3EJZC

Structure of e203v mutant e.coli cl-/h+ exchanger, clc-ec1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
b'VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Intracellular proton-transfer mutants in a CLC Cl-/H+ exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system/proton transport
total genus 40
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejzC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejzC01
2AEQH 5T3XD 4P2RB 1NBZA 5A2FA 2XPGA 1FZOA 1IAKB 2NY5C 1ZLUH 5F9JA 1FLRL 4E41B 3L7EA 1GHFL 3WHE0 3DARA 1LDPH 4JKPH 1HKLL 3L3KB 3KVQA 1B4JL 3MA9L 4MHHG 3VDCA 3S9DB 3PE9A 4HUVB 1K8IA 1R3IH 1INEL 3D9AH 4WJ5B 1DQLH 1UZ8B 4PUBH 5BZWA 1RFDL 3DUUB 3DV4A 3L3JA 4ETQB 5KSAC 2RGSA 3T1FA 1KPVA 1UH4A 5DFVD 1U8HA 1DSFL 1PSKH 4OLVL 5MP6L 3PABA 3HG1A 3T3MF 1IKFL 2F5BL 4MAYA 1G7PB 3JBG7 5D1ZB 1DBKH 3BPLB 3CVHL 4XVJH 4XXCA 5JQ6L 3MV8E 1DFBL 4Y2DB 1ZTXH 3WXWH 4JG1L 5EPMB 1S9YA 5DMJB 1URLA 2N7AA 1ZS8B 1EERB 5IV2B 5ADPL 2YUVA 3H8NA 3RTQB 5IB4B 4I4WB 4X5WA 5DHVB 5D7LB 2VIRA 1XF3B 2NTFA 1DLFH 1ZANL 4ODBD 1FV1A 1FYTA 1MLBB 3S4SG 2CK0L 2VLLB 1ES0B 3KPQB 5E8EA 5EDXA 2F74B 4Q6YA 3VGBA 1P6AB 2Y72A 1I8LA 1J05B 1KACB 2UY7A 2XQBL 4HJGA 1F6AA 4DKEL 3F7VA 2F54E 3U7YH 2CKNA 5ESQA 4UINL 4HXBL 4L4JA 3ZHKA 5IMOB 4LPCA 3C8KA 4M8QB 1DEDA 4JO4H 1O5DT 3UTPE 3OHXB 3I50H 3UJIL 1I85C 4HK3N 1N59A 4CMHC 4YE4H 5ITBH 1WT5A 1EBAA 2BP3A 3FB8B 3KGRA 4HIJA 1UWXH 4R2GB 2DDQH 2P8LB 4F33B 1NANH 3FB7A 3PGDA 3SJVD 3RX8A 3BN3B 5SWSE 5M7QA 1BQSA 4KC3B 1LP9E 3BKCH 3L3OB 1E28A 1W0WA 5IK3B 4IIQC 1AC6A 3RBSA 1S78C 1N64H 3BP4A 4AIOA 3BIBX 2NW2A 5AZ2H 1HHIA 4GG8A 5D7JB 3QZWB 3HC4L 3JWOC 2E9WA 2HKHH 1FN4B 4XPGH 5J6GB 4NQXB 4WI7A 4LPUA 2E7LC 3H7BA 1HQRA 4Q0XH 2XWBA 3QWOA 2FX9H 1BD2D 3ARSA 3KXFE 2W91A 5INCA 1KIUA 3MRPB 5HGGS 2KKQA 2O5XL 3KHOA 4MA8L 4NNPL 5CHNB 2E9JA 3MRMB 4DAGH 1XGTB 2VKXA 1H3UA 1NBVH 4K9EL 2EEBA 1NCAH 4FQ2L 3NIGF 3AAZA 2X09A 2B1AL 3LS4H 1XH3A 3MV9E 4N0RA 4N68A 2P8MB 3QYCA 4Z7QE 1FAIL 4J1UA 3D3VE 3S37L 1IMHC 1C5CH 1MQKH 3CU1A 1K85A 1PX4A 3MV7B 3KPOB 5CJ8A 5IVXA 1N3NA 3VH8A 2JIXD 5A1AA 1FG9C 4U05A 4X4YA 4KGJA 3HB3D 3U9PL 4P2CG 4YWGH 4W6YB 4PJEE 5AYQA 3T65B 5EU4A 2GAZA 5HHVL 4K07A 1NGQL 5GRUL 3O0RH 5DJYB 1TZHB 3VI4F 4XWGL 4GG6A 3L5JA 1LNUB 2UV3A 5HDLA 4RIRA 1MIEL 2HWZH 1GGIL 4UUJB 2IANE 1CGUA 2A6DB 1GGBL 4J3SA 4G8FB 4TUKH 4OT1L 2NX5D 4HBCH 3W11D 1G7LA 5CEZH 1XF1A 5DJ2B 5L2JA 4PBWD 1A6WH 3MV8B 1OQOA 2GSGA 5FGCE 1FGNL 2W9EL 4YHKL 4M7LH 4OFYD 3GHEH 5FO9A 1I8KB 3T8XB 1RK0B 3O6KH 4HIHB 4KKAC 1HILB 4F7MB 5KW9L 4OKDA 1NC2D 3FO1B 3P4NB 1IBGL 2DWEB 4KRLB 1JN6B 3Q5TA 2DI8A 1NGYB 3JV4A 4LQ1A 4PJDA 5I66A 1OP9A 1JNHB 1YNLL 2DJSA 1RQ5A 2YSSA 3ABZA 5GRJL 1J87A 4XC3L 1A1MB 3ZL4H 5MEPB 4G9FA 1J0ZA 2R0KL 4NQDA 2RQ8A 3KR3L 1J9CT 2FNBA 2P5ED 3AUVA 1YEHH 5GGSY 2DYPA 2F8VA 1YQ2A 2YD2A 4HWBL 2Z4QB 4XNZB 5KVDH 1J10A 4R0LA 4D8PB 4HD9A 4PG9B 5C0FB 3GB7B 2YR3A 2X4TB 4K94H 2FX7L 1CQYA 4LCWE 4OD3H 3T3PE 4LHUD 5ANME 4HV8B 4RAHA 2R2EB 1QBMH 5T33L 3CFEB 1R3HA 1MI5D 2RAMA 3VXRD 3QEUA 1T3FA 5DRWB 3UPCA 1NGZA 5DGRA 4OD1H 1RUAH 4G7VH 1OCWH 2GQHA 4P48A 1M7DB 5JUEL 1J0KA 1A9EA 3CXHJ 4UIKL 3C5SB 3SJVB 3T0WA 2UWEA 1YN6B 5EBWB 3SKJL 2RBLA 5I76B 2ZSWB 2V5SA 1AO7E 4MXQC 5DHXB 5DD0H 2UUDK 3K0WA 5C0CA 4I18C 4M7KL 2IADB 1QKZL 5FGSA 1N6UA 3PIQB 3ROLB 4AEHH 3ZE0F 3KS0J 5DJCB 1CD0A 3TNMB 4R26L 4OLXL 1NLDH 1YEJH 3O6FD 2BXYA 1MJ7H 1OLLA 1BD2B 4NN5C 4FQCH 5KSBF 2H9GB 3NFPA 4YAQB 5C0AA 3RIFK 2GJJA 2OR9H 2W0KA 2WSKA 4YBQD 3KPTA 4GKNB 1XT5A 1FNHA 2WBJD 3RGVD 4PJ8D 3EDKA 5DMIH 3IS0X 4WHYH 5IB5A 1L0YA 1Z0NA 3CPLA 4XP4L 4M61B 4PGZA 2F9BT 5F9AC 5J9PB 4Y16A 3WJLC 5J06A 4YHZL 3C5ZC 5FHBL 3FT4B 3W39A 4ZUSB 3U0WH 1A1OB 1DLHA 3QBTB 3OL2A 4FXKA 3QDHA 3KPSE 3D2UA 5ALCL 1Q72L 3C9NA 3UBXI 4OKVA 2IGFL 3QQ9D 5HHPA 3C6LA 5ITFA 1U41A 2OK0H 4CN4A 3TJHD 1T6WA 1TETH 5I75C 4N0UE 1KNOA 5JXEA 4G6JH 2NW3A 4X7TB 3O3DA 1IE5A 1NMBL 2VOTA 3V5DA 1AR1D 4N0YL 1AFVH 3GSVA 5HHNB 4E9LA 2P8PA 3CNKA 5BJTB 4D0CA 4I5BB 1MCOL 2GITA 1QA9A 2E7MA 1Y6KR 4RGNC 3HCVA 5TF1H 1A5FH 5E03A 5DGQA 1CLZH 5HHOD 4MD5A 3MQIA 1FG2B 3W0WE 4WWKC 4I3RH 3G08A 3HI6H 1LO0H 1L7TL 5ACZB 3P77B 3RL1A 2OLDA 3WKNA 5BZDB 1XIWB 3LB6C 3NN8A 2RFXA 1NC2B 4KDTA 1F3DH 3K1DA 5F89B 3T4AA 4U2YA 2P44B 3MCKB 3GSWA 4LL9A 5DMKA 3WIHA 3UTZA 3D48R 4EUPA 3NA9H 4L3ED 3MMEA 2R2HA 4KGLA 3QDME 4X7EC 1UACH 4X7SL 3HZKA 1GGUA 3O9WD 4LCWB 3WHXB 5D70H 3T04D 5ANMB 5D1QD 4OB5L 2P49B 2P5EB 3QO0A 3UTQA 4M6MH 2AJSH 2FO4A 4HPYH 1NFDA 2Y23A 3MNVA 4Q9RH 4HX1A 1QNZL 4NQEA 4XNUH 3V4UH 1TTUA 1OAYH 4HDIA 2X4UB 2ITDB 4LHUB 2AQ3A 1A4KA 1VACB 4RFEB 3SGKA 2WLYA 1S7RA 3P73B 3O3EB 1SQ2N 4HF5L 5BVPL 3JWOH 1MI5B 3VXRB 2NY4C 5D71H 3SCMD 3GI8L 3LEXA 3RZCD 2BDNL 2VDLH 4F7TB 1J1XH 3KLAA 1QLRB 3BPOB 5AD0B 4JZNA 2D3VA 1DQTA 4RSVA 4QRUB 2IFFH 4UQ2A 4JKWA 4AEIL 5D5ME 4EEEA 1FL6B 4HWUA 2WINB 5ALBH 3CZFB 1DP0A 1Q38A 3WLWD 4I77L 3O2VH 1KELH 3ALPA 4LNVA 5J4MA 1QFWL 3ARDA 4LPXA 3WN5C 4PJFA 4C55A 2VXSH 3X3GL 1P53A 5EU3A 3RZWA 5IT2H 2HT2D 3I9GH 4MNGE 1CICA 3QIBA 5J12B 1T5XA 1ORQB 4HW6A 5I1EH 4ZFFA 4R90H 3MRQB 3O6FB 