3EJYC

Structure of e203h mutant of e.coli cl-/h+ antiporter, clc-ec1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Intracellular proton-transfer mutants in a CLC Cl-/H+ exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system/proton transport
total genus 34
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejyC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejyC01
3IFLL 4POYA 1TPXB 2J2ZA 1NCTA 5H37H 5L2KE 3GB7A 1K5NA 3DBXA 1DZBA 3L3DA 1MI5B 4LLUB 2FDBP 5J4MA 5D8JL 1FO0B 3E6FA 1FNGA 1KCSH 5C86A 1GAFH 3NIGF 1KPRB 2QJDA 4PYHA 2PYEA 1ORQB 3O6MH 4L3CB 1PD6A 5ILTH 2HKFH 2XZQL 2BY2A 2OL3L 3CXHK 4J3VA 1BQHG 2YXFA 4GRWB 3UP1A 3D0LB 2VOTA 4X4ZA 4LU5H 5E08L 1W0WA 3N06B 3HMXL 2DWDB 3L5WB 4XXDA 4FQXA 1FVDA 2WIMA 4O2CA 2YA0A 4YHPA 3SO3C 3LB6C 2FHFA 2NY0B 3LQZB 4P57B 5TE6L 4KTDH 2G5BA 2BY3A 1SEQH 3RDTA 5C9JB 1QLFA 4YIQA 5IB2A 5MEND 4NQSA 5F7YC 2HWZH 2X89A 3KG5A 4CNIA 3HE6B 3LKOB 1OTUD 4JE4B 4KPHH 4NUGH 4GUPA 1XF5A 3AREB 5LCVH 1HHIB 2L7UA 4OCSH 4QHUA 4Y4FD 4BELD 1P6AB 4TYUA 5HVGB 1XGUA 1A7BA 1ED3B 3GSVA 4XWOC 1N6QH 5GS0D 2CR6A 4BA8A 4DW2H 4NWTL 1BBDL 4JRYD 2E8YA 2W9DL 3BDBA 4JHWL 2AQ2A 3ZYOA 4D2NA 3FJTA 4Y1AB 5IT2L 3NFNA 1WBZA 1G84A 4WO4D 4FXGB 1QEWB 4IJ3B 5F6HJ 5TDPA 5E2UL 5J7CC 1MNUL 1HH9B 3GUTB 1T7WA 5D5MA 1PW3A 1Q8MA 4G6FD 4QRRD 3KLHC 2DLIA 1S7VB 4MNGB 4QWWC 3UO1H 1R24A 2GI7A 1QRNA 3DMMD 3ET9F 3QUZD 4X7TB 4CVXB 4NQUA 4TNWK 3IJHA 4QHKI 1UZ6E 4KJWC 3HC0B 4M1DL 2APVA 3GM8A 4IRZH 3QIWC 3VWKD 1KIRB 2NY4D 3NCYS 4ISVA 4N8CH 1A14H 4F37K 2ENSA 3TZVD 1NBZA 1ZHNB 2B0SH 1UJ3A 2YPLB 3MFGB 5BS0D 3HNTH 5EZLA 2PW2A 3TVMC 5HYJE 4K3EH 5DK0B 3FN0H 5DJ2B 4GJTB 1X5AA 3EJJX 1JZ6A 2DQTH 2ZUUA 2FB4H 3OR6A 4JKKA 3IGAB 2EIZB 3IXAB 4E0RA 1CU4L 4U1JA 1J1OH 3FQWA 3ME0A 2CGRL 4X6CE 4DGVL 2IAND 2LQRA 3GSQB 5B8CA 5C0FB 4UQ3B 1FYTE 3MLUL 1FORH 1C5BH 2HLFC 3IJSA 3KGRA 4QRUB 2HJKB 5A2JH 4PJAA 1JPGA 1QSVA 1QBLH 2XOTA 5EZOH 4JCLA 2Q86B 3CC5A 4OLXL 1H0DB 1IQWH 4UTAH 5I76B 1MJ7L 1WEJH 2CR3A 4GBXB 4RMQA 2XTJB 2C4FT 4ODTL 4KROD 4Y4HD 5E8OA 4GT7A 3F7PC 4YPJA 2ADGA 5I16B 4FQJH 2R9HC 2ZG1A 2AK1H 4P9HH 1CDUA 5TF1L 1N3NA 4GRLC 1A8JH 1RK0A 4M7KL 1UXSA 3PNWB 4P2OA 4PJDB 5J1AA 4UV4L 1YYML 2X9XA 4TVPL 1I1RA 3WUWA 1N6VA 3KPPA 4HGMA 5C2UB 4P23D 1IBGH 3ZE1E 3O9WC 4HJJL 1JWMA 4JVUA 2ATPB 4JFXA 4RGND 4Y5YB 4G5ZH 2UYLA 3QUXB 3AU1A 3EYVB 4CU8A 5HVHB 5HVWA 1AY1H 5E94A 4PGBB 2QLVB 4FZEL 4J1UA 1IC1A 4FQ2H 3LZFH 2DQFB 1A7QL 2DAVA 4LARH 1XR8B 1C12B 3BH9B 4AEEA 4OLYH 1JHKH 5B38G 1I8MB 3MLSH 4R2GB 2XI9A 2ZUXA 3P0YL 3SDCD 3ULUC 3D85B 5CIPB 3ZYIA 1KENH 3F12A 1RJYB 2BNUB 3LD8B 5C6TH 2BSED 4ZOEA 5HYJA 3S96A 1A22B 4U33A 1LO3H 3DX7A 4PJ7F 4NWUL 3V8CA 2HYMA 2XRAL 5DJ6A 1OTSD 4RQQB 4JM2A 3I50H 3EHBD 5EULV 2AGJL 1CFTA 5CUSL 3BKCH 3N9GL 2GSGA 5TGBB 4JB9H 4ELME 5D1QA 4ZG1A 1FYTA 3S4SG 4Z5RB 1F3JA 3WHE0 4GO6B 4ZFGH 1QUNA 2R8SL 4CVZA 4H8WL 1D5IL 1A02N 2DD8L 1HSBB 3OKNB 1ZT4B 4I3SL 1KCVH 2H26B 4PRHB 1Q0YH 5IK3B 2AXHA 4PBWD 1B6DA 4YHML 3IDGA 5GGUA 1OSPL 4NNPL 5EU6A 1MRCH 2B7DT 2X4OB 4RGOH 2F5BH 2R1XA 1ZSDA 2AERT 1D5XA 4D0DB 4DTGH 1E6JH 1FVEA 3BGMB 1TTGA 1A2YB 3SKJH 4LHUG 1U93B 4M9PA 4P4KB 2EC9T 4HUUB 2VDNL 2XNAB 3C6SB 4P46B 2Q6WB 2OXGA 2QQLL 3UTZB 1MCDA 1NEZA 1R5WB 3TC9A 1MCOL 4S11A 5I1JL 2FJFA 5IVXB 1CDJA 4K2UL 1F42A 4JPIB 5C9KA 1J1XL 3D87B 2E9IA 4K7FB 3GHEL 4OF0A 1JTPA 3MACL 3WIIH 3X3GH 1DN2A 1EBAA 1Q0XH 1G7IA 3WJLA 3T09A 1JNNL 4R4BA 5ALBL 4DZ8A 5AG9A 2A77L 2IFFL 3O41A 3VXUE 4G6AD 1Q9KA 3GEWB 2EDLA 1J8HE 5J12C 5DHYB 3O2VH 2Q20A 5E4EB 2KBGA 3S35X 3QISA 3CMOH 4YQXL 2Y06H 1H3GA 4R8WL 1MVFA 3OJDB 4NZRL 1I75A 2RFXA 1Y18A 4BSWB 4X6BA 1GGTA 3FB6B 5EFIA 5GRJL 4AQOA 4LFHG 2OTPA 3VXNA 2UUDH 2EC8A 4JAMB 4GMTH 4NO2B 3TBSB 1T22B 4NKIL 4HKZB 4ELMA 4XCYA 1INQB 4MCYB 3BPCB 1AFVL 1ZT1B 3QG6A 4FQXC 1N59A 1NBYA 5BJTA 3TPKA 3TA3A 4JFED 5D7SH 1G9NH 2YHGA 1Q9OA 3FO1A 1OM3L 5INDB 3FQTB 2ZCKL 3IFNL 1Z3GL 2YKLL 4N0YH 4QXTA 1FCCA 3RDTC 3PWVA 1FO0H 2NX5D 1YQVL 2VLJD 3WHXB 4MLSA 4XC3H 3BO8B 1CXKA 2Y5TA 3NN8B 3S6CA 3D18B 4Y8AA 1QFOA 4WU7A 4WY7H 5SWSB 1KN2L 5EIIA 5C0AA 4AYFA 1X44A 4GRWH 1OOAA 3M8OL 2OSLB 4Q74A 4NDMA 3FB5A 2CK2A 3UCRA 1RULH 2C1OA 3FFDB 1GGBL 4UDUB 1IM9D 5C0GA 4GMSL 3I9GL 2DKSA 1D3CA 1QHOA 2YBRA 2MHAA 2GAZB 4D0CA 5JDJA 3WN5B 1NGQH 1TJGH 3O6LL 1AXSA 4GG6E 4NFCA 5FB8A 3ZDZF 3SCMB 2HH0L 4XT1C 1SVCP 3CIQA 4HXBH 5IMLB 5D7LB 1MRFL 3RL2A 2MJWA 2Z91A 3IFLH 4XX1E 4C58B 3RGHA 2NXZD 4OFIA 3B2UD 4JFYA 1UJ3C 2GJ6D 4N1HB 1DN0A 1S9XB 3IU3A 5C07B 4EQ3A 5D8JH 3SDDA 4K3DH 3S3SA 2AJXL 4DCQB 1OP3K 4PRBB 4Y7MA 1CE6B 2FD6H 4G6ML 3V7MA 1QVOB 3CFBA 2Y9RT 1ZANL 4QHNA 2XZQH 1EDQA 2OL3H 4MDIB 3BQUD 1IMHC 3ALXA 1PEWA 1YC8A 5T5NF 5E08H 4OZHB 3HMXH 5B8CC 1VGKB 3OF6D 1D9KD 3MRPA 1JF1B 5SX5H 3SKOB 4P2QD 5DRZB 5DT1L 3HG1B 1O0VA 1BFOB 3P4MB 1X5GA 4PG9B 3PIQA 3RPIB 2W1NA 4ORGA 4D0BB 3G04B 3VH8B 4PS4L 3FB8A 5TE6H 2E7MA 4H1LA 1PKQE 1FNLA 4KK5C 3IDXL 3O4OB 5E6ZA 3WFCL 4ZXBB 3D3VB 3QJHB 1MLBB 3DVNB 1N26A 4HUVB 3BP4A 3LHPH 1Q1JL 2YD7A 4BUHA 1TVBB 4AIXA 1P7HL 3BKJH 2C3VB 3F5WB 4W4OA 4WIQA 4JDZA 4OV5A 5DJDB 1DEDA 4P2OC 2HMID 