3EJYC

Structure of e203h mutant of e.coli cl-/h+ antiporter, clc-ec1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Intracellular proton-transfer mutants in a CLC Cl-/H+ exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system/proton transport
total genus 34
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejyC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejyC01
1H15B 1WBYB 3DVGA 2E7HA 5ESVB 4Y1AA 2P1YA 1XF5B 5BZDA 3PV7A 2K9UA 3EOTH 3QWRD 1JNJA 3T3PE 1CF8H 3M17A 4HJJL 4ELME 1I3VA 3A6BL 1NCWL 4C56A 3NPSB 1MCPL 1UQSB 3KG5A 1EIBA 5FM8A 5DURD 1YY9D 1ORQA 4JJ5A 1XZ0A 5MHSD 4X98A 4UV4H 2HLFC 4L3ED 3R1GL 2BCKB 4K8RD 1BJ1H 1MHHB 3VXPB 5A40E 3EFFA 5E2WH 3ORJA 4PGEA 2A1WL 5CD3B 4MNGE 3VD9A 2ZOLB 1CLCA 4JO2H 5EZIL 5MEOB 3TV3L 3UP1A 4Z7VE 1U3YA 1B0WA 3V52H 4LPWA 5I1KH 3U1SL 1CLYL 1LO0L 3O3AA 1DL7L 4TUOB 1G9ML 1JGDA 3P0YL 4KVCL 3V4UL 1ZT4A 2VL5B 3RKDD 1GOFA 4Y1AD 3TO4B 4GSDH 1YQVL 4NUJA 4QRPE 1YEFL 1I1AC 3S96A 2CQVA 3GSQB 1RFDH 3VD4A 3E2HB 1MCNA 3MRQA 3I6KB 3AB0C 3DECA 5ACZA 5GGTH 3D25B 4C56D 3AREA 4OM1H 5EZLA 1KJ2L 5I71C 3SDYL 4UQ3A 3GIVA 2HN7B 1NFIB 4QTIL 3MO1A 3VA6A 3WIFA 3BN9C 4IIQB 5GRJH 4G7YH 4G42B 5LCVH 5C8JA 3FB8B 2VL4A 1KIQB 4YQXH 2GTZA 4GG6E 4JPVH 4LLVA 2XPGA 5IBLD 3Q6FA 1MWAL 1BFVH 3TZVB 1MHEA 3C2AL 3FQWB 4RMVA 3H3KA 1NBZB 2M1KA 4PJFA 5HGAA 4PGBB 5FYLE 1I7RB 5I75C 4YHML 3L6FB 3N1PC 5EIQA 1CXHA 1RUMH 4OIIH 5C0BB 3LMJH 3LPGA 1CE1H 4PY7A 1A6ZB 3ARED 3IDJB 5E1AB 3SDDC 4ODHL 4NQVA 1C7SA 2BSSB 4OZFG 1RUAL 3MOAH 4P5TC 5GJSL 2XN9A 3LKOA 4E0RB 2A9NL 2E9IA 2OCFD 5AUMA 3AROA 4N0YL 1G9NC 4XCFH 2VLRE 3IXTA 3VA2C 4AENB 1U93A 1TQCC 3SDCC 1YEJL 5CHNA 3LIZH 2I60L 1CU4H 2OL3H 2UWEA 5DJCB 2ZPKL 1T20A 1XGPA 5SX5K 1JGUL 1MCWM 3BGFC 4OZIA 1A6VH 4YHPA 5FO9A 5INDA 3NH7L 5TQ2H 1AXSB 3OB8A 5JMOC 3DGCR 4U1IA 3C5ZC 4LKXB 2VDPL 5D2LA 1ZT1A 5MERA 4GMSL 1BQLH 3QIWD 2GJZA 5E08L 5BXFB 2XN9D 2OS7A 1UCBH 2NXYC 2Z31C 5E8DL 4GRLA 2D4DA 3WNLA 2HVKB 5FHBH 5DVMA 4JQIL 3T2OA 4P46B 2EDJA 1UEYA 1NCBL 2QHRH 2YUWA 1QEWB 1CQKA 2A6IB 2IPUG 4KHXH 3RVWD 4EXPX 4ZXBA 1D5MB 3CU1A 4G9DA 2DQCL 5DK2A 1A2YB 3U0WL 4GRWE 2BVOA 4MS8D 4WY7L 4YXKL 3EOBA 4AIZA 5EB9A 4JPWL 5FB8B 4U6YA 2IGFH 6CGTA 4DTGL 4OIAA 4L1DA 5E2VH 3S4SB 3UBXG 1TFHA 1YNTA 1DSFH 3PWJA 5HBBA 4YJZL 3JZ7A 3GM8A 5CEYA 5IEHA 4WGVB 5F7NC 1PYWA 4CJ0A 2NTSP 2PW2B 1T6WA 3TCLB 1HH6A 2F53E 3V8CA 2NY4B 3REVA 2ICWB 2VERN 4GRLD 3STBA 4BFGA 4U1NB 3RWEB 4ZTPH 2UZIL 1BOYA 4GRMB 3L3IA 4U1HB 3TBYB 3BE1L 1JHKH 4P9HH 3IYLW 1L7IL 2WBJC 4PJ8B 3WMSA 2NLJB 4ZXBD 4QHNA 3DGGB 4NZUL 2HJFB 1S9XA 1S7VB 3IJHB 4XNZC 3CFDA 3RHWF 4JEGB 5C0AB 4APQD 1H3WM 5KZCB 3OKNA 4ZFGL 3PHOB 5BCAA 4UINL 3NA9L 4XP4L 4MHHI 3W9EA 4LLMA 4EOWL 1P6AB 4NZTH 3IU3B 3VFNB 2NZIA 3K80A 4ENEC 2HG5A 1T1XB 1F8TH 1NLBL 4PJ7B 5ACMA 4LL9A 1FNEA 1NCWH 3OKDA 5J9PB 1N5YH 3KPTA 3O4OB 3ULVH 4LASH 4XP6L 4QRPD 4YPGA 5IESH 3VGBA 5CINL 4MD4A 1HINH 5MI0C 4NQXA 5I1HH 5D70H 2NNAA 2YPKB 4WW1B 5J11B 1N6QL 4FHBD 3HZMA 4PLJC 5TQ0L 4I2XA 4G3YH 4IOFC 3HUJB 4UDTB 4W4OA 5KS9B 3TBTB 4DZ8B 1CFNB 1N5AA 2XY2A 3FOMB 3KYNA 5E6IB 4YFLF 4TQEH 3N9GL 1OSZA 3R06A 3CZFB 1MCOH 1ZANH 3VXUA 4JVUA 5KSBF 3U2SA 1ZHNA 3F12A 3G5ZB 3G5XA 5BS0B 5DMKB 3MQIA 4CW1A 2FECL 5DYOB 3RUGE 4C83A 2ENYA 1FSKC 1SQ2N 4Q6YA 1KJ2H 5DK3A 3HB3C 2FSEB 1R3KB 4LDEB 4ZQKA 4M5YH 4AJ0A 5FYJH 1E4WL 2B39A 5HHOE 4O2FB 4HPYL 5I1AB 3OXSA 1IAKB 3E1F1 4N9GB 4QXGH 2Z93A 4AL8H 2WBWB 2V2XB 4W68A 1KT2B 2Q3ZA 5IVZB 1A5FL 4ISVB 4LVOB 1CDYA 1BM3H 1PQZA 2C7UA 3THMH 4LLYA 5IJVA 2HJLA 4KK6D 2WIIA 1GC1H 4YK4B 4YNYA 4Y8AA 2H1PH 2EH7H 2FIRT 3WSQH 3RNQA 3VXUD 1FFNB 5A3ID 3QDME 3BKMH 4S1DD 3DXAA 5ID1B 3RZCB 5L6YL 2AEPH 1S5HA 4XCCH 5B3NA 1DCLA 1FVEA 7CGTA 2DM7A 3ILQD 4X6CE 3U48A 4YXHH 1AR2A 4EBQH 1FO0L 1RMFL 3ARUA 4ODHH 2LTQC 2VLME 3QRGL 2O93L 4ODTL 3QXAA 5GJSH 2DLIA 1I7TA 4F3FA 1YMMA 3EO0A 4L8SA 4EDWL 3TWCH 5LAXB 3VWKC 1H8OA 1KCRH 4U1KA 5IMMB 3RFZC 3MGOA 1AIFB 1U8KB 2I25N 3JV0A 3LKPB 2WWMD 1OGAA 1BOGB 2GSIA 4PJ7F 4LVEA 1MRDH 2X10A 3MLXL 2DL9A 3TH3T 1MRCL 3MLTA 4BQ6A 1CVSC 1IGJB 2BOCB 2DQUH 2B7DT 3QUXA 5HVHB 3WS3A 1IGIL 3PV6B 1CWVA 3BESR 3DVNB 1W72L 1S7RB 5I8KH 1JHTB 4Y5VC 3DRQB 2ZUTA 4IOSD 3DXAD 1T7ZA 3JTTA 3JSSA 1IL1B 3IDIB 1AQDA 3FQNA 1T0MB 3MYZA 1GIGH 4I0PA 1MLBA 4P99A 1JV5B 3BWUC 4H1LA 2R69H 3NIGE 4M1DL 2EIZA 5D2NA 4Y4KC 4LSVH 1P84K 1YMMD 4YBHA 3O11A 3QHZH 2HH0L 4NCC2 3BVNA 4IJ3B 4PJXA 3GSOA 4I77L 4F8QA 3WDHA 3BPLC 4R3SA 4G7VL 3TA3C 1UEMA 1F3DH 2F53D 1P7KB 2VXSH 2R15A 3RRQA 3L9RB 4YDIH 1F6FB 3G5YA 3QUXD 2EIEA 3L3GA 4LPTA 3S35L 4QHMA 3VMOA 1OWRM 3L3OA 3MRNB 1IBGL 2AQ3A 3DUSA 5IHZA 4ELKB 2DJSA 1GGUA 1W0VA 3CLEH 1I85C 4KMTL 1AR1D 5JPMA 1IGYB 3UTPD 3DX6B 1WAAF 2VAAA 3FT2A 1DQLL 1S7SB 4EJ1C 4UILH 3FOLA 4I0PD 3NTCL 1HEZA 3RL2B 2O5XH 2JLLA 5HGBA 3TEUA 4BZ1L 1EGJA 5ITFB 5D7JA 4GUPA 1C5DA 4DGVL 1BWWA 2AV1A 5LJYH 4TNVF 5D1QD 3LS5L 1NAMH 3L5JA 1FRGH 2OJEA 5C0CB 3CZJA 4EKXA 4UOJA 1FZMB 1F11B 1FZOB 5DEGB 3GGWA 2X4RA 1DBBH 1JGEA 1L4IA 1KIPB 3CVHH 3WEXB 5H2BB 1RJCA 3KYAA 4XNXH 2CH8A 5E9DB 4XWGL 3QXWA 2KL6A 4WI8A 3ZE0E 4A2MA 3OKMB 4WUUA 