3EJZC

Structure of e203v mutant e.coli cl-/h+ exchanger, clc-ec1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Intracellular proton-transfer mutants in a CLC Cl-/H+ exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system/proton transport
total genus 40
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejzC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejzC01
3M17B 1OP5H 1H0DB 1EEZA 1U3HC 2JJUA 1YY9D 4J3WA 4LVHC 2AK4B 2EYRA 1HKFA 3U7WH 4U6YA 4LVNB 4LPTA 5DD0L 2D7MA 4HK3J 1J18A 5IVZB 5GZND 2EIZA 5KVMC 4JLRB 2V6HA 1KELL 2J2ZA 4LARH 3SDAB 1OF2B 5JXED 3MJ6A 1KIRB 3RWEB 4UDTB 3T1FA 5C07A 3IFOB 2X05A 3RBGA 2DQIL 3AROA 3R8BB 1KJ2A 3D85B 4AZ8A 2LVCA 4NO0A 3I85A 1HXMA 4GW4B 4JY5L 5EO0B 2MTPA 5C08A 4HKZA 1EO8H 3U0PB 3MJ8B 2B4CL 4PRID 3U36A 5F1IA 2WWMC 4ALAH 4HGWB 3GSQB 4UU9B 3V5DA 1T3FB 1C12B 5BZWA 3PUCA 4XHJD 5SX5K 1LMKA 3CFCH 1ORSB 4LBEA 1B6DA 2CRMA 3K1KC 3CVHL 1L7TL 2F8VA 3RI5F 1P9MC 2DKMA 4N8PA 3U2SB 1JI2A 3S8WA 4L8BB 3C5SB 5BXFB 4HJJH 1MCQA 4G6AD 3A6CH 3LH2L 1PAMA 3QCUH 4ZOCA 2IH3A 5D5MA 3EIFA 4XC3L 2AXFA 1WIPA 4Z7UF 3BO8A 3UPRA 5ICXA 4AENB 3UTPD 3OF6A 3C60A 2J88H 5D2NA 5T3ZH 1K5NB 2Y4SA 2IQAA 1QHOA 3R0NA 4AQOA 2VQ1A 4JM2A 1NFIA 5F7NC 4QHKI 5KSAC 2Y07L 2SEBB 4PP2A 5I18L 1SHMA 2AJZB 2YD1A 3C08H 3VXSA 2HT2D 5IP4A 3NCJH 3O8XD 4HWUA 1PLGL 1WZMA 1DVFA 1FDLL 3ARXA 1NJ9B 1FYTD 5F71A 3VFGH 1FFNB 1WIUA 2VXQL 2NMSA 1PFCA 3MGTB 1V7ML 4MQXD 2WANA 1MPAL 5HYJE 1QRNA 5M94B 1C1EL 1OAXL 1YQVL 4KKLD 1O5DT 5KVFH 2GSGB 3E6HA 3WS3B 3WNMA 5IOPA 1CK0L 5E2UL 2AJUH 3K1DA 4MLIA 3TPUA 1ZT7B 5E7FA 1SQ2N 4MJ4A 4MA1B 2RCSH 1DQML 4OF7A 5IHUL 3ARPA 3SDCA 4K23H 1VERA 2VLLB 5J6HA 4PREB 1LO3L 5SWZD 2EH7L 3AUVA 4GXUN 1ZHLA 3C6LB 5HGAA 1DBBL 4DFHA 5CEZD 2QSQA 4GAFB 5FOBB 4NQEE 4U1SA 3VFOB 3GSRA 3KXFE 1NMAH 25C8L 2DQTH 2YR3A 4CADB 1H15A 5JHLL 1GGCH 3WJJC 3VXPB 4ZNEE 4V1DE 5GJTH 4GS7B 5F6IC 5BW7C 2Z91B 5I1HL 5DQ9B 4HIEB 4NJAL 1IKNC 5C9JA 3HR5A 5EZOL 4LCWA 1FFPB 1ZK9A 2ORBH 4LRNL 3S34H 4ZFOL 1GGTA 1OARL 3N1FC 4U7MA 2HP4A 2VZVA 4F33A 2OK0H 5T1DL 2BSTA 2QADD 3IJSB 1MLBB 4Z9KB 1N7ML 3RVXC 3X3GH 4DTGH 4JGJA 4X0KA 4TNVF 1B4RA 1B9ZA 5SX4H 1OSPL 4JPIA 4ZOAA 3G5YB 3PL6C 2NY0C 3EDKA 1P6AB 3MLUH 1RFDL 5E9DB 2Q7YB 1OGAD 5F9WB 2R0LH 3H6JA 2CK0L 1VEMA 2BFVH 3WO3B 3PWLA 3I9GL 2DLHA 3WIIH 1XF2A 3BKYL 5KOMC 3B9KC 5GPRA 4MXQD 4HKJA 3QUZD 4PGCA 1S5HB 2MMXA 5D4QA 4U1IA 2ED7A 4Z7VF 2HFFB 1ZKAA 4PTUB 4TVPH 3ZKXB 1NL0H 3SBWA 3T0VA 3AAZA 5HD8C 4NN5C 3O6FD 3ILQD 1FSKC 4PRIE 5CJOL 3O3AA 4E42A 1K6QL 2NZ9C 4PJ8C 3MOAL 4NKQB 3QNZA 3RTQA 3TN0B 1ED3B 1MRFH 5FYLL 2DB8A 4K3GA 2ARJA 4JVUA 3QDAA 4TNWF 4QRPE 3THML 3SDYL 3FQRB 4FQLH 4JZOB 4KH2A 3GSXA 1N0XH 5H94A 3IDYB 2VKXA 1DBML 3CLFH 2X7LB 4LQFH 3RUGF 2AI0L 3QDMA 5EG6C 3H0TA 2FATL 4OZHF 2PYEB 3FMGL 4XB8A 4GW5A 2NY2C 1K4CB 4EUPH 3C6SA 4MJIE 5HVHC 3QIUA 4HPYL 1T7XA 4DW2H 4JPWL 2VRAA 3WNKA 4DFIA 4P5TA 1LE9A 3TYFA 2V2WB 4LKCA 5CEXB 2H32B 1IAMA 4OF6A 2OXGA 3WLWD 5INDA 1BQLH 3EOBB 5C0GB 5CP3A 3GKZA 4ZUSA 4JY6A 5IT2L 3F7YB 3JWOC 4U6HA 4N0YH 5I2IA 1OM3H 1N4XH 3MQIA 3PJSA 1RUMH 3T3PE 3UTTB 2ZG3A 1EHLH 3GHBH 1EGJA 3X3FH 1GGIL 4ZFFB 5GGVH 3OKOB 4G80B 1HEZA 4KKNA 5ALCH 1BHGA 1ZANH 1EX0A 5KBNC 5GHWH 3NZ8A 5I1DB 2GAZB 4U05A 3T4AB 4NQVB 1J86A 1NLDL 2FJHA 1QHPA 2NYYD 4G7YH 1R3IH 4MAYA 4F8QA 3H9SD 3MJ9A 4YFLI 2MPAL 1IKFH 3QQ9C 4PB0H 2PW1A 2K3TA 3NIDF 5SWZE 3RZCC 2BXZA 2OJEB 3G04A 4EUPG 3FO2B 3WFCL 1T5WA 5CEZE 4UZGA 1WZKA 3IJHA 2LQRA 3LS4L 1S7TB 2VDNH 4RMRA 2EH8L 2X4RB 5I30H 1C16B 4LLAA 3ARBD 4OLWL 2KZ1B 3K4ZA 3IU3A 1T22B 1BJ8A 3G08B 4R2GB 3SN6N 1K85A 1B2WL 5DS8B 4HWZB 3E3QE 1GGBH 5A2JH 1XCQA 5IVZA 2R1XB 3T0ED 1QLEL 5EORL 4JLRA 4HC1H 4QRQA 3MOBH 3VG9B 3SDAA 1CZ8H 3S37X 3IFOA 4X6DA 4JRXE 4CVZB 3GBNL 3GNMH 3LDBB 5CP7B 3ZE2F 4Q0XH 1ETZA 5HDBF 3TNMB 5MENB 4GFTB 1JK8B 1MOEA 3VD3A 4QHUB 1N2RB 3U0PA 1A7PH 3MJ8A 4EVNB 5FUOH 1T21A 3U46B 4YXHH 2A9ML 3GBLA 4KJQD 4Y5VB 2EYSB 2JJSC 4HGWA 1QPXA 4OD3H 4KI5D 5I19H 2UZXB 1RZKH 1ADQA 3FRUB 1ORSA 1N5YH 3TVMB 2IQ9H 3UC0L 5KN5A 1JF5A 3U2SA 4L8BA 4KVCL 4LU5L 2BCKA 2XG5A 4OLYH 1D7FA 4G6FD 4OKVA 5C0BE 1II4E 2R69L 2R1YB 3HC3H 4XP6H 3OB8A 4JFDD 4HS6A 1ND0A 2NY5L 4OCSL 3OXRB 3DTXA 1JVKA 1Y6MR 1G7QA 2R39A 1WBYA 3BZEB 4M6NH 5D93B 3DX6B 4CMHB 3GMLB 3HI6L 2AS5M 1HHKB 1H5BC 2H6PB 3D69B 3KPSD 5DEFB 4MD0B 3IB4A 4IHOA 4YK4B 5GGUA 2FSEB 5DFVC 1NJ9A 4DK6A 2DICA 1WCBB 4KQ3H 4M3JA 3DYPA 4ELKB 3KYNA 3PWVA 5GJSH 4EEEA 1JL8A 4F7EB 1PY4A 3E3QC 5GSVA 3D39B 2PUQT 3OR7B 1EEQA 5EIIB 1EBAA 1G6RH 3U7WL 3ILPB 4NCC1 1BF2A 4J12A 3TBSA 1NGQH 2DTML 1H3WM 4O51B 2IG2L 3QG6A 3MRGB 1MCIA 3DMMB 5TH2A 5DSCB 4UTAH 4WEMB 4LARL 4NQDD 1KPVB 2VLLA 3ALXA 3U1SL 4P23C 1RHHA 4U1KA 4XAKD 1N6VA 1W0WA 2YUZA 3QIWC 4Y8DC 2KH2B 4A2MA 1L6XA 4OM1L 1TQBC 1XR8A 1SM3H 3O11B 2AJXH 4Q9RH 1NLBH 3O3DA 35C8L 1EO8L 1R3KB 2VDRL 3I3EA 4RISH 4KGLA 2VDPL 4ALAL 4JM4H 1BAFH 1CICB 1FVDA 2Z91A 3QJHA 4S0SD 5DA4A 5DQ9A 1S9XB 2ADJB 4MMZC 4KRMB 4Z7UB 1CGSH 5IR1B 4YXKH 1FFPA 4UUJB 3RFZC 2E7HA 2NXZD 4HJJL 4UB0L 4QHNB 4WHCA 4Y19B 4MNQD 3A6CL 1MLBA 3QCUL 4DZ8B 3BW9B 2EIEA 2E7MA 