4M62H 3MRDA 4QXGL 3G6AA 1II4E 2GY5A 5HHXH 5GGQL 3X11A 2EO9A 3QWRD 5F93C 4RBPK 1MFDH 4HHAA 2AQ2A 4WI6A 4DEPB 1EFQA 3MRFA 2BNQE 4L5FL 5IFJA 4JJ5A 2WBJB 1IZJA 4OCRH 2AJVH 4JPVH 5E8PA 2JB6A 4PJ8B 3CVIL 1WISA 3MACL 4NM8L 1GPOH 5DO2C 3IFNL 3MROB 1A1NB 2Q20A 1TIUA 4MMXC 1BZ9A 4NC1E 4XVSH 5E2TL 1E6OL 3D18B 2HN7B 1C1EH 3E6FB 3GM8A 1F11B 1T03L 5EZOL 2R2BB 4NPYA 2V17H 5LXGH 3B3IB 5I1IH 4GQ9H 4LVOB 4NQCA 4ZO6A 4OLEA 2MHAA 2DN7A 2DKMA 4P9MH 4WHYG 1U8LB 2VABA 4H0HB 5IMLB 3EYSL 4QRPA 5LBSH 3R4DA 3WO4C 1JHKL 1KTKE 1BVZA 1IZKA 4G3YH 4U1HB 1O7VA 2Y36H 4QXTA 4MD0A 5GIRA 3F12B 3MFFB 4JN2B 5C0GA 1AD9B 4XVTH 5BCAA 3VXUE 3X13A 2NY1D 3C09B 4NQUA 2A6IB 1P84K 4KVCL 2VNCA 4LPTA 4S10A 3EYFA 2ENYA 2M1KA 3E8UL 5HHOB 2EDFA 2BHZA 2X4RA 3Q5OA 3I75B 4OZGA 2XA8L 4QHLB 5D2LB 5D72L 1NAKH 3SDYH 2AV7A 4OD2B 2GJZB 1NJ9B 2DBLH 4JG0L 1WWAX 4PY7A 3U79A 4PJCF 1QR4A 1CFNB 1TZGH 2QQKL 1ONQB 3PXHA 5IW1A 4XBEL 4URTB 4P5KB 5DVKA 1OP5K 4FA8A 2IH1B 4ZS6D 4NRXB 4Z7OE 3ZKND 3EYQD 4YHLH 3ZDYE 4GRMB 4KXZI 1FNGA 4MA7L 4Z0XB 2VLKA 2YMXH 5HGDA 4P3DB 1MFAL 4L3EB 1RU9H 1WZ1H 2IQ9H 5T3ZD 4GKSB 3LV3B 1WBZA 3VRJA 5FDWA 3O9WB 3QUML 3DVNB 2BVQB 2I26N 1ZT4B 2J8OA 2X05A 3S36L 1IC4H 5D1QB 5EOCL 1BEYH 3MNWB 3KYMB 4WFGD 1B0RA 5DRZA 3S3JA 4KK5C 3HI1A 4DK3A 3F5WA 2MSPA 1JNNH 5I1GH 1U93A 3SE4C 25C8L 5GRVK 2X4OB 3RIFF 4U2ZA 3FO2B 5DUPL 1TJHL 2LVCA 2JCCF 4CMMA 3IF1A 3ULVF 4KDWA 3TBYA 3VXTB 3L9RA 5IQ7L 4ONFL 5IB1B 3BRFA 4XCCH 3VGHA 4QT5B 1P4LA 5T5NG 3TO4D 3O3BB 3QUZC 2DTML 3TIDA 4FFVD 3SCMB 2BNUA 3RZCB 4WTWA 1H8SA 1L4IA 1H5BA 1ZHKB 2HJFA 3FHAA 4WHTA 1MF2H 1P84J 4D0DB 3QEGL 2NR6C 1MY7A 2IBGA 4BQCA 4I0KA 4PJAE 4X6BB 5JORA 5GJSH 1FPTH 3L1OH 2DOCA 1QSEA 1D9KA 5FYJU 5C08D 1Z2KA 4IDJH 4CAGA 4NUGL 4AL8H 4PRDB 2VZOA 5J57B 5C0RL 2VXTH 1Q0XL 4PLKD 5BV7L 4LRNL 3N1GC 2DQJH 5GRZA 1G9MC 4UT9H 4HWNA 3KNBB 3WUZA 1UA6H 5LCVL 4IRSA 5AZEL 3BXNA 5I1LB 5IR1B 4ELMA 3LQAH 2OL3L 3OJVC 4I9WD 3PG2A 3OJDA 2UZIH 1ZVSB 4X6CA 2CIKA 3BEVB 1UT9A 1UH3A 3KS0H 2IAMD 2NY7L 5F6HI 4H26B 1NCBL 3IU3B 5IBTH 1T1YA 2I25N 4N8CL 4ZFZA 3O2DH 1PKQA 3QO1B 4BSWA 4HKBA 1MIMH 2EDLA 4PGEA 3HMWL 4Y5XB 4M4PA 4MQXC 4FQXA 4KI5D 5BRZD 4J3TA 1BMGA 4KJWC 4P46D 3HUJE 4ZTOH 5C6WH 5DXWA 2R0WH 4LLDB 5ICXB 1T2XA 4V1DE 1RZJL 4PJBB 3K74B 4LHQB 4U7MA 4LCYA 4OF6A 3F7PC 2NY1B 3CLFL 4OGAC 1MEXH 3V4PH 2FSEB 1GGCL 1IKNC 2F5AH 3PGFH 2AJ3A 3O4LA 3O8XC 3A6BL 4HC1H 4YHOL 5JHLH 5CEYA 5ETUA 2AABL 1R5VB 3AU1B 1AXTH 4QYOA 1N7ML 4RA3A 5D1ZC 3BPLC 4Y2DC 2ARJB 1CFVL 2D7OA 1G6RB 5B4MC 2F8XC 1F2XK 1BQHA 4KUCF 3U4EB 4W4OC 1HK6A 3N1PC 2WP3T 4JANB 4QRRA 1JFQL 4IRZL 4HC1L 3BUYA 2E9IA 3IJHB 1EJOH 3L6FA 3AS3A 3H9ZA 3JTSA 3CCHB 3MNZA 4JHWL 3ZE1E 4Z95L 4JM4L 4ZDHA 1FSKB 1AHWA 5GGTL 3OPZL 5D7SH 5GQBA 2AXFB 5B38B 3B4NA 2DM3A 3MXVL 4X9FA 2ADFH 4MJ6A 1OF2A 3IDIA 4XTRD 3UTSA 5LGJB 2FJHB 1QRNA 3CSYB 3QUXB 1P4IL 1Q94B 3SY0B 2R15A 4KY1L 1JTPA 2HJKA 3ZE2E 5HGAB 1JZ4A 3VXME 5E2VH 3PV6B 4KK8C 3TO4B 5E8NB 4PRID 1T89C 4NO0D 2EYRB 1DUYA 3RVVC 4L4TE 1F8TL 3AM8A 3MYZA 3EO9H 4R2GC 4D0BB 1C7TA 1XF4B 4PP2B 3WFCH 1RURH 2DMBA 4YFLI 2HFEA 5B39G 3FQXB 5F7HA 5JPMA 3QI9A 3CFJB 4NYLB 2XTLA 5DJ6B 3FONA 1JF1A 4UDUB 5F7FA 2CJUL 4AIZA 3FO9B 1KLUB 4L8SB 4FFWC 4TYUA 4ZO7A 3WHE1 2Z35B 4IRJB 1CFQB 5C08B 1HH6A 1EGJH 3BN9D 3JUZA 4HIIA 2ICEA 3REWA 3JSSA 2AKRB 3V5KB 4CJ0A 2OTPA 1MLCB 3B9VA 4LCIH 3TBWB 4QOKE 1JMXA 2WQRA 2FWOB 1QYGH 3D0VB 4MD4B 3MLUH 5DK0A 4OI7A 3GMQA 5C6PB 3OKMB 3G6JE 2OQJB 2IAMB 5J3HD 4JRXD 1CVSC 1B4RA 4C83A 1UVQA 5HI5D 3NZ8A 5KS9F 3MRCB 1B0WA 3HUJB 3LKPA 3QJHB 1FZMB 4V1DB 1T66C 4JFEE 4ZS7L 3J8F7 4M6OL 5EO1B 4GQPH 3IXTA 4K7FA 5BRZB 5CD5D 2W0PA 2C7UA 4P46B 3AMKA 4ORZC 4MB4A 4YHMH 5IB2B 3QA3A 5EO0A 1AQKH 4NZRL 3MLSL 3AXLB 3BRDA 3PWUA 1YZZA 3HHRB 4WO4A 2CKBH 4ZFGH 3ZKMC 3TCLB 3MO1B 3BUTA 2WUBH 1VA9A 2G75B 1AE6H 2OP4L 4LKCA 3WDIA 5IMMA 1OAQL 3HG1D 1IARB 4MAYD 5CLTA 4AEEA 2GK0B 5DFVC 3X12B 1JF5A 1PDKA 4BJLA 1I3RA 1IQWH 2ZG3A 3I3EA 4AMKH 4K9EC 1RIVH 2PXYA 1I8IA 5CCKH 4X6EA 1HEZA 5EUOF 1XAUA 2XKUA 4CGTA 4PRHA 4R7NA 5EBMB 2VDPL 3ARBA 1JZ3A 5FKAB 1NEZA 5HVWA 1OVZA 3S96B 1EV2E 4OZHA 3VG0H 2ADGB 1TMCB 1LO3L 2PYFA 3RGHA 3GM0A 5GJTH 5ID0A 4WFED 5EBGA 2H8PA 1JGDB 3I2CL 2XRAH 4NT6B 2DLGA 2P24B 5B3NA 2H32B 5DVOA 2Q7YA 3ILPB 1PBYA 1V3MA 2FJGA 2CMRL 2RCSH 4LVNB 5C0JA 3TC9A 1NL0L 1KIQB 2AJXL 3ETBF 4H0IA 3STLA 5KANI 1XGUB 2I5YL 1FYTE 3TNNA 1FIGH 4L4TB 5D7IA 1S8DB 1OOAA 3PWVA 5GS2D 3P0YL 1UJ3A 2VMFA 4ZPTA 5F7YC 2EYSB 5DEGA 5J6HA 1CFSB 4XGZB 1JPGB 2HMID 3WUWB 5TE6H 1GZQB 5EZIL 4NRYA 4PRIB 4NO0B 3MOBL 3MLPA 3QHFL 2YEZB 3HZYA 3LN5B 3U7WH 3WV0A 1SM3H 4XCFH 3NACH 1MVUA 3MJ9H 3VDBA 2Z92B 4BZ2L 4JFYA 2NNAB 4G5ZL 1KGCD 3W9EB 4NFBA 35C8L 1S3KL 5EU6E 3K3QA 5FHAH 3MFGB 1WV7T 4UV4H 4QGYA 1I9JH 1U8JB 3ES6A 3R8QA 1K4CA 1VHPA 1INDL 4PJHB 5K59F 3ZZ1A 4RMRA 2WAHA 3PWNA 4P5MB 5EC1A 3LKOB 5JPNB 5IMKB 1IGFL 2XTJD 1P9MA 4ONGL 1BIIA 1UB5A 4DVBA 5HHQA 5JR1L 2GI7A 1T2QH 4NHCL 2VXQH 2IALA 4X9HA 1HHJB 4JO1L 1IAMA 2LE9A 4GXUM 2X4PB 3WFZA 4V2BA 1DE4A 3BMWA 4JRXB 4WI9A 3NA4A 5IBUB 4ZPVA 1N8ZA 2XTJE 1EVUA 3GJEA 1JPSL 3O4OB 1SY6L 1JPFA 1U8NA 4PJ7E 