5F7HA 1NSNL 1C5BH 2YPLB 4XNMB 1CLOL 2X4OB 5F7EL 1LO5B 4CVWA 1BBJA 4KRPC 5I8CA 3ARFA 3GSXA 3NCBB 2F54B 4KI5E 4DKDC 3D39B 3WNPA 1A7QH 4U1GC 1ITBB 2ARJB 4PUBL 1G7IB 3G6DH 1FG9C 5D7JD 4KY1L 3QDGA 3WLWD 5ERWB 1L9MA 1NUDA 5ANME 3DJ9A 3HNSL 3FN3A 4HXAH 2FX7L 5E5RB 4PB0L 1QNZL 3JUZA 1DQDH 3QJHA 2CD0A 3PWUB 4HBQA 2CUMA 5EH1A 3ULUH 3RZWA 3ALXA 5DXWA 5D72H 1PG7X 5IMKA 5HHOD 2VZSA 5DD3H 1FL5A 3ARFD 4WRLA 1R5IB 2QQNH 2D7OA 2E7LA 2CKBB 4N9OB 4DGYH 4RRPA 5J57B 4NM4L 5B4MD 2ITDB 4Z7NE 3V0WL 1CICD 5F7FA 3VDCA 5C0DB 3D0VB 3QDGD 5FO7A 2EDFA 2LE9A 4TOYL 1FAIL 4OUUB 1Q0YL 1BVZA 4CRPA 4YHKL 3CFKA 1QHOA 3QDMD 5T3ZL 2VLKE 2FECI 3VXTA 1CDIA 5I15H 5IVXA 4JDVB 5T1KD 2BY0A 1AO7B 4FQJH 3S36L 5C07B 4KJPC 1EMTL 4GJTB 1RURH 3RUGB 2NY2D 1EBPA 1CFSA 1XGTA 5IOPA 1SYSB 2ORBL 4HKBA 5EPMA 3AS3A 1T0NA 1HK6A 1HIMH 3QUML 5C2BH 4HDIA 3VFUB 5DJAB 1JFQH 4OZGE 1IC4L 3KPSB 1QSFE 4UAOC 1X9QA 1AJ7L 3B9AA 1J05A 5FXCH 4MJIE 4NQDB 3OPZL 4J12A 4ZDHB 1QQDA 5B39A 4Z7UA 4U1LB 2JJTC 2BFVL 2Y5EA 1ZHBA 3BXNA 4YDJA 3B2VL 1EHNA 3PL6A 2EKJA 3WJLC 2VXQL 5IHLB 2BXYA 2X70A 3LN4B 5IROC 4PJ9A 5E2UH 1EV2E 4JDTL 2EO9A 2QEJA 3RBSA 1CDUA 3LHPL 3LDBC 3BEVA 1DVFC 3W39A 4JO3L 5C0RH 4FOMA 5FGBA 2XKSA 5EZOH 1J0YA 1OTTD 2EEDA 1C1EL 2NY6B 4U1SB 5EIIB 3L7FB 3TN0B 3RVXD 2OI9B 2D3VA 1IT9L 4PJEE 3U7YL 2PO6C 1U8QB 3OJDB 1E4JA 2J12B 3STZB 5GS1C 4IHOA 4JZJB 4X5LA 4NZDA 2PYEE 2YK1H 4I9WD 1FVDA 1V3JA 5DLMH 1HE7A 4MGXA 3GDBA 4R97B 3J8F7 4PD4K 1EEZA 4IRZL 4HJ0D 4XXDB 3T65A 3K4AA 5IFJB 1KFAL 4HKZB 4PJ9D 3OTTA 4HULB 1MFAL 3HI1A 3Q6GL 2X1WL 1QA9B 3BZFA 3FB6B 2OSLB 2P7TA 5DD0H 4A2LA 1AGBA 4WW2F 4Q9CA 1YPZE 2L7JA 3QQ4B 1TMCB 5B38G 4U6HB 2OTWB 1LE9A 4LVHC 1NAKL 4UTBL 3LOWA 2ATKB 2GTWB 5C9JB 1KJ3L 1PG7H 4N8CL 3CDFA 5GGVY 1TJHL 4LF3A 4ZOEA 3VXQB 3QJFB 3W0WB 1F3RB 5IBUB 1HCVA 4NSKB 3MMEA 1N4XL 3W81A 1VKXB 3IDNB 1IFHL 2BDNH 1Q9OA 3H9HA 5H35B 3K81A 3QUYC 1NBYB 4P2QB 1YEIH 4M93B 4L4TB 4RGOH 3LV3B 4LQFH 4LEXL 3CFBB 4DZBA 2R4SL 1KPVB 4HZLA 3SGJA 3LH2L 1Q94B 3PQYE 2LABA 1B6DA 2IAMB 5FV2A 4H88L 4ZUUB 5CJQH 3ZT7A 4LQ1A 1JK8B 3K8MA 1JMZA 3AXLA 2R2HB 5JO5A 5E94B 2YD8A 1DANT 3QR2A 4HS3A 4Q6IA 4JY6A 3ARGB 5BVPH 1Y18B 1R3IH 1A7OH 2OMBA 2DM2A 2XICA 2YD3A 2J3SA 3MGTA 3D9AL 1EJ6A 1TXKA 4PJBB 4IRJB 2D9CA 2OL3B 2ICES 2XQYK 4PG2C 3GMQB 4WEBH 3NZHL 3HG1E 1Q9WA 4JFHD 3SDXE 4U0QB 2IG2L 3T77A 3PABB 5HYFA 3BHBA 5E2TL 4ZUVB 1KCVL 4ZUSA 4MNQE 1A3RH 5IVOA 1G7PA 1NCCL 4U4BA 1Q0XH 5JPNA 2VQTA 1GGBH 1O5DT 2FRGP 3M07A 5DVOA 4F7TA 3S34H 3WDJA 1V3LA 5EG6C 4PBXA 1INEH 4ZFFB 5I8EA 1EPFA 3PGDA 2V2WB 3WL9B 1FG2A 4NO2B 1WK0A 4DK6A 2P24A 4ONFH 1UXWA 5GRXG 3LY6A 1AGCB 5CEZH 2I26N 5F89A 1Q9LA 5DT1L 2BNRB 1E4KC 2OXHA 3ZE2F 4ZNEA 1YQ2A 1MHPH 4X4XA 2XTLA 5HJ3B 4KZDL 5DD5L 2KZ1B 1YN7B 1K9TA 4FXKA 3KPMA 1KC5L 1VPOH 2YS4A 3VFMB 2GQHA 1BIIA 2Q76A 4BQBA 1TETH 2EXWD 3LS4L 3ZKXB 3K4ZA 4GMTL 4QRRA 4P2RA 3WV0A 2VN7A 2P44B 4RIRB 4HUKB 3H6JA 3KDMB 4ZS7H 2AQ2A 4NKIH 2N4IA 1OF2A 2XI9A 3WS6C 3HPJB 5C0EA 4OQTA 1D5XA 4IDJH 1NDMA 5TE6L 3P77A 3ZDZF 1B90A 2CRIA 4KPHL 2HLAB 2J6EA 4M03A 2EYRB 3FHQA 4UOW0 4DVBB 2BVQA 4PV9A 1DDHA 5EU3A 1HSAB 1NLDH 4G6MH 3H9SA 1TVHB 4UQ2A 4YX2L 3GBNL 1QG3A 2P45B 1MJJA 2X4PB 3GKWL 3MOQA 2D03H 4XNUL 5IB4A 3RVVD 3RPIB 4AEIH 2F8OA 4M43L 4OJFL 2ZUQB 4L9LB 5EUOF 4YHOL 3KPRA 1F4WH 4P2RD 4KJWC 5C0GB 4JCMA 3ISWA 3C09B 1MWAA 3VG0H 3QIBA 3HMWL 2YRLA 4MAYD 4XCYB 4EIZC 1T5WB 2AJXL 4Y88A 1U92B 3EO1B 3BKJL 4K23L 3KPNB 4PP2A 2VZTA 5B22A 3PP3K 4CVXB 3MV8E 1QSFB 1G7LB 3FO1B 4FZ8H 4XBGA 4S11A 4LMQE 4NNXA 2HVJB 1NMBH 1I8MB 3GSRA 5F88A 1DQTA 1B0RB 1LQSR 4ODVH 5EU7E 1IJ9A 2C1PA 3DROA 3FQXA 4RDQF 3B9VA 3DBXA 2I07B 1NFDE 1F00I 4W6XB 4WI7A 1LDPL 2QKIB 4OKVB 2VDNH 2IALA 1YEKH 5EZJB 3TT1L 3MUGA 5EOCL 3OMZA 5I73B 2JB5L 1W0WB 2OR9L 3P4LA 4J3OC 3REWB 2CDGB 2VXVL 2DYPB 1SJHA 5JXEC 1R24B 4PRPB 3LKRA 2AI0H 2EE3A 5CP7A 1NGYB 3C5JA 1UWXH 4QGTA 4R2GB 5T5NF 3GK8H 1CGXA 4JFEE 3FFDA 1X5JA 5F9JB 2DWDA 3JWNC 1Y0LA 4WWKA 2XWJB 3BIAX 1T4KA 3FFCE 4EDXB 1MFDH 5CZXC 3MREA 2F74B 2AP2A 3TVMC 5C71A 1OGTB 3LKSA 3S37X 3L5WB 2AJ3A 4PJCE 3QPXL 3TC9A 5TFSH 2X4QB 4LLDA 2FHBA 3WFCH 3MBEC 5CCKL 1GGCL 4K3JH 1K3IA 3UTQB 3BIKA 3IFLL 4H1LH 1VERA 4AQOA 1BZ7A 4R0LC 5I1CH 2F5AH 3RA7H 2HAZA 5BRZB 3PQYD 1PY4A 1N6VA 3MR9A 3TBSB 2H3NB 4MA3B 1VFAB 5F7DB 3RWJA 2M8XA 3O3UN 5TDOA 4ZFOL 3MLSL 1SBBA 2V9TA 3EDFA 5KVDL 3E8UH 3O4LA 1CL7L 4XBEL 1EEUA 3QI9B 4ODSL 1WQVT 3L5XL 5I8OH 1XF4A 3VI4F 1KTLA 4ZO6A 1NANI 2UV3A 1ZA6B 4LK4A 1XR8A 5CZVH 3FB5A 3LH2H 1G7QB 2FH6A 4FQQA 2B1HH 3WIIH 3RX8A 5CSZB 5HYQA 1HH9A 3MRRA 4M1CD 2QJDA 1JYXA 4L8CA 3MRLB 3DYOA 2NW3B 1EGJH 2G75A 2IPTH 4GKZA 1I1AA 5KVEH 4XHQA 3TIDB 4XNQA 2PR4L 3QAZC 4KKLC 3TJHC 3O4LD 4XC3L 4PJIA 1QFWH 3MCKA 3KXFB 4PRAA 5DJ2A 1QFUH 3WLBB 4JFDA 4JPIA 3ROLA 4AMKL 2HLFD 5F96H 1CS6A 1J5OL 1E0OB 1U42A 4O5LL 4LHUG 1S7TB 3RWGB 2DQIH 2D4FA 4KQ4L 3HFML 3HLAA 3DURB 3OSKA 1RAMA 4MQ7A 5HD8C 3CSPA 3QXDA 4GXVL 2Z0BA 5D7IF 1KLGA 4G8GE 3X11B 2O61B 4R4FH 1FV1B 5F1NA 2YC1A 2P8LA 3OAYH 3I6LE 3KJ6L 5IB5A 5GRUL 4OKDA 4N0CC 5ALCL 2VR5A 1MJ8L 2GAZA 5GGQH 3HG1B 4W6YB 4L8BB 5A43C 5FUCC 