5K9JH 4GAYB 2J88L 5T3ZL 1F4YH 4ZDHB 1WICA 3G5YA 5HYQA 3OKLB 4ZPVB 3U7YH 2OR8A 3ZDYE 4R8WH 3IYLW 4H26B 4WO4A 1HH6B 3TYGH 3QQ4B 1NUGA 3AXLB 4OGXH 2HTKD 2FDBP 1MSPA 3TF7C 1DBJH 1TJGH 1R5VA 5E2TH 1MH5A 1E6JH 3H42L 4GOSA 3STBA 3WE6A 1L9MA 3IFPA 3ARGD 1BWMA 2YD8A 4BZYA 3UZEA 4QWWC 2BVUA 4L1DA 4I0KA 4IIQA 4M8QB 4LVHB 4RX4A 3L7EA 3OB0H 4K9EC 2AJUL 3N1PC 3CFJB 1DANT 5DXWA 2RCSL 4JFFE 4F3FB 3DHJA 4S10A 4MQ7B 1NMBL 3VFNB 1GCFA 2WBJD 3BEVB 2QQKH 1IJ9A 4K23L 4L8CB 3ZDZF 2UZIH 3FQRA 3K74B 5EC1B 1DLHA 2HKFH 2X7LA 2EZ0D 4QTHB 2J12B 2AW2A 2DQTL 2PYEA 3M45A 2DQFB 4L4JA 1PEWA 1MNUH 3EO0A 4X80H 1K4CA 3PQYD 4HWBA 4F9LA 2IALB 5I1AB 3MUZ1 1WISA 4OD2A 1CL7H 3IXTB 1LQSR 5D72H 2WIIA 4BSVB 5T1KB 3D5OF 1MCOH 3KPSE 1CD0A 4N0FA 3RVWD 1X5JA 1EXUB 5FB8A 1KN2H 5HTSA 3BVNA 3S34L 1P4BH 1XGRA 4QOKD 1C5DB 3PV6B 2WLZA 3BP6B 1EV2E 1Q8MA 1SJEA 3F7YA 3QEHA 4FA8A 1KGCE 3UTTA 4D0CB 4Y4HA 1M1SA 4XX1G 2EEAA 3ARQA 4NCDA 3OKOA 4G80A 1T5XB 4RGOH 3UO1H 1VKXB 4ETQA 3MLUL 2FL5B 5I1DA 1R3LB 4POYA 2GAZA 2GY7B 3F6IA 4U1GC 3TT1H 4MQSB 2R0LL 5FM8A 1ZT1A 2D9QB 3QXDB 1S3KH 3NFNB 3MV7E 4UDUB 3WIIL 3MFFA 1UEYA 1MI5D 5DGRA 4ONHB 3VGGA 1Q0XH 2OJEA 1OPGH 3D2UB 1VB9A 4KK5C 1UVQB 4G8IB 3IDGB 2ADIA 1NL0L 3D48R 4QXUH 4YBQC 2PYFB 2X4UA 4BFIB 5DJDA 1GRWA 5I1KH 2XPGA 2X4RA 5FUZH 3GSWB 1C16A 1AP2B 2ICWI 2H9GB 1JPGB 3GJEB 4PJ7B 3G08A 4MLSA 5LWYH 4CDHA 2DN7A 4EZMA 3D0LA 1H9VA 4KC3B 1MRFL 3GUTB 5DJXB 5EU6A 3DVNB 3LD8B 1MRDH 3SO5A 1NBQA 4FQLL 4DKAA 1NGXA 5GRVL 4BSJA 1J11A 4TSCL 4KTEH 2R1XA 1BIHA 3CLFL 1JV5A 4LQFL 4WGWB 4WW2F 1YEEH 3GHEH 1ZHBA 5C2UB 3VXUD 2NTSP 5DVLA 2CKBB 4OQTH 5C0DB 4OI8A 1LDSA 5INCA 1N26A 2VUYA 5FECB 2VZUA 1I85C 4AM0B 2IGFH 3JVGA 4JHZA 3KPMB 3MGOA 4QCIA 5CP7A 5D7JD 3TNMA 3MACH 1JK8A 2WMPA 4K3EH 4LLMA 5F6IB 4BFGA 4J8RA 1XGPA 1TJIH 2PTTB 2ZUVA 3PDOB 1Q1JH 1INDL 3GGWB 3AMKA 1ZGLP 2EYSA 5FV1L 1BQLL 1HWGB 2A73A 3MNWA 5T1MB 2Z8RA 2GFBB 4NUJA 4PLNC 2M1KA 4PLKC 1NMCC 3FRUA 4POZC 4Z7WF 4N0YL 1N4XL 3TVMA 1RUML 5DJCB 3TBTB 2A74B 1EHLL 2FJFB 3GHBL 3CU7A 2AXJA 1NCBH 4X6DF 4BQ9A 5GGVL 1LO4H 5ALCL 2PNDA 3GKWL 5GHWL 1S7RA 2NY0B 3RVTC 1F90H 2YPLD 4OCNC 5I74C 4D9LH 4N1EA 2OSLA 3OXRA 3BYTA 2FGWL 3O3EA 4HZAA 5CSZA 4G7YL 4L3ED 2W0FB 3U9PL 2CXGA 1IKFL 5D7IB 4NKIH 5HYJB 2C3XA 5L88L 1JZ7A 2H3NB 3G5XB 4RFEB 5JR1L 2H6PA 3B9KB 5DEFA 4MD0A 1RY7B 1KOAA 5EBGA 4U0QB 2FSEA 1UH3A 4PR5A 5HYSB 4KV5F 2VDNL 1WCBA 2XOTA 5I30L 2A6DB 4ELKA 5ICYB 4X4YB 5J6GA 4TVPD 1D9KD 4GH7B 1FSKB 3O81A 1N8ZA 4H25A 3OR7A 4F9PA 5FAAA 3RWJA 1GZQA 3KPRE 4YHIA 4NQEB 1GGBL 3KXFB 3QDGE 3MBED 3MRGA 3DMMA 2IC2A 5J56B 1WAAA 5DSCA 3PWNA 4HC1L 4S2SB 3MOBL 2BZDA 3CJJA 4S1QH 2IBBA 1CZ8L 2CPCA 1IAIM 1MVFA 1ORQA 4Q74A 2DQDH 1AIFA 3ROOB 4G6JL 4ZO9A 5F97E 4HK3N 3SQOL 4Q0XL 2Z9TA 2NQCA 1NDGA 4JFXA 3SKMA 5EU5B 5CUSH 1R3KA 5ETUB 3PG2A 5FUOL 4RBPH 2NNAB 4JVWA 1XCTB 3GM0A 4Y4KC 5LAXB 4OD3L 3DRTA 5I19L 4FQJL 1S7WB 4P2OC 1RZKL 1S9XA 3VRIA 1EO5A 3CMGA 1V05A 1RHFA 1NC4B 1LGVA 1MVUB 2KUTA 1PGRB 4IRJA 4K94C 4Y89A 3ULSB 3VD4A 2VDKH 2ID5A 2HLFC 5E2VH 1DQTA 4OF0A 4NRYB 4U6XB 2Y25A 5EFIB 1YECH 5DHYB 4YWGH 2R2EB 1XF5B 1UKSA 2E7BA 4DZ8A 2IAND 1UZ6E 3HC3L 2F19H 3S37L 2GK0A 4XP6L 1UB5B 4HUNB 2P8LB 2IADB 5DJ6B 1UWXK 4GAYA 4MX7A 2BK8A 4ZFZA 2DKUA 3OX8A 3RNKB 4ZDHA 3LKOB 3RX7A 3OKKA 1A7BA 4M6NL 1RZJC 3UBXA 1FC1A 3P4OB 3P9LB 1QR1B 4H26A 4TUOA 5JW5B 5I6XC 3AXLA 3HAEA 3MUHL 2HT4C 1ERNA 1A1OB 1HHIB 2F54D 4KQ3L 3ARFC 5GJSL 2AERT 2VR4A 3HHRB 4PGDB 4EKXA 3VXRD 4NKMA 4OAWB 1U3HA 4YBHA 3K2UH 4QRPB 4M8QA 1OSZB 2JJTC 4P5KB 4KJYB 1G6RL 1PX4A 5F88B 5I0DA 4KK9D 4S11A 2XQYG 1NGQL 3SY0B 3FN0H 5CIPH 2EE6A 5IMMB 4MQ7A 3VFNA 1A21A 4UNTA 4UTAL 5GRUH 2ZUTA 3ZTNL 4YX2L 2FEDD 3BE1H 1CXHA 1O7VA 1JZ8A 1T0PB 3AREA 2GW5A 5KS9E 4PRPD 2EDEA 4QTHA 1SM3L 2AJXL 2DQFA 4AEHL 5C2BH 4Z95H 2AEIT 4MD4B 2IALA 5I1AA 2NZIA 3AFLA 3T08A 5IVNA 3DV4B 4JM4L 2LAAA 1BAFL 1Z5LB 1HINL 4EDXA 4FQXD 4L5FL 4HKBA 1CGWA 4QNPF 1JZ6A 3RDTB 1PG7X 2OL3A 4YXKL 4RGNE 4WJ5A 1RI8A 3U0TB 5ID0A 1P9MA 4XCCH 4CAGA 5HHOB 4RNRB 1T2XA 4P5MB 4R97C 1Q0YH 3KJ6L 1KPRA 3ULVF 4FOMA 5HHPB 5GZOC 4I18C 1T5XA 2F5AH 1KIUA 2HG5B 1F4YL 1VKXA 3MRDB 2E5EA 4LKXB 4P4RA 3U7YL 4KAQH 4OZGB 3KR3L 2EC8A 4DZBA 4ISVA 4PLJC 4NGHH 4OLUH 5KSAA 5FGCE 4P9MH 3QXDA 3SHSA 1H5BB 3O9WC 3NFNA 1I9IH 2GJJA 4OGXL 3B6SA 1NAMB 4AY0A 2MCG1 4ONHA 3QUXD 4LHJB 1DBJL 1QFWM 3OV6A 1TJGL 4CNIA 1EFQA 1DEEB 4TULH 1G6VK 1DUZB 1UVQA 1E6JL 2R23A 1KYOK 3HZKA 4G8IA 5ESAA 1S7QA 5KG9B 4GKOA 2I07B 4WHDA 5FF6B 4BFIA 5JIPA 1CGXA 3JTSA 5ERWB 2GQHA 1AP2A 4OGAC 4MXWL 4XTRC 2H9GA 1FGVH 2NY1B 1JPGA 4LLWB 2VLMD 3CH8A 2KPNA 3D0VA 1K3IA 4PGEB 2I5YH 3D18B 3F7PC 2QQKL 5DJXA 3A67H 3IU4H 3P0GB 4WW1B 4GXVH 3LQMA 4OGZA 4X98A 4L4VE 4LSDA 2HKFL 4M03A 3DLQR 3BD3A 3C2AH 1I3UA 2MSPA 2BERA 4XWOC 4Y2DC 5JHDB 1TQBB 3IDXL 4RRPA 3IDMB 3GSOB 3WJJA 4AM0A 1LO2H 1OTTC 1CL7L 5KAQF 2HMIC 3Q6GH 2C1PA 3NN8B 4PJ5B 4DGVH 1AD9B 3OKDB 4RGNC 5BW7A 1MCOL 5E6ID 3PDOA 3U7AA 3GGWA 1U8OA 3T04D 1CR9L 1KN2L 1IKNA 2GJ6B 1FNHA 2FIKB 5C0BB 2GFBA 2P5ED 1NGWB 1C8PA 4P2QB 3RWFA 2A74A 5KSUA 3MRMB 4DKEH 2GTZA 5MEQA 5GRJH 3RPKA 2UZYB 