4KRNA 2KDGA 1Z9OA 5HD8C 4NWTH 5DD1L 5I1CL 5F9WC 4U6VL 1BBDH 5F7EL 2W9DH 3FT3B 3V6FA 3IDIA 1X5JA 2QSQA 3WDHA 1A6ZB 3GZKA 2ITCA 1WGOA 2Q8BL 5IT2H 4PJFF 4Y2OA 3ULVD 3MLWL 4DEPB 5C92A 4MJID 4N9GA 3ARDD 1NC4B 4KMLB 3RL1A 4PGCB 5E2UH 3Q3GA 2ICWI 4GG6A 4OI8A 1KACB 5CP3A 1MNUH 3PHQB 4FQLL 3H7LA 3RPKA 2H6PB 3DUSA 4UTBL 2R1YA 3H2WA 3QXTA 4LGPB 3Q6FB 3AFLA 4OLZL 5BXFB 2P5EB 5BRZB 3KPOA 4M1DH 3QO0A 1N2RB 1B0RA 2RR3A 3PJSB 3QEHA 1J12A 3H8NA 3AS1A 2XG4A 4X6DE 4PJHA 4JREB 1HE7A 1TCRA 4JM2C 2E7BA 3RZCB 2MTPA 4PRAA 5F8RC 2DYPA 4ZUUB 1H3PL 3FQXA 3BP6B 5F1NB 1OP3H 5CHNA 4HWBA 2IPTL 3MOBL 2BVPA 5D1QC 3W81A 2PCPB 1JV5A 4NQXB 5DVOA 4DGVH 5HHOB 2RHEA 1MI5E 2OLDA 2Q8AL 3O2DA 2I9TB 1MSPA 2NTFB 3EOYG 1M71A 2R2HA 3MLUH 1PKQA 3IT8D 3MJ8A 3Q5TA 1E27B 2XXCB 4HFUL 3ZT7A 3MNWA 4ONGL 2VLRD 2WBJB 4FXKB 3SDXB 4GRWE 1WZKA 5GGSB 4OLXH 1F13A 2L0DA 4QYOB 1MJ7H 4AY0A 1TNNA 3M07A 5IIEB 1LO0L 4ODTH 3OKKB 2OI9B 4IS6A 1A64A 3SDYL 3TGXA 2YD1A 3PHOB 4I4WA 3QQ3A 1FAIL 4JCMA 5I1KL 1ZHBB 1XCQA 2VC2H 4M7KH 3PUCA 1MCNA 1AIFA 4LQFL 4UV4H 1YYMH 1A9EA 3BP5B 1RUPH 5SWQB 2EE6A 4PGEA 2D7MA 5ID0A 4U3HA 3I6LE 3SDAA 4GW5A 4HJJH 3HZVA 5SWZB 4L1HA 4CN1A 1OGTA 3HPLA 5JTWA 3WJLC 1MAKA 1IAOA 4P2RD 4AEIL 3VFOA 4WW2A 1A9BA 1JGDB 3C09C 3TN0A 3TM6A 1KNOB 4FZEH 1FN4B 3NIFE 4OFYD 4PP2B 1U8NB 5D2LA 1A7QH 4EN3D 3CFEA 1N64L 4ZFOA 1FZMA 5IB1B 3W0WE 1ZWIB 3P0YH 1CDHA 1I1YB 4OD3L 4IHOA 2OZ4L 5HGBA 1D5ZB 5EB9A 3O6FB 4HUWB 1T80A 2QQKL 4G8GD 4APQA 1RJLB 2WWMD 1HKLL 2X70A 4L1DA 4PP1C 2GTWA 3MRFA 4NWUH 1CDBA 2XRAH 5I15L 5J3HC 2ZSVB 3EYUL 4F33A 4Z7NF 1EUUA 1K4CB 5I8EB 4NN6B 3MGAA 5CUSH 2B4CC 4NC1E 4ENED 3TA3C 3L3GA 1IKFL 2NXYD 5CBEA 2W9LA 4M7JL 3MO1B 1EXUA 4JZJB 2YPLE 4W4NA 5IEKB 2R8SH 4H8WH 5FAAA 1D5IH 2DD8H 3HE7B 5C08B 2F5AL 4TN9A 4E41B 1OAXL 4I3SH 2DWDA 2GITB 2PTTA 5FA4B 4WEUD 1NUDA 3G08A 4YHMH 9CGTA 1R3LB 3AAZB 2BK8A 1OSPH 4HMEA 4NNPH 4F80A 4QY8A 1UACL 1RD6A 3LV3B 5HGGS 3UBXA 5IVZB 2G2RB 4OZIA 4C59B 1U8KA 5KSUA 5C9JA 4PV9B 1GSMA 4P5TB 4XPAL 4HBCH 2VDNH 4N1CA 4YDKL 1VGEH 2M2DA 2QQLH 1LE9A 4U1KB 5I1JH 4OZFA 1I7UA 2XTJE 4K2UH 5ANMB 2MNUA 3AREA 2BNQA 4OZGE 4JKWA 1J1XH 2PW1B 3RWFA 3GHEH 4U6YB 4PTUB 4QRSB 3RY5A 2D0GA 3NA9L 4DKFL 3P0VL 1HILB 4OF6A 3V9FA 1JNNH 5ALBH 4PJDE 3UXFA 1QACA 3W0WA 2A77H 2IFFH 1KT2B 3MCKB 3RWHA 3C6LD 1WZ1L 1SQ2N 1F4XL 4QOKB 5JOFB 1B0GB 3GUTA 2EYSB 1KCLA 5HI3D 5FECA 2HTLD 2MMXA 5ESAB 2W0LA 5I18L 1R3IL 4YQXH 3B3IA 4GAGH 4R8WH 4NO3A 2A38A 4NZRH 3SDDC 4QLRA 3T77A 1BOGA 2NXZB 5J9PA 1B2WL 4PRDA 5GRJH 2HAZA 3ESUF 1QSFD 5DQJA 4HGWA 4C56B 1D5MB 4W81A 1RZJL 4UINL 2XWBB 3DURB 1J0HA 1KSRA 4GLRH 2HT2D 4NKIH 1M05B 5GHWH 4HW6A 4QCIB 4V1DB 3IB4A 3FN3A 1AFVH 5F1KC 2YPLA 1FRGL 5L2JB 1YEJL 2QSVA 2Z93B 4F8QA 3QEGL 1OM3H 1UEMA 2ZCKH 3IFNH 5DS8A 1S7TB 1T1WB 1IARB 1Z3GH 4M48L 3IKCA 1SHMA 5HHME 3W39A 2BCKB 3AROA 4LLMB 4ACPA 4NOBA 5FGRA 3S36L 2Z8VC 5D70L 1YQVH 5F21B 4XP1L 2UV3A 5M95B 3B9DA 5AYUL 1ZGLB 3GRWA 4TULL 2EDRA 5T1LA 2ZNWA 1RJZB 1KN2H 1YMHB 4WVRA 3U4EA 4OQ1A 4LPCA 1QPPA 4QXWA 4NHCL 4W6YB 4W4OC 3C5ZA 4RAHA 4TVPE 5L0QB 5EC1A 1RZFL 2ITDB 4NKDB 5I76A 4ODXA 3QNZB 3KYNB 2PETA 3V5KB 2P8PA 1GGBH 4JFQB 4MZ2A 3TBTB 1F45A 2B5IB 4GMSH 3TYFB 3I9GH 4OZGA 2YEZB 1J0IA 3GSOA 4PV8B 3QRFM 2X5PA 4M5YL 4F7TA 35C8H 2ED7A 2FL5B 4LSVL 4LVHC 1F02I 3VFWA 4XH2A 2AEPL 2L4OA 3ZZ1A 1SMAA 5KS9E 2EKSB 5I66B 1VA9A 2D31A 1ZLVH 1DUZB 1MHHB 2ESVD 1I7RB 3H0TB 5IMMA 5IVXE 5I75B 3MBED 2HH0H 4WI9A 1X7QB 2IALB 2A73A 4UIKL 1AP2B 5E2WL 1MRFH 4I8DA 3QH3A 4LF3A 4PGBA 4ZDHB 2IAMD 3FOLB 3RBSA 1G6RH 1C12A 5EZIL 4N0CD 3QCTL 2JJWA 2BHZA 4MDJA 4D9RD 4KDTA 2J5LB 2CUIA 4RGMB 4G6MH 3V7AE 4XNQA 3P77A 1ZANH 1JTOA 4PJ9D 4WHTA 3D85A 1S5IL 5MP6L 3FQUA 1RJYA 2JJUA 1PAMA 3B43A 3SKMB 2NZ9D 1BBJA 5LAXA 5TPWH 5DT1H 3KHQA 1EGJA 3WHE1 5F3BA 2I25N 3WO4B 2AV1B 1K8IB 4PS4H 1KUMA 3UTSD 5D1XB 4P3DA 5DQDL 2I60L 3LKPA 1P69B 5D7JD 5TGBA 3IDXH 3PDOA 3WFCH 3RX5A 4CVUA 4LPXA 2YN5A 1A0QL 3TF7C 15C8H 1JF6A 3VMNA 1P1ZA 3GGWA 2OTUA 4KTYA 5ECJE 5SX4H 5I6XC 4JPVL 6FABL 3LKQB 5GIRA 3K4AA 2I5YH 1FSKC 1VB9A 5KSVB 4NM8L 4RMRA 5DD1H 3IDJA 4U6VH 2NY5C 5F7EH 3T0AA 3MRKB 2NR6D 3SDAC 2Q8BH 1U93A 4P4KA 3MLWH 2JK5A 5KS9A 4YHIA 5ESQA 4P46A 4FS0A 2WP3O 4WW2C 3TN0C 3M17A 4PRPD 4RX4A 4UT6L 1UH4A 4FTVB 5FM5O 3T2OA 1I1CA 1XGYL 1DBML 4YDLC 5FKPA 4UTBH 2Q87A 1MCJA 5A16A 3EOTL 1EEUA 1U8LB 2P8MA 1BLNB 4PJ7B 5E70A 1Z5LA 2UZYB 4EN3B 3DTXB 4FOMA 4DK3A 3H3BC 4UQ2B 3IDNB 5KN5B 2P45B 4HXAL 1U91B 4Y5XA 3T4YB 1ZT7A 3OKMB 1CLYL 3SKNB 4APQC 2X4UB 4K3HA 1I1FA 4CADA 4LHUD 1W2KT 4I0PD 2ICEB 3PWLB 4XNZC 1KFAL 3S3PA 1R5IB 1OB1B 3U82B 3CGTA 5FV2A 2R0WL 2VKWA 3IETA 1IE5A 5D7LE 1WT5A 3FB7A 1AO7D 2YSSA 4EI5B 4BQCA 3MOBH 5I2IB 4Z95H 5ALCL 1QSEB 4MA1C 5DC9B 1XGPB 1Q94A 3DX8B 5C07E 2Q8AH 3QIUB 1AR1C 2FHCA 1BM3L 2C7UB 4R3SA 5F9JB 1OPGL 3E2HB 3QFDA 4HFUH 1C08B 4KK6C 4ONGH 2PN5A 3O4LD 2FEDD 2NY1B 3MGOA 4ZO8A 1SY6A 2O93L 2HA1A 4OZHE 4JO1H 1SJHB 5ADPL 1F58L 1JVKA 2X44D 1LO0H 1IGYA 3HG1E 3SDYH 4CUCA 4WEBL 5DWUL 3FHAA 2BP3A 4LGRB 3CZFA 4AIZB 2IANE 1FAIH 1OSZA 3WHXA 2D03L 2E7HA 5I1KH 5L8LB 5T1KB 1OP5K 4AENB 5DURD 