2FHFA 3BKYH 2XNAA 3ZTNL 2YEZA 2HTKC 2HT4C 2H2SD 3CDYA 1KYOK 3X14A 3A67L 4G9FE 4GKNB 4QCIA 3WKMH 5CBEA 1S8DB 4JDZB 3SDDA 3I84A 4Z76A 1BJ8A 1KC5H 2VKWA 4NJAL 1U8NB 4P5TA 4JFDD 4FZEL 5L88H 5HGDB 1JBJA 4DUVA 4E41A 3VXRA 1G7MA 15C8L 1U2CA 1IGCL 3BN9D 4CADA 4OZHF 1NDGA 5ISZB 4UU9B 2KUTA 4CN4A 1LP9F 4P5MB 2A6DA 4KVNL 1ZEAL 3SDCA 4HIXL 4GW1B 4E42B 1TZHB 4YZFE 3E6FA 2XFXA 2R1WA 2X4TA 4LEOB 4QF1B 1DBJL 3RX7A 1DEEB 1AH1A 3S37H 1FC1A 3MLYH 4TNVK 3CVIH 4U3HA 2UZYB 5HHME 5FCUH 3M8OH 5ITBL 3MJ6A 4OM0L 1P4LA 2IADA 4MXQC 5HVGB 3SBWA 3UC0H 1AP2B 4JFOB 3WKNA 3MV8D 3MUY1 5F7YC 3C5ZA 1MVUB 1EERB 5DD6A 2NY0B 1WBXA 3I75B 3I6GB 4F37K 1MUJB 1NAMB 3SDDD 4DVRH 4NJ9L 2MTPA 4B7LA 4R96B 1P2CB 2B2XL 3MLPA 2B4CH 4P5TD 4OAWA 3IVKA 3CVHB 4CVZB 1SVCP 1B0GA 4QT5A 4E41D 12E8L 3VXRD 5GZNC 5ACLA 3SPVB 5HHQB 3QFJB 2CK2A 4U1MA 5TE7H 1A02N 4U7KA 2DD8H 5E00A 5FKPB 4MD5B 5CEXA 3V6OC 3K46A 4NRXA 1TDQA 3MFFA 4X6BA 3H9YA 5D7LA 5ICXB 4HK3J 4X0KA 2EZ0C 4XVJL 1Q9KA 1PLGH 1PKQA 3I50H 3MV7E 4KRLB 4WW2C 5BVJB 4NBYB 4WFGD 5IJKC 2G60L 4K94C 4XWOC 3MX0A 4HG4J 1B4JL 4KTEL 1RZ7H 4JRYE 4MA8H 2MQ3A 5SWSA 3GRWL 3FFCD 4XPBL 3C5ZD 1KTDA 2MPAH 2X9YA 3CC5A 1MQKH 3Q3GA 1CDBA 4JREB 2JCCF 4PGDA 1XT5A 3BKCL 3O8XC 3BPNC 3DVGB 2VXVH 1QBLL 3SY0A 5D5ME 3HC4L 3JWDL 4JN1H 4Y1AB 5CGTA 3TJEL 2PW1A 4XHJC 5GS2D 5BZDB 4LPCA 3D0LA 4TUKH 3T0EC 1XCQA 2C1OA 1E28A 3M17B 1XH3B 2VNCA 1CI5A 5F6IB 2WBJA 4C56B 4XI5C 2OX5A 5FDYA 2BNQA 1HWHB 1ORQB 3QDJE 1D5ZA 5DR5L 4JJ5B 1XZ0B 2DQGL 3DX9A 5J06A 3PWPA 1JNLH 1TPXC 4HWZA 4IRSC 4KUZL 3EFFB 5FHAL 4OZ4B 4PGEB 1ZTXH 4LNRA 4HJGA 5SWSD 1AKJD 5IQ9B 2VITA 3O6KL 4JCLA 4LSDA 1JMXA 1K8IA 1KIRA 2FJFA 4H8WL 4FXLA 3N1GC 2W9DL 3O3AB 5CGMA 4Z0XA 4G8GA 3DMMC 4MMZC 4ZOBA 2MCG1 1ACYH 1ZT4B 5C0JA 2RAMA 1JNNH 2DKUA 3IFPA 3KYMA 4NUJB 3F6LA 3S96B 2H6PB 1J8HE 9CGTA 1GGTA 5JHDA 4PJGE 2J8UA 1D9KC 3MRQB 4PREA 1AFVL 1GAFH 5HYJA 2WBJD 5EZLB 1G7JA 4UQ3B 2ADGB 2FGWL 3VRLF 4JO1L 3O6MH 3MO1B 3HC3H 3PWPD 5IBTH 2HT3C 3WIFB 5E5UB 5F6HI 4BH8A 4XPAH 3SE8H 3OR7B 3UTTE 4OLWL 3P0VL 4Z78A 4NKDB 1ZLWK 1VEOA 2XPGB 3HHRB 4GBXA 2LVEA 3DWTA 3Q6FB 3LZFH 3FN0H 4C4KO 2BY1A 2G2RA 4ENED 1MHEB 2Q8BH 1K3ZA 2VSCA 1G6RL 4G8GD 4A6YL 3DX7A 5HGAB 2NMSA 3SQBA 3RTQD 1A3LL 2NY7H 3C6LC 4YBQC 3UMTA 4AY0A 5EO1A 3I6LD 1I9RL 3WHXA 2CLVA 3TYGH 5L8LB 2QSCH 1WT5C 1G1CA 4PY7B 4L4VE 5HYJD 3QCVL 4YHLH 3FT3A 3U4BH 1U2HA 2F15A 1RJZA 4NQVB 3MV01 3PDOA 4U3XA 5D7SL 3FO2B 3NCJL 4O5LH 2XN9B 3LKOB 5JW4M 5AUMB 1OP5K 1LK3H 4QRTA 4HH8A 1TCMA 1TQBC 4TPRH 4IOFD 5FKAA 1U93B 2Y36L 4XAWL 1GRWA 3CSYA 4MA1B 2GK0A 3PP4L 5CHNB 3SO3C 1FJ1A 2UWEB 4GBXD 5I6XB 4OTXL 4XVUD 4GLRH 3EJZC 5GJTL 1HDMA 5AZ2L 3RGVC 3TH4T 5EC1A 4WU5B 4CMMA 2Z9TA 1T20B 1A1NA 1XGPB 1IM3A 4OZIB 1A22B 4GQ9L 3BEWA 4GLRI 4YHPB 5FO9B 1WZ1H 5INDB 4J7RA 2D0HA 4PJHB 2ZJSH 3DV4A 3RIAF 2V9RA 1BAFL 2DWEB 4U1IB 4N8PA 1BEYL 2JELH 5D2LB 4WDIA 2OYPA 1ZT1B 5MERB 5C92A 1U8OB 3X3GH 4KDTC 5EC2B 3CU7A 3VWKA 3E6HA 4Q0XH 2GJZB 2XTJE 2VYRE 4QYOA 3JWOC 4F9PC 3OGCA 2HFGH 4GRLB 1H8NA 2VDKL 3IXAA 1JGVH 3VFWA 1AD9A 4TTDC 4S1SH 5D7KE 4YHYC 5HHNA 4W81A 5BZWB 4QRSA 3LRSB 3BH9B 2IFFL 4ZXBB 2V17H 5I1EH 1XMWA 4HWBL 4G9DB 5DK2B 4Y5VA 5BW7C 2BVOB 1AY1L 4NT6A 4BJLA 4HLZG 4EUPG 4G6KH 4AIZB 5CGYD 4OCWH 4U6YB 3Q1SL 1YNKH 3D87B 4V2BA 1MLCA 1MFEH 4X9HA 4YIQA 2APVA 5I0DA 3QXTA 2J6EH 1DE4A 3AS0A 3CXDH 4PJAE 5CEYB 3VXME 4S1QL 5IEHB 2DMKA 2J4WL 1PYWB 1RULH 4JFPA 1OAZH 2DQTL 1MCRA 3VWKD 2X40A 1WFNA 1E6JL 1HH6B 4ERSL 4BH7A 1ZHLB 4PJFF 2CIIA 4PTTA 3NACH 4S0TD 3CXHJ 3REVB 3CFEA 3UPCA 2DBLL 5AAWA 3E3QC 32C2A 1A1OA 3L3IB 3S6CA 5KANI 1F4HA 3T0VA 1F58H 1LD9A 3QEQA 1ZXQA 3V6FA 2A77L 3SDAC 4OCMC 4QHNB 2YZ1A 5IW6A 3DSNA 1S9XB 3EKCA 3U46A 3CFDB 2R0KH 5D96B 3UJJL 4L5FL 1QSVA 1I85A 4MD0A 5T3ZD 3OKNB 4KZEL 1OAXL 3RJQB 5E8EA 3VU2A 1OPGL 5I1JH 5FGCB 3W9EB 2ARWA 1RIVL 2D31A 4LLMB 4DOHB 4EUPA 5IR1A 3ES6A 5IF0A 4K2UH 2MHAB 4FP8H 1P6FA 1B88A 1OSPL 3MV7B 1XF3A 2HG5B 3EDDA 4G8FA 2QQKH 2XXMB 5HYEA 4UNUA 1RZIA 3HC4H 4YGVA 4XMLH 1CE6A 4JRYB 3SE9H 2QQQA 1GZQA 3WNOA 3KJ4B 4XNYL 4ZTOL 3OKDB 1FNEB 1UT9A 4N5ED 3CIQA 1UWGH 4G80A 3MV9A 4OD3H 4Z77A 3QEQD 4YPGB 1A6AB 5F3BA 2GJ6A 4MD4B 1J8HD 1F4YL 4I5BB 1P9MC 3CGTA 3A6OA 1YJDH 2NY1D 3LEVL 4NQXB 2NNAB 4MX7A 5GIRA 1J88A 1RV6X 3IKKA 4PJDA 3HZMB 3WFBL 2X09A 4I2XB 3STLA 1T22A 2W9DH 1N5AB 3QDJB 4UIMA 4QHUB 3UTTD 1F2XK 1OSZB 3T3PF 4UNVA 4ELMF 2Q7NA 3OV6A 3VXUB 4Z7WE 3U2SB 1ZHNB 1I75A 3F12B 3G5XB 1RIHL 3RIFF 4C83B 3EYFB 4XVSL 3NFSL 1KN2H 3VFVA 5I9QC 1I4FB 1KUMA 1JHLL 3FZUC 3R8BB 4M7JL 3MV9D 1JL8A 1YYMH 4HV8A 3QNZA 3GSNL 2GJ6D 3VFGL 2A0LC 3OXSB 2VLLA 1PKOA 2Z93B 4Z7VF 2P48B 5IHUL 4OLWH 4FFVD 5J3HD 1LEGA 2NY3C 4FQ2L 1LHZA 1NL0H 1Q72L 3AU1A 1PQZB 5JZ7D 4HGKC 4LLYB 5IJVB 4HQQL 1WC7B 2HJLB 2WIIB 1LEIA 4YNYB 3RI5F 2BC4A 3RNQB 4XVTL 1V3MA 2AK4E 4DAGH 5HVFB 2AJUH 1WV7T 2FD6L 2PUQT 1S5HB 3QQNA 1EZVX 5SV4A 1FVEB 4ZSOA 5JXAH 2AERT 4NWUH 3RL1A 4YXLL 4OLYH 5IMOB 5F9WB 3FMGL 5D7SH 3MRKA 3QXAB 1I7TB 1PGRB 1YMMB 5DC4B 3EO0B 4L8SB 3UTZA 4F3FB 5JA9A 3MGOB 3QFDA 4X5WA 1CGSL 1OGAB 4DW2L 2GSIB 1FYTA 1MVFA 3FQTA 1GHFH 1X5IA 4M7LH 