3MRBA 2R2BA 3VE0A 1G7IB 3PL6A 3ARVA 3FO1B 1MEXH 3HN3A 5F1SA 1MCLA 4YLQT 3E6FB 4FFWC 5GIRA 1M6OB 4P9HH 5D1XD 3FB8B 4OT1H 4FG6C 4DVBA 3JTTA 4MCYA 3WFHA 5HYJA 1S9WB 1I1AC 3G5XA 1Q0XL 3B9KA 1OPGL 2XI9A 3HE6D 5GISL 1AD0B 1BZ7B 4NKOA 2VZSA 5SWSD 4OUUA 3MUGB 4QXUL 3PXHA 4GSDH 1QA9A 1P2CB 4JO4H 3TBVB 3W9EB 4Y5YB 4H8WC 3LHPH 4LSPH 5DO2D 2W0PA 1IM9B 2F5BH 4NM8H 1X6LA 4PJ8A 2Z4QB 5BVPL 4YO0A 1WV7T 3VXMB 3GMOA 4OTXH 4FS0A 4NQEA 3KXFA 4JJ5B 4Q6IC 5CJXA 3RHWF 4L9LB 4KI1A 3CZJA 3QRGH 3HE7D 4K7PY 1YEEL 3GHEL 5CZXD 2QBWA 1EZVX 4ZNEA 1ZLSL 4OQTL 4V1DA 4AG4H 1RJYB 3AS2A 3VRJB 1KCKA 2MQ0A 4XPBL 2WBWB 2BY2A 2IGFL 1G0DA 4LLQB 3ROOA 2X9YA 4F37K 5F7DA 3C87A 3S9DB 1WT5C 2MWCA 3QNXB 5CEYB 1GZPB 4K3EL 3TO2B 5BOZG 1EHAA 1FZOB 3QXAB 5ETUA 3W9DA 3PWJB 1TJIL 3GMPB 4XI5C 3BPNC 1Q1JL 2NNAA 1XCTA 5TGBA 3VI4F 5LAXA 4N68A 4OJFL 1JMXA 3U4BH 2FR4A 1BM3H 1S7WA 4HWNA 2FB4H 1WAAF 1CE6B 3F62A 1NC4A 3PP3K 1MVUA 1FLTX 2R1WA 1HHJB 3IAQA 3OSKA 5IBLD 1NCBL 2GUOB 3QEQD 2V17H 1LO4L 4U6XA 2E6QA 4NRYA 4FFZH 4EN3D 4ZQKB 5DMIH 2OR9L 3G6JB 3B8SA 1F90L 3A0OA 5HHQB 1QFPA 1UB5A 5A2FA 3LOWA 4U1GB 3FQTA 1A7RH 1HHGA 5JXEA 2PO6C 3QWRA 3CSYA 4BH8A 4BQCA 3T3MF 1KTDA 4Y4FC 3HKFA 4ODWB 4KPHH 3DVGA 3RZCA 3WHE0 2E9WA 3O6LH 3FQUA 5EU4A 5JW5A 3EFDH 2EDYA 1WFNA 4PRIA 3KLHD 3FFCD 2ZNWA 3QDJE 3MMEB 1EFXB 1J12A 4GO6B 4QHMB 3VWJD 4LPUA 2GIYA 5ISZE 4QRPA 5IF0A 2XTJD 1BOYA 1OSZA 1JNLH 4P5KA 3MGAA 4NO3A 1CBVH 1JCKA 2HFGH 4RFOL 4P3DB 4ZS7H 4ERSH 3KYAA 4J3TA 2P5EE 1RZ8B 4XPGL 4MJIA 1JNNL 3V4UH 1DQLH 5IBUB 2BVTA 1OAKH 1IGTA 3BHBB 4JANA 1C5BH 3S3SA 4NC1E 3MRJB 3MODH 1J8KA 2A6JB 4AIZB 1FRGH 1FJ1B 3ULUH 1YA5A 3BH8A 3I75A 2XTLA 1KTLB 1YN7A 1ZT4B 2JJSA 1HIMH 4IOSD 2BMKB 4ZUVA 3STLB 3W11D 1FO0A 1A0QH 3TBYB 3RRQA 5L2KD 1KLUA 4XXCC 3MRIB 1MY7A 3H3PH 2WUCL 5SWSE 5K9OB 5E2VL 1JWUB 4ZFGL 3U0TA 4OCYH 4N8CH 5FA4B 3PWPE 2C9AA 1Y6KR 1YECL 4YWGL 4JFHD 3REVB 4OM0H 4WI7A 2F19L 1BOGB 4Z7OE 2R4RH 4HAGA 1ZHNB 4WFED 5HXMA 1I4FA 1OTSC 5I74B 1LE5A 5SWZA 1IAII 1JHTB 3QEUB 4LSQL 4LF3A 3DURB 4F15C 4LKXA 5LGHL 4PJFE 1LNUB 5DVOA 1T1YA 1H5BA 4PJ9C 2ZPKH 1NAMA 2VLJD 4YR6B 3DXAD 5ALBH 5I76A 4KROC 3IRPX 4H5SB 5EPMB 1DEEA 4HF5H 1DUZA 3HCVB 5KG9A 4HGMA 4X7TB 2AEPH 4G8EB 4APQB 3SPVA 1K4DA 4JDVA 2VDQH 2E7CA 4WRLA 5ERWA 2OZ4A 5HI5D 1RJCA 4HKXA 5DJ8A 1N6QL 4WUKH 1KLGA 2AABL 3FN0L 1UCTA 4PGEA 3CFEB 2QQNH 2DIBA 3VJ6B 2IMNA 2ADGA 5GRUL 4KKCC 1B0RB 2D7QA 4JRXA 4KFZC 5GGRA 3BE1L 4WW1A 4NZRL 2XXMB 4P23A 3U6RB 4NC1C 2YPKA 5KSBF 3QIWA 4HH9B 3Q3GB 1KCRH 3A6OA 4Z95L 4MA3B 1U3YA 1MQKH 4MVBD 3L9RB 3IDMA 3GSOA 2IPUG 2HFTA 3NN8A 4HK0B 5E03A 1JWMB 5D1QD 3TZVD 3N9GH 5C0BA 4XCCL 5I1GL 3VFUB 2BVQA 2DWEB 1UCBL 3BJ91 1NGWA 4J4PD 5D1ZD 3FFCE 5AG8A 1F42A 1Q0YL 4K07A 5FYKL 4WGVB 1F4XL 3OG4B 3QISA 2PF6A 3W82A 1RAMA 2C4FT 4DOHB 1KB5B 5DMKA 4YHMH 1EEYB 1U93A 1HNGA 5MEPA 3HZVA 1CFVH 1NSNH 3EGSA 1NUFA 1SYSB 4KAQL 5KZCB 1W8OA 3JWDH 3LRSB 4OLUL 5BS0D 4P9ML 5CP3H 4KQ4H 4L4TE 4PP1C 2YRZA 1NANI 4BSWA 3FB8A 4I2XB 1I9IL 2R15A 1JRHH 4FFVC 1JGDB 1S9WA 1EGJH 4GRWH 3TT3H 5DT1H 3KHOA 2EO1A 4R4ND 1T66C 4X5WA 3HG1E 1PG7L 1HSAB 1REIA 3FOMA 1IEAB 3ARFB 1WSST 2APBA 3NAAL 4EQ3A 3QQ3A 4RQQA 3TBVA 4M6OH 1A3RH 3SDXE 3W9EA 1OD9A 1Q94A 4M93C 5FHBH 1SBBA 4LLYB 2BSRB 3HNTH 4G8GD 3MJ9H 1RD6A 1X5KA 3UJJH 4N8VB 1E6OH 2CDFA 1XF1A 1I9EA 1MCFA 5CJ8A 5SX5H 2Z4QA 2HYMA 4ZPTA 2EE9A 5F9OH 3VH8A 4Y8AA 3MJ7B 4LNRB 1FLRH 4GXVL 4JFEE 2DI7A 1KXTB 3B2UD 3OKNB 1OP5K 1H3UA 4HMDA 2UWEE 4PJDE 4JFHE 1J05A 3NABH 4NOBA 5ACZB 2HA1A 3C2AL 1FVEB 2V5YA 3ZKMD 2BVYA 4LSSH 1BPVA 4IRSD 2IF7A 3D3VE 1LO2L 1U2CA 2Y5EA 4ELMF 1QFWI 3TIDA 3NCMA 3QIBD 1MCKA 3Q6GL 2BNUB 4DGVL 3ZYJA 4YHNB 3QNXA 5CEYA 5DURD 4UIKH 5IB4A 1YPZE 3ARWA 3QXAA 1V7NH 3BIBX 3NIFE 1MF2H 4G9FD 1MCCA 2Q8AH 2M2DA 1SEBB 1KJ3H 4Y88A 3G5VB 1UJ3B 5HPMA 1YMHB 2WIMA 3CFIC 5C8JB 1UZ8B 4R97B 4WV1C 3PABB 4J3SA 3IVKA 2VITA 4S1DD 2HJKB 1NFDE 1F4WH 1KYOJ 4Y7MA 4KKLC 3B9VA 2ZSWB 5DJAB 5LCVH 5DWUH 3RGHA 3VFSA 4PJCE 4G3YH 2DRUA 5DJYB 2EE3A 3T2NH 4P9HL 2XG4A 1F13A 5E4EC 3SE4C 4ZD3H 4OT1L 3O9WB 4W68A 3X12A 3GEWB 3GMMB 1NBYB 4ODWA 2C26A 1DDHB 4E9LA 5KVGL 2FYYB 1LK3H 3DX9B 4LCYB 2C5DC 4LQ1A 4NNYA 1MHCB 1OTUD 1I3RB 4GSDL 4YZFE 3RIAK 5E94A 5C0CB 4TTDC 4JO4L 1J8HB 2BDNH 1J0JA 1WJ3A 3MV9B 2X1PA 3LHPL 4LSPL 4JFFA 3MMEA 2H26B 4LCCB 4QHMA 4ZAKD 3RVVC 1H8SA 1IL1B 1JYNA 1XGTB 4D2NA 4NM8L 1G7MA 1YEGH 5BV7B 1A6UH 2ZJSH 1KEGH 3M8OH 3ORJA 4G9DA 4O2FB 5T3XL 5TF1H 4GLRI 5KS9B 4RZCB 3I6GB 3BIKB 4IDJH 4R0LC 2B4CC 2YXFA 3X11A 4OFPA 1OLZA 3SJVB 2VXSH 1CXEA 3QRGL 2FZ3B 1OB1B 5E5UB 4GKSB 1MCBA 2FHBA 2V5SA 4AG4L 2D0FA 1TXKA 4Y2DB 1I7RB 12E8H 5DTFB 1NEZA 4GT7A 1I85A 5EBLB 1X5LA 5IMKB 4R4BB 3QUMB 1HH9B 4BYHA 3KPSA 5HGGS 5KW9H 4NPYB 4H0GA 4RGNB 3CAFA 2E9BA 3B4NA 1NCTA 4AIZA 1FJ1A 3QUYC 4ZXBC 3QSKB 2XWTB 5FYJU 5ITBH 3WL9B 1DUYA 3U4BL 1CFBA 5MEOB 1BM3L 1WWWX 5CSBA 2FB4L 3CDGB 2XZAH 3F65A 3MRIA 3QXTA 1HNFA 1AGEA 3ZKNC 5K9OA 1JWUA 1A6ZA 2V17L 3BP7B 1CLZL 3Q2CA 4PG2C 5GGSB 5DMIL 1OGTB 3LN5B 5J3HD 1FH5H 3RA7H 1BOGA 1J88A 1NCAH 3MV7A 3O3UN 5IW6B 1A7RL 3PHOA 1IQDA 1JHTA 1F5WA 2JELH 3EZJB 3VDBA 