1K8DA 4B7IA 1HI6A 4MQSB 1XGYL 4N8PA 4RGMB 4MZ2A 4KHXH 5ELIA 1NBZB 3DX9A 2XI9A 2XPGB 1FZOB 1OP3H 5F9JB 5EC2A 1KCRH 2QHRL 3L7EB 2CR3A 4CN1A 2HRPL 5IW6A 1CDBA 4TNWF 1A6VH 2DQCL 4KAQH 3RX5A 3VW3H 3JUYA 4M8VA 3B9EA 5BZWB 5C2UB 3DV4B 2FBJH 2BERA 1XGQA 3L3JB 1MFCL 2D4DA 3W11C 1NUDA 5DHVH 5F6HJ 3T1FB 1KPVB 4LCUA 1UEYA 3PABB 3S5LB 3HG1B 4I1NB 3MR9A 4MAYB 3S34L 4HK3J 4Y4HC 1XIWC 1S9VA 3BI9X 5IHBA 4OIBA 4ZD3H 4KJPD 1S9YB 4LDOB 5IBLC 2VTFA 2IBBA 4TVPD 1HYSD 3C5JA 1MCIA 2XOTA 1PEZA 1QQDA 1U9KA 4J6RH 2GEEA 5IESH 3BIAX 3THML 2BFVH 1VB9A 2R0LL 3CSBA 3OXRA 1F90H 4X5WB 4G9FD 4PY8J 2VIRB 3AY4C 1A4JA 3GBML 4NQDD 1T22B 1LP9F 3TN0C 2UY6A 2DYPD 1FDLH 4KZDL 2VRAA 4HJGB 1GGTA 3F7VB 4Z0BL 3PNWA 4U6HA 5ESQB 2L7JA 1CU4L 1C8PA 5J11B 1RZ7H 3SDAA 3C8KB 4LSVL 2KQMA 5E7BA 4OGXL 4CKVX 1OSPL 1UM5L 3BO8A 4XPTH 3CC5B 5TQ2H 4ZYKA 1JV5A 4HIJB 1IM9A 1BFVL 1CXIA 4QLRA 3TFKD 4LLUA 3FB7B 3BPOC 2BRQA 1FNEA 3PGDB 3DLQR 2B4CL 2A1WL 1AR2A 5IFAH 4HFUH 1I85A 4UT7H 4AM0A 1MCPL 1N6VA 4M43L 1W0WB 3BP4B 4YQXH 2NW2B 1HHIB 4GG8B 1AGDA 2D03L 5JW3H 3BSZH 4H8WL 1EH9A 2UWEE 3H7BB 4OLYL 2XWBB 3QWOB 4Q6IA 2FHCA 3RU8L 5FOBA 3QISA 5C0CE 4FTVE 3O6FC 3E6HA 4TNVK 4JGJA 5C0AD 5FYLH 5INCB 4IOIA 2XZZA 4K8RL 5HVHB 2C5DC 5KJRL 2H45A 4FQ1H 4YHPA 2XTJB 3TJEL 1NFIB 1NSNH 4LFHG 5T3XH 3AAZB 1G7MB 1G7HA 4UNUA 3LD8B 4ZSOE 1XH3B 1E4WL 4DUXA 2W38A 1M4KA 3WJJA 4TSBL 1SMAA 1QSZA 4J1UB 3DSFL 4PGCA 4DN3L 3VFWA 4U6VH 4WTXA 4HPOL 4L3AA 3D2UD 1DANT 4GXVL 5IVXB 1N3NB 4PJIE 3VH8B 1E4KC 4MQ7B 4JO3H 2B5IB 4X4YB 3P11L 2M2DA 4ALAH 1AGBA 3UC0H 3C6LD 4KVNL 4LVOC 1F13A 2AV1B 2EH8L 3EAKA 3NCYP 4WUKL 5GGVY 3QEHA 3AREA 5EU4B 2GAZB 3BP6A 4GG6B 5MI0B 3IXAA 5JXED 3ZKQD 2BY1A 5FECB 3MZTA 4RIRB 5K9JL 5IFHH 5E9DA 4HXAL 1R5IA 1I9RL 5KSBA 2KBGA 4PR5A 1AR1C 4DOHB 1G7LB 1N6QL 1WIPA 5L2JB 2ORBL 3VWKA 1YUHA 2IBZX 5FO9B 1KENH 4M03A 3T3PF 5C0ND 3MXWL 1AIFA 2CXKA 3WDHA 3QFDB 2ERJB 2YC1A 1BZ7A 1J0JA 4POYA 3RY5A 2DQTL 1EZVX 2FD6L 4ZO8A 3LRHA 2D0FA 3BJ91 3JV4B 2Y5TB 1EEZA 4PJDB 2EECA 5I66B 1NCDL 3TWCH 3P2TA 1Q9KA 2JJUA 1R0AH 2YSSB 4IMKA 4BQ8A 5C07D 3AFLA 1HSBA 4FHBD 3RHWK 1G0XA 3NPSC 3W82A 1CGTA 3U46A 1U95A 3VWJC 4G9FB 4LVEA 3IRPX 1VSCA 4NQDB 2V7NA 3FFDA 1WAAF 3BZEA 2DYPB 2JLLA 3UJJL 5DUML 5D1QC 4BKLA 3ARZA 4ONOA 4P4RA 1EEUA 4R0LB 2E8ZA 2AXHA 3TT1H 4NC2B 5EOCJ 2E27L 4WDIB 3BYTA 1F58L 1RUPL 4HAGA 1CTNA 5GZNC 4Z7WA 3DXAA 3GK8H 4HS3A 4ZTPH 2IPTL 1OGAE 1AGCA 3EYOA 4XP9L 1X5JA 1PJ9A 4NKOA 5JLZA 5TE4L 1R3HB 1YDPA 1IAIL 2ATKA 2P5WE 2PW1A 1T21A 3PWPA 1DANU 3QEUB 4HH9A 5ISZA 4NQEE 1VERA 1BAFL 1JHLL 1NGZB 3QFJA 1FFOA 2MPAH 5EZJA 4GAFB 4YBHA 3RZCC 2O5YL 1A9EB 1QEWA 4FXGB 1XEDA 2V2WB 3DVFA 4BA8A 4JB9L 4PRPD 3T77A 1HHKB 1YNKH 2H41A 4RISL 4XZUA 4BFEA 2NY0C 4JFXA 1L0XA 5ILTL 4GMSL 1T83C 3ARDD 3NGBB 4RMUA 4D3CH 1T1ZA 1PY4A 1X5LA 1MJJA 1CICD 2W0LA 3OKYA 3QIBD 4LDEB 1KEMH 1PYWA 4UTBH 4Y5YA 4Q9QL 2XA3A 4MQTB 1U58A 4FABH 5BO1L 2DQIH 4I18A 2J4WL 3NFPB 5C0AB 4EN3A 3VFRA 4K3DL 4PS4L 4PJFE 1UKTA 3SE8H 4NC1C 2DQDH 4G8GA 1D6VL 2ZCKH 4IOSD 1X5GA 5IB5B 3BVNA 3CPLB 4PJXE 2HLFD 1ZLWK 3TPKA 2I9LA 4L8BA 1CL7L 1BOYA 4M7ZB 2DLIA 4QHMB 1OGTA 1DLHB 2WK2A 2YUXA 3DX8A 3D2UB 1I7ZB 4OAWA 4NQCD 5DQDH 4NP4L 4OM0H 4OKVB 3TVMD 4C54A 1ACZA 3VGGA 4P2QA 5CKGA 3C6LB 4R7DA 5ITFB 4AJ0A 5TFSH 3CSGA 4QRPD 4K7PX 1IQDA 1FGVL 1YEFH 2IFGA 1J0HA 2NW3B 1TITA 3OV6A 3O3DB 4JFPA 4UIMA 1MFNA 3GSVB 2P8PB 4Z76B 4D0CB 3HNVH 5LKNA 3O11A 1QA9B 1LO5B 2ZKHH 3HCVB 4O02H 3TO2A 2NY1C 5E95B 4MD5B 2P7TA 5BV7C 3QULA 1A6AA 2M26A 3G08B 4P3CH 1CLYH 3VD5A 2D7TL 4M00A 1DBJL 3RL1B 1BVLB 4AIXA 3NN8B 1L0QA 2RFXB 3P0VL 3R0MA 1ZEAH 4L9LA 1EAJA 3FRPA 3T4AB 2BSED 3PQYA 3E1F1 1U8QA 3GSWB 1J1PH 4X4MA 1ETZA 5DMKB 3UTZB 1TJIL 1J18A 2VLKD 1TZIA 4EUPB 2BMKB 4R8WH 2J2ZA 4F58L 3MMEB 4J23A 3WFDL 4CL7A 2R2HB 3ULUD 4PJ5A 3HZKB 5D5MF 5IJKA 5JZ7D 1G0DA 4UNTA 3U83A 4TSAL 4Z8FH 4K71B 2VAAA 2DQGH 3UTQB 5CIPA 1JYVA 2FO4B 3TH4T 4XPHL 3GSNA 4JKMA 5DK3A 1NFDB 2OJEA 3MNVB 3DHJA 2UYLA 3A6CL 4HX1B 3DGGA 4TNVF 4NQEB 3V0WL 1W2KT 4LAQL 4R8WL 1WVZA 4APQC 1U91A 1A4KB 1RZJC 2HFGH 3UYRL 1C08A 1S7RB 2JTDA 1H3PH 4LKXA 3QUXC 4XAWL 1LVEA 2AERT 5DT1L 2DRUA 3VFVA 3IDNA 3LEXB 2KQNA 5TDNA 2Z8VC 3RBGA 3ILQD 3OSKA 4JZNB 4FFVC 1E4XH 1F4XL 3QNZA 4UQ2B 1P5VA 1KOAA 4HCRL 4OGYL 3W2DL 3ZTNL 1HSAA 3LAFA 2DLFL 1DBMH 4P59L 2ESVE 3GBNH 1BBDH 1QSED 2A38A 4M4RA 1D9KD 5HI4C 3U4BH 3ARDB 4M5YH 4EOWH 1RULL 4PFEA 5C09D 5CP3A 3LH2H 3DUSA 1DQDL 1CICB 4L8SC 3QIBB 5A16A 1T5XB 4NDMA 4IRJC 4ZFFB 2LFGA 4X6DA 3UZVB 2W92A 1F4YL 1P7QA 5DC0A 2CH8A 3GSRA 4MNHA 1JNJA 3OG4B 3X11B 3CX5J 4PLKC 4HHAB 2ZCHH 4IRSD 2A77H 3MRFB 2F8OA 4A2LA 1XCTA 3C2AH 5IFJB 4JJ5B 5E8PB 2JB6B 5CP7A 4P2YA 1YEIH 2Q87A 1BZ9B 2IAMC 5FCUH 1OPGH 4RMQA 3V6OA 7CGTA 4JVWA 4KJYA 3SDXF 1QSVA 3GRWA 4NPYB 1PZUB 3RHWF 4PP1D 4NQCB 1S9WB 3RRQA 2P47B 3BW9A 4JO2H 2FHBA 4OLWH 4FQXD 4JQXC 3TVMB 4Z7OF 1RIHL 2MHAB 4M5ZH 2VABB 2YK1L 5DD1L 5E2WH 4QRPB 3FO0L 1NMAH 1U8OA 2CK2A 1I9IL 4LSQL 1PKQE 4GLRI 3FFCA 4NJAL 4OSUH 4QXTB 4MD0B 3RVWC 3NH7H 5GIRB 4ERSH 5C0GB 3X13B 4NKMA 5ACLA 2CDEA 3FZUC 4M93B 3EYFB 4OLWL 3QNYA 3O4LD 2ENSA 1P7KA 