2MPAL 3VFSA 3VU2A 4LQFH 5EOCJ 4NQCB 2VXTL 1CICD 2YN3A 2N7BA 3AREC 3BUTA 3T2PA 5MENA 1YN6B 3MPCA 2EDYA 4NM4L 3U83A 4YXKL 3X14B 4X6FB 4F15B 3KPTA 1SJVA 3FFDA 5DFTA 1QYGH 4AEIH 2VUOA 4Y4FA 3Q1SL 3I75B 3MX0A 1KJ2A 1IAKB 1QQDA 3NABL 1KXVC 5I1AB 2V9RA 4IJ3C 4JRYA 4ZUTA 3VI4F 3KWWA 3BW9B 1N64H 2R39A 2C26A 3QQ4B 3MV01 3NFSL 2H3NB 2E27L 3BEVB 4WO4A 4Y4KD 4O5LL 2VXUH 4OD3H 5DRNB 4ZAKD 2XY1A 5IF0B 1QPXA 1ODAA 3OX8B 2OZ4H 1H3XA 1L7TL 5C0JA 3R8BB 1G7LA 2QQKH 4O02L 4BZ1L 1HKLH 3BZ4A 3DJ9A 4QRRA 1JN6B 2G75B 3GMQB 5I15H 4KXZI 4CMHC 5EO1B 2CSPA 3MA7A 3DMMA 4ELKB 1F2QA 3QUZA 2VZOA 1T0MA 2NY2D 3L3KA 1OQXA 3V5HB 1IAII 4RSVA 4G43B 1SYSA 4G9FD 3O3BB 3VWKA 5E2TL 1CE6A 1OTTC 4M7JH 1QVOA 1WWCA 3TZVA 1CFVH 3L3HA 2NY6C 5F6IC 3KPMA 4PJEF 2F5AH 2DQJL 4H5SA 4FQHB 4NQDB 5J56B 1VGKA 1OAXH 3GSXB 1ZOXA 2DQUL 3H3KA 1C8PA 3DUUA 3FTGA 4NJAL 5HHOE 5K59F 4U6TA 2DBLL 2IANA 1UACH 2Z35A 3C5ZC 3WV0A 1I4FB 3PP3H 4GW1B 1PG7L 4RMVA 3DVNA 4PD4J 4XPAH 2PUQT 2H8PB 3SDXE 4HUVA 4YDKH 1C7SA 1AD0A 1YPZF 4YK4B 1VFUA 3BN9C 4Y16D 1AXTL 3QA3B 4HKBA 1MCCA 3ZE0F 1FQ9C 5DMGC 1N5AA 1S5HA 4YEFA 3NGBB 5F7WC 4I5BB 4N90E 5JDSB 4BFIA 4Y4HA 3KPRD 5HGAB 4WFEE 1OGAD 4IRSD 1IGFL 4ZMAT 1XR9B 2F54D 5DD0L 3NA9H 3JV5A 3P0VH 1G7QA 4DQOH 4XMKL 2CXKA 3DVFA 2RCSL 1F4XH 2DDQL 4PTTA 2XFXA 2NW2B 2OR9H 4IMKA 4PJIE 4I18A 5DRWB 3QT2A 3BHBB 5CILH 5I18H 3EO0B 1RV6X 4KI5D 3TO4D 1R3IH 1GZQA 2EDXA 1NC2D 1MJ8L 1NMAL 2D0HA 3RWIA 2CO7B 4KDTC 4MXQC 8FABA 1TQBC 4JQVA 3ULUF 1HOCA 1B2WH 1F6LL 3QR2A 5BXFA 4LSSL 1YNLL 4LVOC 3GJEB 3Q0HA 1RZJH 4S1DD 4UINH 5HI5D 1A7OL 5F1OB 5IW6B 5DK2A 3MJ9L 3UAJC 2YMXL 1YJDL 1NJ9B 3SDCA 1FRGH 1YEJH 2R4SL 5IHUL 5HDLA 2HJLB 3RZCA 3WNLA 2D3VA 5HHPA 4M48H 2B39A 3TLRA 1CFSB 2K3TA 3MJ7A 3PWPB 3S36H 5D70H 1ZA3B 1JPTL 4XP1H 4PJ5B 2E9WA 3H9SD 1J87A 3OXSB 1FAKT 1KBGL 2MQ3A 5AYUH 3BE1L 4TULH 1Q9LA 3SKUD 1C7TA 2E7LA 2XN9D 5A40E 5CD3A 1FL5A 4U1NA 1PY9A 3SE8L 4BH8B 1TQCB 1NMCC 4UB0L 5ICYA 1KEML 1TETL 1QOKA 3VA2C 1BWWA 1TJHL 1E27A 3JWOC 4NHCH 4PJFB 4ZFZB 1NPUA 5C08E 5E5MB 2GK0B 3G6AB 1RZFH 5DXWA 1AQDB 4M4PA 3QCUL 4EDXB 1UCTA 4RDQF 5IIEA 5F8QC 4F3FB 4XHQA 5L8KB 3NCJL 4POUB 5H94B 1ZV5A 4P4KC 1JNLL 1QA9B 2YA1A 4JKLA 4XPHL 3SY0A 4M5YH 4P46C 4U05A 4G8FA 4LSVH 4RNRB 1VKXB 2GSIB 4Y19D 1KLFA 1T04A 2DI9A 1OAUL 2AEPH 5CGYD 4LEXL 1V3JA 1MVUA 3KLAA 4L3ED 5I1IL 3BP5A 5KSBA 4JFDD 2EIDA 2VLKB 1UXWB 3MNZA 4YFLF 5DD3L 4Z7UB 2C3XA 2NYYC 4PJIA 3UYOD 3FZUC 2UWEB 1OF2B 1ACYL 2DQCL 2WIIB 1DDHB 5E2WH 2DJSA 4Y5XC 1D5BB 1HEZA 5C8JB 1DL7L 2CUHA 4PYGA 2FEEL 2D9QB 5F6HI 3VFNB 3OKOB 3VDAA 43C9B 4EVNA 5IP4A 1IL1B 2Z8WC 1WZMA 2A6DA 5EZIH 3F62A 1ETZB 3QCTH 1E4KA 3RTQB 5F7MC 4HK3N 3LS5H 1K8DB 3FFCB 2WLYA 2VLMD 4UDTA 2R23B 5ETUB 4JLRB 4QOKE 4HIHA 1W0VB 1WT5C 2ZPKL 1OD9A 1BX2A 4Y5VB 3NIGE 1NGWB 5DVKA 3T2QA 2FO1A 1S5IH 1CK0L 2P49B 5MP6H 3SPVA 5BOZG 1RJLA 3OKEB 1U92B 1F3RB 3BVNB 3VGGA 2VXSH 5ID1A 2DBJA 2FX7L 5F7DA 4PLOB 3CVIL 1B4JH 4XGZB 4GAYB 1EUTA 2I60H 4YWGL 3JTTB 4RRPG 1MFEL 4WI2A 4I13B 1IZKA 1A0QH 2VYRE 3PXHA 1FBIL 1SYVB 3L6FA 3H9YA 1AKJD 4JFFB 4UNVA 1JYNA 4JPVH 1I9RL 3MLRH 5GSRB 4P2QE 4RAUA 5AAMA 3DYPA 3GSWB 5EO9B 1I8IB 1CZ8L 4RIRA 2EDKA 5FYKL 2NX5A 3F7YA 4NM8H 2VLJA 1U3HB 3SGEI 3L7FA 1JGEB 1UWXH 1P2CA 3QDAA 3GMRA 3LDBB 1OTUC 3NOIA 3MV7B 3WDJA 4Q6YA 2BVQA 2JELL 4Y4FC 1JWUB 5HHQB 1WBYA 4U1KA 4UT6H 3O0RL 1NUGA 5GS0C 1X5YA 4K8RD 2CKBL 3QEQD 5D7IB 4JZOA 2M26A 3MRBB 1XGYH 5D5MF 2D7PA 1DBMH 2Z92A 1XH3B 3QIBD 5EUKB 2XWJA 4J3TA 1T66D 1ROWA 1F4HA 5LGJB 4WO4C 3RJDA 2CKNA 2I9LB 3ZT5A 4HXAH 3EO1A 3B5TA 3QNXB 2IWGA 3SGKA 1CLYH 2W0PA 3LPWA 5IOPB 1YDPB 5AD0B 1IEBA 1KFAH 5JOFA 1B0GA 3DMMC 2AXGA 3QUZC 4KMTL 2EYSA 4HIIB 2A9NL 5E6IB 1DVFB 4UOW0 4H26A 2QHRH 4JFZH 1ZLWK 4NZJA 5J6GB 3RVUD 4JFHD 4WFFD 3BPOB 3MREB 1JI2A 3VWKC 2NY4C 2LV4A 5ALCH 4KRLB 4U0QB 4FXLA 2D7NA 4NGHL 1A4KB 5CKGA 3TZVC 1I9JL 1XF3A 4H20L 1MCBA 2GJ6A 1HYSD 4YH6A 4ZS6D 3DURA 1BM3H 1QFWI 4QF1A 4R97B 2XQBL 1HSAB 3RWCA 1RIHL 3V5DB 1OPGH 2WINB 1IEAA 5E7BA 5I74C 5FDWB 3EAKA 4JDTL 4PJAF 4K3JL 4XI5D 5DRXA 3BQUA 3VE0B 5ADPH 3QJFA 1F58H 5L6YH 5JHLL 4YFEA 1D9KA 3MFFB 4ONOA 3S8WA 4P2QA 2PO6B 4WEBH 5DWUH 3RUGA 2CKBB 2OP4L 1MLCB 1DUYA 1ONQB 4G80B 4MQ7A 1OAQL 5D7KD 2HJFB 4NPYB 2D03H 1BVLB 1RAMA 1ZGLA 5JHDD 2IQAB 2MPAH 1YMHA 3VGAB 1P5UA 2VXTH 4M43L 2LU3A 1F2XK 1HI6A 5DJYB 3U7YL 4KROC 4Y4HC 4WENB 4NM4H 3V8OA 5GGVY 4YXKH 4NKDA 1FFRA 5HYEA 2PR4L 3QAZB 4OGXL 3V5KA 1BZ7A 3MLYL 5T1DL 1EERB 3FO9A 5IB5B 3ECBB 3D39D 1XF1A 3TYFA 3KPRB 4QTHA 3IDUA 4IRSB 3NABH 4X8XA 1RZKC 2XKNB 5DQ9A 4DEPC 2BVOB 3CXDL 3IRZA 3QZWG 2FNBA 4P23C 4YAQB 1UZ6F 3NFSH 4IMKC 4I18C 3T2NL 2E27H 1YC7A 4RGNC 2A6JB 2EICA 4O5LH 4X98A 3ARGD 3O2WL 1YUHA 3ARDA 3BMVA 3K8MA 1GGIL 1L7TH 4Z7VA 3P4OB 1ZA6A 4JQVC 1NKOA 5C0BD 4O02H 2Q1EA 4J3WA 2ZUTA 5HYIA 3D2UB 1S9YA 4HWEL 4Z76B 2W60A 4P59H 1WISA 3B9KB 4X4YB 1G7PB 4PJ7E 2ICCA 3UEZA 1VPOL 1DQJA 2WAHA 4MHHI 4JM2F 3PABA 4OIBA 3SDCC 1RUQL 4MSWA 5JW5B 1BWMA 4OZ4B 5T3XH 3VG9B 1V3LA 5I1DA 3P11H 1Y0LA 4WGVB 5E2TH 3RZCC 1X5FA 2VLLA 1VDGA 4QRPD 4JY5L 1LMKA 3PE9A 2QSCL 4G8GE 1I7ZB 4UI2A 4BSVB 4YGVB 