5FM4A 3GIVB 1R0AL 2APVA 2WBKA 4LK4A 4RMUA 1LNUA 1I1AB 2BVPA 3O6LL 3EFDL 5D70H 1AGDB 4JQXC 4PJIF 2LVEA 3MA7A 4JPVL 3BPOB 4H5SA 5EPMA 3OGCB 1GIGH 2X4PB 3R1GL 3V7AE 1PZ5B 3H7BA 4C57C 2EKJA 3H3BC 3Q0HA 4G8EA 1L0YA 2BNRB 4UILL 4U3CA 5CLTA 1BFTA 2QR0B 1BVLB 1E0OB 4PS4L 4JDTH 3MV01 1JNLL 4L4VB 5CILH 1CBVL 2HFGL 4ZS7L 4ERSL 1XIWC 4XNQA 4K7FB 1QBLH 1B0RA 4UOJA 3KYOB 1CGVA 4KUZL 3V4UL 3TPKA 2OMBA 3QCTH 3RWDB 1JNHA 5DHXB 4PV8B 1I8IB 2F53E 4LPWA 5JQ6L 2EDJA 3Q3GA 1I9JH 4A6YA 4NQCB 4MA3A 1WC7A 3E8UH 4Q9BA 3L9RA 2A9NH 2CKNA 3IDJB 4PY7B 1FRGL 2PCPA 2N56A 3CFDA 1R3JA 2B7DT 4HBCL 2UVFA 1P7QB 2R0KL 4Y4KA 3EYFA 3RWHA 2Y7QB 3I2CL 3KJ4B 2PXYC 4P2OA 1SJHA 3H3PL 1CD1B 3AMLA 3KYKH 2D03H 3OKEB 3ULVH 4OCYL 3OQ3B 3VFVA 5A2KH 2JE8A 4OM0L 1X5ZA 3C2SA 1LP9F 2FWOB 4JZNA 3EOAA 2OYPA 4CU7A 4KKAD 2WBJA 3UAJD 2R4RL 3IKKA 3SGEI 4YDIH 2BNQB 5C08D 3W5NA 2ENYA 3V6FA 2C3GA 5HVFB 2HFEB 2XN9D 4YXLH 1SYSA 2ZOLB 3MO1A 4LGRB 2B39A 3LRSA 3N50A 4M5YH 1LWRA 3AU1A 2ZPKL 1NCWL 1ONQB 4I8DA 1JGDA 1YZZA 2YD3A 5FK9A 4HF5L 4YEEA 3KYMB 1AGFA 2HKHL 4NZUH 5FDWA 1X5FA 5IVXE 1KF9B 2AEPL 1J1XH 1P5UA 4YAQB 4G8FA 4F7TB 3KPRA 3OF6D 3RWIA 4P2RB 2KQMA 1GGUA 2YBRB 4F37F 3QDGA 1NKOA 4XNUL 5T1LB 5GS0H 1LO5A 4JM2D 5IG7B 4WUKL 3K81A 5D9SA 5J8OA 4WU5A 5JLZA 5KSBB 3TGXA 1NDMB 1AKJA 2ILLA 3MXWH 4L3CA 1SY6A 4ORZC 2QQNL 3VXSD 1FFOB 1CG9B 2VWEE 3ZYZA 3MJ7A 3C5ZC 1C08B 1QFHA 2DQJH 4JPKL 5CZVH 4F57H 5C0AB 4Y1AE 1MJUH 4OCRH 2G75B 3V5HA 3RKDC 2R2HB 3KDMB 3TJEH 3LAFA 1QRND 1KCRL 2L7JA 1PYWA 3HMWH 3BQUC 4KY1H 1MQKL 3P73B 1QVOB 3RY5A 1UC6A 4IRZL 2BNUA 3AS0A 3KWWA 2P5WE 4XCEA 4KMTH 1MFNA 4CJ1A 2VSDA 3ULUD 3W0WB 2UVEA 3N9GL 3SDCD 1AGBB 5SWQB 3QFJE 1PDKA 1JTPA 3G5VA 1IT9H 5F1OB 1YQ2A 1YMHA 5C8JA 1D5XA 1QSFE 3RAJL 5B8CA 1MCEA 3PABA 2OXHA 2QHRH 4N9GB 1BEYH 5DZLA 1B90A 4B41A 3DX8B 4XP1H 4I18A 2H8PB 2XV6B 1CFVL 1NSNL 1R3HB 4F15B 1MRCL 3JWDL 4ENED 4GQ9H 2NR6D 1ZE3C 3UJTL 3ARYA 1M7XA 2APTA 3QDJB 4PJ9B 1JRHL 3O9WA 3UBXI 3TNNA 4ODBD 4LCWD 5IJVA 1EGJL 1DDHA 5DT1L 1S7UB 3CDFA 4KROB 2YOCA 4LCYA 2YRPA 4GG6E 1MHCA 3GSNA 4CU8A 1HCVA 1CDUA 1I3RA 2AKRB 5CD5D 4MJ2A 1ZHKB 1A3RL 2K9UA 3KHQA 2AV1B 3HNTL 5IHLB 2H26A 3MJ9L 4KDVA 2VWEC 4DWHA 1IL1A 3UJJL 4Z5RB 3MRRB 1E6OL 4WWKD 2NY4C 3Q1SL 4ZUUA 1P4LB 5CBEB 1I3GH 5C09E 3HPJA 1AO7E 3I6LD 5F9OL 1A9EA 1CIDA 1FLRL 3I6GA 4ELMB 4JO3H 4FTVE 4U1MB 1U8NA 4Y5XB 2VXVH 3GB7A 5AAWA 2FZ3A 2EYTB 4GKSA 3REWA 3AM8C 4LSSL 4UV4L 1I7RA 4LPXA 5TF0A 4WI2A 4XVUC 4KI5F 5DTFA 1J9CT 2R29H 4KKBD 5EBLA 5IMKA 4TQEH 3CX2A 4M4PA 4X7DC 1HH9A 5D7LB 2XN9E 3L3GA 1D6VH 5CJQL 4NPYA 4UIKL 4YE4H 1V7NL 1M71A 1YMMB 1MF2L 3RTQD 2WINB 4NYLB 2Q8AL 2NY5C 2V2TB 1U8LB 2XWTA 3WL9A 4EBQH 1D9KA 2NTFB 5HGBA 5EC2B 2VLRB 5HPOA 3QO1A 3VCLB 4ODUB 2X2YA 2P4AB 3QDMD 2YKLH 3HB3D 3PHSA 5T3ZE 3BH9B 1M7IA 5FYJE 1CI5A 1F4WL 5DD6A 2YA1A 3BP7A 4P46C 5GGSA 4LVEA 4Z7NE 4JZJB 1OGTA 3LN5A 2ZKHH 3MR9B 3QFDB 1DZBA 3QIUD 5LCVL 1A6TB 2X4OB 4G3YL 4JFYA 4P5TD 5EUOF 4N9OB 4F7PA 3T2NL 4ZD3L 1YYLH 2E9IA 5IW1A 4KRNA 4OZIF 4GBXC 2MCPH 1LK3L 1I1AA 3CLEH 3MSPA 4JO2H 4LOUD 1JZ3A 1GHFH 5CHNB 4WHYH 1ZVHA 4ZO8A 4CMMA 4PRHE 4LIQL 3X13B 5GGTA 3TCLB 2Y06H 2HJLB 2FHFA 4M93B 3IKCB 1BVKB 3X14B 1M7DB 5JZ7D 4OZFB 3DO7A 5CGTA 2XKUA 2DLFH 4KRLB 1YEGL 4BM7A 4OCXH 1A6UL 1G9EA 1VGKA 2HTLC 3M8OL 3WUWB 4L4VA 3BYYA 4ZG1A 4PUBH 4MAYD 3MLZH 5TF1L 3HAEH 1UH4A 4YBLC 2GT9B 1NGYB 4IDJL 4OCLC 1I3VA 5L9DH 3EKCA 2VXSL 2HVKB 5IB2B 4PJHE 2ATKB 2B8OT 3HFMH 1YEFH 4Q6IA 2OS7A 1QYGH 4GRLC 2NW3B 1FNAA 4C56E 2V7NA 5F3BB 12E8L 3RWDA 4QRRB 2AJSH 1I8IA 2RQ8A 1AC0A 1FZJA 5E2JA 1IBGH 3N06B 1BZQK 1WT5A 5T5NF 1FC2D 2VIRA 5KW9L 4NDMA 3ZKSD 4QGTA 3O2VL 3ROLB 2AK4D 4OFYA 2HT3C 3L3OB 1RUKH 1K8IA 1P7KA 3O6ML 2CLRA 3QP3A 3E2HC 5ITBL 3O0RL 1KT2A 3RBSA 5F7LB 3WNLA 1HHHA 4WHYG 5IQ9B 1KPUB 3O8XB 2XZAL 4X7SL 3RGVC 1VHPA 3JWNC 2YXMA 4W81A 1CD1A 4HCRA 3UBXG 3SDAD 4WV1B 4LSVH 5FO9B 4KXZH 4F58H 3TJHC 5I8OH 3L3JB 3D85D 3FQWB 2FWOA 4GAGL 4L4TB 3HAEG 3RA7L 2BHZA 5C6TL 1NCAL 3NBNA 4LPVA 2QLVB 2VXUH 3ZDXE 2ITCA 2HFEA 5C71A 2JELL 2PO6A 1G9NH 1FL5B 2IH1B 4H1LH 1RZ7H 2DQGL 5E4EB 3HG1B 1T03H 2OL3H 1AR1C 3SKJH 4Y4FA 4H0IA 4MJ6B 1A2YA 4WI3A 1BF8A 5K9KA 4NN7C 3SDXB 2PTUA 2XKSA 3EO1B 4GMTH 3WKNA 5DZOA 1R5IA 4J6RH 1HKLL 1GIGL 4ZO7A 1BQUA 2HRLA 2Y36H 4XXDA 3QNYB 4WTZA 1UJTA 2NXYD 1P84K 4ODHH 4ODVH 5BCAA 4XC1L 4JFEB 2NY3C 1DTUA 5EU3B 3V6ZB 5CILL 2UWEB 5T1LA 4PJDB 5IG7A 5L6YL 4G43B 1SEQH 1OW0C 1QBLL 4UBDD 3D3VB 1FFOA 1KCSH 3O6KH 2CR3A 1KIQB 2DQCH 2R9HD 3BRGC 3HRZB 3QCTL 2QADB 2W59A 1KNOB 1CFTB 3QWOB 4PGBB 3MLXH 3CVHB 1YPZB 3K46A 2NX5E 3MRPB 3GK8H 1CVSC 1MLCB 2VE6B 3RVUC 4RFNC 5JUEH 2DQHH 1I8MB 1CU4L 3LSOB 4W6XB 5KTEH 1CFQB 3VXQB 4B7IA 1RZGB 2EC9U 3P73A 1AJ7H 1BWWA 1QVOA 3QAZB 3QUYB 1MCPH 1OGAB 1KG0B 4ZXBB 2WWKO 3T4YB 1LP9B 2K7PA 3LKRA 1PEZA 3V6OE 1RULH 4H88H 4OLEA 3QXWA 1INEH 1AGBA 4XXCA 3KYKL 4LCUA 3QUZB 1CT8B 3ULVL 3C6LD 1F6AB 1P1ZB 2YSSB 3FQNB 3CXDH 2WQ8A 3BD5A 4E41E 1T2QL 2Z93B 3RIAF 4D0BA 4YDIL 3B43A 3VXTB 3O6FB 3DX8A 2EDXA 2H8PA 3DWTA 3QJFB 2P45B 4YXLL 1R3HA 5DVMA 5EO9A 2BX5A 5L8KB 4TUKL 4IMLB 4O5LH 1S7XB 