3C6SA 4WTZA 1S7VA 1BJ8A 1PG7W 2YWZA 5D8JH 2AW2A 2Q8AL 4OZGB 1Q9WA 4YDIL 2F19H 2I60H 5HHME 4F7CA 2AV7B 5CJBA 3VXPA 4PY7B 4G80A 1KN2H 2ICWA 1G7JA 5GZOD 1KCKA 5IW1B 2EH7H 4MAUL 4O9HL 1EEQA 1F4WH 2C4FT 3P4OA 5HPMB 4G6FB 1IAII 4QRRD 1UCBH 1FNGB 3S98A 2VLKB 5HGDB 1ZT1A 4DN4H 5EA0L 1WBZB 3VRJB 1JP5A 5FDWB 3MLYH 3LHPH 2NY3C 4LLVA 1B0RB 5DRZB 4YXHL 3HI1B 3F5WB 2DQUH 4QRRE 4KMQA 4LVNC 3VE0A 4S0SD 1U93B 3VGEA 3QXUA 3UTSD 3WNKA 4YUEH 4LLAA 3ARRA 5EBLB 2EE9A 3FT3A 4CMMB 1QRND 3IF1B 3S7GA 1ED3A 3TBYB 3QQNA 4K3GA 3L9RB 3W81A 4XTRC 4JPKH 1TQCB 1G6VK 3RAJH 1CDIA 1GZPA 4JN1L 2BOCA 1P4LB 3QH3A 3TIDB 2FECL 2BNUB 1X5IA 4HIXH 3NZHL 5FUOL 1H5BB 4XH2A 1NGXB 4WHTB 4JRWA 5HDOA 4M1DH 1JCKA 2XWTA 2OZ4L 1RZKL 2H6PB 1RV6X 5F8QC 1MY5A 5GGVL 1EPFA 1UM4H 5INDA 5C3LD 2IH3A 2YPLE 5JORB 3OKLB 5EULV 3SO3B 4C58B 4PJGF 1CL7I 1QSEB 1T0NA 5EOQH 1D9KB 2PTVA 5FYKE 1EO7A 2R29L 5CJOL 5I30H 4RCAA 5C09B 3TV3H 4S11A 1J1OH 3ZTJH 5I15L 5I6XC 4X4XA 3VMOA 2FDBP 2JELL 3BN9C 2CUIA 1I9EA 5C6TH 2AK4E 5HYJD 2E9BA 2A9NH 4R97B 4LQFH 3UXFA 2JJTC 1DZBA 1QVOA 4IRSB 2EICA 3BXNB 3FQNB 4ELMB 3RWCB 2EXYD 3OJDB 1IC5L 4X6CB 5T1KD 2C4FU 2CIKB 5EH1A 5IIEA 3LOWA 3IKCA 2ZG1A 3B9KA 4DKFH 4LPWA 4KKCC 4XC1H 4TN9A 1AGEA 4BZ1H 4AG4L 4MDIA 1WC7A 4DTGL 3LIZH 4LMQE 2X6MA 4ZFZB 3WE6A 3P3YA 4JDZA 4BSWB 2VDRL 4HKBB 1MJ8L 2Y06H 1RUQH 5FXCH 1NAMB 4RGMC 2ZNWA 3CLEL 3HKFA 4FQXB 2XNAA 4J3VA 2LAAA 3FAXA 5IGXL 4QWWC 2ZPKL 1KXQE 2ZZUT 4MVBC 5KG9A 1DN2A 5CD5C 2NMSA 1N26A 5L6YH 1G6RH 4NOBA 3PV7A 5I18H 5C0DA 3GMMA 1BM3H 4YFDB 2YHGA 3FB6A 1PD6A 3QRGL 2P46B 2A9MH 1TJGH 1YYML 1U8IA 2AJ3B 3O4LB 3VFGH 5T3ZH 5CEYB 5LGHL 5ETUB 2VXVH 3ARQA 4MA3A 1A7RH 3GI9H 5KSVA 2PXYD 4MAYC 5FYKL 5EFIB 4QYOB 4WW2C 1IGCH 1MWAH 4QTHA 2WMPA 4KKLD 2Z93A 4AQ1B 2HT4D 4UB0L 3ARBD 1FH5H 4CADA 1JGLH 4MWFA 4XRCA 1BM3L 1H8NA 4E42A 1BQHB 1UWGL 5L9DH 1FVEA 3WNOA 5CFHA 4QRRB 5H2BA 1SBSH 4ZNEA 3BUYB 4M6NL 4HZLA 4X7CC 4U4BA 1HYRC 2OXHA 3IGAA 3L6FB 4PRHE 2D2OA 3VGDA 1CBVH 1FORL 3JTSB 1DL7L 1IEBA 3MNZB 1KBGL 2AJYL 4W4OA 2XZQH 1I8LC 3M07A 4KKNA 1QSFE 3C87A 5ERWA 5DQJA 3EFDH 3VDAA 1Y6NR 3VD7A 2VLJA 1BP3B 4MJ6B 4NO5A 1OF2B 3IDIB 5J11C 3UTSB 5JMOC 3ARFA 1QRNB 5I8OL 1TVHA 2NY2D 4G8IB 4G6KL 2HJKB 5EUOA 3OXSA 3CMOH 5DC4B 1DUYB 1WT5C 4M48L 4L4VE 3UDWC 5SWZE 1EK3A 1A21A 1UB6B 4KKBD 3OMZA 2J8UF 1CXKA 2HFEB 5C70A 1OY3B 3QI9B 4OCSL 3LEYH 1J5OL 5HPOA 3FONB 4JRYA 1JF1B 4LPYA 1JGVH 4NKIH 1RK1A 4I0PA 1C7SA 1EXUA 4LSTL 2R8SH 3CMOL 3KPMA 4AIZB 2I9TA 3GHBH 3CVHA 4KI1A 4XBPA 1VESA 1AC0A 3MZGB 3BMVA 1HH6B 1YMMA 3CGTA 1YPZF 4HIIB 1EMTL 4S1DD 1IEAA 3NAAL 3SE9L 2BNRA 3UP1A 4K7PY 5GRXG 5HVHC 4TPRH 5E5MA 3V95A 4OQTH 1FE8L 1M6OA 2XTJC 5FYJD 5D2NE 1BJ1J 4DGIL 4KJQD 4Y4KA 3KYAA 5L2KA 2WWKO 4AY0A 1QACA 3GMQB 3GUTA 1HHHA 2Q76B 1MCJA 4M1CC 2EIEA 4FP8H 1WZKA 4C83B 1UVQB 1BOGA 3BH9B 3NZ8B 4YNYA 3VFNA 3BE1H 5I1KH 2AEPL 3LKPB 3I84A 2NXZD 5SX4I 3VU2A 5TH2A 2B5IC 3MLZH 1KT2A 3NIDF 32C2A 4U6YB 3RPIA 1Z3GH 4UT6L 4LIQE 2B4CC 2LU7A 3EO0A 2R39A 3IXTB 4K7FB 2VC2H 1VFAA 4EDWL 4R4BA 2Z31C 2C7UB 1N4XL 3DO3A 4GAYA 4ETYA 3QA3B 5E4EB 5EO0B 5DDHB 2NZIA 2QEJA 3PWUB 4ZFOB 3RA7H 2YWYA 3HMXL 3R0NA 4PRNA 3JVGA 1MH5A 3Q48A 4KHTH 3RWHA 1MELA 3NABH 1QOKA 4LKCB 1QFPA 4XMKL 5IMMB 4FFZL 4HJJH 4O2EA 3WNMA 3K46A 3KPRE 3RI5K 5EG6C 1I3RB 2ERJC 4U1LA 1MFEL 2PXYB 1I8IB 5KSAD 1JZ6A 4OIAA 5KBNC 1TCRA 3NIGE 1EHLH 4R7NB 4R96A 5EU5A 4DGVH 3ARBB 3LQMA 3SQBA 1IEHA 4IDLA 2VDOH 3DX7B 4GSDL 4AENA 4KTDH 4OZHB 2GTZA 2PYFB 5E6ZA 5ID0B 3I6KB 2H8PB 4XAKE 5DHYA 1Q9LA 4JREB 3BKYL 2MCPL 1T4KA 4K23L 4H25A 2IWGA 4HUNB 4NHUA 2MOVA 2R2CA 1KJ3H 1NGWA 4MCYA 2Q7YB 2B1HL 4M9OA 2FJGB 3U7AA 1JI1A 1KTLA 1RZ8B 4PV8A 4R0LC 5C0JB 5JW4R 3STLB 2Q8BL 3VI4E 3R1GH 2R69L 3SDAD 3TNNB 1SJEA 5D7IB 5I1DA 3PWVB 4LSUL 1FCGA 5SV3A 1UJ3B 1C16A 3C60A 4ZPTB 5DEGB 4LIQL 5J6HB 4Q97A 2NY2B 4OZIE 3V7AE 4ODVH 3T2NL 2DD8H 3RVXC 1MRFH 1KC5L 2HKFH 3K4AA 1U6AH 2AK1L 4X80H 5DSCA 1RVFH 2CUHA 4NRYB 2FH8A 5ECJE 2DM2A 3WSQH 4YDKL 5DLML 3S37X 3M8OH 5L7XL 1Z9MA 1D7FA 3Q2CA 4W4NA 5SWSA 1MVUB 4LLQA 1LP9A 3EOYG 4JFYB 4G6AC 4TOYL 4HLZH 4PJ7F 2YRPA 2X10A 3GMLA 3SGJA 3TGXA 1FNSH 3NGBC 3VFOA 4OIIH 4ZXBC 4O51B 3ES6B 3VGAB 1NH6A 4PGDA 1I1FA 1MCBA 3REVB 2BOBA 4G43A 5GS1A 3DPBA 3CZJA 3PWNB 3KXFA 5EC1B 1UC6A 4PLJC 3MCLL 1IGMH 3VMPA 1BIIB 3S6CA 1UB5B 4DVBB 5HHQB 3IFLL 1OARL 2IALB 2Y4SA 2EDBA 5GHWH 2I24N 4L3CA 4LK4A 4HWEH 5CGYC 1CK0H 4HWBA 4Y16C 1DE4B 5IHUL 4M9PA 1A6PA 3H9SE 1A7NH 5GGUB 3EGSA 4M7ZC 4ZPVB 1N8ZB 3D3VA 5DUBA 5JOPD 4Z5RA 3G6DL 1JPFB 2K1MA 1U8NB 1K8DB 1HI6B 4QHKI 2H1PL 2NXZB 4N5UA 4DGYL 7FABH 5F1KC 4GH7B 2AI0H 1UWEL 3MUGA 3C6LC 4OZ4A 4D9LL 3DX9B 5C7XH 4MCZA 3BDXA 3G5YA 2FB4H 43C9A 5EC2B 3FN0H 4OFVA 4KQ3H 3QAZB 5ABDE 4PGBA 5E9DD 4EI6A 5CBAA 5IW6B 4X98A 5JXEC 4LEXH 1PG7H 2IANA 3RFZC 1MJUH 1NLBL 3INUH 5T5FL 1FZKA 1U0QA 4WFHD 1GC1L 3VWKD 3ZE0E 4LLWA 3ARTA 4BH8A 4DJMA 3M17A 1XGQB 5F96L 5IB3A 3O3UN 1FRGH 1XMWA 1WIUA 4JHAH 1J8HA 1N2RA 5JOFA 4S1RH 5KSBE 5ENWA 3MR9B 5C0NC 3DV6A 5IHLB 3LEVH 3ZT5A 2ZNXA 4LMQI 3STZA 2C3WA 1S9VB 5KSAB 3MGAA 3HRPA 1IFHL 4KH2A 2QL1A 4KKAD 3C5JB 1I1RA 1QQDB 