5BV7C 3IFOA 3MLTB 4CKVX 3SE3C 2OTUA 3DSFH 1MJ7L 3QUXB 3WS3B 4HUVA 2AK1H 5I1GL 4X8JB 2UUDH 4HHAA 3VG9B 4GQ9H 3VXSE 4U6XA 1XGQA 4JG0H 1T3FA 3TM6A 5MENA 2E3VA 2JJTA 3HNVL 3JTTB 3ALPA 3MRCA 4WHCA 1AQDB 5DUPL 1MIEL 4NQSA 1F5WA 2GUOA 3WJLA 4HIJA 1GGIH 3KVQA 4I0PB 3LQAL 5KG9B 1MLBB 5IROA 3MLZH 4H1LB 1OAKH 2EIZB 2Q3AA 3MGAA 5D2NB 1AXIB 1CIDA 2WANA 2V5TA 1KELH 1DVFA 3O11B 3T3MF 3RWCA 1P69B 1CTOA 3BVNB 4PJXB 1OCWL 3GSOB 4XX1E 1G0YR 4U49A 4KV5E 1FYTD 3X13A 4ZODA 1I3UA 2PCPB 43C9A 3TPUB 5ADPL 1FGNL 4QOKA 1G9NH 3G5YB 4QHMB 5GS1A 1BJMA 1H3VA 2BRRH 2AXJA 1RZKC 1MI5A 3DUSB 1NH6A 1X5KA 2DLGA 4JKMA 5TH2A 1W0VB 3M1BA 2J88L 2YMXL 3MRJA 4LPYA 5JPMB 1JE6A 5EU5B 1I8IA 2VAAB 3FT2B 3BP7A 4PPTA 4WIQA 1IQDB 3FOLB 4F57H 1HEZB 4X83A 4CVUA 1IZJA 1E6JH 5HGBB 3WFDL 3QUZB 5CMAB 4RNRA 2VQUA 1KB5L 5H8DA 5D7JB 4R90L 2AJYL 3HS0A 1C5DB 1LDSA 4KROB 4HIHA 2AV1B 3QZWG 2F19H 2XA8L 4D0BA 1I9JH 2OJEB 4Z7WA 1XR9A 2NXZC 4LGSB 2O5ZH 3GGWB 2X4RB 4MQXC 3BWAB 3N1FC 4OF8A 1TJGL 4H25B 3TBVA 1KLUA 4PRHE 5GS2H 2ERJB 3ARZA 1MI5D 4WUUB 2IANE 5EO0A 1JRHH 4P23C 3RVUC 5I2IA 1BBJB 1TLKA 3MA9L 5SWZA 4RGNB 5I8CB 2YUVA 3ARFB 3GSXB 4JQVC 4KXZI 1JRHI 3QUYA 1Y6MR 1F45A 1F97A 1YEGL 4X6DE 3GMRB 2HP4A 3D85A 3ILPA 4NNPH 4KTYA 1SY6H 1R0AH 4JPKL 1I7ZA 4WU7A 5T3XH 1A0QH 2Z8WC 1UH3A 4PGCA 1UACH 2X9XA 3BZDA 1M7IB 3S3SA 1NFKA 3QZWA 4GW5A 3C60C 3QJHB 4NRZA 2XY1A 3GI8L 1TNMA 4XX1G 4F9LC 4QEGA 1HILA 2BJML 1FFQA 1B2WL 3WFBH 5JW4R 1JPSH 3OJ2C 5KSBA 5IMKB 3UO1L 3IKCA 1FL5B 1JYWA 3D5OF 4AH2A 5B8CB 2XZAL 4PG2A 3GIZL 3QUYD 3C2SA 5BV7L 1I3GL 3ZYJA 3MACL 2C9AA 3D85D 1MJUH 4YO0A 1VEPA 5IFAL 3W5MA 5C2UB 3U7WL 3WDIA 4PFEA 4JKPL 4BQ9A 5FO7B 3ABZA 3U30B 4UB0H 3QG6A 1J0IA 4CU7A 3B5HA 1FH5L 2D7TH 5IK3A 4RGMC 4LAQH 3VXTB 4R26L 5DJYA 5IVXB 2CRZA 4ZFOA 2VZVA 1LO2L 3MJ9H 4PJ5E 4P2CG 3D2UA 1QRKA 1E4KA 2XRAL 1IMHC 3ARBD 1S5IL 5KTEH 3J7HA 5ALBL 1XGTB 1CFSB 5IOPB 3WJJC 1A7NH 1KPUA 4I48A 1T0NB 3MODH 1PSKL 3RWDA 4JY5H 1R5VA 4HDIB 3L3KA 1CFVL 4JO4L 3FO0L 1A6WH 5DGRA 5KVFH 5JIIA 3HRZB 1J05B 1M4KA 1CBVH 3G6AA 3BJLA 3O41A 5LBSL 1A7PL 3CDGA 5LXGL 1KULA 1OHQA 5B39B 4XPFH 4L9DA 4UOW1 1IKNC 3G04A 3I2CL 1ZHBB 3BXNB 1NGWA 4YDJB 3VXSD 3PL6B 4ZUTA 4CU6A 1SBSH 4D2NA 1WJ3A 3TT3H 4OBSA 2X70B 4PJ9B 5C08A 2HKFH 5EU4A 3HNTL 4M1GH 3D2UD 1WUNT 3BEVB 4D94A 3ZSTA 1MCEA 4LSTL 2FL5A 3W39B 3AREC 4RMWA 4YE4L 4TVPH 1NJ9A 4IOIA 2CRMA 4M6ML 1AQKH 5E24E 4DK3A 4N0UA 3CFCL 4JFZH 5I1LB 4OF0A 2R1XA 1C16B 4NNYA 1YEEL 5I74B 1QPPA 4IHOB 4EI5C 5DK0A 3BISA 2KQNA 4XCEB 4N0FA 3OWEA 2ZCLH 4U6TA 5HPMA 1NGQH 2K3TA 2AJVL 4UT6H 4Y89A 4TSAL 1EEZB 2XWTA 4J3VA 3T65B 4QRQA 4LCYA 4Y16C 5C08D 5IM7A 1HXMA 3HI1B 2VDOL 3I02A 3BZFB 5I17A 3LN5A 4HCRL 2P7TB 1AGBB 4ONHA 2RCSL 4ODUA 3MXVL 3HZYA 2AJSL 3IJYB 4D9QE 3EIFA 5E99L 3QIWC 4MB3A 3CAFA 1CD8A 2FR4A 1SVZA 4V1DE 1WAAA 5JXEA 4KJWD 4W6WB 5GS3A 3BW9A 4LF3B 3IJSA 3NCYP 1C08A 2EDNA 3FCTA 3IDYB 1T1ZA 3S9DB 1QLEL 4FQXC 4HXBL 2YMXH 3NIGF 3RVWC 4PRHD 4Z95H 1P4IH 1T5XA 2HT2C 2CLZA 3MMEB 1X5XA 3WFEH 5GRYA 3PHSA 2C3HA 2IAND 4HWNA 1L7TL 1WZLA 3H9HB 1CFTA 3TVMA 1T89A 4AQ1B 1HKFA 3I9GL 4U6VL 1PZ5A 3MBEA 1N2RA 5ENWA 1XIWC 4DZBB 4HZLB 5FFLA 2CO6B 3NIDE 1LK2A 3QCTH 3V4VL 5GS0L 4GAGL 4R0LA 3MLRH 4Z7UF 3IF1A 4X7SL 5CLTA 2DTMH 1NGZA 3OKLA 4OFVA 2HKHL 3AXLB 5IQ7L 1EAPA 5ADOL 1UWEH 4HPOH 5JO5B 5IFHH 4DKAA 4OCNC 4HS3B 4LP5A 4Q6IB 1WEJL 1HI6A 4YUEL 4ZAKA 1ZS8A 4JZOA 3B6SA 1X6LA 5DDHA 3UJIH 4PRIA 2OXGA 3MGTB 2HTLD 5D6DC 5EBGA 1OAUL 4DN4L 5DMJB 5DC0A 4NQCE 1IGML 4G5ZH 4FG6C 4HWEH 5CZXD 3O3DB 4APQC 5E6IC 1Q9WB 4Y19A 5GGUA 1ETZA 1QFPA 4JM2A 3VDAA 2YSSB 3T77B 5C0IA 4EEEA 3BHBB 4WO4C 2AXGA 4ZUSB 1G0XA 1G7PB 5JPNB 5JHLL 3D18A 3OKOA 4N8VG 1NBVL 4F7TB 1A1MA 4XMKL 4CJ1A 5I8EB 3ZE0F 1PZUB 3PUCA 3PGDB 4KDWA 1FG2B 3P4MA 4OT1H 3FRUB 2P24B 4JFXA 1UXWB 4P57A 5F89B 1Z3GH 5CP3A 1Q9LB 2BJMH 4KWUA 4GAJH 3KLAA 4ZAKD 2FBOJ 4PJ5D 2YA1A 5DGQA 2E8YA 5M7QA 3VI3E 4FXKB 1UB5B 2RB8A 3KPMB 4NQUA 5EORH 1BIIB 2Q76B 3D69A 1INQA 1RU9L 5HXMA 4Y19D 4QRRB 4P2RB 5AZEL 4JM2D 1O7SA 2PF6A 3AMKA 2Y4SA 5GSVA 3SKUD 3AGVA 1BWMA 3MOBH 4FQIH 3RU8H 3NABH 1OF2B 3WO4C 1BVLA 3ZZ1A 5C0EB 3QBTB 1D5XB 5EFIB 1NDMB 1IVLA 2A6KA 3P77B 1HQRA 4JHZA 1DBMH 3CH1B 3VGAC 2J2ZA 3QNXA 1JZ6A 5L9DL 2VC2L 1A14L 3QEHA 1EXUA 1J11A 4PV9B 2YBRA 1DDHB 5EU3B 1I8LC 1S3KL 4X4ME 2V5MA 3S88H 3H9SB 4UQ2B 2KZWA 4KKLD 1KCKA 3TJHD 5C0FA 4Z7NF 1MJJB 1CFBA 5IB4B 4L3CA 1KXVC 2FX8L 5HHXH 4POZD 5FYKU 3KPRB 1A7BA 4OCSH 5HVWA 1JPTH 2GFBA 2V7HA 3PGFL 1HHIA 3QIBB 5ICZA 5K9JH 5J6HA 3GFUA 1G6RA 1FIGL 1F90L 1KGCE 4TRPL 4PP2B 4M8QA 4N0CD 5F71A 5A3IC 4K7PL 5IMLA 4XBGB 3GBMH 4NNXB 5F88B 1LO3H 2C1PB 3DROB 3PXJA 3FQXB 3DBXB 2N7BA 2HT4D 4P9MH 3K0WA 1FN4A 4JM4L 2YHGA 4OZGF 5HPOA 4LPXA 1ZE3C 4LARH 4OLZL 1NCNA 1BREA 4D0DA 1V3KA 3HCVA 4EVNA 3T4YA 1WFUA 4RMSA 2IALB 1T2QL 5JR1L 4M6OH 3BPOB 3MUGB 2R4RH 4M6NH 4P59H 3NPZB 2JB6B 5C7XL 1E27A 1ZVSA 3IDUA 1NGPL 4M48L 3LKRB 1DZBA 2DQDH 5CP7B 1BGXL 3C5JB 5CFHA 5JOPE 3QISA 3BT2L 1VGKB 1HHKA 3NGBC 3TNMA 1NCDL 1KCUH 3FFDB 4F58L 3ALWA 5ESQB 1NGXA 2KKQA 4NP4L 1Y0LB 4WWKB 4WW2A 4E9LA 5JW4N 1T4KB 5IJKA 4MXQD 