2W91A 2ZSWB 1OTSC 3KHOA 4YO0B 2DQJH 3VFMA 1NDMA 2N56A 3EHBC 2BDNH 2E7LC 2DQUH 3OJ2C 3PWNA 4NJAH 5B3NA 1QSEE 1ZGLP 1YEIL 2DBLH 4MMXC 3TNMA 3X3FL 3MV9B 3JV6B 1XZ0A 2VNCA 3AM8A 1MF2L 5A1AA 1LEKB 1I1AB 4IEFB 4LCWB 2VLRA 1EEZB 2E9JA 4WHYH 3BDYL 2DKMA 1AXTH 5E99H 3HZMA 4UZGA 3GI9L 3EFFB 1JZ7A 1K4DA 3ROOB 4XCFL 1CDIA 3K1DA 3AC0A 4HAGA 5H35A 3L9RB 4A6YL 5JO5A 1IGFH 3U4BL 1L0XA 1FNAA 3SGDH 3LRHA 5DD0H 4K07A 4QRQB 5DYOB 4NQCE 4XCEA 5JLZB 5E8NA 3PGCB 3GK8L 4XMKH 2X1QA 2RCSH 3CNKA 4NN7C 4YHZL 5D93C 1KELL 2DDQH 1F6AA 1SVZA 1JFQL 1KG0B 4ZPVA 3DVGB 4GQ9L 2BFVH 4Y89A 1WZLA 8CGTA 2D7TL 1T03H 4HC1L 3BKML 4PB0L 1FH5L 4KFZC 3KPSB 4P48A 4P2RA 2FJHA 1E4KC 1G7JB 2AJSL 1NMAH 1MJ8H 1T5XA 3QFJD 3ARZA 4PGZA 4MNHB 4OFYA 3STBA 1S7RA 4EN3A 4G6AC 2CDFB 2YPKA 4UQ2A 1YNLH 2J8UA 5IEHA 3W5MA 1A7OH 3MRCA 1FZOA 3MJ9H 3IDMB 3FRUA 3LEYL 2YMXH 1YJDH 4ELMF 3QNYB 1S7XA 4HDIA 3G5XB 4H0GA 5EOQL 1OB1A 1NCBL 4YDJB 2R4SH 4S1RL 5HHXL 4G8GA 5EA0L 1XEDA 4RMTA 1KIUA 3VFVB 3U2SB 5FOBA 3O8XD 2H9GA 3R1GL 1EHLL 1NGPL 1CT8A 2VQ1A 2D0FA 3KLSA 2J12B 2F19L 5CGMA 3EYSL 4KH2A 5GJSL 1JPTH 2VZUA 1IGJA 2XQYG 1ADQA 1KBGH 3D69B 2RJMA 3BE1H 1MCWW 4KUCF 4JGJA 3SE8H 4A6YB 1CQYA 4UB0H 5GSVB 1KEMH 4NP4L 2YD5A 1TETH 2FR4A 5B22A 1C08A 5ENWB 1UKQA 4R7NB 5IB4A 5CD5D 1V7NL 1MQKH 4ZD3L 3DX9B 3QCUH 5BZDB 2J6EA 3FCTB 3T0BA 1DE4B 3NCJH 4HZLB 2IPKB 4O51A 2BOCA 1YMMD 4Y0GA 1JNLH 2A74B 4LQ1A 4XPHH 1TITA 3LKRA 2MOVA 2I24N 4L4TB 5EOCL 1WC7B 1OAUH 4XPFL 3A0OA 4LEXH 5BVJB 4J8RA 4P5KB 4U1HA 5I1IH 3H7BB 4Q9CA 1PG7W 4M61A 5CJ5A 1G0YR 5F72S 2BHYA 4LIQL 5DD3H 1F00I 3IVKB 4LPTA 2GYSA 2YZ1A 1BQHA 3W9DB 5IW1A 2OCFD 3ZDZE 2JJSA 4IOIA 2X42A 1ACYH 2DQCH 4X9IA 4FG6D 3QPQD 4NJ9H 4OUUB 3SGKC 3B8SA 3M45A 5CKAA 3WD5L 1WIUA 3OR7B 2YUZA 3CFCL 4Z8FL 5GRZA 1NBVL 4IBLT 1U8HB 3D9AL 2WANA 2VQTA 2W0FA 3C6LA 2ZPKH 3L7EA 3RVTD 4ZPTA 1CK0H 3CXHJ 2NXZC 5J11B 1A47A 3B2UC 4NNYB 3SO3B 4I0KA 3QHFL 4OSUL 2HG5A 4KKCD 2AXJA 2FJGA 2XTLA 2FX7H 5E2JA 3CFKB 2IJ0C 3GSRB 1LO5B 2QR0A 3CVIH 4MXVF 1MHEB 1QSFA 2EZ0D 4I3RL 32C2B 2ICWA 3A6BH 1R3KB 4X83A 4YWGH 4C83A 3BQUC 3O3BA 1FNEA 1IILE 3MUHL 5TFSL 3U0WH 1MFEH 5I19L 4UU9B 3L1OL 1D9KC 2DIAA 1KJMA 3CSYA 3HI1B 1S9VB 4KZDL 1FBIH 2DIBA 3TESA 3WSQL 5EBMB 3WNOA 2AKRA 4HIEA 1FFQA 3WNNA 1FIEA 1FHGA 1CZ8H 4OI9A 3DX6A 4PJ5E 5FYKH 5HYQA 3FO2B 3V0VA 3UTSE 2HFEB 4LLWB 2QADD 2ILLA 1FIGH 3DRTA 2PTUA 1RHFA 3H9HB 3WEXB 4PJFE 5DHVB 3WS3A 3CFJA 2HMIC 2BC4A 4HPYL 1K3IA 3WFEL 1QR1A 1XGRA 5CFHA 4GG6F 2CKBH 4BZ2L 4CVWA 3QDJB 1D6EB 4ZYKA 2KUTA 1BJ8A 2VZ3A 4KK9D 1AGBA 3VXRB 5GRUH 1D6VL 4HWUA 4L4JA 5DJXA 2ARJQ 3E1F1 4TNWF 1LO2L 3QIWB 1CDGA 3ULVC 1GRWA 5F9OL 3TT3L 3ARDC 4P2YA 3V4PH 4ZSOA 4F37F 5AAWA 3TVMB 4NRYA 4BQ9A 3FOMA 4YDVA 4M6OL 3MMEA 2Z9TA 4XZUA 5LWYL 2ESVA 5ADOL 4Z7UE 4B0MM 4MD0A 5EZJA 1X5LA 3HTLX 3MBEA 1T21B 4KMTH 2EEAA 2UWEE 3KYOA 2A9NH 4OAWB 5DJZB 3WLWD 2N4IA 2VMFA 3QYCA 4U7MA 2VIRA 4PJEB 3PGDB 3VDBA 4P9HC 3ULUL 2A9ML 2QKIA 2F53D 3DIFB 4NGHH 2IAMA 2IMMA 1I9JH 3AB0C 4H20H 3RU8L 3D25A 3K74B 4E42A 3FFCE 2XQBH 1MJJA 3BFOA 4LP5A 1RIHH 4Y2DD 4YPGA 4OD2A 5E9DD 4L9LA 3VRJB 2Z4QB 3CFDA 3RKPA 2C1PA 3ARBD 4PJ9A 5BV7C 4JHZA 1R3JB 4KQ4L 4JDTH 4K3JH 5E1AB 4FQ1L 1T1ZA 2W07A 2XA8L 4R0LA 1A6VL 5DJ0B 5JHLH 3N0PB 4GRLB 1IC7H 1YQ2A 3PWJA 3IAGC 3P4NB 1CFSA 1JCKA 2OP4H 3P73B 3AM8C 5K33A 4X99B 3UTSA 2AABL 2FSEB 5D7JA 3RY4A 3O9WB 5DR5L 1Y6NR 1WCQA 2LTQC 4M43H 5C09B 2DL2A 4G6KL 2X1WL 4PG2A 3U1SL 1QLRA 3U7YH 1HQ4A 2OMNA 5T3XD 3STLB 4L8BA 4JFFE 4Z78B 3MRLB 2WM0A 4OGXH 3VXOA 3STZB 5HHNA 3MLYH 5ABDE 5L7XL 4YR6B 5FUZL 4BQ8A 5JPNA 3A6CL 3EOBB 4M3JA 4WW2F 5E8EA 2X7LA 2MQ0A 4GAFB 3CXDH 4WI8A 1PQZB 1A3RL 5D2LF 1KTLA 3X13B 4KZEL 3MV7E 3T2NH 3CDGA 5KOVC 2OBGA 4NO0D 3O2WH 1HQRA 3T3ME 5HYFA 2MWCA 5H2BB 1GGIH 4WFGE 4KJYB 3RHWK 4X6DF 1MREL 5AG8A 5CSZB 3REWA 1A1OA 1IC5L 4PRPA 3RGVD 5D7IE 5IBTL 4Q58C 1J18A 4EN3C 1WIPA 2J1KA 4PLNC 1OF2A 4OFVA 4HWEH 4MAYD 5DUBA 2R1WB 5GPRA 1VPOH 3VFNA 3LEXB 3TCXA 4WFHE 1KC5L 3EDDA 1RUQH 1ETZA 5EUOA 2P7TA 3TCLA 4Q6IA 3IF1B 4RZCB 1E28B 3FFCA 4C4KT 2WWMC 4X5LA 4I0PA 3LSOB 2ERJC 4JY5H 1J5OL 3SEPA 1LE5A 3W9EA 5AZEL 5I1GL 1LK2A 3OMZA 3SE4A 3G5VA 4ENEC 1EZVX 1AO7A 1KIQA 4TQEL 4WTWA 1KB5A 4MMZC 1T0NB 2NXYC 4G8IB 1YEIH 4F7PB 4X8JB 1CBVL 5C0CD 5FYKE 3BZFB 3MTRA 4O9HL 2WBKA 2LAGB 5C2BL 2CDGB 1MFAL 1UM6L 2Y1VA 2WZPD 1XF2B 1MF2H 3BH8A 4ZNCD 4WWKD 4M03A 3O4LA 3BDYH 3DROB 4U1IB 3GI9H 2DLFL 1BD2B 1MCHA 1HH6A 1I8IA 5TE7L 4RDQG 2P47B 3ABZA 2PXYD 4G7YH 4A6YH 5M94B 2V7NA 2EDFA 2JJTA 4KQ3L 2EYTB 3PL6D 3NIFF 2D2OA 5DSCB 4WHCA 4F15C 2JLLA 4MNQD 4RMSA 5J12B 2VDPL 3GK8H 1CICA 2JJSC 3DBXB 5JW3L 3L3DB 3U36A 1G9NC 1DEEA 1JFQH 5HHQA 1HDMA 4GQ9H 1FG2A 2D7TH 4HC1H 5D7IA 4HKXA 4PB0H 1FH5H 2PYEB 3MCLH 5CCKL 2V5SA 1J0JA 4PY7A 4CJ1A 3KPRE 2AJSH 2N1KA 1NKRA 2QSTA 2F54E 1W0WB 5DF0A 2YC1A 3C6LC 4FQXB 3DECA 4AH2A 3HA0A 4O2CB 5IUSA 4MXWH 4YHPB 4I0CC 5HI3C 3LEYH 4UOW1 2ZUYA 3LVEA 2HTLC 3VXPA 1RMFL 4Y4KA 1G7HA 1GOFA 4L5FL 4ZAKA 5AEAA 1JRHI 1I8KA 2G5BB 2O5YL 1NCBH 3RDTB 2FHBA 1ZS8A 4S1RH 5HHXH 5EA0H 1QLFB 1RIUL 1UQSA 2VDKL 4KI5E 4YIQB 1EHLH 3R1GH 4NQSB 