1LK3H 4UOJA 1FL5A 4GRWB 3GSOB 3QHTC 1X4XA 4XWOD 5A2LH 3OXRB 5GS2H 4O2CA 1DEEA 1EVTC 1CDUA 2YD8A 1A4JB 4DKAA 5I8KH 3AC0A 3L3IA 2GT9B 3ARWA 1Q1JH 4XP5L 4NWTL 4Q2ZA 1A7BA 4L1DA 3PNWB 3AS0A 1IILE 2OJZL 4U6HB 4F7EA 3DXAD 3EJJX 1AQDA 3SDAB 1NGPL 2DB8A 2HYMA 4L8DA 3SGKC 3OKKA 1ROWA 3PWPD 1IGIL 5CINH 1GSMA 3B8YA 3VA2C 4WEUD 5ISZD 2YUWA 2PYEA 4HKZA 3NCYS 4ZYKB 2GCYA 1FBIH 2VLRA 5C86A 2JB5L 2K7QA 1JV5B 5FKPA 5KVGL 2VDNH 1IM9B 4S2SA 2Z8RA 2CLRA 4LLUB 1PZ5A 3HS0A 5JTWA 4ORGA 2W9LA 1FNEB 1MHPL 4Z7VE 4ZO9A 3FRUA 5CS7A 4WEBL 1T1XA 3WD5L 5LWYH 4AM0B 3CDGA 4CMHB 2CQVA 4UOW0 2BX5A 3K7UA 3QFJE 3R06A 3VFUA 1WAAA 4MXWH 4NQTA 3MJ7A 4R6UA 1FL3A 1AGDB 2DLHA 4FQLH 4LCCA 2VLMD 3ARDC 3OR7A 3VXQA 3PHOA 1CICC 5IJVA 4Q6IB 4X5XA 4MXQD 5T1LA 1E6JH 4IIQB 5FOBB 2FR4A 1T7VA 3E6HB 4EN3D 4RAVA 1UM6L 4D9QE 1JHTA 5BVJB 3DUHA 4OF8A 4YHPB 4JFHE 5DZNA 3WIFB 2P43B 1N5AA 1SEBA 4MJ4A 1G7HB 3RI5F 4WUUA 1A14H 2BK8A 2J6EL 4JFDD 4WU5A 4F57H 4GW1A 1MCHA 2HLFC 3QDGE 1LMKA 3T09A 3O45A 4G8GE 2DQEL 2EO1A 1RZFL 3BAEL 1KCVH 2VXUH 3FCTB 3H3PL 3OGOE 3N1MC 3P9LA 3RY4A 1AGBB 4P2QD 3TA3A 8CGTA 3QEHB 3MLVH 5EU7C 3AREB 3HPLB 4GMTL 4K3JL 3WXVL 1SYVA 3BP6B 4A6YL 5CBEA 3IXAB 1DCLA 3WFHA 1IM3A 3HNSH 3IAQA 3DSNA 2XZCH 3OG6B 5E9DB 3AS2A 1DR9A 1R5IB 3NFSH 4HGWA 4TVPH 2ZUXA 4PR5B 5HY9A 5HJ3A 1U42A 2QKIA 3DMMA 2YA2A 3EYUH 4M1GL 3VWKB 1YUHB 3PWJB 4JFZH 4G9DA 1SJHA 3QG7L 1S9XA 1RMFH 4JQIH 3S5LG 1AIFB 3W0WA 4NZUH 1JWSA 4GO6B 1I3GL 1MCKA 1V7NH 4RGND 5AAMA 1BZ7B 4BUHA 3MLRH 1ADQH 4KPHL 4HKJA 4XNXH 1JVKA 5F1IA 5I1JH 2GY7B 3DRTA 4UI2A 1EEZB 1SJXA 4OCWL 1MCSA 3I85A 3HNTL 3DIFA 3H0TA 1G1CA 1X7QA 4PREA 1QBLH 2SEBB 1HSBB 3LB6D 1FFPA 1I7RA 4ZUWA 3P0GB 3PXJA 4PJ5D 3U46B 1BF8A 3QDJE 1HZHH 2EDNA 3DI3B 5DTFA 3GIZL 3PQYE 5KZCD 2V7NB 3MLRL 2B2XL 1MHEA 3BZEB 5JZ7C 4LSSL 4BKLB 2AS5M 3L7FA 4P4RB 4HUUA 4PB0H 4XMLH 4RMVA 3E3QE 1WTGT 5EIIA 1EUUA 5E8DH 3VWJA 3VFSB 4Z7WB 3EDEA 3DXAB 1S5IH 5GGRY 4JFFA 1XCQA 4HS3B 3UYOD 3EYOB 3P30L 1AGCB 4BELD 4NKOB 5JLZB 2ATKB 2PW1B 3WNPA 3PWPB 1TQCC 2BCKA 2VH5H 5HYSG 5ISZB 3T0EE 1TFHA 1S9KC 2R4RL 3QFJB 1FFOB 2JF1A 2AXJA 5EZJB 1BQLL 1A6TA 3A67H 4PJXF 5BS0D 5F21B 3ILQC 4KZEH 1IGYA 1JPTH 3VXSA 2DBJA 3SO5A 4X4ZA 1H5BC 1ZAGA 2VZ3A 4BH7A 2P45B 2NY4D 5JQHC 3NPZB 4PJCE 3OKNA 3O2WL 5D5MA 4XZUB 2EDXA 4XCYA 4JFXB 2O5ZH 3DBXB 4LU5L 4ZQKA 3ME0A 5CILL 1V7MH 3MLWH 3HLAA 1T1ZB 4HJ0C 1MJJB 4QY8B 5TE7L 1JPST 4NBZB 1JYNA 3IDMA 2VR9A 1P7QD 4MNGA 5KSUA 1PYWB 3GKZA 3ZT7A 4Y5YB 3HZVA 1U58B 4CU7A 3ULVD 4I18B 4ZMAT 4CW1A 4EN3B 3GJFH 4ZAKA 3VFRB 1CXHA 5HTSA 3MOAL 4R97C 3IDUA 1LD9A 1H15A 1KFAL 1BX2A 2BNQA 1CLOL 1FFNA 3QUMA 3BVNB 3MRHA 2EDWA 2JCCE 5ID1B 1OAZH 5MEOA 2I9LB 4HS8L 3MTRA 5GISL 4XP1H 1HINL 4JFDB 1SVCP 1EO5A 1FQ9C 1OT2A 4KTEL 1OGTB 2LV4A 3K8KA 3D25B 3DX8B 4OAWB 3WL9B 4XB7A 5B3JF 5DO2D 3TT3H 4P2QB 4PP1C 1X5YA 3FHQA 5DMYA 4R7DB 3U0TB 1IQDB 1UQSA 1ITCA 2KZWA 2ZOLB 4C4KO 3RWGA 4UMGA 3SPVA 4IJ3C 4YPGA 2HG5B 3S36X 3FFCD 4X5LA 4JFPB 4UIMB 4J3UA 1MCLA 2BSSA 5IG7A 3V6BR 2XYCA 3O11B 2PR4L 3V8OA 3WIHH 1BZQK 2AEIT 5B39A 3VXUA 2R4SL 4EUPH 3TO2B 2W65A 2P7TB 1FC1A 4H1LG 5I75B 5IM7A 4Z77B 1A6AB 5F1NA 5M95B 4JY6A 4ZG1A 1X6LA 4JHBA 4TUJB 4TULH 4RGNB 3DROB 2VZUA 1L7IH 1KJ2H 4QHKJ 1CLCA 1OHQA 3D1MC 1HXMA 4RWYH 1U8QB 1VFMA 1QLFA 3RVTC 1ETZB 2YD3A 2Q7NA 3QEQA 1TZIB 4DKDC 3RWEA 3CFIC 3V6ZA 4FNLH 4NNXA 4F37K 2OL3A 1HNGA 4PJ5B 3MRBB 1CE1H 5GSVA 5D2LF 4KMTL 4YFLF 2VAAB 2F15A 3F7YA 4NWUL 4YXKH 1A9BB 2N56A 4RWYL 3GSNB 4TQEH 1AHWC 2OJEB 2UYLB 4YR6A 3DGGB 2ADJA 1HWGB 4U6XA 5JA9A 2D9QB 2YPVH 4WFFD 1E27A 1C08B 1PY9A 3KYNA 4LKXB 1KB5L 4JR9L 1VPOH 4QF1A 3SDCA 1PW3A 5GGSA 4NBYB 5CD3A 3IDNB 4RFOL 1XGRA 4APQA 1R3JA 3L3GA 3GRWL 3AM8C 3O2DA 4OUOA 5EN2A 3QNZB 2L7UA 3H42L 3KPLA 3U9UA 1OAXL 4IEFB 4BQBA 5DWUL 2JJWA 3VG9B 3F6IA 3QUZD 4LVHB 2NY4B 4S1QH 3Q6GH 3QI9C 4TSCH 1ERNA 4PJAA 5FV1L 1NC4A 1G9NL 4UV7H 5ADOL 5F7DA 2QQNL 2NR6D 5A16B 4NDMB 1ZV5A 4Y1AD 4X6DB 1PLGL 4B53A 3GMOB 1P7QB 3OGCB 2A83A 3FQTA 3GSRB 4MNHB 3AS1A 4G8EA 4KV5F 1ZMYA 1OLZA 5DD5H 4OV5A 3TYGH 4HC1A 4JVUA 5JXAH 1XCTB 3LZFH 4FFYL 3SGDI 3IJSB 3QNXA 2QSCH 4S1SL 1GAFH 4HWZB 5CP7B 4ODTH 4BZYA 4F9PC 2EXYC 5FM5M 1HDMB 1FO0L 4OCXL 3JTTA 4OM1L 2V9TA 4DW2H 5DRNB 1MFBH 3SDDC 3L5XH 2HH0L 4I8DA 3N06B 4KJYB 3OAYH 4GFTB 4YFEA 3MA7A 1YA5A 3ZHLA 5H94A 2IPUG 5B22A 3BW9B 4PJGA 1OAKH 5F7NC 4GAGH 4QCIA 1Z9OA 5CJ5A 2I27N 2HP4A 3A6OA 5EWIL 4LARH 1Z0MA 3C8DA 1A7QH 4BSVA 1U8OB 2F53A 2RHEA 3QG6B 3FFCB 1F3JA 5DI8A 1OWRM 3BWAA 4GBXC 4N90D 3B2VL 4NM4L 4NKMB 4WO4C 1DQMH 3QCTH 1B90A 5EOTA 1QPXA 2CDEB 4TRPL 5JA8B 4EJ1C 4RZCA 4XP6H 1KCUH 2CIIA 4WHDA 4XBGA 5D96C 5JDSA 4E41D 5F6IB 3WO4B 3C6SB 1S7VB 3ULUH 5E24E 1YN7A 3IFPA 4NC0B 1S7UA 1QRKA 4FZEL 1Q9WB 4Y19A 4CDHA 4N90E 3K2UH 4U1SB 3U36A 4OGAD 3IDJA 2MNUA 3D85A 3Q3GA 4G80B 2ICWB 5C9KA 2VL4A 1B6UA 1WGOA 4PJBF 5I19L 3O8XD 3P4OB 4RMWA 3ARBC 5KOVC 3CFBA 2WIIA 3B6SB 1RIUH 1OT1A 1WCQA 4Q9BA 2QSTA 2AJUL 1WCBB 1AKJA 1ZT1B 2VL5B 5D1ZD 4U7SA 5KS9E 2VO5A 3MRGA 4JREC 5B4MD 4P49A 4YEFA 5SX4H 3G04A 4LLVB 1EGJA 1KN4L 5D9SB 5HYIA 2XG5A 2P1YA 3QHZH 1QZ1A 2VLJD 3VE0B 4E0RA 