2WZPD 3MREB 2A74A 3LKSB 1OWWA 2XWBA 2AJ3B 1D6VL 4LLDB 4PJEF 2DLFH 3UYRL 2EC9T 4H5SA 3WIHL 3ZMRA 3O8XA 1BZ7B 2R56H 4NHUA 3OF6D 1GZPA 2V7NA 3RJDA 2ESVA 4NC0B 3MR9B 4PS4L 5GZND 2WP3O 2FCBA 4RQQA 2CXKA 2IWGA 3RWJB 1UB6A 3T0EA 5TDOB 2BVTA 4FQLL 3BJ91 1C5CL 3K4DA 3RI5K 4X9IA 2W59A 4GKSA 4KRMB 3O4LB 4CDGC 1TCRB 1CK0H 2MCPL 2EZ0D 4NZJA 3CK0H 4OCXH 2JJVA 4HX1A 1XF4B 4FABH 4JRXA 2P5WA 1KTLB 4XWOD 3ZYZA 4IRSA 4V2CB 1U91B 3GEWB 4LU5L 5FGSA 1YPZF 1V05A 2DI9A 3FB5B 1IEHA 2IH3A 2EYSA 3P9MA 4FQQB 1BF8A 1B9ZA 4WTXA 1X5ZA 1HH9B 2VXUH 3MRRB 5HYQB 1DQJB 5CKAA 2X42A 4H20L 4ZS6C 3DMMA 4LCCC 4L8CB 2Y1VA 1VGEH 2RFXA 1OTUC 2G75B 5LGHL 4XHJD 4O9HL 2KQMA 4GKZB 2VLJA 1I1AB 5D1QC 2H2PC 3T0ED 4YUEH 4R7NB 4XNQB 3D3VE 3VMPA 4G6AC 3HE6C 2EDBA 4NHCH 3N50A 4XI5D 5I71B 1MQ8A 2EDLA 3MCKB 1QZ1A 4PJIB 1NPUA 4EIGB 5DJ2B 4PRAB 5D71H 3DX8A 3S98A 4RISH 5GZOD 4JFDB 4JPIB 3K74B 2P5WD 4JRXD 3ROLB 3RVTD 2KDGA 3BH8B 4IRSD 1DUYA 4FS0A 1SJVA 3HLAB 1OB1A 4MQ7B 4OLVL 3QULA 4ETYA 3QXDB 2DQJH 2YRZA 1KLGB 3OKKA 4XMKH 1X5HA 5F1NB 4K9EL 2YC1B 4M00A 1TJIL 2P8LB 3B83A 5IB5B 3DMMD 3P30H 2ITCA 2GAZB 4MDIA 1C12B 3MRFA 1OTSC 5I75B 3L7EA 1MELA 2VDRL 2VZOA 3O0RH 1JZ8A 2EH8L 1AI1L 2XNAB 3Q5YA 3WUWG 1MPAH 2WWKT 1KBGL 3X14B 4P3CH 2GW5A 2ICEB 3W2DL 3KS0H 3SDXF 2VABA 1ZSDB 3N06B 2FHCA 3SDDB 4TULL 4Z76B 2OLDA 2EXYD 5L8JB 1CFQB 2ZSWA 3IDMA 4P5TB 5FDWA 1BD2A 2N1KA 4E41B 1N64L 3VXRB 1G7MB 2HT3D 2IQ9H 4B5EA 4CADB 1NDGB 4OGXH 4WFHD 4GOSA 4LSPL 4GS7B 4LLWA 2A6DB 1TQCB 3C87A 1JZ7A 2GJJA 3SDCB 1QFHA 4AM0A 4NM8H 3ZKNC 1INDH 3E6FB 1FL3A 5B4MC 1Y6NR 2UZXB 2R1WB 3RGVA 4HSQA 2X4TB 3KR3H 1MFCL 1CICC 3ZL4H 3O2VH 2Y7QA 5DMIH 1H3GA 3BGFB 1DQQA 2IADB 5HSFA 5EOCJ 1A4KB 2W65B 1B6UA 3KPPA 1QPXA 4TNWK 2ZSVA 4FFWC 2X4NA 3C5ZB 1W2KT 1MCHA 1WBXB 3DRTA 4WVRA 4KDTA 1BQUA 4MA7L 3WXVL 2QTEA 3WUWA 3IVKB 4OAWB 3C08L 3TN0C 4F9PA 5FK9A 2NXYB 4QT5B 2Z31B 2NY2C 2ICWI 5ILTL 1YMHA 1FNAA 4U1MB 3KHOA 1FDLH 5JW5B 5E00B 2DL2A 2R0LH 4ONGH 5ETUA 1FAKT 5CEXB 4JAMA 3VXNB 3MFFB 4X6BB 3H3PL 4LLUA 5D7LB 3RGVD 4PJIF 4X0KB 1JGLL 4TSBH 4XP1H 1Q9KB 5BW7A 4POUB 4BSVA 5JOPD 5JA8B 2R23A 3U79A 2YR3A 2MKLC 1DN0A 3Q0HA 4KJQC 5AWNH 4O4YH 5SWSB 4OI7A 1D7FA 1RIUL 2HMIC 5B21A 3TO2A 5L7XH 3OKEA 3Q3GB 3VH8B 4G6JH 4GAYA 1KCSH 4PGDB 4RFEA 3I3DA 4NQEA 4Q9QH 1RJYA 4MLIA 1A7RL 1IARB 5HHVL 3SY0B 4MAUH 5CILH 5F6HJ 2PW1B 5KW9L 3D0LB 1MRFH 4S1RH 1XCQB 2C1OB 1E28B 4C58B 5E8NA 4K55A 4NZRH 1IGTB 1N7ML 4JFFA 4LCWE 5BOZG 3EYSH 3WCYA 3T09A 3G6JE 2BNQB 1EH9A 1D5ZB 1NFDF 3LEYH 1HKLL 3DX9B 1CG9A 3PWPB 4HWZB 5J1TC 2HFTA 2E5EA 1H3PH 5EU6A 1RZJL 2Y72A 3E0GA 4O02L 4LNRB 1ADQA 4XGZA 3IFNL 2VITB 1N0XH 4XP9L 1K8IB 1KIRB 2FJFB 3WYRA 5HYIA 3L3JA 3BP6A 2P5EA 2WLYA 4Z0XB 3HAEG 5TF1H 5C0JB 2PYFA 1K4CB 3IFPB 3KYMB 3S3PA 1HYSC 1NEZG 5JHDB 2J8UB 4PREB 2DQHL 5HYJB 1P4BL 4LSQH 3OQ3B 3SKJL 4I3SH 1P9MA 4XPGL 2DRUA 5MI0B 4D3CL 2DBJA 3C8HA 4KI1A 2EYTA 1CZ8L 5H37H 4BH8B 5EU6D 4QXTA 3BO8A 4Z78B 2DIJA 1HZHH 3HTLX 4Q9RL 1KB5A 2JJSC 2G2RB 4YWGH 4P4KB 3RDTD 1X5LA 2C3WA 2FYYA 5ICYA 3BRDA 5AYUL 1MAMH 2P5ED 2NX5A 25C8H 4KI5C 3DX7B 3IU4H 3C8KA 3EZ8A 3FQUA 3SCMC 1VFBB 5EO1B 3KPLB 5EOQL 1GYAA 4KTDL 1FSKB 3DYMA 5CZKA 3WHXB 2CLVB 2VXTL 1D5BA 1FYHB 3ZKQD 4U1JA 5JUEH 3JV5A 3FT3B 2XZQH 3DO3A 1IZKA 1YA5A 3EOTL 3O45A 3W5NA 5D7IA 3PDOB 1TNNA 1CF8L 4H0GA 1NUGA 5DRNB 5TF0A 1CR9H 4QRTB 3MRPA 3BRFA 2FX9H 2A38A 5CJOH 5DD1H 3CSYB 2GK0B 4UV4L 5DRWA 1FJ1B 4OLUH 2EKSA 1HDMB 5E2WL 5EC1B 3EYOA 4CMMB 1A1NB 1X3DA 2NX5D 3SGJC 2AEIT 4JO2L 1IM3B 3ARVA 3BEWB 3V52L 4WHYG 5I1KL 3DV4B 3FZUD 4GG8A 3GSUA 2YKLH 4OZHA 1LP9A 2LTQB 4X7FC 2E7CA 5JTWA 4WDIB 4XH2A 1ND0A 1GL4B 4GSDL 4C4KT 1RFDL 2A0LD 3VWKB 3E6HB 4M7KH 5CP3H 4I18C 4QYOB 3OGCB 2Y25A 5GGTL 4CN6A 4OM1L 3GI9H 3IXAB 4HMEA 2NY3D 3S5LG 1G6VK 3C09C 3MRBA 3VFWB 1AD9B 5I1DA 1F4XH 5DHXB 3OXRA 5HHNB 2DM3A 3P9LA 4FNLH 4QRSB 3SE3A 2VDLH 5GRJL 4G7YL 3QIUD 4LCIH 1FE8H 5LCVL 4XPHH 4YQXL 5I30H 3CX2A 4Y5VB 4JPVL 4K7FA 4OCRH 5C0BE 4NT6B 1BFVL 5C09E 1KG0A 1VB9A 4DKEH 5D1ZC 1MLCB 4YIQB 1DE4B 3ZYOA 3BGAA 4Y4KB 1RVFH 1WFOA 3NZ8A 1CXFA 1BQHA 3UTOA 4HFWA 3VD5A 1KXTB 4JFPB 3LAFA 1LE5B 4YZFF 5I73C 1I1FA 4OGYH 1RUML 4OIIL 4BH7B 5IV2A 1GPOH 3LMJL 3RY6C 4PTTB 3BPLB 4KJYA 3TA3B 2RQ8A 4OB5H 2D0GA 3H7BA 1IEAA 32C2B 1CXEA 3MOAL 1A1OB 1QRNE 1CIUA 3S8WA 1LD9B 1MNUH 3QEQB 4Y2DC 5JQ6H 4I3RH 2JF1A 4XCFL 3V6FB 3S5LA 2BK8A 4R8WH 4UT9H 2XQYG 2SEBA 1UM5H 3EOAA 4ZUWA 3U46B 4MAYC 2JCCA 1G9MC 3LIZL 4FTVA 1CU4L 2OL3L 4MD0B 5CSBA 1ZLWH 2JK5A 4Q74A 4XAKD 5E8EB 1U3HC 1AGFA 2X05A 1A6VL 3B8YA 3T8XA 4EUPB 5IR1B 5IF0B 3GZKA 4HUXA 5TQ2L 2W0LA 3UAJD 4XXCC 4G8FB 3MLUH 4JR9H 1RZIB 4HGWB 4YGVB 4RAUA 5T1MA 1XF5A 1I7UA 4KGJA 1IE5A 1QBMH 4B50A 1GZQB 5C6TH 3VGEA 5EWIH 4LHJB 1BZ9A 3R0MA 2ZUWA 1BQLL 1LNUA 4G80B 3F5WA 4YH6A 3MV9B 4N68A 4Z5RA 5IT2H 2A83B 4PR5A 1UCBL 3BAEH 5F3BB 5FHBL 2GJ6B 3SGDH 3KHQA 3AS1A 3JVGC 3CFJA 3QHFH 3BZ4A 2QHRL 4MX7B 3VXPA 2CKBH 4P23A 4ODWB 1RZGA 3FRPA 5CD3A 3SGDI 4KHXL 4KRPB 4NN5C 4NRYA 4JQVA 3EYQD 5MEOA 1MREH 3STLB 1T22B 5DRXB 1T83A 4K94H 4UIMB 4LSSH 4U1GB 5AD0A 4BK4A 2ICCA 4HCRA 5CJXC 2YUZA 5J6GA 