5B39B 5T33H 4LLUB 4NO2B 4M5YL 5EN2B 1OAYH 4X6CE 3QDJA 4PJ9A 4LP5A 5JW3H 2BSED 2VB5A 4NZDA 4QHKJ 3C9NB 1S7UA 5DFTA 5EZIH 3HC0B 4PIRF 1QKZH 2I9TA 4OFVA 4NZUL 5ISZA 1R5WA 1J1XL 4WFGD 4EQ2A 3RY4A 1A02N 4EOWH 2AKRA 4U1JA 1KV3A 5HGHB 1JJUA 4O2EB 1H8NA 1KXQE 4NQSB 3E0GA 2AK4E 4NRZB 3FOLB 4LDOB 1KFAH 2P5EA 5GS0L 8FABA 5CKAA 1TENA 5AYUL 1MHEA 5D71H 1XIWB 2PN5A 3CH1A 2QKIB 4WO4D 4X9FA 1RK1A 3LMJH 4F57L 1ACYH 3R8QA 4QHLB 1MJUL 4OCRL 1EA9C 3MNVB 5HGDB 2CDEA 2XRAL 3L3IA 5I9QC 3TFKC 3TJEL 5H35B 3LKNA 4WENB 2CSPA 4S1SH 4ZFOB 3HMWL 4O9HH 5IGXH 5B38A 4GKZB 3V6OC 3NCCB 1UWXH 1DQJB 2X4SB 4I9WE 1YEIH 4RX4D 1I75A 2VC2H 3LEYH 4KMTL 5LGJB 5IFHH 5SWSA 1U91B 4J2XA 1N0LA 3H9SB 1X4ZA 3GRWH 3PWPA 4BA8A 1DBKL 5EU7C 5IV2B 5EIVA 5IKCB 1IT9L 2NTFA 5D7KD 4PJAF 2W92A 5LJYH 2DJUA 1VACB 1JWSB 2E27L 2YA0A 4ODUA 3NVQA 4UTBH 1RMFH 2QHRL 3ZTJH 3BH9A 4RBPK 1BEYL 2PYED 4QRTB 3FL7A 1I7UB 3P0YH 4JFQB 3ARBB 3DECA 3ES6B 4X4ME 2E7LA 1TVDA 4PJFA 5I8CB 4RIRB 4XWGH 5GQBA 3QFDA 1MJ7H 3MUY1 1EMTH 1LO0L 3IGAA 3LN9A 2WUBH 4YHOH 1I1YB 3V0WH 2XQYK 5A16B 1XEDA 5D8JL 1CDIA 2WZPD 3MXVL 2VUOA 5CAYB 3BDYH 3JWOH 1Q9OA 1FNEB 1WLHA 3DRQB 1Z6JT 5GS2D 4N5ED 1HOCB 5KVDH 3UTQB 2V9TA 3H9HB 3UTTD 3NACH 1RUAL 4Y4HD 4UT7H 1BBDH 3V52L 5GS3A 2WP3O 3X13A 4NO5B 3FO9B 3TCLA 3S4SA 3UTOA 5EZJB 1G9ML 1DLFL 2BVOB 2C4XA 1CFSB 2N4IA 1DQDH 4HLJA 3WUWA 1I3GL 4L29B 1C7TA 4NM4H 6FABH 4EN3A 1MFDL 3X17A 3ZTJG 1NGYA 5E8OB 1D5ZA 1IC4L 5BV7L 4JO3L 1RPQA 3C5ZB 4QTIH 5IB2A 3QPQC 2VXVL 5IK3A 2ATKA 3PGDA 1RJZB 4PJEE 3QCVH 3F12A 5JW4N 4S1RH 3NGBB 1RZKC 2DS4A 5C0ND 2YEZB 4FXGB 4F8TA 3KPPB 3TO4C 2UY7A 4G6FB 4TQEL 4JR9L 3TBWB 4Z76A 4JFDB 4BKLA 3RQ3A 1D6VL 5TDOA 1JYVA 3O3BB 1FE8L 1IC1A 1PQZB 2FBJL 5KANI 2YUWA 3MC0A 4GQPH 3BT2L 4JRYE 4TUJB 4WUUE 4IOIA 3OKMB 5EU6D 3FFCA 3EYVA 4NQUA 4YDJB 1ZLWK 1V3LA 2P24B 1F58L 4R90H 3INUH 5EUOB 2YKLL 3TM6A 1EJ6A 3L5XH 4KHXH 1ZLUK 3WFDH 4ZNCD 5FO9A 1PKQB 2VR5A 1ZTXH 3G6DH 3L3JA 4UNUA 5MI0B 3A6BH 2ZKHL 4L4TA 5MEND 3WEXA 3MFGB 4H20H 5E9DE 2JCCB 3HPLB 3NCFB 5JW4Q 1CYGA 4K3JH 5I0ZA 1FO0H 4JVPA 3HC4H 1A3LH 3J7HA 2IH1A 3SE4A 3HG1A 1INQA 3EJZC 5BRZB 3BKCH 4MD5B 3CLEL 3CPLA 2OTPA 4U1NA 1I8KB 4NQDB 1CLOH 3CZFA 5F3HB 3SDXA 1G7HB 3TVMD 4CU6A 3EO1A 4C54A 4MA7H 1GHFL 3WFBH 2XZQL 3FZUD 3BPCB 1XF3B 3S97C 2Y06L 1S8DA 4LLVB 2AQ2A 4M02A 1AXSB 3P9MA 5L2KA 1HI6B 5CEZH 2DLFL 4JFEA 3O4LE 3AVEA 2WWKT 4FFYL 4LVOC 4UT9L 4FZ8H 2EXYC 5EU3A 3V6ZA 4PUBL 1HYSC 3MLZL 5C6PB 4PJDA 1NGZB 1VDGA 4ZMAT 5L9DL 1T1WB 5F7EL 3QZWB 1A47A 1JPST 4R0LA 1U6AH 3MJGX 4CN4A 32C2B 1KC5H 3HFML 1YEFL 2VDMH 2XY2A 3D3VA 1QYGL 4M7JH 3I02A 4GS7C 4E5XB 1V5JA 3MBXH 4PRNA 2OZ4H 2P5WB 3WIFA 4MNQB 4U33A 3QWOA 4PGBA 2AJSL 3CVHA 3P4MA 1X5XA 1IBGL 1CGTA 5FYKU 4UQ2B 3MRPA 3MYJB 1MLCA 1KXVC 4P48A 3T77A 2D9CA 4PBVC 4I4WB 1HYRC 1CFQA 2DMKA 3QFJB 1X4XA 3D39D 3M1BB 3DXAA 4IM8A 3QUYA 5AWNL 2Q6WB 4ZXBA 3EYQC 3BXNB 5A3IC 3RWGB 3QHFH 4NC2B 3MRNA 4LEOA 1IAKB 1J0IA 2AV7B 3DMMD 1NFDA 4JHWH 4POUB 1EK3A 3GJFB 4LSVL 1CT8A 4Y16C 3L3HB 5IM7B 5IJKC 2EDOA 4F58L 1F6AA 2YSSA 2JIXA 5I8OL 4PJCA 4PG2A 4BELD 2Z93A 1U8MB 4OF5A 1QQDA 1TZIA 3AS3A 2VDOH 3LPFA 3FRPG 3VXTA 5ID1B 2AEQH 3EDDA 1G9NL 1S9KC 1T03L 1EAJA 1RZ7L 3MRLB 5JNYA 1T80A 2OL3L 4IMLA 4ZUTB 4JY4B 5E8EB 4CVXB 2ICWA 4LLUA 4FQHA 3P11L 2V7HA 4OV5B 5C3LD 1E4XI 2YD5A 4GMTL 3OXSB 3WLBA 4JQXA 4IRJD 4J6RL 4YFLF 1KCUL 2X09A 5GSRB 3WJLC 1FL3A 4K8RL 3RL2B 3ARDC 2QHLA 4FZEH 2Y36L 3BDBA 3VGBA 5D1QA 5J1SC 4TN9A 2IAMC 5DK2A 4ODHL 5IB3A 3HUJE 2H2PC 4ODVL 1OOAA 3SE3C 3PQYB 3LQAH 4HZLB 5HGHA 1X7QA 4O2EA 4HLZH 1OAQH 4NQSA 4D3CL 4FTVB 1XF4A 4JKLA 4BH7A 1UM5L 5DRWB 1U2HA 5FGSA 2C3WA 3BWUC 1SEQL 4FQCH 5FM5O 4XPAL 4DVRH 1XIWA 4E0RB 1FFRA 1TZGH 4TOYH 1N59A 5HI3D 5DA0B 2OTWB 1VFMA 4WHTB 3VWKA 3PGCB 1A1MA 4XBGB 3DUUB 3PP3H 1F6FB 4JFPB 4D94A 4GRLB 4PTTB 4XMKL 3MNVA 5HHNB 4M3KB 3MLXL 4KK6C 3GK8L 4ZFOA 4XNXH 5JUEL 5MENE 5FCUH 2DQHL 3UTZA 5KTEL 1U3HD 1AJ7L 5GRXG 4AEEA 2D2OA 5JOEA 4Z7QE 2EKSB 5F96L 2Y6SC 5F9JB 4G42B 3CC5A 5E00B 1MCPL 3EYOB 4P57B 2GTWA 43C9A 3E2HB 3JZ7A 1RULL 4H88L 5BQ7B 2JK5A 5AUMA 1INEL 3QB7C 4CL7A 1NUNB 2PXYA 1KBGL 2VSCA 5ABDE 4LPYA 3MRFB 1WITA 2ZCLH 1G0YR 4UAOC 4YHPB 3CXDL 2VL4A 2VL5B 1TQCC 1MJJB 4FQIH 1ZVSB 4NZJA 5BVJA 3TV3L 5DRXA 4N0UE 4UV7H 4NNXB 3ES6A 3LRGA 3GO1H 2D31A 5I8CA 4B0MM 2I25N 2O61B 4I5BA 4X6EA 4O5LL 2WWMD 1T6WA 1I1YA 1Q9KA 5T33L 3EW3B 5A16A 3N1QC 4F7MA 1ZEAH 1OAYL 4PRHB 3S35X 3TWCH 1YY8B 4PG9A 1JZ2A 5HHME 3HS0B 4XH2A 1AI1L 2ZUYA 3S3PA 1MAKA 1QKZL 4R2GC 3SDDC 3VXUB 4FMFA 3VH8G 1NCCH 4AH2B 4EOWL 4YHZH 2OQJB 4YHYC 4NO5A 2F9BT 1H3PH 5D7JB 1CDYA 4PJFF 3D39E 2NY3B 1OL0A 2A0LC 4D8PB 5B22A 2YMXH 2W9LA 5D71L 1CFSA 3VG9C 3SE9H 3UP1A 5KSAD 2O93L 3SKUD 4L29A 3B5GA 5H2BB 4EI6B 3LMJL 3WNNA 1ACYL 2F53A 1UH2A 4NT6B 3D2UD 1RJZA 3FTGA 3S35H 1BBJB 1HXYB 4NWTH 4R7NB 4Z18A 4PV9A 4O9HL 1W72H 1HZHH 2IFFL 2OP4H 3BQUA 2J4WL 1YEIL 2VC2L 3TBWA 4PJAB 3T0AA 3ARTA 3LEYL 1HDMA 4WEBH 2V2XA 2H2SC 5IFHL 3O3BA 4X7EC 1IQWH 5F8RC 3MRCA 4L3EB 1NC2B 4TUJA 3GRWL 3S96A 2JB5H 3IF1A 4Z7UE 5IHBA 1DN2A 3LV3B 1IM3A 4N0CC 4JCLA 1VADB 4YDJA 5DHVA 