1L9MA 2APTA 2F58H 3ARFD 3FT3B 4X6FA 1ED3B 2W9DL 1MREL 5GS0D 4JFQA 1T7ZA 1XF5A 4K3HA 2ITCA 2CR6A 3SHSA 1GZPB 4HEPG 1KTDA 2NY2C 5F9OH 1DUZA 3QH3B 4P5TA 3GMPB 3VXMA 5C2BH 4FQJH 2X41A 1BECA 1GIGH 1QLEH 4LSRH 3MSPA 3GKWH 1U3JA 2O93L 5AUMA 5E2JA 3HC3L 5EO9B 2V5MA 1VKXA 2EDOA 2XWTB 2GUOA 4KKBC 4UTAL 4KK8D 5EUOE 1G7IA 5C0IB 3QUZB 4JRYD 4RX4A 3RNKA 1EO8L 5INDB 4X0KA 3VFMA 3ZDXF 1P4BH 2GTWA 3NCJH 3W9DA 5E5UB 1P69B 1T0NB 2YPKA 2ZCLL 1ZSDA 3JWDL 1FYHB 4YIQA 3BHBA 1FAKT 4XPBH 3RIAF 4KUZH 3TLRA 1YMMD 3FMGH 1QFWM 4X4XB 4CVUA 4Y1AB 3VGAC 2BNRD 4LPVA 1TNMA 5HGBB 4S1DC 1D5IL 4PJ9A 3NTCH 2CGRL 4QOKA 3EOTH 1QVOB 1NAMH 4RQQA 3BIKB 4WY7H 1P9MC 2XFXA 4QXUL 4XPAH 1HWHB 5FFLA 2X2YA 3OKEA 3S4SB 5L2KD 4M7JL 5IIEB 2VSCA 3IKCB 3BEWA 4KJQC 3B9KB 4L29A 5FO8A 1AGEB 5IROA 3BT2H 3LRSA 1WC7B 2J8UA 4NQSA 3U82B 3MYJA 3WE6B 2GFBB 5D7KE 5F7WC 4JDZB 3LRGA 2N7BA 4Z7UF 1CDCA 4O2FA 3HFMH 2V2TB 1UJTA 4JFEA 4EBQH 4HQQH 2HT3D 2XNAB 3GGWB 3QCUH 3WMSA 3ROOB 1YJDL 2BJMH 4P9HH 3O6MH 1B88A 4DVRH 4UAOB 3CK0L 1YPZA 5KG9B 1T66D 4Z7NF 3S88H 1QD0A 3QXWA 5C0DB 2APWA 3HI5L 2IG2H 1F4AA 5GS0L 1LE9A 2WBKA 3LS5H 3BZFA 3FB6B 2EE6A 3WIIL 1I8MA 3BZ4A 2C26A 8FABA 2PKDA 1BIHA 2G60H 1U8IB 3F7QA 5K59E 5E08L 5BOZG 4AK1A 4KI5F 4MA3B 4H5SA 3ZKMD 4PD4J 1KCSL 5KSVB 3VFPA 2R0ZH 4FZ8H 1NBYB 1SEQL 1R6VA 3MV8D 2X1XR 5FUZH 1A7OH 3ZO0A 4WEMB 1EIBA 2AEQL 4CADB 4MWFB 4XRCB 2O61A 4PB9H 4E42B 3O8XB 1VGKB 1MHCA 3EFFA 1FVEB 2XIDA 3SKOA 3W5MA 1I75A 4WI2A 5H2BB 2VUYA 1LDPL 4JKPL 2X4QA 4WW2A 4HZLB 2DKSA 2MMXA 5DRXA 3IGAB 1KB9K 3WKMH 2VDMH 3D9AL 1R3IL 1IEBB 3RP1A 1DQLL 4PUBL 2CD0A 3MBXH 1B3JA 1K9TA 2F54D 5DD6A 2VLJB 1PSKL 1SY6A 2HLAA 3C08H 3OX8B 4NO5B 3SDAC 3ARFB 3IDYB 4P2RA 1DBKL 2ICES 2VDKH 4XVJL 1IAKA 4YX2H 1MVFA 1TVHB 3BQUA 3UTPD 1ZTXL 1X5ZA 4K3EH 3WXWL 2OSLB 4ENED 1HH9A 1YEGH 3RUGB 3OXSB 4ISVA 2Y6SC 4WCYH 4XNYH 2ID5A 2XZAH 5DYOA 3CFCH 5E6IC 4LHJB 3C08L 1DLFL 3CXDH 3VXOA 1PKOA 3B2UD 5SWSD 1LE5A 2BVOA 1AI1H 1A7PH 4JDTH 2ICWI 4H88H 4LOUD 1FJ1A 4JRYB 5JW4N 1RK1B 3U7YL 4I0PB 3UBXB 1EXUB 4HUMB 4M3KB 3KPMB 3UDWA 5EU6A 2WZPD 5E6YA 3CVHB 5HDBE 4XBPB 3QUKA 3OB0H 1IVLA 1YMMB 1N0XH 3V2AR 1MNUH 4KDVA 5CJQH 3QSKB 3OAUH 4Q6IC 1RHFA 4JO4L 4ODSH 2WLZA 2EIDA 3KXFD 3HTLX 3TM6A 5FDYA 3I50L 2BNRB 5F3BA 5MHSE 4YE4L 5E5MB 5ITBL 3MRLA 1I3VA 4BK5A 1JGUH 3FL7A 2DDQL 2F74A 1KB9J 5L2KB 5CEZE 3MV9D 4NZTH 3GUTB 4H20H 1HHHB 5HVFB 1RUKH 3MCG1 3WJJC 3BKCL 3D3VD 4JM2F 4PJHF 3UJTH 4NO3A 1BOGB 1PEWA 4YNYB 1N64L 2E6QA 5AZ2L 5HYEA 4WGWB 4ELKA 1I1AA 1U3YA 5TQ0H 5TH2B 4MHHI 1KT2B 4PJ7A 32C2B 3RPIB 1XF2A 1KF9B 2HKHL 5DJZA 4PTUA 4XPGL 5LQBH 4NFDA 3EO0B 4FQHA 4Q0XL 3AREC 2FX9L 1J7VR 2YD6A 5HGHA 1VFAB 5IQ9A 4R4BB 3ARUA 4GAYB 2IAND 4OFKA 3ZSTA 1YYLH 4DAGL 5AYUH 1NBVL 1NCAL 3PUCA 3LS4L 5D1XA 3DURA 3BRGC 4PRNB 1MH5B 3VWKC 1J8HD 1GCFA 3H9YA 2Z31A 43CAA 3L5HA 2GSIA 4U3XA 1C5CL 1MQKL 2NLJA 4NQXA 5I73B 2BHUA 4U1LB 4ODXA 4OZIF 1AGFB 2CSPA 4LRIA 1TCRB 3FB5A 5EU5B 4YWGL 4N1EA 1J8HE 1HIMH 2WUCH 2XN9E 4UILH 4AENB 3T2OA 3SGEI 3O0RL 4IMKC 1U3HA 2GTZB 4Y4HD 1XIWD 2DIAA 2EDKA 2HWZL 2V2XB 5DHYB 4XWOC 1Q9LB 3KAAA 5MENE 2P8MA 1N5YH 5IBLD 3V4VH 1T4KB 4H25B 3HE7A 1SBBA 2XKNA 4TUKL 4NHUB 2Q3ZA 4HBCL 5CEZL 5HSFA 1KPRA 4OLUH 1NGWB 4MCYB 1A6WL 3TPUB 2DQHH 4F2MA 1KTLB 3P9MA 4PV8B 3GNMH 4M7LL 3GHEL 2F54B 3S3SA 3O6KL 3FT2A 3QIUC 4NSKA 4TUOA 4LCWD 3TN0D 5E1AA 5I1DB 2ED9A 3GJFK 5IHZA 4TTDC 4YK4B 4MNQE 1C16B 3C60B 1N5YL 2VERN 2IPUK 1MCQA 3O6LH 1LNUA 1X5XA 2PYED 4UUJA 3W5NA 4IM8A 5DSCB 3ZL4L 2R1YA 3BD3A 2X89D 1D5MA 3K80A 3NCBB 3SBWA 1CTOA 5SWSB 1YEHL 1RK0A 2PYEE 4LLQB 1LP9B 2VLRE 1JRHH 5KVDL 1AO7D 5FYJH 4W70A 1U2HA 2R23B 4PIRF 3VFOB 2C1OA 4KK6C 4K94L 1ZLVH 3N85H 4HT1H 4OD3L 4Z78A 5DD3H 4PGDB 5T1LD 5I8CB 1I1FB 2FZ3A 1CF8H 1QBML 2BOBB 4Y5YC 4G43B 3OAZK 2YKLH 2X4SA 1WAAE 1F00I 3RNQA 2M8XA 5HD8C 3KXFB 3UO1H 4FTVA 1QHOA 2ZWLT 3PP4H 1WFNA 4EN3C 1OAUH 1CXLA 4U31A 5F3HB 4ZXBA 3LMJH 4OD1L 1BREA 4ODHH 1RUAL 4G7VL 1OCWL 4ZSOA 2ATPB 4L3CB 3MV9B 4J7RA 2W0FA 5BW7A 1NDGA 2VITA 4JLRA 2X4TA 3EGSB 4JGMA 3LPFA 1ZLSH 2K9UA 1W72H 3D3VB 5DD0L 5DUBB 1P5UA 2NCMA 5D6CA 3NBNA 5C9JA 3KPSD 2NY5H 4WUUE 2HVKA 4PJIA 4AEHL 4OTXH 1BWWA 1NLDL 1JMZA 1U92A 1WICA 2C1PA 1YEKH 4PJEB 4OZ4B 1YEJL 3BPNB 3G5YB 43C9B 1MJ7L 3V52H 5HDQH 4FQCL 5DMGC 5ICZA 4X98B 2OR9L 2IANB 2ZSVA 3EOAA 1MRCH 3LKQB 1XGPA 1FZKB 1VCAA 5HYFA 4ZUVA 5DMIL 5IVXF 4GRWH 4LLWB 4MJIE 3M17B 4X8JA 4KK9D 5IB3B 5F44A 5FGCB 1J8HB 1N2RB 3W0WD 5JOFB 5HVGB 3ROLA 2JJSA 1NQBA 3IS1X 3D6GA 5ENWB 3UTOA 3U0WL 4GG6F 6FABH 3DV6B 5TPWH 3CFDA 2E7BA 1BWMA 1A0QH 5F7EH 3STZB 3QJFA 4GW5B 4NCDA 4L9LC 1S7TA 1LO4H 2H9GA 3K4DA 2OR8A 5I17A 3N1QC 2OK0L 1FL5B 1TETL 3FN9A 4OUUA 1ZGLM 1J0IA 4NO2A 4Z7VF 4O2CB 4G6JL 4Y4HB 1IC7H 3CAFA 3E3QC 3QDMD 4M61A 1V5JA 1AFVL 3L3IB 5IJKC 4BFBD 1DBAH 1LDSA 5TF1L 4LSPH 1A5FL 5BMFH 1CLZL 3OBAA 4PJDF 3VWJD 4I3RL 3HI6L 4F7EB 2JIXA 1LO0L 1H3WM 1GH7A 1OTTC 1AQDB 5MERA 3TN0B 1CE6A 2V5TA 4NJ9H 4L8DB 1A6UH 4GT7A 3OKKB 1OGAA 3WFEH 1QFOA 2P5WA 2PYEB 3QUYA 5GZND 4HKZB 1HXYA 1FNFA 5FYKU 1RPQA 4YXLH 4JFFE 1MAMH 2CLRB 1PZ5B 3NA9L 3HS0B 4ORGB 2NX5A 4PLNC 