5I1LA 1NGPH 4JQXA 4YHLL 4QHLA 5DI8A 2F19H 4CNIB 4OGAD 2HT2C 1L6XA 5JXED 5CWSA 3EYSH 5GJSH 3PXJA 4GUPB 1TVHB 4AEHL 1XF5B 5BMFL 4RWHA 5C0IA 4QHUB 1XGUB 3GSVB 4G9FA 4NP4H 3S36X 1N8ZA 2WINA 4M1GL 4ZUWA 1V7NH 4OLWL 1WBZB 4ZD3H 4XNMA 1I7TA 4OIIL 3BPNC 1G1CA 3QDGB 5HY9A 5ESVA 4K94C 1JHTB 3VFTA 3BZEA 2F74A 5D5MB 4OZGF 4EJ1C 2QADB 3EYOA 3MV9E 5EOCH 1FZKB 4XPFH 4L4VD 3KS0H 1HHHA 4LCWE 3IJHB 3BIAX 1EO8L 2GFBA 3DXAD 5D72L 4LIQH 4ZUSA 4Y16A 3CLEL 3S35H 5GRYA 1UENA 1NBZB 1UJ3B 1KB9K 4EOWL 3WFZA 2AK4D 2OMBA 5EZLB 3KPRA 5E5RB 1CCZA 1NANI 1OGAA 2PW2B 3C8HA 5AYQA 3N85L 4IRSA 4JKPL 2F54A 4ORZC 3WD5H 3OR6B 1ND0A 5DHVH 4E0RB 4Z8FH 5B39G 1NBVH 4U1JB 4XAKD 3MBEC 2L7JA 1P5VA 5DFVD 3D9AH 3FQWB 4JZNA 5B8CB 4UUJA 3DV6A 1T1XA 4JM4H 3QULA 4JGUA 4O58H 3B2VH 3P4OA 2AJ3A 2IAMC 3IJSB 3KPSE 1EK3A 4OLEA 3GFUA 3QHFH 4OSUH 4Z6AT 4N0CC 4PJAB 1JPGB 2QQNL 4O00A 3TO4A 3CC5B 3HUJA 4L9LC 2J4WH 1BREA 1D7FA 1VHPA 4LPWA 1SJEA 3QCVL 1F5WA 4PJ9C 5IQ9A 4I3RH 1G7MA 5E8OB 4KAQL 3RAJL 2ADGB 2VLME 3V79C 1NAKL 5TFSH 4QO1A 4R0LC 1N3NB 2NZ9C 5I19H 2OR7A 3ISWA 3L1OH 2CH8A 1RK0B 1Z0NA 1UXSB 1I7ZA 1RVFL 3N1MC 4P2OB 5AWNL 1X6NA 5J1AB 3RIAF 3B9VA 3ILQD 5F9WB 3WSQH 5FCUL 3KPPB 1TQCC 5D7JC 4KKLD 1JWMB 4ZO6A 2RIKA 2BVYA 2JCCB 3B9EA 4JFXB 4JG0L 1MIEL 2UVEA 4PG2C 3H9SA 2P24A 3B4NA 1PJ9A 3TH2T 2UYLB 2WQRA 3AU1B 4F8TA 5EC2A 5DHXB 1KXQE 2XN9A 5E94B 5CEYA 1JZ8A 2ORBH 4J1UB 5F71A 2AEWA 3QQNA 4PJBA 3NCEB 1VFAA 5KS9F 2X4QA 2VZSA 2AP2A 1MPAL 4HPYH 3WFEH 2OK0L 1KCRL 4BZ2H 2YRLA 3WUWG 4Z7QE 1O7VA 5E00A 1FZJB 4W70A 2XZAL 2NR6C 5FYLL 1JUFB 3F12B 2J7LA 1DR9A 1LO2H 3T08A 4MJ6A 4YHNA 4DN4L 3OB0K 1ZEAL 4HS8L 2Y6SD 1FFOB 5F9OH 5HYJB 3S96B 3TT3H 3DX7B 5DD6A 4Y19A 4EZMA 4NKQB 5DJ6B 3MROA 4HKJA 5F89A 3NCFB 2IPUG 1KCUH 1BHGA 1GVIA 4M6OH 3VXTA 4JM2B 4DN3L 4L3EA 4KUZL 5LWYH 5ADOH 3VG0L 3EKCA 4WTXA 4JFDA 2GSGB 1BP3B 2AJZB 5D1QB 1RUKL 1FYTB 1F3JB 4OB5L 5EU4A 5E0QA 1WFNA 4PGDA 4OGYL 1G7JA 4Q6IC 4CVZB 3AXLA 1QSZA 3KLDA 3F6IA 1JP5A 3ULUH 2A9MH 2P46B 4I0PC 4OM0L 3VD4A 1WIOA 1Y6MR 2DI7A 3RU8H 1BAFL 1GYAA 3IAQA 1AGDB 4GKZA 3IDGB 5GGUB 4XNUL 5EU6B 2VABA 1N0LA 2DS4A 2BRRL 3SE4C 4LMQE 1ZSDB 1D5XB 2PKDA 1FVEB 3G5XA 4E5XB 4HF5L 4KQ4H 2B4CL 2FO4A 1C5DA 3WLBA 3NCBB 4OFPA 2XA8H 3O3UN 1A6VH 3L3OA 3MUZ1 3K8KA 2XWTA 5SV4A 1M4KA 4QNPE 1NEZB 1MCLA 2C3WA 2CUMA 3TPUA 4GSDH 3ZKQD 2FJFB 2NY3D 4RISL 4X9HA 2AABH 4M6NL 2FEDC 5DR5H 2P5WD 4G6KH 3U1SH 4CU6A 4LOUD 1G7IB 4JR9L 1NCDL 4R4BB 1K2DB 4DZ8B 4BFBD 3C09B 3RVWD 4L8SA 5LJYH 4LIQE 2JIXD 3O41B 1AKJA 2GHWB 3A67L 4DUVA 2JJTC 5BZDA 3SOBL 1GCFA 1Q9KB 5L7XH 3E6HA 1S7QA 1DE4A 5DD5L 5D7KE 5FUZH 3PGFL 4TSAL 3A6CH 4TVSa 4CJ0A 1CICC 1P7QD 3P9MA 4G3YL 1T6VN 1A3RH 3BOVA 4N8VA 4IOFD 4OLVL 2OTWB 1NUFA 3VI4E 2RFXB 5ICXA 3MR9B 4X6BB 1H3WM 4P5KA 2JB6A 2VDLL 5EFIB 3N50A 3VXNB 3QUYB 2E5EA 1S8DA 1MREH 3IYLW 1IC5H 3G6JA 3QDJE 5IBTH 4ELMB 4XCYB 5BVPL 3QEQA 1NCUA 3VXRE 2WUCL 3FN9A 3QG6B 1AC6A 1N59B 3QIBA 1NBYB 2NPLX 3TA3B 4OUUA 1A6TA 1S9WA 1Q9OB 3FO1B 3ZTNL 3RY6A 1E4WL 4RWYL 5F93C 4Y4KC 5HBBA 1A5FH 4ZAKC 1KC5H 1UM4L 1UEYA 5ELIA 1Z9MA 4QXTB 5B21A 5MERA 4CGTA 5DMYA 3PWVB 5ISZD 3QG7L 1MRDL 1KXTB 1GZPB 4JQXC 3OSKA 4D9QE 5HGHA 2X2YA 4WU7B 3BGFC 1J5OH 4LNVA 5EIIB 5C0BE 3V6ZA 1TLKA 3INUL 5C0AB 5JR1L 1YN7B 1BQLL 3KPLA 4NNYA 2EDDA 1BGXL 3MRGA 5I1GH 2R0ZH 4KJQD 1W72A 2NY2C 1CDYA 4NDMB 2X4RA 4OZHF 3FB5B 5T3ZL 4TQEH 4LSRL 5JIPA 3TIEA 4M8VA 3V0AC 3HNSL 3S7GA 4LLDA 1CBVH 4HPOL 2C1OB 1EFXD 4ESKA 1MHEA 4YLQT 5C0GB 1IFHL 3UTTD 1YEFL 4O9HH 5C2BH 1MFAH 1RFDL 4EUPA 1H9VA 2R29L 1IC4L 2YBRB 3GMLA 1CLCA 3PP4L 4X5XA 5K9KA 2MHAB 4D0CB 7FABL 1PG7X 2DLFH 5INCA 3ZL4L 4LLVB 4XC1H 5ERWA 3ZE0E 2HT3D 5IM7A 5J0BA 1AXSB 1UYWL 3ES6A 5FB8B 5TE7H 3CVHA 1X5HA 1FP5A 1UFUA 5C0EA 3Q48A 2OJZL 5JHDA 3BP7B 3RL2B 1P4IL 2Z91B 4Y16C 4Z0XA 5LVEA 5C09E 1FC2D 1A7NH 2VDPH 4JFYB 3KXFD 1A7RL 3VXSD 5JW3H 2AVGA 1DN0B 3IU3B 3HHRB 3SDDB 5K9QG 3BXNA 4IRSC 5ICZA 2YUWA 3CFBB 5CCKH 3ALPA 3U6RA 3WDIA 2P1YA 3VGDA 3D39A 3VRIA 1IGTA 2EEBA 2G60L 2H45A 2B8OT 3BI9X 3MRPB 4XVUD 1X6LA 2QBWA 3HRPA 4DFIA 2VL5A 1RK1A 4WI7A 2CRMA 4ORGB 1RMFH 4KI5C 1HNFA 1OD7A 3PG2A 2YD8A 3FB8B 4L5FH 4ZO7A 3TO4C 2Z8SA 2W65A 2XACC 3VWJD 3D0VA 2Z31D 2O5YH 1WAAE 4H1LB 4UT7L 5EIQA 3T65A 1S9KC 1J05A 12E8L 1HHJA 5C0BA 5D96C 1RIUH 2VDKH 5HTSA 1I3RA 1A6UL 5LGKA 1KIPB 3BP4B 4S1DC 3QFJE 5HI5C 5EBWB 1JL8A 4OCNC 4HWBL 5FOJA 4AEHH 3QI9D 2ENYA 5BMFH 5EU5A 1FPTL 4OV5B 5FHBH 3O2DL 1E4XI 2OQJA 3ARFD 1W8NA 1WWBX 4LKXA 4MA7L 3V6FB 3IDIB 4QRPA 4M1GH 4OLWH 2ITCB 4AJ0A 3QXDA 3GSUA 1BZ9A 2A0LD 1J88A 3ROLA 4OIIH 4N9GB 5I73C 4LVHB 2HVKA 1AXIB 4RMUA 2XA3A 4WW1A 2OS7A 3Q3GB 3V4UL 1CXIA 4YC2C 1EAJA 5GZOD 5JW4N 4NUJA 2FECL 3DUSB 1DANU 4GOSA 2R1YB 2BOBA 2VDQL 4FN0A 1A6WL 4PJCE 4F7MA 1EO8H 5D72H 3KPOB 5KSBF 4JJ5A 2NY5L 5KAQF 2APWA 1B0RB 1QLEL 3QEHB 4DKEL 3CFIC 3CLEH 3X12A 2B20A 1BD2E 2NNAA 4PJHB 4AK1A 1T5WA 3IJYA 4PJIF 5BQ7A 5TQ2L 3C60D 5CGYC 3H9ZA 5GS1A 5CINL 1F90L 2EDQA 2W9EL 5ACMA 4XBGA 1TCRB 3N85H 5F1IB 4PRAB 4JKPH 2DYPB 4V2BA 3FQXB 4HCRH 3CAFA 1X9QA 2LE9A 3SJVD 4ZFOL 1LEGA 2D9CA 1JV5B 2FBJL 3QXWA 3VGFA 1HNGA 