3NFPB 4Y19E 4UTBL 1RMFL 5E8PA 5D93C 5EDXA 1T7ZA 3TA3C 1HQ4A 1MJ7L 4DGYH 4YK4C 1EMTL 3V5KB 1XZ0A 2WUBL 3HPLA 4YHOL 3V0WL 2FECL 2OI9C 4ZYKA 2YN3A 1IILE 1S5IH 3BDYL 1G84A 1WZ1H 1I7ZB 4R96A 5IVXA 3CVIL 4NQXB 4MD5A 3CXHK 1MCDA 3HZMB 3KNBB 4PJXA 4MHHI 4I0PC 2IWGA 5DQJA 2Q86A 4UT7L 1BBDL 4MS8C 4XBPB 2X41A 1XF3A 3RVXD 5HDQL 3L5WB 3BKMH 2YD2A 4P4KC 1MCWW 3QUKB 1AXSA 2BJMH 2IPUK 3PL6D 2NY0D 1HI6A 1DQDL 4EUPB 3RL1B 4DCQB 5IBUG 2EDLA 5DDHB 3DX7A 4QO1A 4HJ0C 4Y1AA 5ENWB 5TE4H 1NEZG 2DD8H 1NGZA 3V2AR 2G9HA 1BP3B 5HYJD 1T1WA 3QZWA 5A43C 3B9KD 3QCVL 3WDIA 5I9QB 1U8QB 4J4PC 1PX3A 1V3KA 4XCNB 3ALWA 4AQ1B 1CICC 3WMSA 2P5WA 1CIUA 1Z9OA 4U1LB 4HUVB 5HD8D 3KLSA 4Q9CA 3OJVC 2J6EH 3MYJA 1K9TA 4C4KO 1U8HB 3F7VB 4I4WA 3MCKB 2NZ9D 2RGSA 2X6MA 3QFJA 5JOPE 3G6AA 2O5ZH 4PJ8D 3MRQB 1ZA3A 3OWEA 3AY4A 5JXAH 2DWDB 3F7QA 4FNLL 1AR2A 1MIMH 4U2ZA 4WI6A 4E41B 4D9QE 1QSFA 5FYKE 4NQED 1FV1B 3KXFD 4HS3B 4B53A 2ITDB 2EDQA 1VSCA 3L5XL 4KHXL 3WFDL 4CGTA 3C8KA 3L95B 3L3HA 4A6YH 4DKFH 1ZTXL 3G6DL 3ME0A 1QFUL 1KCVH 2AJVH 2NY2D 4P46A 3A6BL 3SKOB 4HDIB 3KLDA 1IVLA 3CFBB 1U8MA 4AIXA 3VI3E 3TIEB 2VISB 4Z7VE 5ID1A 1FO0L 3GSVA 1F00I 1LD9B 3V4VH 3MRLA 4LHUA 3BKCL 4GG6A 4U0RB 4K94H 5T5NG 4GBXA 3ZLQC 4NFBA 1CLOL 3IAGC 3OXSA 1NC4D 4MA7L 3WFBL 1X5GA 1PKOA 3I3DA 2JLLA 4MDIA 1FG2A 3RL2A 1YNKL 4NFDA 5BZDB 4JGUA 3B5HA 5IEKB 5C09A 1F45A 1AO7A 3BP5A 5CEZL 2D0GA 1SYVB 5LG1A 4HZLA 3F7RA 1A1NA 4PJ7E 4FTVA 4OZHE 4FZ8L 3I6KA 5EO1B 4XP9H 4LSUH 3QWRD 1J5OH 1IC5H 1EO7A 4Q9QL 1L7IL 3QQ9D 4M00A 4YZFF 4U7SA 5TDPB 1U6AL 4J1UA 1DE4A 5JORB 4OV6F 3RZCD 2VDML 2OTWA 3FONB 1OP3H 4O58H 5IBTH 2CR6A 4OB5H 4XBGA 3FCTB 5BMFH 3FT4A 2XN9A 3MBXL 3HLAB 4GRLA 4PTTA 4Z0BH 5HHNA 2N7AA 3TO4B 4Y0GA 4JFOB 5C0FB 3OR6B 2JKXA 5DMGC 4QRPD 2NPLX 2H1PL 2FEEL 3EYOA 3SGJC 3ZMRA 4P57A 3QHFL 4MNHA 3VFWA 4Z78B 3BP4A 5I17A 1VEOA 4JHWL 5CBAA 1F6LL 3ZT5A 2B1AL 3RGVA 4MJID 2CD0A 2Y1VA 1RURH 2ARWA 3U48A 2FBOJ 2VL5A 3UZVB 2EDBA 4MHHG 5E1AA 3OPZH 1BJMA 5FXCH 3Q5YA 2VDOL 5LBSH 4IJ3C 1G7LB 4X5LA 3DGGB 3GMNB 5DYOB 2DLGA 7FABH 3LN4B 1ZMYA 3EJJX 15C8H 1XGUA 4HFWA 5D7IE 3OGOE 1A4KB 1N5AB 5D7SH 1G6RB 4PRHA 5GGRY 4PJBF 1KCLA 3DUSB 3SGDI 2ZZUT 1IFHH 5HHOD 4FZEL 5CFHA 1NCNA 2X89A 1IGYB 4AH2A 2G60H 1V3JA 5HYEA 5JOFA 3LQAL 5HY9A 3LD8C 2G2RB 4MQTB 2VDLH 5T3XE 3QI9C 1BX2B 2VLKE 1XR9B 4PJHA 3PDDA 4LVOB 4WFFE 2X4NB 4LPCA 4PJEB 1N6UA 5E6IB 1TZGL 1GYAA 4TOYL 3ZE2E 4MCZA 1MHHB 2YPVH 1U8PA 3GFUA 5HDBE 4C56A 2Z31C 5M7QA 4OSUH 1OW0A 4EI6A 3GSNH 1JTOA 1VFUA 2BC4B 4HQQH 2WAHA 5DFVD 4NT6A 3VFPB 3WO4C 4HJGB 4LSRH 4CUCA 4CW1A 1MWAH 1BBJA 1HXYA 2Z92B 4JRYB 3K7UA 4GW1B 4WUUB 4XCFH 5FCUL 1H3XA 4QXTB 1JUFA 4M6AA 4UNVA 4OBRA 4TPRH 5JIHA 2VO5A 5C07E 4FABL 3G5ZB 4PJGB 3DBXB 3QH3B 2FH6A 2J8UF 2FX9H 1U92B 3GMQA 5DR5H 1NC2A 4OLXL 3Q6FA 1UM4H 5E70A 4JRXD 3LS5H 3KPNA 2X70A 3HE6B 3BEWB 5DJZB 4P23D 4Y16B 1CLYH 4WWKA 2XWJA 1YDPB 4JREB 4RAHA 4FQIL 3QIWD 1JPTH 4UV7L 5F93C 3GO1L 3KPQB 2V5MA 4PJ5D 3FB6B 2Y5TB 1U8JB 1ZEAL 3TWCL 2Y72A 3VGAB 3P77A 5TQ0L 5D2NE 5C0BD 2XA8H 4KMLB 1T1XB 5EB9A 1OAZH 5CMAA 4M43H 4P2QD 3ARDB 2Q76B 5D2LF 1NCCL 2V5RA 3O4LB 3UMTA 3EHBC 2IAMB 3SEPA 4YHZL 1Y0LA 2EXWC 2I60H 1AHWC 1H3PL 3VWKC 1XFPA 3L5WA 4C4KT 4UINL 2FGZA 3QUKA 2YMXL 3BMVA 5IHZB 3LRHA 2BHUA 2UYLB 3RL1A 4M1GH 5C0IA 1T4KA 2FO4B 5MERB 9CGTA 1A5FL 3EDEA 4NKDB 4XT1C 2NX5A 3FQXB 4OF3A 4PJXF 4HHAB 5EOCH 5DMJB 1WIOA 5BO1H 3S35L 1WBZB 3IJYA 4JDZB 1RQ5A 4NWTL 1U8QA 2ICES 3VW3L 4XCNA 1W72L 4OFKA 3WHXA 2A77H 2HJFB 1F3JA 2GJZA 1GOFA 4QWWD 4ZSOE 3V6OA 4R6UA 3BN9C 2OTUB 4C59B 2A6KB 4WEBL 1JHKH 2AXGB 1IQWL 2CLVA 3MCKA 3IDIA 1S7VB 2E6JA 2FJGA 5AD0B 1A7OH 3MRQA 1BQHA 2DQEH 4DEPC 3B9DA 4OZ4B 4DAGH 2DWDA 2C1OA 2JB5L 4R4FH 4E41A 2JJVA 2BSSA 4LHQB 1T04B 5HHOE 3L6FB 1AQDB 4UAOB 4M7ZB 1X5IA 4NSKA 1DFBL 1TQCB 3F5WA 3V4PL 2QTEA 3WCYA 5C9KA 3DGCR 1KJVA 1KB9J 1HQRB 3O4OC 2DF3A 2K7QA 3VWJB 4DGYL 3CFBA 3C60C 5D2NC 4X6CA 4OZGE 2XTJB 2VISA 3PHQB 1L6ZA 4M62H 2WW8A 4PRAA 4YGVA 4ZUWB 4HIJA 2DYPA 4PPTA 1WZ1L 3PF2A 5DD5L 4NRXA 1TCRB 3BJLA 3HUJB 3M17A 1H0DA 2R4SH 3G9AB 1DVFC 4OF8A 3DETC 4XPTH 4X99B 3SDDB 2W0LA 3F58H 2AK4A 4HT1H 1P7HL 2DBJA 3JUYA 1VFAB 3K8LA 3DSNA 5ACLA 2Y23A 4YHYB 1NGPH 3BKML 3ZDZE 5IEKA 4GG8B 2BJML 2AGJH 3P40A 4RA0C 1OF2A 1P6FA 5TE4L 3RWEA 1KIRA 4UDTA 2DD8L 4EDWL 5DLML 3DI2B 4GG6F 3D85A 1UADC 3L7FB 5TDPA 4Q2ZB 3O2DA 4GW4A 4M5ZH 5EO0A 4X5XB 2DTSA 4KK5D 5JPMB 4P3WA 1GSMA 5JA9A 3FCTA 4PLOB 1FIGL 3TH4T 5JHDE 3HLAA 4YBQD 3GSQA 4UU9A 4JFFD 1CFNB 1T3FA 5FOJA 1C12A 2J6EL 1D5MB 3RDTC 5KVEH 1RZIB 1RVFL 4PJ5E 2VMFA 3OR6A 5C0FA 4X6BB 2O5ZL 1DQQB 2APWA 5DGQA 3I50H 5JXAL 1EJOH 3C5SA 5BXFA 1MIML 4QRUB 2GJ6E 1C7SA 5EZLB 5I1IL 2P49B 2CDGB 3SCMC 4P2QE 1U95B 4N0UB 5E8NB 4AENA 2MQCA 4X4MA 4X9IA 1K5NA 3CXHJ 4JHBA 4A6YL 3TESA 4DKFL 4KJWC 4URTB 1U8IB 1T0NB 2AJVL 3TA3B 3ESVF 5EH1A 2SEBA 4ONFH 2AAVA 2AJZA 5EOTB 3M07A 5HHMB 3VFRB 5J06A 1G7LA 3DGGA 3GMNA 3J8F7 4KHTH 2E8YA 4RAVB 5ESQB 1YYMH 2OI9B 1FFNA 4PD4K 3V4VL 1NFKA 4WTZG 3MGTA 3B2VH 1RJLB 1KGCD 5D5MF 4PYHA 3PIQB 2KDGA 1G6RA 2GSGA 4O02H 4PLKD 5K59E 3BZ4B 4POZD 2NY6C 4I0PB 