2IGFL 5E2VL 2ZNXA 3ZE1E 3T0WA 1DSFL 3HR6A 1CGWA 3WXWH 5F1SA 4LVNC 3VFVB 2OZ4A 1A9BA 3I6KA 4YLQT 3ARQA 3VCLA 4HV8B 1ZHKA 2XZZA 4O00A 5C0AE 4UTAH 3QNZB 3C60A 2DOCA 3GHBH 4NFDA 1AXTH 4ZTPL 4F9LA 1JHKL 4P9HL 2DKSA 2Y06H 4DJMA 3N0PB 4WI5A 1LEGB 1FL6A 3AU1B 1AE6H 3BP4A 1ZA3A 4NGHH 1LEIB 4PJ7E 1NBZA 5FO8A 2BC4B 5TE4H 3C9NA 1FLTX 2W91A 4Z8FH 1C8PA 1I7RA 3TO4D 3L6FA 1Z0NA 4NZTL 4KDVA 3O2DH 2WMPA 2GY5A 4AIXA 4UV7H 5DWUH 5GRVK 4ZSOB 4I0CC 1F8TL 5DFWH 1MF2H 3RL1B 4LRNH 2BSSA 3C60D 3MRKB 3HUJE 1EO8H 3UTZB 1Z5LA 2Z8VC 1N5YL 1J0KA 5KS9E 2GIYA 3ULVL 2BY2A 4LASL 1JZ2A 3QFDB 3WJJA 2IMMA 1NMAH 5IESL 3NIFE 1Z9SA 4X5WB 1QKZH 1T03H 1HINL 1I9IH 1FYTB 1JI2A 3FQTB 2DQEH 1EEQA 5I1HL 3IFOB 5D70L 4UAOB 3V6ZA 3TYFA 3GJEA 5BS0E 3P40A 2OTUB 3T1FB 4HUVB 4CN1A 4G3YL 4BKLA 4HHAB 3S4SG 4HH9A 2YD7A 1KJVA 4U6XB 1XGQB 2EICA 3NCEB 5J56B 1T3FB 5MENB 1IKNA 2VDMH 4TQEL 4PJDF 4NN6C 1UYWH 1MCOL 3MRCB 3MRIA 3UJTH 4NQSB 1ZANL 2GUOB 4DCQA 2A6JB 1URLA 3SKNA 5C0ND 1OT2A 4M62H 1QYGH 2H2SC 1K6QH 1VESA 3NCMA 3VRIA 1DVFB 4P5KB 3RWCB 3UTSA 4KHTH 1R5WA 3F8UB 5CUSH 4JGJA 3V5KA 4M5YL 2YD6A 5FYJL 3EJYD 1NCTA 3T0AA 3BZEA 2F5BH 5MP6H 4QXGL 5K33A 2OP4H 2PO6B 3C6SA 4AL8L 5I1IH 4QOKB 2IBZY 1ZVHA 5GS1B 2WK2A 4EI5A 4GAFB 1A2YA 3OKYA 1BM3L 3FB7A 4ZPVB 1HQ4A 3THML 2Y07H 1FZKA 3B2UD 5TH2B 3ARSA 1W8NA 4RFNC 1F13A 3M1BB 4HF5H 1GC1L 2FDBP 5I18H 4X7TA 5E7BA 3WSQL 2H1PL 1A47A 1I8IB 2EH7L 3MNVA 3BP7B 4NUGH 4RMQA 3NAAH 4Y16A 3BKML 3O6LH 4P2OC 1RUQH 3HE7C 4LFHG 2AEPL 4XCCL 4RNRB 3AS2A 4PRDA 1P1ZB 5EU7C 5I16B 3UTSD 5C09B 4YXHL 5FUOH 3HS0B 4EBQL 1IRAY 5KVGH 4HIHB 3QIWA 4D0BB 4P46D 1XR9B 3H7LA 4LVHB 4MYWB 3TBYA 3TWCL 2O26U 1RZFH 1KCRL 1QLRA 2X5PA 3JWOH 4JVWA 3LB6C 3QB7C 4LOUC 3TBVB 2VZ3A 1NC4A 2X44D 5H94B 3JXAA 4EI5D 1GXEA 3T2QA 2XIDA 3P3YA 1MRDL 4FQXA 1T7VA 4YDKL 4HS8H 1RUKH 2XZCL 5I2IB 2DQUL 4OCYH 2NTFA 1U95A 4WWID 1QRNB 5GRZA 3BDYH 5SWZB 5I8KL 4NO3A 4P3WA 1S9YA 3SBWC 1E4XH 3QUYB 1LWRA 4Y16D 3PIQB 3BSZH 2P42B 1JWUA 2COQA 1IQWH 4LIQH 5TJWK 1QTYT 3ILPB 3HMXH 3QSKB 1XIWA 2NY4D 3DUUA 1GIGL 1P84J 1I7ZB 4WU7B 3CMOH 2R69L 1NUFA 4PGCB 5FA4A 4U7MA 4LSVL 2WINA 3QHZL 3OGOE 3ZO0A 3U4EB 4PJ8D 3U83A 1ZLUH 5JDJA 4OZFA 1JF1A 3GB7B 1NC4D 4NRZB 3PGCA 4B0MM 4QHKJ 4R4BA 2VXSL 4ESKA 3N85H 4FQXD 1HILB 2FO4A 4ELMA 1V7NH 3IS0X 5KZCD 5D6DA 4YDIL 2HT2D 5FM4A 5KSBB 3IKCB 3WD5H 5FYKH 1E6OH 3TBTA 2M2DA 4APQA 1CFNA 5E6IA 5IEKA 3CLEL 2AS5M 1UCTA 4YO0B 4WO4A 5C0CE 4LSUH 5CIPA 1XIWD 3V7MA 2X4SB 4M3KB 4UILL 1ADQH 1YZZA 4JHAH 4MNGA 1KN4H 5JIKA 5DYOA 2O5XL 3K8LA 2J7LA 1WSST 3CPLA 5E9DE 4DN3H 3GSWA 3QG6B 4Z7VA 2B0SH 2BX5A 4PIRF 5IK3B 1R3KA 2K7QA 4RAVA 4XP5H 4ZFOB 2APXA 2YPLE 3PXHA 4KQ3H 3SE4C 2I5YH 3TIEA 1NAML 3V4PH 1FRGL 3CLFH 3D2UB 2G9HB 1MCQA 1IGFH 2AV7A 4QRPA 5DUMH 1DBBL 2F54E 4QXUH 3CVHL 4XNXL 3EDKA 5IVZA 4YR6A 1MY7A 4BUHA 3D39E 3ZDYE 1KPUB 4I48B 4BZ2H 1ED3A 2CLRA 1ODAA 5F7UA 2GK2A 4PB9L 4Z7WF 2UUDK 4FG6D 1R5VB 2HWZH 4FFZH 1C5BL 2CUIA 5DZLA 5E6ID 3UYOD 4WO4D 1DFBH 4UUJA 3G6AB 2H41A 2WUCH 5C70A 3CDGB 4OD1H 5DQDH 4GG6A 3DYPA 3GHEH 3RZCA 4F7PB 3G04B 3T0XA 1A7QL 2YD1A 1NGWB 3UBXA 3L3HA 5HDBE 4ZUTB 3G6DL 3RTQC 4O58H 4R6UA 5L2JA 4HFUH 1OARH 3BI9X 4D9LH 5C08B 3Q48A 1I8LA 5EU4B 5KOVC 4K3DH 1O0VA 5IMMA 2ZNWA 4HXAL 1LO4H 2FL5B 3V6OE 1NJ9B 4FQ1H 1BOGA 1EAJA 1DQDL 4YHZH 3BUYA 3ULUL 1N26A 2AABH 2DIBA 4N0UB 4J3XA 5D72L 1EFXA 4NNYB 2RR3A 5E4EC 5DD3L 5EBMA 5L0QC 5DK0B 1P5VA 2VLRA 4HMCA 4GBXC 1GOHA 2QQNL 4N0FB 4XVUC 5HPMB 1VEMA 1DBAH 1N6UA 2C4FU 4DGYL 4WJ5A 1CD1A 3RZCD 1AO7E 5F1IA 5LGJA 3MCLH 3RWIA 5C07E 1REIA 2CPCA 2PKDA 2X1XR 4QRQB 4QHLA 1SMAA 2HRLA 3EFDH 5IM7B 4I3GA 5FYLD 2QADC 3I02B 1YY8A 1F6AA 5DTFA 4AT6A 5I17B 3LN5B 5I15L 1VHPA 3KPSE 3ZTJG 3RAJH 4ODUB 3MJ7A 1OP3K 2WW8A 3HZYB 5JW3H 2DM4A 4FQJL 4HBCH 3G9VA 4QY8B 3WFHA 4NQDE 2FR4B 1RURL 1KEMH 1SYVA 1X5FA 2YWZA 1EFXD 2D2OA 4J2XA 3X3FH 4W70A 3BW9B 3IJSB 1C08B 3FCTB 1HIML 1T1ZB 5C2BL 4G43A 5F44A 2VLRD 3UZEA 5FOBA 2WSKA 1JFQL 4MWFA 1M6OA 4HT1H 1PY9A 5IUSA 2C4XA 1T5XB 4ZPTA 2CLZB 1TENA 1UZ8A 4GW4B 2EE9A 1G7HB 2XG4A 3TVMB 3VJ6A 3BYTA 5CGYC 3WNKA 3ROOA 1JTTA 3DPBA 1TTUA 3MBEB 1N2RB 5ENWB 5KBNC 3UDWC 3A0OA 1LK2B 4R0LB 5SWQA 5E2UL 1YEHH 1TZGH 1NGZB 5K9QG 5DEGA 3PWVA 3OKLB 2ILLA 5CJ8A 3WEXA 2F58H 1NKOA 1EAPB 4IM8A 5C0RL 2F53A 2EDQA 1CXKA 2OM5A 2AGJH 3RY5A 5E8PB 4Q58C 4YDKH 5EZOL 1GCFA 4XZUA 2XZCH 1Q1JH 1ZS8B 4JZOB 4XNMA 3B6SB 1EX0A 5DDHB 1N0LA 5DQJB 4RFOH 3PE9A 4PRIB 3T0BA 5TDPA 2YK1L 1RZKH 3EZJB 3VFRB 4PD4J 5DLML 4PP1D 1RSFA 4Y19B 5F8QC 1BFSA 1ETZB 5IIEA 2C5DC 3A6CH 2BMKA 2AXGB 2X1OA 2HFFA 3QWOB 3MLWL 4YPJA 1IAIH 3OKOB 2O5YH 3HI6H 1A1MB 4Z0BH 4LCCA 1J86A 1QVOA 3CCHA 1IAII 3W0WE 4JFXB 5DD0L 5D1QA 2DDQH 4I4WB 3LRHA 4P57B 1Z0MA 4N5EC 3QAZB 2L4OA 5F7LB 4HC1H 3HE6A 3U9PH 3KLAB 1CGVA 3NFNA 4P2QE 3ZSSA 4KKAC 4X7DC 4L4TE 2X1PA 1WLHA 1PG7L 1R5IA 2NY1C 1UJ3C 1GVIA 3D69B 1INQB 3SGKA 4UIKH 1WIUA 2BDNL 1R3LA 4NDMA 5C0DA 1G84A 3VE0A 5EUOE 1YEIL 3GBLA 1BVLB 4RGOL 3DARA 4ZS6D 4LQFL 3I3BA 2A6KB 4YHNA 1HQRB 1OTUD 3MJ8A 3QNXB 4Q9BA 1K8DA 4Y8DC 2H2PD 1EXUB 4ZD3H 4N90E 2YBRB 4PJBE 5JNYA 4ALAH 4M4RA 5CJQL 