4UT9L 1XGTB 1M71B 2R2HB 1P4LA 2R2EA 5T1MA 5GGQL 1PKQB 1WAAA 3T0DA 4CBPA 3MJ8B 3T4AA 5CZVL 3MNWB 2QQNH 5HDQL 3QFJA 4J4PD 3K2MC 3HAEG 3I3EA 4DGIL 5DMJB 3QCVH 4R4FL 4IS6B 3AY4A 4KAQH 4I4WB 3RAJH 3QQ3B 4XNYH 5HJ3A 1NAKH 2WWKT 2Y5EA 5I6XB 4FABL 2V9QA 4TSBL 1B6UA 1RVFH 2EDWA 1AIFB 5FF6B 1A9EB 3OWEA 1LDPL 2X1PA 3V6BR 1FLTX 3C8KA 1A21A 4JJHA 3AMLA 4PGEB 5FCUH 3O8XA 3OZ9L 5ID0B 5IFAH 4Q9QL 3SDAB 4QHKJ 4GW5B 4CMMA 3HZVB 3OAYK 1IGIL 1YY9D 4JFOA 1MIEH 4JG0H 5F9DC 2B1AH 1T83C 3HPLB 1CGXA 1IAOB 4EEEA 3VFOB 3BZFA 5IESH 4WW2B 1A9BB 3TN0B 3I6GA 3MRMB 4L8SC 5D2LB 4PJCA 4JPWH 2VWEE 3CFEB 4ZFOB 2LAAA 1FZMB 3MZTA 3EYQD 1MPAH 3THML 2OK0H 1KCRH 2VE6A 3GMOA 3QDGE 4DZBA 1UCBH 4N5ED 4IHOB 2V5MA 1UKSA 2ID5A 2XZAH 3QXAA 4NNXB 5FYLH 3H42L 1YMMA 4DN4H 4APQB 1ZEAH 4HS8H 4XRCA 1GOGA 4M7LL 2X70B 5FYJD 4LGSB 3NA4A 5CEZL 4WCYL 2GTWB 3CCHA 3MRFB 4QXUL 4XNZB 5DSCA 3BUYA 1BEYL 4F33B 5J1SC 5JZ7D 4K8RC 3J7HA 4DN3H 1OL0A 4PRID 4KUZH 3QIBC 3VG0H 2IEPA 5BW7A 1CXLA 3L3GB 3WNPA 1T66C 1RUKH 3BJ91 4PLKD 3RY6C 5CBEB 4MA1B 1LD9A 4OB5H 3VCLA 1EXUB 2M8XA 2ADJA 4OGYH 3UTPD 4Q2ZA 3UC0L 1U0QA 1N5YL 4X9FA 1NGZA 1PY4A 4B7IA 4PFEA 2PTTB 2J8HA 1BAFH 3G08B 5J11C 4XNUH 2GW5A 2DJ4A 4HIJA 4QY8B 2QEJA 2BRRH 1YEGL 3UBXB 4JRWA 1LHZA 3VGBA 3G5ZA 3RVUC 4HF5H 4I48A 4OZIB 1U8KB 5KSUB 2B4CH 3WL9A 5I8OL 3T0ED 5GISL 4PJAE 3LH2H 3TBYA 1HYSC 1LE9B 3T0XA 2F53E 1T7ZA 4OZFB 1I7UB 4RISH 2ZG2A 3RUGF 1TVHA 3FO0L 3IRPX 2WW8A 4GW4A 4MWFA 2BNQB 4GS7C 4M6NH 3GRWL 4KGLA 3RWFB 4XI5C 4P3WA 3TT1L 2X09A 3WJJA 2N7AA 2DMKA 1NCDH 4U6HA 5H8DA 4X0KA 1A4JA 3QEUA 3O3DA 3W0WB 4BQBA 1IGCL 3A67H 3QDGA 3RWHB 3SOBH 1BFVL 2DIJA 1OT2A 3BX7C 3QDMD 2APBA 4OZFG 2JCCE 1JHTA 5EWIH 5DGRA 4TSAH 3IU4L 5FECB 3FKUS 4G3YH 1JBJA 3B3IB 3QB7C 4NO3B 2Q3AA 4OLVH 1FZKA 5FXCH 1ZHLA 4LSDA 3T77B 1BOGB 4UV7L 5J9PB 2VDLH 4PRDB 4YHYC 5DQJB 4HGWB 3T04D 3ULVF 3BGAA 1J11A 4CMHB 3LY6A 5BVPH 4Z7VF 4I2XA 3HNVL 4R7DB 4WU5A 3I3DA 3MYJA 4TSCH 3ZTNH 1E4WH 4RWYH 3GBML 3B83A 5HVFB 5DS8B 1II4E 1UM4H 1EJOL 3IKCB 3W39B 4DUXA 3FT2A 5JQ6L 2NY6B 5F6IB 3VI3F 5F97E 3S5LA 2B1HL 3QG7H 1MRDH 2E3VA 3NZHL 5J13C 3O11A 2Q76A 2DQEL 4LCUB 5DTFB 3IFPA 2FWOA 5T1LB 3H3PH 2FX8L 5J8OA 1RUML 3INUH 4AZ8A 3U4EB 5JR1H 1BGXH 5K9JL 5EG6C 1QD0A 2VO5A 4NCC2 3C5ZB 5T3ZH 4LSRH 4ZS7L 1HWGB 3V2AR 1URLA 5EC1B 4LCYA 1ACZA 3HNSH 3MQIA 2F53A 4ODXB 1EGJL 2P8PB 4FFZH 4P9MH 1GGYA 2C4FU 1YEFH 3PQYD 4MYWB 2PNDA 4OZGB 5EU6E 2H32A 1QRND 4Y2DA 2R29H 3GSOB 5E9DA 5C7XL 1BF2A 4OQTA 1IC4H 5L2KD 3PP4H 3MA9L 1U36A 4F7TB 2HFGL 3ARBA 4H0IA 3VFWB 3GJFK 3JV4B 2VRAA 4XH2B 5K93A 3X17A 2BERA 3DO3A 7FABH 3X11A 3FMGL 3ZL4H 4NYLA 2D31B 5EDXA 4Z9KB 4JRXD 1UYWH 1YECH 3OAZK 4BM7A 1PDKA 2VDRL 3JWOL 2E6QA 3K2UH 4LBEA 5IMMB 2JCCA 2NMSA 1I8LA 5FYLE 3FAXA 1HCVA 2OJZH 3W82A 1LP9B 4XP6L 2BSSA 1IAMA 2A73B 2GCYA 2Y25A 3IDYC 3QH3B 1P4IH 4LF3B 2CDEA 3L5JA 4JFPA 1A7RH 1H15A 4AL8L 5DJAA 2FGZA 1VFBB 5DEFA 4ETQA 2EO1A 3U48A 4MDJB 5GS1C 1YEKH 1L0QA 2R2BA 2RQ8A 1TQBB 5CP3H 1JWSA 4XNQB 3P77B 1C16A 3DETD 1FZJA 3P2TA 4HX1A 1B88A 4LVOB 4WHTB 3DOSA 4TUOA 1JUFA 4F7CB 3FQUB 4XPTL 2G60H 1FFOA 3VD9A 5K9QI 5F44A 5EIVA 4N1EA 1F97A 3ZYZA 3MNVA 1LQSR 1BBJB 5LAXB 5HHMB 3WIFA 4LASL 4KHXL 2J8UF 1YNTA 4PIRF 1RSFA 5F3BB 4HS6A 3OB8A 4NO0A 4F7EB 4P3DB 3VW3L 3LKPB 4UT7H 2AJZA 2X6MA 2YS4A 3RGVA 4U31A 3PDOB 1A6UH 3HZKA 2APTA 3HAEH 2APXA 3AY4C 1NLDH 1NMCB 1P1ZB 3GGWB 1BJ1J 2OTUB 3OGOE 1J0YA 43CAB 3UJIL 2VDML 4R96A 4FFYH 2JE8A 5GIRB 2OM5A 1HHGA 1YZZA 1FPTH 1AGDA 2VN4A 3O2DH 1DFBL 2I07A 3IDJB 2EXWD 3HKFA 3O8XC 4MA7H 5C0AE 4E5XA 3TH3T 3HPJA 2CIIB 4N0RA 3OHXA 5E8DL 5C3TA 5KS9B 2JK5B 1MHPL 1SY6L 4YHIB 5ESQB 1YY8A 1NGYB 1IM3A 1IKNA 3MLXL 4OF5A 1YYLL 1KTDA 3M17B 3V4UH 1HINL 5C0CA 2FH6A 4JKMA 1AI1L 1O5DT 5FKPB 4XTRD 2YZ8A 2IBGA 5CD5C 1DBJH 5A16B 1NL0L 2VDQH 4AG4L 3AVEA 2AV7B 4GRMB 2P8MB 1A6WH 1Z5LB 3RVXD 4S2SA 5DJCA 4WWKA 2NY5H 1K2DA 4Y5XB 1ZT7B 2FIRT 1QLEH 3FQNA 4DKEH 1I1FB 1CLZH 1IGML 4CADB 2E7CA 4XP5H 2DN7A 4KY1L 5TQ2H 1P9MC 1LK3L 1F90H 2W9EH 3GSNH 1S78D 2PXYA 5GS2H 2ZUQC 3IETB 1M6OA 5GS0L 2EDBA 1KJ2L 3JWDC 4YFDB 4U4BA 1XF4A 3FB7B 3PL6A 4CN6A 5BW7C 2EXYD 2YSSB 4L4VE 2OTWA 3VFRA 3MR9A 3RKDD 4MNQA 1ZHKA 3DXAE 1Q94B 3QUYA 4RRPA 1NGXA 2QL1A 4FG6C 3QPQC 1QP1A 4R3SB 5GGQH 1E4XL 3FHQA 3V7AG 3QFDB 5CZVH 1PSKL 1R3HA 1X4XA 2AK4E 2GTZA 5IMOA 4TUKL 5HDQH 4HG4K 3MGOB 2ARJB 4ZO9A 4DGIH 5DUPL 1VCAA 4B41A 5T3ZE 2GUOA 4ODHL 4MXVE 4R4FH 4JPKL 1IGYB 3RVTC 4U0RC 1V3MA 3RWGA 3CZFB 4OIAA 1OSZB 3BJLA 4MA3A 4D3CL 2ICWJ 4JQIL 4FABH 4TSBH 2H2SD 1GZPA 4KKCC 4XMPL 1S7UA 5FHAL 3VFSB 3QXUA 1YNKH 4LL9A 1YN7A 4FP8H 1LDPH 4NQED 3GMMA 1ORSA 5MENB 4ZTPL 4Q9QH 4NRXA 2BJML 4UNUA 4YBLC 4X4XA 3WJJC 5JXEA 1IGIH 4XMLL 4PJ8D 5LG1A 2PTVA 4R90L 1CD8A 4Z7WA 4DOHB 2VWEC 4Y4FB 3DO7B 2HN7A 2O5ZL 3DGGA 1KJ2B 1QQDB 3VFGL 2FRGP 4X7CC 4JRYB 4ZUTB 3TJHD 3KWWB 3THMH 1R6VA 3ARVA 4WO4B 4OZFH 1EV2E 4LLVA 2IBZY 2QADC 4XPGL 2WUBL 3L3IA 5C0JB 3WXWL 2HTKD 3H42H 3SE9L 4QXGL 1G7LB 1MHCA 4M7LH 4QGTA 3NMEA 2CLVA 3BZ4B 5I71C 1UVQA 4G6FB 4QRRB 5CEZH 4WCYH 3BP7A 4QXUH 2KQMA 1BEYH 1HWHB 4KRPD 4HGKC 3MA7B 3DMMB 4L4VA 