5DJ0A 1UACL 3MRKA 2G5BA 5FIEA 5AWNH 4QO1A 1T1XB 2OI9B 5D70L 2YD1A 3OAYK 4OFYA 1NANI 2FEEL 3CDGB 3VG9C 4IOFC 2W59A 4LVHC 4M6ML 2AJSL 3R06B 4JKLA 3MREA 3VFUB 1AO7B 1CGWA 2J5LB 4HPYL 2H2PC 1FL3B 4LCCB 4Q9RL 3VXSE 3OR7B 4XNUL 5F88A 3V4UL 1OAYL 3VXQB 3KJ4B 3PHOB 5IJVB 5DJDA 3TEUA 1DQJA 2NY0D 5T1LB 2FR4B 5E94A 4RAVB 1JHTB 3JWOL 3PJSA 3ULVC 1JGEA 3FOLA 5D71L 2ZUUA 2VDLL 2BNQD 3JWNC 1N5AB 1J1XL 1SEBB 1CGXA 3BYYA 5LG1A 1RUMH 2FCBA 3E2HC 5KVEH 2IFFL 2Z8WC 4WU5B 4PJXA 2R56H 3HAEH 4GW1B 2ICWJ 5ALBL 3O45B 1K4DA 1ND0A 3O2VL 1QUNA 1KELL 1IGJA 2EKJA 3V6OC 3V5HA 3P73A 2VXSL 3KPSB 3P9LB 3UCRA 5IT2L 3I9GL 1V3JA 1CN4A 3TA3B 1EUTA 1JK8A 3VXRA 5I1EL 3L5IA 1SYVB 2IPKA 4R90L 5CBEB 4M62L 1LGVA 3WFHB 5HHXL 1QLRA 1IM3B 5CZKA 4N0UB 1MFDL 3O41A 1K6QH 4HGWB 4QNPF 4K2UH 4YZFF 2GJ6E 3G5XA 5T1MA 3X3FH 4KROC 3VXUD 1UEMA 5HY9B 5HJ3B 4OCLC 2WINA 3CZFA 2QR0A 4OCRL 2AJVL 3ZMRA 4JPVL 3DMMB 3MGTB 4HCRA 3QXDB 3AGVA 1GPOL 3KDMA 4G9DB 1SJHB 1S9XB 4U1IA 5F6IC 4QGTA 4XVSL 3W0WB 3SE3A 1NCWH 1JWSB 4OI8A 1C1EL 4NN7B 5F1IB 1A2YA 3DRTB 2V17L 2A74A 5LXGL 5I1IL 4GQ9L 4DUWA 4G6MH 4P9ML 3GFUA 3DIFB 3H0TB 5F7LB 1FFPB 1I7RB 4ZUWB 5LBSL 2EIZA 3EUUA 3RGVA 1KJMA 5JHDE 4G3YL 3ZYIA 2Y36L 5DTFB 4O5LH 1A1NA 3QDMB 3SDXE 4XVTL 1MHEB 4F3FA 3B5HA 5D93C 1C5DB 2D0GA 3QEQE 2YXFA 4OGZA 5C71A 1MCNA 4HUUB 3I6GA 1M05A 2ED7A 2VDQH 5JIIA 3NPSB 3TIEB 5EIIB 3VWJB 2BVTA 4C56A 1FFQA 3V6FA 2Y9RT 4KQ4H 4KU1A 3D39A 4JFFB 1XCQB 1I7TA 1NAKL 1U8LA 3SDYL 5EORH 2DBLL 1BF2A 4NGHH 4JPWH 1TZGL 2BCKB 5J1AA 5SWQB 4G7YH 2HTKD 4BFIA 4QTIH 4APQD 4YHLL 4OCYH 4OV6F 1A6TB 1NFDF 2A6IA 2W60A 2YMXL 3SQOH 4IHOA 1RU9L 1IGYB 1WZ1L 2IQ9L 5DR5H 3VXSB 3QUXD 3MJGX 3RX7A 5HHOA 4JEGB 1P6FA 5JNYA 5C0BE 3GO1H 5D5MB 1IC4L 2LQRA 1BEYL 4U1KA 4K7PH 4XCYB 1UXWB 3I75A 4R4FH 2ESVA 4QHLA 4ZQKB 3HLAB 1JNNL 1UENA 1VENA 2GJZA 5I1GL 2YD4A 3GZKA 3IDMB 1ONQA 1UGNA 4MNGB 4OF0A 5KSUB 1UFUA 2DQFA 3HZVB 2J88H 1LEKB 5HI4D 2NY0B 3LKNA 3KJ6H 4X7DC 4ZAKB 4XCCL 5CUSH 1L6ZA 3T0BA 3FQRA 3O9WA 3RVUC 2EZ0C 1LD9B 1H15B 4IRJD 1ZLUK 2BVQA 3U30C 3CJJA 4RA0C 1LEIA 3QPQC 2BNQB 1FFNB 4IMLA 3QUMB 3MRHB 1NUNB 2FHFA 4WI5A 1MF2L 3B9KC 4MJ5A 1OW0A 3O3AB 3Q1SH 1NFKA 4OJFH 5JMRA 4WWID 3IDGA 3B9AA 1CDYA 5GJSL 1FPTL 2Y07H 3L1OL 1MCWW 1VFUA 1PVHA 1X5HA 3DVGA 1F6LL 1YEEH 1AJ7H 2NPLX 4IDJL 4AL8L 3N9GH 5L88H 4QT5A 2VXTL 4FQIH 1UQSB 3SCMA 3RWGB 5AG9A 3SPVB 2DQJL 3HC0A 4YPGB 2YZ1A 4UT9L 3HAEG 3SOBH 3P4MA 4UAOC 1CWVA 2DIBA 3MODH 4N1HB 4QHNA 1UA6L 1ZHKA 2BSSB 1A47A 4W68A 1CG9A 4PJGE 3JWDC 4V1DD 5IG7B 2G2RB 3LQAL 2UZIL 1TQBC 5B39B 2D0HA 3VXUB 2W65B 4X99A 2JE8A 2OZ4A 4HULB 3KYKH 3NOIA 2DKUA 2F53E 3BDYH 1CIDA 4JY6B 2HRLA 5IBTL 3RVWD 4PY8I 1QR1A 1FHGA 3O2DL 4OZFB 3D85D 2FBOJ 1EX0A 3FZUD 4JY5H 2VR5A 3GSNH 3PGCA 1MIML 4J12A 1CDGA 1B6DA 5MEQA 5BV7B 1QLFB 2YN3A 1OM3H 1ODAA 2DL2A 1U8PA 4P2OA 1NCCH 3RWEB 1C5BH 1AKJD 4Y19E 4QEGA 3V6ZB 4ZTOL 3RWJB 4NNXB 3T0DA 2OL3B 2R0WL 4N5ED 1IRAY 3DX6A 2BSRA 5GSVB 3IU3A 4OZGF 3D69A 3DNKA 4EI5C 1UWXK 3S35H 3SKNA 4ONHA 4R4NC 1MEXL 4P57A 1EFXD 3V4PL 4QRTB 4MYWB 1B2WH 1YJDC 4UDTA 4JZJA 2FEEI 4YR6B 2F5AL 2CRZA 3OZ9H 2ADJB 3PGFL 4U6XB 1ACYH 5JHLL 2UUDH 2CLVA 4Y5XA 4YDVB 2NY3D 1AXTL 5M94B 1JUFA 4LASH 1CVRA 3ARFC 3IDYC 3KYNB 5IF0B 3UTTE 2PTTA 3ULUF 4QF1B 5GS0C 3VD3A 5GGSB 4EXKA 4TNWK 5CP3H 5CD3B 4P5TD 3VXMD 1IAIM 1WLHA 1XGRB 4PJBA 4APQB 1R3JB 4L4TD 4H0GA 1CGSH 1MUJA 1QFWI 5EN2B 3KPLB 1EJOL 3BP7A 3U9UB 3ULVH 4XCNA 5TDPA 3BKJH 4O4YH 2B0SH 4RX4D 4D9RE 2LTQC 1EBPA 3SKUD 3AU1A 4PJAB 5D7SL 2YPLA 3IU4H 5DVLA 4I0PC 5F7DB 5FO7A 5FCSH 2ADFL 1LO2H 5TGBA 2ARJA 1G6RA 2KDGA 3FQTB 3MRNA 2WANA 4PJ9D 5CZVH 1D6EA 2MWCA 4QOKD 4OV5B 2AK4A 5E2VL 1LK2A 2B8OT 1OB1A 3QNXB 2CDGB 5I1CH 3CCHA 3NIFF 3EO9L 3JV0A 4Y4KC 3TP4A 1HOCA 1MWAA 2IQAA 3UMTA 3WFCL 4CVXB 1RURL 2CLZA 3JTTB 1S7WA 1UZ6F 5BQ7A 3QCVH 5CZVL 1H0DA 5DJAA 3MA7B 1MPAH 3LPGA 4F9PA 2Y7QA 5H94B 4KKCD 1RJZA 3WFBH 4PJGB 4JFED 3LQZA 4ELMF 4I3SH 4QCIB 2YRLA 3V9FA 1EGJL 4X6CF 12E8H 2J8UE 1S7QA 3PHQA 2ZUTA 2ZJSH 2HT3C 3BH8A 4OLZH 1D3CA 3SDDA 4BSVB 4YJZL 2DM7A 2DJ4A 4LCIL 4U1JA 1F3JB 1R3KA 5DI8B 3BWAB 1TLKA 5KTEH 2FRGP 1OTSC 4I0CC 1QYGL 1ULVA 3PL6C 3MLUL 4Q74A 3PHSA 1F42A 1KLGA 4QWWD 5EOTB 3PDDA 2FX8H 2AGJH 4LP5A 4RZCB 5I2IB 4XBGB 1YPZE 3JVGC 4MVBD 1YN7B 2ZJSL 4KTYA 4MXVF 3IFPB 1S7UB 1V05A 1CFQA 5C08A 4HKXB 4GBXA 5CSBA 5I73C 3WNLA 1DQQA 3IDJB 5A2IH 4LP4A 4RAUA 3D85B 3Q3GB 1HCVA 3TYFA 3BGAA 4Z7UA 2GYSA 3F58H 3WLBA 1QO3A 3CFBB 2WIIB 2FWOA 1YY8A 3B8SA 5KVFH 1TPXC 1X5AA 4LFHD 1AKJB 2XY2A 1J8KA 3QXAA 4JPIA 3I02A 4YHML 3MLXH 3MRGB 1AQKL 2YOCA 2CRMA 4WW1A 2CKBL 4ZFGL 3G04B 3NIDE 4FRWA 1KEGH 3QQ4A 1IT9H 2JKXA 2EE3A 2WUBL 3LKRA 1EFXB 2ILLA 1AE6L 1H3GA 4O58H 2FJFA 2QLVB 1QSFA 4XMPH 5IEKA 5JIPA 4E0RB 5E5RB 5ACMA 1FYTD 1OL0A 1CT8A 1IQWL 4P99A 4X6FB 4AMKL 3BQUD 1RIVL 2NY3B 4JFQB 5CCKL 1XF5B 4YK4C 1QFUH 3C60C 3VRIA 1KPUA 5FM8A 4P46A 4L8CA 15C8H 1KTDB 2OX5A 3WYRA 1Y18B 4ENEC 1BGXH 1JWUA 4XPFH 1DUZB 1YECH 3U2SA 1CR9H 3VG0L 4P5TB 3VXMB 3WS6C 5GJTL 4P2RE 4RGOH 5ESVA 4POZC 4L4VA 5AUMB 1L9NA 2XRAL 5SWZA 1VKXB 3HMXA 3TZVA 2GW5A 1R3LA 1G7IB 3B2UC 3BKMH 