AS2A 5FYKD 2I5YL 4DW2H 4PRBA 1KLUB 4Y4HD 1JK8B 3UTSE 1L4IA 5D70L 3GMMB 4G42A 4PFEA 1R3IH 3DTXB 5KVFH 2DTMH 1FO0A 2V5RA 3TFKD 3K4ZA 2V7NA 2YEZB 1CF8L 5SWZD 3GSRA 5JZ7D 1CE6B 1VFAB 3CIQA 3K3QA 3KS0J 3WLBB 5C0EB 5CBAB 3GEWB 2Y72A 4JRXE 1VKXA 4PV8B 1JJUA 3IFPA 2X4QA 3DUUB 2AVGA 5FOBB 1NGPL 2XIDA 4TTDD 5AWNL 2R56L 5DMGC 1XGQA 2MPAH 1OAUL 1OT2A 3KPNA 1JIBA 3RWHB 5DD1H 1B4JH 4PS4H 3TBVB 3MRBA 5DD3L 4TNWK 5EO0A 3SJVB 4KKNA 4P2RE 3ZO0A 3GSXA 5EOTA 3RY5A 3VXNB 3LV3A 4LPUA 3PP3H 5DEGB 1X5YA 2YA2A 1FN4A 1WEJH 2DM3A 2PYFB 4BELD 1P84J 3OAZH 3S36X 1EEYB 4XH2A 5EU7E 3GIVB 4G8GE 1G7LB 1CTOA 4L3CA 2NY6C 4N0CC 4KAQL 2Z92B 4N8CH 4AEIL 3RTQD 2QV2A 1FORH 3Q5OA 4KVNH 3SGEH 1NCNA 3AS3A 4XP6L 3JWOH 1G6VK 4PD4K 2LTQB 3ROOA 1LO0L 3L6FB 4BSWA 3WN5A 3MLPA 3MRRA 4E5XB 5DHYB 1NBVL 3S6CA 1ZT4B 5F6HI 1TQCB 1GXEA 4HQQH 1UH4A 3MMEA 2CLZA 3NCFB 1FC1A 1GGBL 1SBBA 3VFWA 5KN5A 3FONB 3IKCA 3FHAA 5F88A 4LAJH 4RAVB 3X13B 2B0SH 2XWBB 2B4CH 1P2CB 2FX9L 3GSNH 3CZFA 4QHMB 3IFOA 3MODH 2C26A 4Y4FB 4HXBL 3QAZB 4GKNA 3VD7A 4NYLB 2ARJA 3X3GH 1HXYB 4LLUA 3OJMB 3QULB 5D6CA 4MS8C 3D5OF 5C9JB 5FV2A 2DLIA 5F9JA 3V5DB 2GAZA 2BSTB 2E9JA 3KHQA 3VWJA 4OI9A 1N8ZB 5DYOB 1JMXA 2YPLB 3C09B 3VRLF 2ZUYA 1ETZA 4PRID 3K81A 1MCOH 1Q0YH 5TDPB 4U6VL 1H3UA 4LLDB 5D7LA 1AGEA 1IAOA 3BSZH 4YFDB 4M1GL 1T0NA 1YPZE 5FKPA 3U2SA 2NXYD 5DEZA 1J86A 4PJIB 4YHOL 5BXFB 1KPRA 5DC0A 1CFVL 2HJKB 3MBEB 4L8SB 4PREB 1CDCA 3CLEL 2R2BA 4HSQA 5BS0B 4F7PB 3QBTB 4U1HA 1BQHB 5ERWB 5I2IB 4WO4C 3W9DA 1BFOA 5GS3A 4EXPX 4KJQC 4K71C 1PX4A 1VGKA 5L6YL 5F1IA 5I8KL 5C0BB 1S7WA 4D3CL 1OD9A 4KUCD 1T1YB 3GIZL 4G8FA 3T0XA 3NBNA 4YHMH 3GDBA 1JI2A 3QDAA 4HCRA 1EMTH 4NKMA 1M71B 4O2FA 3F7VA 4P2OA 4WJ5A 3QI9A 4ZYKA 2Z35A 5GHWH 3L1OL 4DCQB 5GZOC 2XWJB 3HE6B 4V1DD 1NUNB 1BGXL 3TT3H 2PNDA 4ODXB 1T20A 1LILA 5HI3C 2QADB 2NY5L 3OJ2C 3A6BH 3MLVL 5IW1A 1U8JA 4L1DA 4PGDB 2EC9U 1E4XH 3BPCB 3IETB 5HHOA 4G9FE 3SPVA 4X7SL 4PJ8B 3SO5A 3RIAK 5ESVB 1MHPH 3T04D 2XFXA 4NFBA 3U36B 2IBGA 2OR8A 3LHPH 1E4KA 4G6KH 3ZMRA 1CIDA 5JHDA 3F7YB 5JW4Q 1QSFE 4BH7A 1I3RB 1CR9L 2BRQA 3GMOA 3DV4B 1CQYA 4Q2ZA 5KJRL 3C5SB 4ODTH 3BKJL 3O3BB 5E8PA 2APBA 4JPIA 4YEFA 4JEGB 5AZ2L 4WFFE 2BVOA 1T5XA 3O11B 2BERA 5I8CB 3MZTA 2V17H 2YK1L 4XMPH 2R9HC 4JY5H 2EC8A 1JGDB 4GXVL 4BKLA 4DAGH 4WDIB 1S7VB 4KROB 3WDHA 2IC2A 3AREC 3EHBD 3SCMC 5IMOA 4WW2B 4LLVA 1DQDH 4QRPE 4U7MA 1JNNL 3LKQA 4K8RH 4PJBB 1CFSA 3RPIB 3BPOB 5DMGD 5CJQL 2ITCB 1ES0B 5ETUA 1JNJA 1S7RA 1QFWH 2M1KA 1MCNA 3PWVB 1U8NA 4G8IB 2VXTL 4K9EH 5L8JB 4I3GA 1XCQB 2XYCA 3VFSB 2J1KA 3HPLA 3ZTNL 1XEDA 4Y4HB 4G6FB 1W0WA 4LPVA 2O26U 3ALWA 1E27A 1KIRA 3PGDB 2OI9B 3O2DH 1MI5D 5GXBB 4ZFOL 5IW6B 1S9VB 3MLTA 5E5MB 4FFZL 2C3GA 5DXWA 5C09E 3BZ4A 4YLQT 3IXAB 1A7QL 3EOBA 1QLEL 4N0CD 5SWZB 1QRNA 3PNWA 3WUZA 5EU6D 4HIEB 3O6KH 4FABH 3BZFB 1LE9A 1UJ3C 5GJTH 1BFVH 3VXME 4APQA 1YC7A 5CP3A 4JDZA 2I25N 4RBPK 3R8BB 5L2KE 3TT1H 2BVTA 3GUTA 5DC4B 5DEFA 3WNNA 1HN1A 2GY7B 3RGVC 3H9YA 5F3BB 1Q9LA 3OZ9L 2VDRH 5FHAH 4OM0H 1MCPH 2HJFA 5BOZG 5J1AB 5C0FB 2IFGA 1JGUL 3C08H 2D7MA 3GJFK 3WL9B 4OLZL 3EDDA 4UIMA 5KS9B 5EU5B 5AEAA 4FQCL 1FVEB 1GGYA 2FZ3A 4M1CC 5I8OH 5C92A 5JW3H 3LKOA 4MAYC 3RWFB 1DBAH 4MNHA 2IGFH 1FAKT 1KYOJ 4HV8A 4ONGL 4XWGH 1OGAA 2HMID 4JY6B 1XT5A