3QUZB 4J7RA 1T0MB 1FNFA 4KK9C 3DXAA 3L3KB 1NAMA 1RZKL 4OF7A 1GPOL 1SYSB 5KW9L 3VWKB 2NY4B 4PJHE 5IMKA 3TZVB 1VERA 2UZIL 3L3HB 5BS0B 5JOPE 2AK4A 3EDFA 3KPMB 2LVEA 3UC0H 1N5YH 1P84K 4U1LA 1NFIA 4H5SB 5GGTA 5I74B 3DUUB 3FTGB 1DBKL 3VXMD 4CDGC 4CKVX 3WLWC 2IANB 1YEGH 2Z35B 5E95B 4S1QL 2XIDA 2FGWL 5KSAD 1UB6A 5IR1A 3RZWA 5I8OH 2LFGA 2E6PA 4IRJD 5IFHL 4NRZA 4ONHA 1KIPA 3VXUD 1AD0B 2GIYA 1NSNL 2GJZA 5EBWA 4HKBB 4Y2DC 1N5AB 5JW4M 1J8HD 1ULVA 1S5HB 2EH7L 3FO0H 1CL7L 2LU7A 3RIAK 1ZVYA 2DOCA 4MX7A 3ULSA 4I3GA 3ARBC 4BFIB 1MJUL 4KROB 3GRWH 4Y4HB 1MWAA 3QZWA 4FRWA 3TT1H 2LABA 3VH8G 1XCTA 5JMOC 1JYVA 4JHWH 4TNVK 2CLZA 3FT4A 1ITBB 5JOEA 1I8LC 4LSTL 1G7QB 2AJUL 1CGVA 1V8HA 3QPXL 1BFVH 3GO1L 1EH9A 2JTDA 4P23B 4PTTB 5B3JF 2XFXB 1ZLUK 1JGUL 3QBTB 4I18B 1FJ1B 4RGNB 4PB9L 3TYGL 3F8UB 5MEPA 4TTGA 1GZQB 1RI8A 3RWIB 2BNRD 4GXVL 3F7RA 3SN6N 4UV7H 8FABB 1HOCB 5D2LE 1U8MA 1TZGL 4HBQA 2UY7A 1NCCL 1MFDL 5DK2B 3HB3D 4Z7UF 2ED8A 5DMIL 5CJXA 3SDCB 3HNVH 2RBLA 2UWEF 1L0YA 1OVZA 4HLJA 2VB5A 4P0DA 1B4RA 2SEBA 4QHMA 5F1IA 1U8QB 3GBMH 4ODVL 4ZTOL 5HHPB 1EJOH 5IG7A 5TDOA 5JQ6H 1CU4H 3MJ7B 3RGVC 5EUOF 2B1HH 2WBWB 1JZ3A 3U9UA 2CGRH 2V7HA 2DQEH 4PREA 4U3XA 2X4TB 4MAYC 1Q9LB 4YX2L 5CD3B 1FL5B 1XGTA 4U1NB 2FX8H 1RZ7L 1RUMH 5CIPH 5ICYB 1U8PB 5K9JH 4ZNEE 2ED9A 1MIML 3K4ZA 4KK8D 4KMQA 1TZHA 1E4JA 3U7WL 4ZS7H 1EIBA 2YD6A 5D1ZD 5EBLA 1EGJH 3F6LA 3RNQA 3BRGC 3LOWA 5BO1L 2F8OA 4K7PY 5KVMC 2H1PL 3GJFA 5C7XH 1DLHA 5TF1H 4EI6A 1JZ5A 3SY0B 1B0WA 3LQAC 2ZNXA 4G8FB 1BF8A 4OZIE 5GGVL 1T04B 1IKNC 4KKBD 1EBPA 1E6OL 1RIVL 5FF6A 4S10A 4UAOB 1MVUB 3KLAB 4QEGA 3FMGH 4TVPH 5KSBB 3QO1A 3OTTA 4YXLL 1ZXQA 5TQ0L 2VDRH 3JWOH 5E2VL 3MNZB 1J0ZA 5ITFA 3ETBF 4BQ6A 4RA3A 2DQDL 4M6AA 2VXQL 4PJIB 2BNQE 1UM5L 3OQ3B 4XP6H 4NN7B 3UTTE 4WWKC 3L95A 5D93B 2IGFL 4RA0C 4MD5A 3MRMA 1HEZB 5CEZE 2YPVL 1J0KA 2P5WA 4EIZC 4EVNB 4AL8H 4HFWA 1F3DH 2A6DB 2EO9A 1RZIA 1QTYT 1PX4A 3E8UL 4FA8A 4OV6F 3TO2A 2PXYC 1QBML 3T3MF 2JIXA 1GAFL 4UDTB 3MOQA 4HIHB 1RZ8A 4G9DA 3PL6C 5D7IF 1BX2B 3MV8D 3O6ML 5F70A 4MLIA 4NNXA 3IKKA 3SPVB 4XPTH 1UG9A 2X41A 4LU5L 1X5ZA 4ZFFA 5ID1B 1JPST 3QUYC 3ZKSD 4RCAA 2VR4A 3QXVA 1MCIA 1MEXL 4WV1A 5F7DB 5ITBL 4LASH 3C9NA 3CX5K 3CPLA 3GHBL 3O45A 4JY6A 1H5BA 2AGJH 3N9GH 3VW3H 3MRRA 2VZ1A 3VA6A 4ERSL 4UMGA 4X6EA 4ZNEA 3V6OA 3F7VA 1G9MC 4NCC1 4JFEB 4P99A 1FE8L 2BRQA 1EAPA 4HH9A 5HI4D 1WBXA 3L6FB 5TDNA 2VDMH 4KPHL 2IH3A 4L8CA 4WTZA 3OKLA 4RAUB 5KJRL 3QUMA 1EFQA 1BQSA 3EOAB 3MUGA 3WYRA 5IJVA 5KTEL 3MRDA 4RIRB 5ISZA 2NX5B 1DFBH 3F7YB 4FQQA 2VLJB 3A6OA 1DBAL 1G0DA 3ILPA 3L7FB 2H41A 1XIWD 1P2CB 2GT9A 4PJXE 1CD1A 3GMRB 2C5DC 5JXEC 5E8DH 1OW0A 3BWAA 5CSBA 1KTRL 1M1SA 3W5NA 1MHPH 1SY6H 4NQEB 2BVQB 4ONFL 5DDHA 1IQDA 1QFPA 3MLXH 1WBYB 1MCOH 2DTML 2HT4D 2HRLA 1HINH 4JZOB 4LCCA 1EFXA 1IM9B 1NMBL 2Z92B 2IH1A 1AI1H 2XWJB 3UTTA 3UO1L 4ODSL 1MFBL 1NL0H 3PDDA 4AG4H 4UBDD 1S7WA 3MACH 4YGAB 1CR9L 1MI5D 3PWUA 3EO1B 3GIVA 1LNUA 1MAJA 1IGMH 2J3SA 4N5UA 1IEBB 1QZ1A 3HNTL 1LK3H 2AXGB 1X5KA 1LP9E 4HH8A 2BSTA 2Y7QA 5GS0H 1KJ2H 3LIZL 4H26B 4KRPB 4S1SL 1N4XL 1KEGL 3KXFA 4PY8J 5IHZA 4KWUA 3VXSA 3ZKXC 2NY0D 5IBLD 3ULVL 1XF3B 2V9TA 2GJ6B 3HS0A 2VZTA 4QF1B 5CJ8A 1BFSA 3RWCB 1T7XA 5IROA 1WQVT 3OKDA 3C8DA 1DTUA 3RI5K 1CWVA 1IEAB 4MCZA 1PSKH 4ODWA 4NQTA 4R7DA 4TUKH 3GMNA 4KI5F 5FGBA 4N0UA 3HE6D 5DRXB 2XV6B 2FYYA 3BQUB 1IQWL 4M7ZC 4POZD 5DFVC 5DUPH 3HUJF 2O26U 3QJFB 4ODHH 3S3JA 1D9KB 1JMXA 2YKLH 4L29A 4P2QB 4QRTA 3RUGB 2YWYA 4MQ7B 1DUYB 3B5GA 4K71C 4P9HL 4D3CH 5DTFA 4LCUA 4JQIH 1NFDB 1U3ZA 3ORJA 5I8KL 3GIZL 4XMPH 5FHAH 1RHHA 3VWJA 5LQBL 2Z31A 3WFHA 4Y1AD 4YZFF 3RFZC 5TH2A 4PJXA 3CJJA 3U0PA 3VFUB 3M8OH 3EJYD 3BIKA 2Q7NA 2Z8RA 3C2AL 3UPAA 1HI6B 1CIDA 4ZTPH 2BJMH 5BV7L 1IEHA 4XMLH 1KF9B 1BZ7B 5HYSB 3QI9A 4XVSL 1AGCA 2VAAA 3FO9B 1GIGL 4KVNL 4R90H 3EYFA 1YEHL 4DWHA 1YEEL 4N0FB 4QTHB 3WKML 1NBQA 3ARFA 1JHLL 3ILQC 5DQ9B 3VFGH 1XFPA 3KJ4C 4PJBF 3OGCA 3JV4A 5F1SA 5FM8A 4KKLC 2IADA 2ZG3A 1FV1B 1LEIA 3ZYJA 3QRGL 4MJIB 4X98B 3O6LH 3UPRA 1YUHB 3ARDB 4XPGH 2WUBH 3V52L 2AQ3A 2YPLD 2NLJA 4CW1A 3WXWH 1KENL 4Z7VB 3SE9H 1ZA6B 4WNQA 2Q7YA 1VACA 3T8XB 4IDLA 4F2MA 1LP9A 4OF8A 1S9YB 3ARRA 2XPGA 2W60B 1JJUA 3JTSA 2BNRB 5IVOA 4BFGA 4JDVA 1VFBA 3O6KL 1DQJB 5CJXC 3PABB 1GPOH 3EGSA 4MSWB 3BKCL 2AJXH 5I1DB 1Y0LB 1IJ9A 2Y6SC 4URTB 3BAEL 5CJQL 2VLLB 4ZFGL 3AB0B 4MGXA 4WJ5A 1A1NA 2R0KL 3TIDB 3C60A 4F7CA 1GC1C 2YOCA 3MLPA 1TDQA 1NDMB 3VFMB 3N1PC 1TZIA 4GBXD 2XTJD 3SBWA 1JI1A 3PWNB 5BV7B 4K9EC 4GLRI 3BN9D 3SJVA 1DBKH 1JPFA 4LLQB 4KU1A 2BY1A 3TNMB 4S1QH 2F5BL 2XZCL 2VISA 4F7EA 4E9LA 2AXFA 3VXQA 4NC0B 1XZ0B 1VFMA 3T1FA 5C0ND 5IFHH 1KJ3L 2BZDA 4EKXA 2X05A 3KNBA 4MQXD 5HPMA 2VLRB 4Z77A 2EKJA 1NSNH 1Q1JH 2EIBA 3HZMB 4DK6A 43CAA 4J4PA 2P43B 1K4DB 2EH7H 2LTQB 1CL7H 1CGSL 4Z18A 3QUXD 4NKOA 1ADQL 1MJUH 5H35B 4D9LL 3ARSA 5A43C 4OCMC 5JO5B 1T20A 2AJYL 1A3QA 5I1CH 3MCG1 1HXYA 1Q0XL 4DVBA 2X4SA 2K7QA 1IVLA 5MHSD 3KYMA 5F88A 4U6XA 2CIIA 4R2GD 4XCEB 2V2TA 2KZWA 5E8NB 4LSTH 2NY3C 2AJUH 3DGCR 5MENE 3WIHA 1NH6A 3QPXH 4O2FA 3GO1H 1NGYA 4U1SA 1ZTXL 3D85D 1F6AB 4Z7QF 4ZPVB 