3RNKB 2DWDA 4X0KB 1U36A 3VFMB 1AXIB 4YGAB 2GTWB 3W9DB 4LOUC 2RCSL 2YPKB 5E99H 4EIGB 3SGJC 1Q0YH 5EU6D 3SGEH 4YIQB 3BHBB 3N0PB 5T1DH 1G9MH 4LGRB 1NKRA 5EBMA 1FIGL 4KWUA 5FKAA 1CZ8H 4JVPA 1I7UA 1ZGLB 3ARGA 1T20B 3IVKB 1JNLH 5GS1C 1BBJA 4PJ9B 3T0AA 5TE6L 4QOKB 1B0GA 4EXPX 3DECA 2XFXB 1UYWH 3B9DA 1CS6A 4GAJH 3RDTC 2BRRH 5I6XB 3U7WL 5D2NA 3I6LE 2QQLH 3BEWB 1VGEH 4GKZA 1SM3L 3KWWA 4GRLA 2D7MA 4XCFL 4L29B 4CUCA 5D7LE 5FO8B 3G6JB 3LRSB 3NACL 3MJ9L 2HTLD 5IEHA 3CDYA 4NQSB 1NDMB 4MX7A 3MYJB 2HA1A 3SEPA 1ZGLP 1I1AD 3OR6A 4O2FB 5FHAL 1NPUA 3LSOA 4M1CD 4UV4L 1I9JL 4X8XA 4JFEB 4AH2A 5AAWA 1MRDH 4W6XB 5J56B 5HI3D 5J1TC 1EAPA 1YEDA 3BPNC 1YPZB 1F3RB 3IDXH 3L3DA 2YEZA 1F45A 4DQOH 1TTGA 3U1SH 2VZTA 3ALXA 4K94C 2DF3A 5F7KC 4HMCA 2FATH 3QPXH 1LE9B 1T2QL 2VXQL 3BZFB 2VYRE 2Z31D 2DIJA 3BZ4B 5E2UH 8FABB 4N0CC 3ZLQC 2LVEA 3J7HA 5EUKA 3IAPA 3TBSA 1WEJH 5I1HH 3KPRA 3VFPB 4JM2A 4P4KA 3STBA 1K8IB 3SKMA 1YQVH 5CMAA 3K81A 5DZOA 3EW3B 1DBBH 4AYFA 4KHXL 2FATL 4K8RD 3KHQA 2O61B 4Z18A 1U3HD 2BVEA 1BPVA 1WWWX 4DUVA 1U8HB 4QHUA 1MHCB 3EFFB 3SKOB 1A3LH 1KCRL 3WS3A 2X4QB 4X83A 4NCC1 4WW2B 5DRXB 4E5XA 1A6VL 4KAQL 3GSXA 3HE7D 1FLRH 5I1HL 4JJHA 1W0VA 4ODWA 3VW3L 1GHFH 1HKLH 1B4JH 1Z5LA 3MA9H 1JTTA 2FBJL 3ET9F 5B8CA 5DD6B 1INEH 1JL8A 5HDBF 2HLAB 2NTFB 4NZJA 4OZHF 1RFDH 4N8VG 4PRBA 1FV1B 1FYTB 3T2QA 2CRYA 5E8EB 1DSFH 2X40A 4OLVH 3G9AB 3BQUB 5MP6H 4RWHA 1IKFH 3MV7E 2F5BH 4ZD3L 1F6AB 1HH9B 3F6LA 5FYLE 4J8RA 3RWIA 1F3DJ 3CVHH 4OZIA 5JQ6H 4ISVB 4J6RL 1DFBH 5IESL 4JG1H 2BFVL 5DYOB 3X14A 1F90L 1VDGA 5T3XE 3VXOB 5ADPH 2EDJA 2B7DT 1LE5B 2BVOB 1JWMA 1FDLL 5D7IF 2OI9C 3RVXD 2EYTA 3S5LA 3LDBB 1FJ1B 1ZANH 1N59B 3LPWA 2CK0H 3QT2A 2DI9A 2J5LC 5E6IA 4LCCC 5EU6B 2XWJA 1X9QA 2VN7A 2XQBH 2PETA 4DKEH 1RZ7L 3QUKB 3KJ4C 4G6AD 4UINH 4U33A 4HXBH 1E28B 4Y2OA 2CDFA 5C0CD 4FTVD 1UCTA 5F3BB 4FMFA 2J12B 4XI5D 4XPTL 4R3SA 2YN5A 5TQ2L 2BC4A 1T22A 5CZXD 4ZODA 4OFIA 4ZXBD 3MRLB 2DM4A 3UJIH 5A2KH 1HQRB 3QQ3A 1Y0LA 2V7HA 5FA4A 4GS7B 5IFAL 4HFUL 4UT7L 4PLJD 1PG7X 2H2SC 1B9ZA 5IW3A 1DVFA 4NO3B 3H9SA 2D9CA 2VB5A 4YQXL 4RMSA 4ELKB 1NMCC 1I1AB 3K8MA 5CGYD 4PJ7B 3VCLA 1XF2B 4Y16D 2NYYC 5JW3L 5DJZB 3BSZL 4PTUB 3TA3C 2QBWA 4FQHB 4RDQG 3CC5A 5HYSA 5HGHB 3HC4H 5IQ9B 5FYLL 4BQ6A 5FEBA 4Z6AT 2CPCA 1E4JA 4TTGA 1RI8A 2VZSA 3NCCB 4FQ1L 1MCDA 1PAMA 5CGMA 1ZHBA 4GKOA 1NSNL 5T3XL 2O5XH 4MA8H 4NNPH 5D1XB 2FIRT 2WP3O 3DURB 2ICCA 3DMMC 3EYVA 1T7YA 4K9EH 2YZ8A 2Z31B 4FQ2H 4KK9C 1WITA 2B1AH 4U6VL 43CAB 2V5RA 2GSIB 5JIHA 3MLTA 2NLJB 3SJVE 1KJVA 1FAIH 2NY6D 5EB9A 4NN7C 4JO3L 5GXBB 4ODXB 3S37H 4ALAL 2H3NA 3FB5B 3UC0L 3K8LA 1XR8A 2GSGB 3JV5A 3CUPA 5DS8A 2AXGA 3GSQA 2H26A 1U3HB 3U9PH 1NFIA 4YHIA 3VD9A 5IFHL 1G7MA 5HHVH 1NGQH 5GRUH 1BD2E 1RY7B 3U0PA 4XWGH 3HE7B 2XKNB 1MIEH 1GGIH 9CGTA 2EXWD 1GGBH 2J6EA 1NUFA 1KPRB 6CGTA 4F2MB 3P9MB 3OKOA 4ZOEA 4OT1H 4MQ7A 1KENL 3FT2B 4HUWA 4NSKB 4TUOB 2AV1A 1FGNH 2W9EH 4GRWF 5E1AB 4YHKH 4Z9KB 5IHZB 1OGAD 4CVZA 3IJYA 4JAMA 2P5WD 4UNVA 5FECA 5KW9H 4A6YA 3EZ8A 2FGZA 3QUYD 3TWCL 1IBGH 1QFHA 4HGKC 4XNQA 1R0AL 4NQED 5DK2A 3QIUA 3CXHK 2R1YB 1YNLH 4Q7DA 2APXA 1D5MB 4XVUC 4Y4FA 5GRJH 4Z7VA 4XC3H 4H1LA 1FZJA 1KYOK 1Q8MA 3QFDA 4BQ9A 1T3FB 3UBXG 2R0KH 3H3KA 3KR3H 3TT1L 2NX5E 2G5RA 2C1OB 4HWBH 1Z6JT 2Y5TA 4Z78B 3GK8L 4ZTPL 2UWEB 2FZ3B 1AP2A 2FX7H 2X4SB 4DZ8A 3RNQB 1LWRA 4YDLC 5C0CB 4FTVB 4ZOBA 4ZAKC 3QZWG 5T33H 2V5YA 3H9HA 5H35A 4ZXBB 4KXZH 2MPAL 2DAVA 1ADQA 4NUJA 1R24A 4ZSOB 5CSZA 2W0FB 1NDGB 4WDIA 3V8CA 2FIKA 2VITB 4JLRB 5JUEH 1YNKL 3S8WA 4ZOCA 4UIKH 3QDGA 4F8TA 1H3TA 4EDXA 5D6CB 2P5EE 5C9JB 3DRQA 4D3CL 2HVKB 4PJIB 3SKJH 1XZ0A 1A22B 4M7KH 4Y16B 1QKZH 1KEML 1U92B 2C1PB 1T1WA 5DJ8A 5A3ID 4UTBL 4FABL 1A3RH 3W39B 1V3KA 2W07A 2DQIL 4R26H 4OLXH 5ICZB 2FYYA 1KV3A 4FXGA 4FXKB 3ECBA 2PF6A 5DEFA 2ZSVB 3EOAB 3SE8L 1XGPB 3C9NB 2DQDL 2V2WA 2ZCKL 1MI5E 5HHPB 3VXRE 4ZUVB 1HHKA 4HK0A 4X8JB 4DZBA 1KNOB 1GGYA 1KYOJ 1A3RL 4BK4A 3P40A 3EZJB 4XP4H 1D5ZA 5EZLA 4QKXB 3V5DB 3DO7A 3CFDB 4YHZH 2GITB 3QJFB 2NY6B 4UQ3A 5FHBH 1CFBA 5DQDL 1TTFA 4OM0L 1S7TB 1KG0A 3MGOA 4XNMA 5I17B 5ALCH 1Q72H 5TFSL 4OUUB 2IGFH 4NO2B 1YEFL 5DURD 3UZEA 1OTUD 3QDJA 2ZOKA 4UZGA 3HNVL 4BFGA 2ZKHL 4MSWA 5B3JE 1NBQA 4O02L 4G6FD 1NMBH 4QHMA 4MA1C 4N0YH 3PDOA 3KPNA 1MCOH 1I7ZA 2Z0BA 4C56D 2OCFD 2JIXB 3GJFA 4HS6A 4P3CL 5F9DC 1CLYL 3D39D 1J0YA 5MERB 1CE6B 4WNQA 5F72S 2Q86A 3LQAC 1ZEAL 4MB3A 1L7TH 1YC7A 1OGAB 3QO0B 4MS8C 4XT1C 2P5WB 2VWEE 3SDCC 1J1PL 3QUYB 1HXYB 4C56E 5KN5A 3QIWA 4Z76A 5I71C 3T0EA 2HTKC 3D39E 1LO5A 4WGVB 4HDIB 2NX5B 2YD5A 5DJ0B 3MRKB 2G5BB 4NCC2 4Z7WF 3H3BC 2DL9A 4Z8FL 5F97E 2ESVD 2DQGL 3AROA 4PJCA 1BVLA 4ODUA 4X7SH 3MREB 2X7LA 3T0XA 4B7LA 3KLAB 4OB5H 2X9YA 1QPPA 1YC8A 2I07A 5F88B 1BHGA 3RJDA 5HHOE 1SMOA 5DJDB 1DQJB 2HFGL 1BJMA 1QNZH 4OFDA 2BMKA 5C07A 1H3PL 5D2LE 5E94B 5AEAA 4HJ0D 3PJSB 1YMHA 1JGEB 3FOLB 2CO6B 4PJFB 2OS7A 5EU3B 5FUCE 4HF5H 5BVPH 1ZK9A 2XG4A 1J88A 1E4XL 3GI8H 1KJ2A 2BDNH 3MRDB 3RKPA 2EDDA 2E6PA 3G6AB 2JCCA 4PJXB 4L3EE 1DBML 2VZVA 1K4DB 1ND0B 3BD4A 5FV2A 3GBNL 1IGJB 5E4IA 1BBDL 3ELAT 4AEIH 3U4BL 3IETA 3V5HB 4M5YL 4EOWL