3EZ8A 3WS3A 1DBAH 5B3JF 3NCBB 1EAPB 4JM2F 1D5BB 2NY1C 2F74B 4NJ9H 1ZT7A 3DIFB 1B0WA 2HLAB 5HI4C 1ZVYA 3VD9A 4P4KB 3MV7D 3RVTD 2YD9A 4MXVE 2XY1A 4WCYH 1TNMA 4PREA 3UCRA 2J7LA 1FNGB 3C6LA 5I1LB 4LSUL 3MRHB 1J5OL 2APFA 3VXME 4PJEA 1CGYA 3TZVB 3U79A 5FOBA 3VFOA 1MHHA 4CADA 4M61B 3T0XA 4O58L 5DRZB 5IBTL 4OB5L 1QLFB 4PFEA 5FA3B 3UROR 2IJ0C 3VXPA 1V8HA 5BMFL 4Z0BL 1T0MB 1FN4B 2UY6A 4OD1H 2XZCH 4IOFC 2Q7NA 3CNKA 1M05B 4DN3H 4JRYA 4HIEA 3ULUF 2Z35B 4NQTA 5C0JB 3CFCL 4WUUA 1WWBX 4Z7WE 1XGQB 4XNZC 1IGJB 5IW3A 4X6DE 3W2DH 3DBXA 2ZCHH 3QH3A 3OJMB 5BS0B 3IJSA 1E27B 3MOQA 3JWDC 4ONOA 4HMEA 2CUMA 3MV8E 1RURL 8CGTA 4NBZB 4Y16A 5CINH 5IJKA 1QUNA 5E9DA 2Q7YA 3KPOB 4MNGB 1YDPA 4M8VA 4W4OC 4GKNB 3OPZL 4NWUH 1ZLVK 3C08L 3G6JE 3LB6C 3NCJL 4PJBB 5LBSL 2RR3A 5E08H 2FO1A 5ACMA 4G8GB 3VFGL 2J8OA 1IAOB 4WWID 4KV5E 1S5HA 4XNMB 15C8L 3GI9H 2Y5TA 4Y4KD 2HFFA 4PTUA 1U8JA 4MAYC 3QHZH 5D7SL 2ZUWA 4DGIH 5KVFL 4KTDH 4P2OD 4LIQE 4Y5YC 1DL7H 1U8KB 4HUWB 2R2CA 3H3KA 5CIPB 1T1ZB 2HLFD 4WW2C 3WJLA 3ARDA 2Q76A 4AT6B 1QBMH 3O4LA 4ODSH 4WI8A 2G60L 2IAMA 4PBWD 3TN0A 1ED3A 4BK5A 2NLJB 4MA8H 2VDLL 1J1OH 3SE3A 4KZDH 1DCLA 4IMKC 3HZYB 4L9LC 1WGOA 4JZOA 4NBXB 5DRNB 4O2CB 5DVKA 5KZCD 2OLDA 1PSKH 4G6MH 5IB1B 1PZUB 2UYLA 2QSCH 5B38G 2YPVL 1NMAL 1UT9A 2ESVB 3GBMH 1GGCL 4HG4K 1MIEH 4M1DH 3NFSH 4NKDA 5GJTL 1QSEB 3ZO0A 3KPLB 1PY9A 3QO0B 4K7PX 3D25B 4HHAA 2HT4D 2JF1A 4LSRL 1WBZA 4JDZA 1MWAL 5J0BA 2V2WA 1FORH 3ARFD 3L3DB 4MZ2A 5CEXA 2H32A 3CFKB 3KPRD 4TPRL 3EOBA 2P8MB 2BRRH 2ORBL 3BRFA 5C0GA 4D9RE 3QDGD 5F1NB 2AJYH 2OK0L 1QG3A 2AXGA 1AKJD 1D5IH 4LSTH 5DR5L 1JHLH 1UM6H 4OZ4A 3X3GL 4DTGL 1CDGA 1UM4L 4ZFFA 3MNZB 1T2JA 4HV8B 1A9BB 1BGXH 3BIAX 5DJ0B 2I24N 4FN0A 3ZL4H 1VEPA 4Z7VB 1OCWH 3T4AA 3UX9B 4NQVA 1B88A 3WIHH 5DUBB 2BFVL 1T89C 3FB5B 4XPFH 2Q20A 2EE2A 4K7PH 4IJ3B 4RAUB 4ZAKB 3BFOA 2C3VB 4L1HA 3FO2A 5EBMB 1UKQA 4HD9A 1KUMA 3PHQA 4TVPL 5D2LB 1T20B 2DMCA 5C7XH 4GRWF 2B20A 3S4SG 4ZUWA 4RDQG 1G7JB 5ICZB 4YHKH 1S7TA 1I1RA 5GS1B 1Z2KA 1TCRA 1IGMH 3S5LB 1OAZL 3RUGB 3WUWG 3MLRH 1T22A 4XRCB 4P3CH 4YDLC 1IGFH 4OZHB 2A83B 1VFAA 5DS8A 2VABB 4X6FB 4HWZA 3UYPA 5CCKH 5GZOD 2BOBB 2DI9A 3QI9B 1SBSH 5EBWB 3S98A 4GG8A 1N0XL 4OQTA 1YUHB 4M1GL 4CN1A 3EYUH 4PLJD 3JV6B 2Z31B 3O9WD 4CVZA 3MREB 5IMOB 3L7FA 5CGMA 3KPTA 5MENA 4DW2L 5EOCL 1NCUA 3WO4B 4QHUA 1N2RA 4X5XA 4EVNA 1UENA 4QY8B 5GGSY 3U46A 5C0CD 2DQIH 1J8HD 3OG6B 4GXUM 4XBEH 4BZ2H 4Y5VA 3MV9D 2ZCKH 1CFNA 2ATPB 1SVCP 1D5MA 4DJMA 4OGAD 1D3CA 4XTRD 1JHKL 1OM3L 1A7OL 2DQEL 5F89B 3X3FL 3ULVE 3S6CA 1L0QA 1ZANL 2QEJA 2DL9A 4TSAH 1S78C 2R1YA 3H9ZA 4TTGA 4N0UA 1L7TH 2BY3A 1FQ9C 1R3IL 1X5AA 4XWOD 4DOHE 3BZEA 4PB0L 4HWEH 1X44A 5IIEB 1T0NA 3DX6A 3TA3A 3GMLA 1HHKA 3D69A 3BUYB 1OTTD 5JDSB 2HMID 1MCSA 3T8XB 4M62L 3SKNB 4RGND 1QPPA 3VFRA 4HGKC 4J3VA 5ESQA 4I2XE 3MLYH 4APQC 2R4SL 1PLGH 4F7EA 1JMZA 1FAKT 3BZ4A 3WYRA 3F58L 3D39A 2FX7H 2IBZY 3UTSB 2VLKB 5EIIA 1LEIB 1D5BA 1AHWB 1TZHB 3ILPA 1NGPL 4QF1B 4UQ3B 1MPAH 3VWKB 3DIFA 1OAXH 1YQVH 1EEZB 2AGJL 4O51A 1PBYA 4P4KA 2W38A 1A14H 5C86A 4OIAA 1E4KA 1KPVA 4JB9H 4FFWD 5I1LA 3GNML 4FG6D 1I1AD 2EIZB 3O11A 4M5ZL 5DRZA 3K2MC 1LO3H 5DK0B 5HYIA 1OWRM 4MMXC 1A7PL 1ZXQA 5C07B 2GHWB 2XNAB 4YXHL 1T0MA 2BY1A 1CICA 1T7VA 3LIZH 4NO0B 3ULVC 1FYHB 3VFTB 1HXMB 25C8H 1M05A 5KVEL 5C0JA 2ADJA 1Z0NA 2MKLC 5L2JB 5C08B 2BNRD 1BD2E 4Z7UA 1N5YL 2IQ9L 2O5YH 5F6HI 5AG9A 5IR1A 3U36B 1OQXA 1XGQA 4UUJA 1EJOL 4L4VD 4DEPB 1TTUA 4LAJH 1SVZA 3ARSA 4QHNA 5BZWB 2O26U 4Y19A 4OLYL 4LBEB 1FNFA 3BW9A 5EZOH 1T83C 3WV0A 4QKXB 4XP4H 3OKLA 4ZPVA 5T1DH 1CQKA 3VGDA 3O4OB 4GKNA 2AXFB 3BO8B 3DNKA 5ICXB 3UPRB 1HH6A 4EI5C 3C60B 3FT2B 5D2NB 3NIGE 3QQ4A 3RU8H 2IQAB 4KHTL 4OFYD 4PY8J 1YYML 4XI5D 3B2VL 1R6VA 3PDGA 2D3VA 1W0YT 2L0DA 4WI5A 3VXSB 5GS0C 3SOBH 2D4FA 1CDJA 5ADPH 4O02L 1DVFB 1DBAL 2ZUUA 4LGPB 2YUXA 1T1ZA 5C0CE 3CFJA 4NJ9L 1J8HE 5EWIH 3MV9E 4F3FA 1GOGA 4J3OC 3BEVA 3E6HB 3ECBB 4WCYL 1L4IA 2BNQD 4ORGB 4L8CA 3H2WA 3D9AH 2YZ1A 5EC1A 2DDQH 3TPUB 2PO6D 5F7UA 4N90E 4QRSB 4Y4FD 1RZFH 3SJVE 3SDCB 1P69B 4Q9RL 1ZLWH 1NLBL 5J6HB 2QJDA 4ZSOB 4RISL 1ZLUH 5DI8B 3IXTA 3QO0A 1DBMH 3O41B 4GUPB 4U1SB 3VI4E 4OD1L 3GSRB 1EHXA 4BSVA 5T1KA 5DF0A 3FMGH 3L3DA 1H15B 2PETA 3JVGC 1CGSL 1EXUA 2C7UB 3F6LA 1UJ3C 1C5DA 2CUIA 3PV6A 1WWCA 5T1LD 2ZCHL 3BP6A 4M9OA 2ZWLT 4FQ2H 1CDBA 3SGJA 4D0CA 3SCMB 5K9JL 3NMEA 4HV8A 1A9BA 1MCHA 5C0AD 4M7LT 4V2BA 4F33B 1V3MA 2FL5A 5CINL 1R3LA 1RUPH 3T3ME 1NPUA 3OMZA 2WV3A 4Z7VA 4R8WL 4NWUL 3V7AG 3TYGL 5C0EB 3FB5A 4UDUA 4X83A 3JUZA 1DEDA 2DQUH 2C3VA 5E2TL 1YEJH 4P0DA 5EBMA 3V7MA 3D2UA 3GI9L 3ARRA 1G9MC 3EOTH 1NLDH 3IDGA 5F72S 3QHZL 2W65B 3PWLB 4DGIL 2PYFA 2Q87A 5MHSE 5J1AB 1XF2B 5DHVH 3L5HA 5T5FH 1DL7L 4HKJB 2NY6B 3GSWA 4LCCC 4PGCB 3BGMB 3S5LA 3GJEA 1XAUA 1JZ4A 4PJ7A 5BV7C 4OLVH 4ODSL 4M1CC 1DR9A 2A83A 1CXLA 3GUTA 2GITB 2BNRE 5E6ZA 4KZDL 3DVNA 2UZIL 1OTSD 3QI9A 4OLWH 4U4BA 5BJTB 1YUHA 4G6ML 1PSKL 3HA0A 1WUNT 5AAMA 3RTQB 2CKBA 1B2WH 5C0DA 3GBML 1MREH 1MNUL 5FECA 3QDJD 1MIEL 2Z31A 4PJ9D 4X80L 4M1DL 2CRYA 3KPMA 5H94B 1N3NB 3LVEA 4KROD 1BFOB 5D72L 5ISZD 3H0TB 