2J6EL 1JGUH 4PB9H 4FQLH 1F8TL 4X4MA 4DUWA 4DOHE 3RWJA 4P2RB 3CMOL 2FJHB 3LKNA 1QBAA 1T5XB 3RVWC 4GXVH 4GRMA 2AV7A 3N1FC 4JRYE 1S7RB 4OLZH 3RHWF 1TZGH 2YPKB 2J8UB 1NCCH 3TBWA 5IEHB 1MFDH 3MRCB 4AM0A 1FZOB 3FRUB 3G6JF 5DMIH 1S7XB 4HDIB 4IOFC 4WV1C 2NW3A 4GKSA 1FL6A 1G9NL 4TVPD 4G8GB 4QRRE 4ODVH 4ZTOH 1H5BC 5M7QA 1HXMA 1H3PH 1QO3A 5FOBB 2H9GB 4PRHD 4J23A 1CT8B 2ERJB 2VQ1B 2IPTH 3SQOL 2DQIL 4PGJA 2BXYA 1IGJB 5IB3A 1AGFA 1QG3A 4PRIA 2CLRA 4XC3L 3KR3L 4YX2H 3NAAL 3V6OC 3VJ6A 4Q0XL 1RZ7H 3G5YA 1UWEL 2NXYB 3QQ9D 2FR4B 1MIMH 4HQQL 5BS0E 4P46D 2CRYA 3U7WH 5IB4B 2ARJA 3NCCB 2YA2A 4QNPF 4LPYA 5JIIA 1KCKA 1MCEA 4O51B 4HS3A 2BOCB 2V5TA 1OW0C 5BO1H 1SEBA 2H1PH 3MRJA 3OG4B 4DAGL 5FO7B 4KJQC 4XWGL 5AZ2L 4ZUVA 3LKRB 4D8PA 1UH2A 5GGVH 4LFHD 5JA9A 1E6OH 1RIVH 2HLAA 5FCSH 4GKOA 4JN2B 4J8RB 5SX4I 4LCCC 4U1HB 4KTEL 3KS0J 5D6CB 3T0EA 4M61B 4YXLH 5TQ0H 3KVQA 5E2VH 4YBHA 2QTEA 4HZAA 4TUJA 2DWEA 2DQDH 2VXQH 1BQHB 3CDCA 5IW1B 4IOIB 1UM5H 4HXBL 3PQYE 1FFPB 1CDCA 2IGFH 3DO7A 4LHQB 2ARWA 4K94L 2YPVH 5I9QC 1OP9A 1ES0A 2CK0L 5IHLB 2HT3C 5I0DA 4FMFA 3E8UH 4L8DA 5D9SA 4K3DL 4NBYB 1QBMH 4XHJD 1EVTC 5JPMA 3MLVL 2FD6L 3B6SA 4JRXE 4IIQA 2W0FB 2GQHA 3C6LB 3L7EB 3QDMA 4NQVA 4ZPTB 1JYWA 5A2KH 4RGNE 5IVNA 5DLML 3OXRA 2WNGA 3TH4T 2HG5B 1PZ5A 1H3UA 2FJGB 1MEXH 2FCBA 5J6HA 5ITBH 4NKMA 3EYUH 1RJCA 5IROC 3MRQA 2QR0B 1AJ7L 3GHBH 1REIA 5ACZA 1QSFB 4HEPG 5FGBC 2ICWB 5SWSD 4RFEB 4C83B 5JNYA 1IKFH 1FNEB 4ERSH 5D71L 2DTSA 5DMKB 4XVUC 1KJMB 3CSYB 4NBZB 4PJGA 5BS0A 3LHPL 1FE8H 3WO3B 3BKJL 1PZUB 2WK2A 4MZ3A 2QV2A 3QHZL 1TENA 3PHSA 5KJRH 2AKRB 4HIEB 1RQ5A 3SE3A 3VWJC 2Z31C 5KTEH 1OT1A 3P3YA 3DX6B 4X7DC 5HYQB 4HMCA 3V0VB 3G9AB 4WEMB 3BPNB 1DBAH 3CK0L 4AIOA 1LO4L 3DRTB 3S9DB 3FRPA 4NO5B 1AD9A 3QI9C 4ONFH 3VDCA 1QHPA 5EPMA 5LBSL 1A1MA 3T3PE 3WS3B 3CFJB 2DTMH 2BC4B 1QR1B 1CFQA 3SCMD 1XGRB 2MCG1 3ARFC 1OP5H 4ZYKB 5C6PB 1PYWA 4OLUL 1NMBH 5C70A 1AGBB 2OL3B 3E0GA 5D7LD 1I9EA 3U0TA 1UWGL 3PQYA 4ODSH 1MFBH 3ZKMD 5DJXB 2YD3A 2A0LC 5B39A 3L3JA 5L2KA 3KJ6L 4XCNB 1CR9H 5I0ZA 4DKFH 4HJGB 1FVCA 5C07D 5IFJA 4ZSOB 4I1NB 4U1GC 4NRYB 1QNZL 3FOMB 4YDVB 5KSBE 4GG8B 3MMEB 4PR5A 3VRLE 5GZOC 4XZUB 1L7IL 3E3QC 2ESVB 1WZ1H 4JRXA 1KB9J 4M3KB 4P23A 4MD0B 5EZJB 2WSKA 1Z2KA 3MBEB 1C5CL 1FJ1A 3KYOB 3LIZH 2VIRB 1A6AA 3HG1D 4S1SH 4LEOA 2QKIB 5A2LH 5D2NE 1N4XH 4KDWA 1KEGH 2IAMB 4LLYA 4FFWD 3ULVH 2EYRA 5J1TC 3D25B 3C60C 4E42B 1MJJB 4YPGB 3AS2A 3LEVL 2DLHA 4OD2B 4L9LB 4ZXBD 3D3VD 3CFDB 1WAAF 2COQA 2HFFA 3SBWC 2C1PB 4PJ9B 4LDLB 1DQTA 2ADIB 3CSGA 4NIKB 3QEGH 3PV6A 4TOYL 4BKLA 1U8QA 1T1ZB 4R0LB 2W38A 4LPVA 4Z0BL 1HN1A 1RZGA 3OBAA 3PWJB 5FFLA 5T5NG 3MSPA 2BSRA 4OFKA 1CTNA 4R6UA 4GKNA 2VAJA 2X4TA 3UTSB 5I8KH 3GIZH 5JORA 4HHAA 1DQLL 2VC2L 3ZHKA 3AS3A 5LQBH 4JVPA 5D7JB 4J4PC 5B38B 3GNML 3LN5A 1U8PA 5EO0A 4HD9A 1RPQA 5ACLA 1QLRB 1RUPL 3C2AH 3RNKA 1HQ4B 4JFEE 3VMOA 1NC4D 1N7ML 2ZWLT 1M7IA 4L8BB 5BV7H 1KB5L 4LDEB 3VXOB 4WHYG 4K55A 1UZ8A 5HHNB 1NEUA 4XVSH 2O61A 2RAMA 1GIGH 4KVNH 2A6KA 1YEHH 2NX5E 5JPNB 1YEEH 2VLJE 3BRFA 1ZAGA 3WKMH 1JHLH 4HCRA 5E8EB 2X7LB 2P5ED 2X9WA 5BRZD 4PJCF 1KTLB 1Z6JT 3ZHLA 4CRPA 1YY9C 4NQEE 3CDGB 1I85A 3S4SB 3QRGH 1P53A 2RGSA 1HQRB 3V52H 4XBPB 3NACL 4QTIL 3ZKND 1P7KA 3REWB 1A1OB 2UUDK 4PRPB 4EBQL 3RZCD 4LVNC 4UIKH 4MJ5A 5DUBB 3EYQC 5DA0B 1SM3L 1NLBL 5HHOD 5D2NA 3BDXA 3O6KH 1U8IA 1EVUA 2APFA 4N5EC 4X6CA 5EUOB 2P7TB 1B9ZA 3TCLB 4Q6IB 1J86A 3I2CL 4G42A 2Z0BA 3BAEH 4LHUB 3N1GC 4OCLC 4I0PB 5CJQH 1TXKA 3CX2A 2WBJD 2R0KH 2HVJA 1UA6L 1LE5B 1F11A 3IS1X 3W9EB 5JZ7C 3NPZB 1LK2B 5DEGA 2YUXA 4OUOA 3G5VB 3HLAA 1AO7B 5KG9A 1KIQB 4N90D 4P5MA 4DJMA 1KB5B 4PLKC 4YHOL 1TNMA 1JK8A 4WFED 1LDSA 2GJ6E 2XZCH 1DQQA 1EEYB 4P4RA 5DQDH 1K9TA 3RWEA 5FO9A 2ZOKA 2V5YA 3MRIA 4M7LT 1KJ3H 1KTKE 3MV11 4HBCL 3BH8B 3HCVA 3P0GB 1BJ1H 1VGEL 3O4LB 3K4DA 4JFEA 4OCRL 1I3VA 3GI8L 2X4NA 3M1BA 5SWZD 1KOAA 1CGSH 4N8PA 6FABH 4YBQD 1ADQH 1HH6B 3RUGE 4N9OB 3EOAA 3BESR 4D9LH 5I8CA 3VXME 2X10A 2X4PA 2AJYH 1JNHA 1NFDE 2V7NB 3T0EC 1XGQA 3VD7A 5DURB 5GZND 1CICB 4FQCL 3LRGA 3GMPA 4NQEA 3U36B 1ZTXH 2EDHA 1DEEB 4OGZA 1HDMB 2J6EH 3O6FD 1FG2B 2BMKA 1K6QL 3CUPA 1VADA 1F8TH 4HKXB 2V2XA 4PJ8A 2VTFA 1IM9A 4H25A 4PY7B 3LN4A 4GAGL 2EDEA 3EOTH 5DZOA 5MEOA 1INEL 1KV3A 4HSQA 4IIQC 2YC1B 1FFNA 4J12A 4JGMA 5FGCB 1CG9A 4AH2B 1B90A 3ULVE 5SX5K 3LN9A 3HFML 4MJIE 5GHWL 3VXPB 4Y4KB 2GJJA 1G7HB 5E8PA 4ZAKB 4Z7VE 1I8KB 1ZS8B 1QFHA 4AT6A 4M02A 2R0WH 3IXTA 3IFOA 4J3SA 2NCMA 3HE7D 1CGTA 1HHKA 5CJOL 5C08D 1UQSB 4E41D 3KPNA 1IT9L 4KKAD 5T5FL 5I1LB 4XCCL 2BNRE 4QHLB 5DI8B 3BGFB 2ZP0T 3SQOH 2DQIH 5CWSB 2PYFA 4RFNC 1JZ2A 1V3KA 3UJTL 3VI3E 1GGCL 2NY2B 3KR3H 3ZO0A 3NAAH 5C0IB 2EEDA 2EECA 1JMZA 1UT9A 5EU7E 4Q0XH 4EIGB 1UWEH 4G9FB 2FLRT 4K23L 4NOFA 4P5TD 1N8ZB 4HQQH 1K85A 3SE3C 4NC2B 4ZUWB 4ZQKA 1FLRL 4WWID 4KKNA 5FUOL 3CDFA 4XNMB 1I7TB 1T1YA 5HY9B 3OF6A 5ESVB 1CIUA 4LAQL 3VFTB 3BZEB 3VXMA 4Q9BA 2F74B 4DAGH 2DM4A 4JHBA 2ATKA 1QKZL 4XWGH 5AZ2H 3QWOA 1NFDA 3EYOB 35C8L 4HWZA 3W2DL 3I6KA 4W68A 4HV8A 1NUNB 5KSAA 4C4KO 1UADC 1HHHB 1T4KB 3OKYA 3VFUA 1FL3A 4IRJA 3WE6A 5FO8A 4XXCA