4G6AD 2CJUH 2OZ4H 3RUGA 3HE6D 4RWHA 5C0FB 5HDOA 1DLHB 4JQXC 43CAA 2X4UB 4PB9H 5EA0H 5BVPL 4L3CB 1R3IL 1A7OL 4M7ZC 4Z6AT 1U58A 4EQ2A 4FFVC 1A4JB 4MCZB 5ESAA 3AUVA 5HHOA 5J3HC 4M5ZH 4JHWH 3QH3A 4LIQE 3DI3B 1M1SA 2GFBB 5JZ7C 4JB9H 3MNWB 1YN6A 4HAGA 2V7HB 1HHIB 5T33H 1PDKA 5ICZB 1BFOA 4K8RH 3KYKH 5J6HB 2RIKA 4WEBL 5D1XC 2DKMA 3SKOB 2VZUA 2ZCHH 4K7PX 4PLKC 1CICA 3WE6B 1V7MH 2I9LA 4NWTH 1A64A 2BNRE 1A3RL 4OCLC 3GNMH 1Q0XL 2EDWA 2IBBA 1OTSD 3QUKA 1GGBL 5DMGC 1U8LA 1KACB 3QDMA 3S34L 4JM2F 1HWGB 4BQCA 2K7PA 1INEL 3HA0A 4ORGA 1FN4B 5T1KA 4HIIA 1BPVA 2DLEA 2FLRT 4JY4A 1JUFA 4ONFL 4OV6F 4XTRC 4D0DB 4Z7OE 4EVNB 3T4YB 5CEZL 4X6CA 5GGVH 4YC2C 5EIIA 3TN0A 2R0WH 3OG6B 1T7WA 5IBUG 4Z7QE 1E27B 1MHPL 1ZVSB 2J5LC 4M61A 3VW3H 1A21A 2XTJC 4Y2OA 2XQBH 2EO1A 3PDDA 1JWMA 3RY4A 4Y0GA 2CMRH 1HOCA 3ZKND 1VPOL 2MWCA 1TVDA 2BNUA 4RWYH 1M05A 1TETL 1HHKB 3TNMB 1J7VR 1NGXB 3QO0A 4XXDA 4WW2B 5IFJA 4GQPH 5HDQH 4ZS7L 4NKIL 1SEBA 3ULSA 2A74B 4P48A 4H26B 2VUOA 4LRIC 5AAMA 2XWBB 4IDJL 1IILE 3MBXH 4FFWD 2ZOKA 1K85A 4H5SB 5CD5C 2B20A 3O8XB 3BPNB 3PWLB 4NHUB 3R4DA 2V7NB 2ESVB 1FBIH 2VLMD 1NLDL 4G6ML 3TN0D 4EN3C 1U41A 2R0ZH 3OZ9H 4PYGA 4RQQB 4UBDC 1WWAX 1UB6B 2D03L 3T0EB 3DIFA 1KENH 3BRGC 2PTTB 1MCIA 2NY5H 1JN6A 3NN8A 4AEIL 4GKSB 1XGRA 4WCYH 4JKLA 4NYLA 1F4WL 3V5DA 4X99A 4HX1B 1FQ9C 1UZ6E 1G1YA 4JRXB 4OFIA 3VG0L 2FB4H 1TPXB 2CDFA 4IRSB 4KJQD 4HW6A 1QP1A 1CT8A 4XMPH 3CFBA 4P2YA 1JPFA 4QLRA 2R29H 3ULVE 2IH3B 3P9MB 2HMID 4FZ8L 4IBLT 1NMBL 3B5TA 4ODVL 4PRPE 3BGMA 3DMMB 5C9KA 2RFXB 5JIPA 4URTB 1GOGA 4YDVA 2VLJB 2VDNL 1YEKL 2AKRA 3UCRA 1NCAH 2QR0A 4OLXH 4KMQA 1D9KB 3PF2A 3S97C 4M3JA 1UH4A 4KKBC 3CMGA 1ULVA 2XYCA 4PJBA 4IRJA 1FVCB 1XF1A 2AAVA 3DX8B 2OL3A 2AI0L 4LPVA 5B8CC 3NIDF 3EAKA 1DUYB 1FNSH 3RX5A 3WN5C 3GK8L 4KAQH 1OAYH 4JZNA 1OB1B 5EOTA 1RK0A 3QULB 3MLWH 5BRZE 5D9SA 4PV8B 3OKKB 5LGKA 1MFDL 2F8VA 2VIRA 2JJSA 5FYJE 3T2NH 4LAJH 4RBPK 3L1OH 3BQUC 4DEPC 5TFSL 3WFCL 3HI5H 2ITCB 4MDIB 2ICWJ 3C6LB 4NBZB 3SCMA 4K3JL 3L7EB 3ARGD 1KB9K 1HYSD 5I1CL 4J3TA 5T5FH 2F5AL 3RA7L 1U8IA 1U8MA 3K2UH 5ANMA 3U0TA 1DTUA 2VABB 5BO1H 4IRJD 1NBQA 4OZFH 3QCUH 2H32A 4J6RH 2ZSWB 3IDMB 4MHHG 3U6RA 1BD2B 3E8UL 4LSRH 5LWYH 3MV11 4OFYA 1TQBB 4RIRA 5IB1A 4LLWB 5I8OL 4BSWA 3SO3B 4AM0B 2AJZA 1FL3B 3RGVB 3VXOA 2R9HC 4XPTH 5IVNA 5GGSA 1BIHA 5CZVL 4KI5D 5F3HB 2HLAA 5F93C 1DN2A 3WIIL 1A6UH 2B1HL 2DJ4A 1DQQB 4DWHA 5FF6A 3SCMD 4MCYB 3KPPB 3VI3F 3KXFE 5GHWH 5KSVA 2BNRD 2FATH 2QBWA 2X4NB 5EUOB 1EGJL 2YXMA 2IPTL 3DRTB 1EVUA 2VLKA 5B38A 5KVEL 2OK0H 4FRWA 1OW0C 1NMCC 1MEXH 2LV4A 2EDYA 4I18A 1QSEE 2CIKA 3ARBC 5FK9B 4LKCA 2X6MA 3V79C 4TSCH 1YMHB 4OFYD 5CLWA 4IDLA 1QFWL 1RHFA 2D7PA 1W0YT 1QFUL 3G5VA 5ETUB 2RGSA 3JTSA 3IDGB 3WHE1 8CGTA 2A73A 5F96L 4JAMB 1OL0A 4LLUB 1FORH 3KPNA 1M71B 2DQIL 1KIUA 2BHZA 4CVXA 1UM4H 4OZGA 1IAIM 1G7LA 1QSFA 4NPYA 5DJ8B 3I3EA 1JWSA 3ARRA 1V5JA 2R23B 1I8MA 2FBJH 5IGXH 3QEGH 4FQHA 4M9OA 2CK0H 1T2XA 2DIAA 3O3EB 4MJIA 4R4FL 1DN0B 1FLRH 2I27N 2R8SH 2N56A 5I66A 3K7UA 2EDKA 1UC6A 5D1ZA 1ZLSH 2NQCA 3PJSB 5GGQL 4FQCH 2QKIA 3MLVH 1XGYH 3IRZA 3OKEB 4NKOB 4NO5B 5ISZE 3H42H 1KYOJ 4GAYB 2VLKD 4RFEB 4NQEB 3BKYL 5J4MA 2APFA 2CGRH 1RJYB 1W0WA 3RY6A 2XKNA 5FYLH 4X80H 3WKML 3MXWH 1R24A 2WV3A 3U0PB 1J1XH 3MUJA 5D6CA 2Q8AH 5L88L 3BOVA 4JFFB 4Y2DA 5IW1A 1CLZH 2PXYC 7FABH 1V8HA 3SDAB 3ESVF 5JDSB 3MYJA 2X89A 2XT1B 2XWJA 4PJEA 1QSFD 4MAYA 3GO1H 1JTOA 1CG9B 2ZKHH 3SEPA 4MJID 2PYEA 3VRLE 3L5WA 1G0DA 5EU6B 4K7PY 1U8JA 3P0GB 3S37L 3LSOA 3MLYL 3CVIL 4K3EH 4XGZB 2VAJA 5D1ZD 5FCUL 1U3HA 3M8OL 3LD8C 4PLNC 3UTQA 1DLFH 3UC0L 3TGXA 4HZAA 3QFJE 1KJ2A 3L3JB 3BP6B 4XXCA 3HC0A 3TBWB 2A9MH 2P5EB 4FXGB 5HI3C 3VFTA 1XCTA 3RHWK 1KEGH 2H3NA 4MA3A 2DYPD 1FGVH 3MRDB 1X7QA 4M8VA 1OM3H 4DVRL 3KPOA 1EJOH 1MFBH 2IFGA 1SEQL 2B4CL 4G6FD 2B1AH 4OGAC 1YPZA 4R2GD 1ZVYA 4L3EE 4Y2DD 2FJHB 3LPFA 4K07A 3FJTA 35C8H 5FM5O 1HHHA 5TE7L 3JVGA 2DD8L 2X89D 5LQBH 5T1DH 4AEHH 2EYTB 2ZUYA 4F8TA 2PYED 4QXTB 1S7UA 4M7LT 5DHYA 3BO8B 1FZJB 1I1YA 1PLGL 5CSZA 3I50L 1U3HD 4HKJB 3QT2A 1OQXA 4Y1AE 1YYLH 1KB5B 1ZK9A 3FT4A 1RZ7L 3UROR 2FYYB 1HNGA 5BRZD 5CJXA 4MA8L 3ULUE 2NW3A 2NX5B 5KJRH 4OUOA 2P8MA 4L29A 1RK1A 4PGJA 2MPAL 2B8OT 5FYJD 4C56E 1D5IH 2APWA 1U3JA 3FQUB 1MQKL 1BX2B 3PQYA 5I9QB 2V5SA 1D5BB 4U1JB 2AEWA 4RZCA 4JN1L 4N0RA 2VKXA 4X6FB 2EDDA 4TUKL 5D7IB 3T4AA 4IS6A 3I85A 3TNNA 2DTSA 2HTLC 1U0QA 1MSPA 2NY3B 3MRPB 6FABH 4NKMB 1U8PA 1J0JA 2CSPA 4AG4H 1T89C 1JNLL 4OFPA 1CDCA 2F9BT 2R1YA 1UM6H 2GYSA 5CJBA 4KK9C 3EYOB 4DFHA 1ZTXL 3HG1A 3SDXA 1ERNA 5IKCA 2X2YA 4YFEA 4OIBA 4MNQA 1YNLH 2WBKA 4GG8B 2LU4A 3GSUB 2AEQH 4OZHB 5DMYA 2X7LA 1ACYL 1LP9B 4JDZA 5DVNA 4MVBC 3KXFD 1JNNL 4XH2B 4PBVC 4QTHA 4U0RC 4ZAKC 3VGGA 3DETD 4XCNA 3TH2T 1MH5B 1GAFL 5E5MA 2FZ3A 3MRBB 5BMFH 3O6ML 5I1DB 4F2MA 3OXRB 4PJFE 5F9OH 3P9LB 3HPLA 5KSUA 3HC3L 2WUBH 5IBTL 4JM2C 3OAUH 1QD0A 3MZGB 4JANA 4JN2A 4XPAL 3SE8L 1VENA 3HG1D 4TUJA 4K7FB 2VQ1A 4JKKA 4MNQD 3LZFL 3FN0L 1KG0B 2C3VB 3HR5A 2Q8BL 3JWDC 4LP4A 2XN9E 3LKNA 3I6GA 2HRPH 2NY7L 2E9JA 1J1PH 1RJLB 3NZ8B 4P3DA 3P11H 3VWJC 1BQHB 4HFWB 3TYGL 