3GDBA 2N1KA 5JPNB 1FORL 2PTTA 4QY8A 5DEZA 4RMWA 4NQCE 3C6SB 1MCRA 1JGEB 2AVGA 1TMCB 2BRRL 1P4BL 5T1MA 2EEBA 4JKPH 2AJYL 4XNZB 1LE9B 4I3GA 3TYFB 1D5IL 4LSTL 1OT1A 5DJCA 3TBTA 2FJFA 2ZNXA 4RGOL 3UO1L 1BGXL 4KKCD 1CLCA 1RU9H 4U6HB 3ZL4L 2GEEA 3PJSB 3UC0H 3TT1L 1OCWL 3WIHL 3V79C 4GRWB 4KJPC 1S3KL 1TTFA 2W0FA 5D7IA 2BNQE 4XPFL 4K7PL 2H3NA 4RFEA 2VOTA 1MUJB 5D7LD 4ZS6C 3ZKQD 5CLWA 1AGCB 4M6MH 2FJHB 4ZOEA 1YMMD 3BPOC 4MAYB 2N7BA 1HK6A 5HYSA 3PWPD 4YHKL 5I1KL 5FUZL 1IGML 2A6DA 3G04B 3VA2C 1TVHB 4X4YA 5ICYA 4QLRA 1T5WB 3MLRL 5TE6H 4WW2B 3QHTC 5LWYL 4KUCF 2VLKA 1LEIA 3R0MA 3QZWG 1B3JA 1AHWA 1MRDL 4UQ3A 4P2RE 1SBSL 3IU3B 3IFLH 4KTEL 4ONGH 5KSBE 1A3QA 4S2SA 4RMSA 3V95A 1MFCH 3EYUL 1JIBA 5E99H 3ZE1E 4YNYB 4PP1D 3B3IB 5IEHB 2Q3ZA 2DTMH 4KK8C 1XCQB 4FFVD 1X6NA 2IG2H 4HFUH 5C0AE 3MACL 4Z7WB 4QRQB 4YHLH 3U1SH 1T66D 5DK0A 5EU5A 3AREC 2XNAA 1DANU 4X6DB 4BZ2L 4XBEL 2ZCKL 4OM1H 4YC2B 3VFTA 1ETZB 3KJ4C 7CGTA 5D6DC 5L2JA 4L9DA 4ODTH 1KJ2H 35C8H 2VDRH 4U31A 1T21B 2VDPH 3MV8B 3ULSA 2XA3A 5AEAA 4JE4B 3W0WE 1AY1H 5EFIA 5DHYA 3VD5A 4TSAL 2R2EA 1XF5A 3WD5H 5SX4I 1G0XA 1G9NC 2B5IB 3W5MA 5KN5B 4HSQA 5DJ6A 4D9LL 2P8LA 2IADA 4CRPA 2IPKB 4YH6A 1RK0B 3RNKA 3LKOA 2BCKB 4LHUG 4UB0H 4HWEL 4NKIL 3P4OA 3P9LA 1QR1A 3U82B 4QRRD 4OKVB 4YDVB 2NXYB 5FGRA 4K8RC 3HNVH 4HS6B 1ND0B 3FHQA 5IB5B 3BZDA 3QPXH 3DTXB 3FT2A 5IROC 1G7QB 1I1CA 1WFUA 5FYJH 4JO1H 1WBYB 1A1OA 1HHIA 3MLYL 5JIIA 2W1NA 4IHOB 1BIIB 4PGDA 5GGUB 4ZOBA 1Q9LB 4OAWA 4KRPC 3O45B 1U0QA 4K2UH 2FX7L 4YDLB 1MFAH 1QBBA 5I1CH 1S9VB 1TLKA 4YEFA 2PW2B 2C3HA 5B4MC 4XZUB 4KJYA 5F88A 1U58B 4CVUA 2Y9RT 3KYNB 3PWVB 1S7SB 3H42H 3B83A 3SY0A 2VN4A 4L4TD 5IMMA 4Z0XB 5GSVB 1A14L 3ECBA 1UACH 2MHAB 4S1QL 4ORGA 1IZJA 4JB9L 2DQDL 4Z6AT 3TBSB 3HG1D 1Y18B 3QXUA 4QRSA 5I15H 3U9UB 3QG6B 4ELME 5TH2B 1NMBH 3PE9A 4K3DH 4OFIA 2YUVA 3VXNB 5CUSL 1RHHB 4MD4A 4ZSOA 4U1KB 1W0WB 1F11B 3DV4A 5DI8A 1Z5LA 4TTDD 3EYSH 3O41A 3LIZL 4GUPA 1XR8B 3QYCA 4QT5B 4EIGB 5D7LE 3O3DB 3RDTA 2O5YL 3RVVD 43CAB 2C7UA 4WTXA 1X3DA 4JFED 4RWHA 1YMME 2VDKL 4XVJH 1FVDB 5HHOA 4RNRA 4P5MA 3QJHB 1TDQA 1UGNA 1LVEA 1YEKH 4IBLT 5HHPA 2VLRE 5TPWH 3SCMA 4JJHA 3D3VD 1VPOH 4XP4L 2HG5A 3MRDA 5FM5M 1U36A 4OZGA 5E5RB 1B0GB 3AS1A 1HN1A 1TETH 4KMQA 2W9EH 2RFXB 4QXGH 1B6UA 4WU7B 5C0EA 1GPOH 5CGYC 3RU8L 2KBGA 1X5HA 5HYQB 1EVTC 3FRPA 3QUYD 2X10A 3FKUS 4ZXBD 1WBXB 4O4YH 4WO4B 2I07A 3SOBL 2COQA 2W65A 5ADPL 5FF6A 1UQSB 2LU4A 2R8SH 3VA6A 4MB5A 2MJWA 5J1AA 4U2YA 3K2UL 3ZSTA 2DM2A 2DLIA 1BMGA 1R5VB 3BGMA 3PGFH 3ZKND 1UXWB 3VI3F 3EJYC 4X4ZA 5EWIL 1MH5B 2JIXD 4LLWA 1KLFA 3WE6B 2ARJQ 3IFPB 4L3AA 3IXAB 3D18A 2GITA 4AMKH 4IIQB 3JV5A 3L7EB 3VD7A 3D9AL 5BJTA 2DDQL 4NZTH 4Y5XC 3UPCA 4WI9A 1WF5A 1RZFL 5JHDA 5C2BL 4XHQA 1SMOA 2P1YA 5CJXC 4N1CA 1WQVT 1DLHB 3DVIA 4TSCH 1N3NA 4PJ5A 1AD9A 1BFOA 4PJ7F 2X9XA 3OKDA 2D7NA 4QRRE 5JPNA 1KTRL 3EO0B 2XXCB 3UTPE 2GJ6A 4OD2B 1JGEA 2FIKA 4N5UA 5TJWK 2X1QA 4FQ2L 2WIIB 4P2QA 4I0CC 3MZGB 3OHXB 1XIWD 4N0FB 3MRMA 1INDH 5FB8B 2ICEB 2F5AL 3BVNB 2G5RA 4JZJC 1XGRB 1FYTE 1SJEB 1G7IA 1YY9C 1RUPL 2KQNA 3FO1A 3QEHB 4JN1H 4Y4HB 3S36X 4NGHL 3E6FA 4W4OA 3SGKC 1M6OA 5E2WH 4EI5B 5L7XH 3GKWH 4PJIE 4ETQB 2DQUL 2FHCA 5GZNC 1YEJL 4TULL 1MUJA 2X5PA 1AD0A 1BZ7A 1IAIH 1ZT1B 5JXEC 3EOTL 2CGRH 1AGCA 2OR7A 2AQ3A 5DC4B 2FGWH 3MUGA 3MFFB 3U9PH 1P2CA 3C09C 5T5FL 5AZ2H 2PXYD 2NW2B 4Y5YA 5L88H 2XQBH 5JR1H 1TVHA 1IM9A 1FGVL 2EDDA 1F4HA 2ADIB 4WW2A 3P0VH 3WFEH 4OLVL 2I5YL 1IRAY 2X4UB 1T7YA 2L7UA 5DJDB 4Q7DA 3A67L 3IU4L 3EUUA 2XPGB 4XHJC 5D7IF 3VXMA 4JFZH 4M9PA 2XIDA 3VDAA 4IMKA 4JJ5A 3S36H 4L9LA 3K80A 3D0LB 4NIKB 2P46B 5L8JB 4YNYA 5EU6B 1MREL 1P5VA 4G6AC 1RJYA 2WSKA 4ZTPH 3VRJA 3B3IA 5IEHA 3EO9H 4LLQA 1NGXB 3BAEH 1FCCA 5DZNA 1JV5B 2R56H 1BD2B 3RPIB 5FYLD 1TTGA 1BQHG 1GZPA 1ZHBB 4Z7WA 1ZS8B 3TO2A 1FZOA 1UA6H 3PWJA 5CZKA 5INCB 3GMPA 1MCJA 3MGOB 4WEUD 4QCIB 4G6JH 2HT2C 4JKPL 3O8XC 3SQOH 3TH3T 4LLMB 1OGAE 1OP3K 1CE6A 4J8RB 1XGPB 1J1PH 3MCG1 1LP9E 4K71C 4DKEL 1HHJA 2LABA 3EAKA 3MV8A 3WXVH 3UDWC 2GUOA 5GRJL 4MQXC 3O2DH 2J5LC 2A73B 3MNWB 3F8UB 4NUJB 4ZQKA 3LEVH 2F53D 4FQJH 3C5ZD 1RU9L 5SV3A 4FXLA 2AXHA 3G6JA 1MEXL 5HHQA 1CTNA 3DVFA 4R3SB 4HXBH 2IPKA 1QZ1A 3RKDD 2HH0H 5FGBC 1RK0A 1W0VB 1ADQH 1BLNB 1T89A 1JPSH 3BQUD 5C92A 2YD6A 4YDVA 3KS0J 1S7RB 2YHGA 1Z0MA 3S37H 5IB5A 2OSLB 4M6ML 2A1WH 4Z8FH 3O3EB 5CSZB 1U9KA 1O7SA 2Z0BA 1H3TA 4GAJH 4WY7H 1NANH 1EFXA 2F5BL 1YNTB 1BIIA 3PP4H 1Q9LA 5J7CC 5TE6L 3O45A 3CUPB 1Z3GH 4PR5B 4K55A 1S9VA 2PW2A 4XZUA 5I8EB 1MQ8A 1U58A 4OTXL 4P3DA 5J6GB 1S7SA 1J0KA 3FAXA 1N8ZB 3HR6A 4H25B 3IFLL 4Z0XA 4ONGL 3LKSB 1RZ8A 4I3RH 5E8DH 5J13C 2MHAA 1MFCL 2B2XH 5E99L 3RWJB 2QADC 4MDJB 1GZQB 4YHIB 3LCYA 4B50A 1Y18A 5BRZD 3U9UA 2MFNA 3BHBA 4HFUL 3NZHH 2FLBT 1CL7I 3PWNB 4YHLL 3VXNA 4J23A 5FUCE 3QAZC 3QWQB 3ZTNH 4YX2H 3MRJA 1O0VA 1ORQB 2A6JA 1AIFB 4L8SC 3MZTA 4RMQA 1F11A 1KTLA 3V0VB 1X5YA 1ZT4A 1TPXC 1YNLH 3STLA 2EDFA 2BMKA 3SKMB 1NDGB 4JFXB 2VQTA 2G5BB 4QT5A 3TBYA 4AEHH 3JXAA 4ODTL 1KJ2L 2EDTA 4MXQC 1QFWH 43CAA 3QUZC 1P4IH 2NY4D 1WZLA 4Y1AD 3H9SE 5JMRA 1HINH 5FA4A 1AY1L 3WSQH 4FFZL