3TESA 4DFIA 2QSCL 1I1FB 3UPAA 2AXFB 2ADFH 4YDLC 1YECH 2UWEE 4KJYB 2LU3A 4Q2ZA 3LKQA 3V95A 4MDJA 4YHLL 3U4BL 3H7BB 4QWWD 5IB2A 3O2WH 4MD5A 2W60A 1QFWI 5KN5A 1HXYA 4POZC 2APBA 3EOYG 4OZIE 1LK3L 1UG9A 2WQ8A 3MNZB 3S5LB 4OD2A 4PJHE 4TPRL 1QSEB 5HTSA 2D0FA 2SEBB 1DEDA 4H8WC 3EOAB 4ZUWB 4X6EA 2JCCB 3QEUA 1ONQA 1JPST 4FTVB 5HYSB 4D8PA 4IMLA 5D2LE 5DEFA 1CDJA 3U36A 3OR6A 5J12C 1QO3B 2A2QT 2ZCKH 1ACZA 5JOFA 4P2OA 1AGFB 2BZDA 3HE7A 3T8XB 1WZ1L 3MV8A 5F9DC 4HUXB 2ZJSL 3RKPA 5L2KB 1F02I 1EHLH 4GXUM 2ZG2A 1HNFA 2JELL 5INCA 4RAUB 5D8JH 5T1MB 5DRZA 1I7UB 1NFDA 3QFJD 4DQOH 4K3HA 1HHGA 3H3BC 1XH3A 3X3GL 2NXZB 1BZ9B 5GRVL 4K3GA 5BQ7A 4Q0XL 1LNUB 3F5WB 4Z5RB 4PR5B 1KTKE 3OL2A 2HFGL 3MRMA 3SQOH 1JGVL 2NZ9D 1OAQH 4S1SL 3CFJB 3BZ4B 1IC5H 4LHUA 3SJVB 2W0FA 4P23B 3INUH 1RZGB 4K71B 4OSUH 3RQ3A 4OZ4A 3U7AA 2BSRA 3L95A 3T1WA 2VUYA 5DA4A 2YPVH 2V17L 5I1EL 4NRYB 3B9KC 3F58H 4UT7H 3L5HA 5IQ9A 3P73A 4MXVE 4JFEA 2UYLA 4P2OD 3HE7D 4NOBA 2E27H 3FFCA 4G6KL 5AD0B 5FUZH 1Z9OA 3DVFA 4OQTL 4OCWL 5J6GB 4OF7A 4QRUA 1YNKL 3QQ3A 4PJCA 1MFEL 2D7MA 4WGWB 4E5XA 1XF2A 1NC2A 2J6EL 2KBGA 3CXDL 3G6JF 2H6PA 3VRJA 5TPWH 3ZHDA 3ULUD 1DQMH 1SEQH 1U36A 1MCFA 1RULL 1OAZL 1A9BB 3Q5OA 3O6FC 3VCLB 3ZDXE 3NACL 4LPUA 3LB6D 2ADGA 4LOUD 1ZHKB 5DS8A 3C60B 2PN5A 3K2MC 4B53A 1BJ1J 1AGEA 4LHUD 3MUHL 1F58L 5FGCE 5DURB 4MQSB 4DOHE 3OR7A 1BBDH 4NKDA 1FL6B 3GMLA 4WUKH 4L3EB 1AHWC 3BP4B 2R0KL 1ZA3B 4JFED 1IC7H 3ZLQC 2Z91A 2IBGA 3W9DA 5CEZE 1FO0A 5EBLA 1AKJA 1H5BC 2Y5TA 5FO8B 3B8SA 1K5NA 2FWOA 5JMRA 3GMNB 3C9NB 3QG7H 2IQAA 4LHQB 3F6IA 1MCLA 4XC1H 5I1JL 1R6VA 3OBAA 1SM3H 1NC2D 4K2UL 4FP8L 4HUNB 4DUXA 4RGMB 5JIHA 2NYYD 2QQKL 2Q7YA 1MOEA 4XMLL 3SE4A 3SE9L 1IAMA 3FO2A 4I2XE 4KU1A 1N8ZA 1Z5LB 1UWGL 1W72A 2BOBA 4Y5YC 4OD3L 2V2TA 1JIBA 4GS7C 3IDXH 5GZOC 4X98B 4QKXB 3T3ME 4NN7C 1YJDL 3VXUE 3RVTC 3RGHA 3V6ZB 3TYFB 2VISA 3GJEB 3TPKA 4DGIH 4WU5A 3SOBH 2W9EH 1T04A 4BKLB 4HH9B 1KJVB 3QPQD 5IW3A 1YC8A 1RQ5A 4PJHA 4PTUA 1JGDB 4ZYKA 2DWEA 3MRIB 5J13C 4MXWH 3RTQA 1K4DA 1KF9B 4DCQB 3CX5K 3SKNB 3F7PC 4HIEA 1U8OA 3BIBX 1RUPH 3CDCA 5EC2A 1KN2L 1SJEA 3VRIB 5ACZB 3AREB 1FPTH 3UTSB 4FFYH 1YYML 3GIVB 4RMRA 1R5WB 3V5KB 3P4OA 2EXYC 1MIMH 4G9FA 2GSGA 4YBLB 5BZWA 3BZEB 1WTLA 2H32H 4HKXA 1QLFA 1IKFL 3C6SB 3LRSA 2MJWA 3BH9A 3DXAE 5C8JB 5I19H 4MB4A 2GTZB 1F2QA 4EI5B 1T1YA 4LLVB 1NL0L 4UDUA 3EYUH 4JG1H 3FB7B 3TFKC 1HQ4B 1FZKB 4QNPF 3R0NA 1X4ZA 2AQ1A 2V5RA 3FQRA 4PJFB 4X7TB 1YMME 2GCYA 3ARWA 3BDXA 3DUHA 3MNVB 4PG9A 4Y16B 1LMKA 4DAGL 2AJUL 2VDQH 4ZOAA 1OGAE 4HD9A 1ZHLA 1UA6H 2N7AA 2QSVA 3KYOA 4PRDB 3TF7C 1WGOA 4PRBA 5JXAL 4NWUL 1U6AH 4OLYL 3AY4C 3QIWB 4G9FD 1U8HA 1FHGA 3U4AA 1QLRB 3IXTB 4EZMA 1JCKA 5CBAA 1NC4B 1DBKH 3UTPE 4CU8A 3WUZA 1GHFL 4M7LL 4FQXB 4OFDA 3ZKMD 1OD7A 2NTFB 3DSFL 1U95B 5D2NE 2D7NA 2AK1L 4XRCA 4NO3B 1J1OH 2FH8A 1S9YB 4PJXE 4JG0L 4WV1C 2MHAA 4R7DA 1JWUB 5HHMD 1RHHA 3MV7A 1ZLVH 1XIWB 3UDWA 3O9WC 2QADD 5KSAC 2XACC 3DUUB 1GGIL 4JRYA 3MLZL 4HJJH 4OQ1A 1OAKL 3A6BH 2Q6WA 5FA4B 5JOEA 2EEAA 4G8EA 1MCPH 1KELL 2WINB 2D9QB 1A6AA 1I9EA 4S2SA 3CD4A 4Y4HC 4OZFB 1JF1B 4I5BA 1WF5A 4AIOA 4U31A 3R1GH 5D5MA 3PGCB 1EUTA 4F15C 4L8DA 4R4BB 1T66C 1QFOA 2A1WH 2FO4B 4ELMB 2CR3A 4KGLA 1G9NL 5EZIH 1FNGA 3TV3H 3SKMA 2BRRL 3FO9A 4MLSA 3U1SH 1CLYH 1LO0H 4APQB 5LKNA 3KLHD 1EDQA 1UKTA 1DL7H 3QDJA 1G9MH 4QHUA 3SHSA 1WISA 5IEKB 3UPRA 3EOBB 3P0YH 4KVCH 3V4UH 4OQTH 1HCFX 4P4KC 4F7MA 3MV7D 4WO4B 5CIPB 1YQVH 1YEFH 1YNTB 3PWJB 3NMEA 2ZZUT 4QO1A 5CEZD 4JRYD 4MNGB 4F57L 3ARDC 3EYFA 4JFYA 1I4FA 3CPLB 3P4NA 1QFWM 3GSWB 4Z7VB 3SDYH 4WUUE 4RAVB 3QUMA 4MJ2A 1WCQA 1OOAA 1S9WA 4QTIH 2F19L 3TIEB 4OF6A 1I9JL 1O7VA 1X5AA 4RGNE 3KNBA 2AV7B 4QRPB 2O5ZL 2AXHA 4UI2A 1J8HA 1II4E 1VADA 4PJGA 4YR6B 3DNKA 4WI3A 3DLQR 1JNHA 3G9AB 5CWSA 1UJ3A 1ED3B 2CLRB 5JLZA 3EDEA 1MWAH 1WC7A 3C2AH 1JRHL 3QDGE 3ZE1F 3QDJD 5FOJA 5F7WC 3LQAC 2UVFA 4UUJB 2EC8A 4YHMH 3UTTA 4H0HB 4H1LG 2EDRA 5EBWA 3WO4B 4GG6B 3RDTC 4LDOB 3BP5A 3BD5A 5GGSY 3UBXB 4NNPL 4CNIA 3VGAB 4I13B 3L3HB 1SY6L 1R0AL 5L2JB 5IMOA 1RUAH 2UVEA 5T3XL 1A0QL 2A9NH 2Z4QA 1UACL 4N0YH 3QO1A 2DMBA 3EBAA 3FTGA 2FLBT 4JQXA 1Q8MA 4KKAD 1H0DA 2E6JA 1YEJH 3BPCA 1ZGLA 2I60H 4L4VA 2DMCA 3BUYB 2ZPKH 4TVSa 2K1MA 1WTGT 1P7QA 1JPSL 1JGUH 1EFXB 4X8JA 1P53A 4O51A 5EBMB 2G5BA 1TZIA 2VLRB 3EHBD 3NH7H 3KYNB 5D1XA 5IVXE 3EJJX 2R2EA 3R06B 4Y5XC 4WJ5B 1CD1B 5F1IB 5LGJB 3HUJF 1MJUL 1OLLA 2VDPH 3RWIB 1BF2A 5KS9F 5KG9A 2XKUA 4GMSH 3V0AC 4CW1B 4QHLB 1K2DA 5E08H 3NIFF 4X5XA 4UB0L 5E8DH 1C7TA 2D7TL 4LAQL 1YY8B 1F6AB 1XFPA 4ZQKB 5DTFB 4JQIH 4AT6B 3MJ9L 1OGAD 3MJ7B 1NCBH 5E56A 4M4PA 4L4VD 4UNTA 4IEFB 1IKFH 4I9WE 4Y4FC 3WFHB 2PCPA 3TPUA 1SYVB 3HZVA 5KTEL 1P7QD 4Z7UE 2DQCH 5ID0A 3U0WH 2H45A 1UH2A 1A7NL 1WBZA 2C7UB 1Z6JT 1RY7B 3MODL 4WY7H 4YXKH 4G43B 4JY5L 5FOBB 4JPWH 5D1XD 4MWFB 1M6OB 3NGBB 3QIUC 1KSRA 4PRNA 1XEDA 4DTGH 4PLKD 5EU5A 1A6WL 4ZPTB 5KVFL 1UZ8B 1D6EA 1GH7A 4AYFA 2GITA 5D93C 1IQDA 2P8PA 1CBVL 3DXAB 5DMGD 3VJ6B 4XB7A 4LRIA 4XPFL 1DUZA 3QUZA 4GRWB 5CMAA 3ROOB 3BMVA 1XGUA 1KNOA 1T21A 1SBSL 4XTRD 4CMHC 1F3DJ 2UZIH 3TT3L 4F7EA 2J8OA 4GG6F