3EJZD

Structure of e203v mutant e.coli cl-/h+ exchanger, clc-ec1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter clcA
publication title Intracellular proton-transfer mutants in a CLC Cl-/H+ exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system/proton transport
total genus 46
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejzD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejzD01
1ACZA 1QRNB 2ZWLT 4G6AC 4LGRB 1CYGA 1JWUB 3HUJF 3PXHA 43CAB 2P42B 3CK0L 3GJEB 2FO4A 5EU3B 4K9EH 4WEBH 1BJ8A 2R1YB 2CK0L 3ESVF 4LNVA 1T03H 4Z9KB 2EDTA 5GHWL 2V7NA 5B8CA 2FEDD 4JFDE 5ANME 1OTUC 4KWUA 4ZUTB 2GSGA 3JWDL 4CN6A 4JN2A 5KS9B 2QQKH 1P84J 3NFPA 4OCRL 4GBXD 2X4OA 2AEPH 3VI4E 3TO4D 3W0WD 1Y0LB 3FB6B 5IR1B 4EBQL 2YHGA 5DC0A 5I1EH 1CIUA 2EDKA 5JZ7C 3RZCC 2P8MB 5EA0H 5DSCA 1PY4A 3V6OE 1IBGL 5DFVD 2H9GA 4P4KC 4YNYA 5D4QA 5D70L 43C9B 2XA3A 2BOCB 4PGDB 1RHHB 1TCMA 3NCEB 4UUJA 4QRQB 2HFFA 2VQTA 3FMGH 3QIWB 4FXGA 3C6LA 3E2HC 4XVSL 3VI4F 4MD5B 3PHOB 4Y2OA 2HLFD 3LB6C 4LLUA 2Z91B 3O9WB 1U93A 1J0KA 1JN6B 1JCKA 2CLZA 2M26A 1A6WL 1JHLH 3SPVA 4QOKE 1FP5A 5D7LE 4MDIB 3STBA 5C6TH 3QJFA 4JO3L 3IETA 4ZODA 1T6WA 4PJFA 3Q6FB 5ICXB 3H3KA 2C4FT 4GRWE 1KB5L 4B50A 3K4DA 2AK4B 2BSTA 3PP3K 1A14H 2DIBA 2X4NB 1XFPA 5E03A 5E8EB 4NZTL 5KSBA 5ESVB 1IAOB 5FGRA 1IAIL 2HT2D 4GRWF 4H1LH 3RRQA 5F9OH 4OSUH 5D2NB 5FDYA 3BH8A 1A6VL 1T4KB 5DUBA 3HR6A 5SV4A 4CVZB 1YYMH 3H9SA 4KQ3H 2IF7A 5ALCL 3CMOL 3P4MA 5CGMA 3PHSA 1L6XA 1UWXK 5T1KB 1E0OB 2D4FA 5FGBA 4U7KA 1QYGL 1RIHH 4LF3B 1ORQA 2EDXA 3HCVA 3MBEB 4KUZH 4JFEE 1FFPB 1GXEA 5JW5B 4EDXB 4JFXB 3CDCA 3KPMA 2A77H 3HMWL 4GS7B 4UAOB 3VW3L 4WI3A 2YD6A 5D2LA 4XPTH 2DQCH 3GIZL 3DVFA 3HC0B 5E9DD 5D7SH 4HUNB 2FH6A 3DHJA 1YN7B 3FT3A 3BDBA 3UTTA 3SCMB 1QZ1A 4PJXE 1QFPA 3U48A 4XCNB 4OI9A 4XHJD 1CQYA 5EO1A 3ILPA 3C5ZD 4X80H 4OAWB 4WEBL 5DJYA 5TH2A 3K2UL 1T03L 3RKDD 2YEZB 4WO4D 5GGSB 1NFIA 2GJ6D 1PZ5B 1LP9E 1QSZA 1N59B 4PJXF 4M61A 2GTWA 2NY2B 3B9EA 3KGRA 4Z7UE 3FTGB 2QQKL 2V7HB 1RZ7H 4X99A 5B38B 4LRIA 1KCUH 2N4IA 3SN6N 5K9JH 3AUVA 3WFEL 4S2SB 2VAAA 3NCJL 1LP9F 2C4FU 2W0KA 3FQRA 5I1EL 1S7RA 3VFUB 5I66A 5EA0L 3QWOB 4IOIB 4I4WA 4Z7UF 3L5XH 1KGCE 3H7BA 3VFPB 3BVNA 1S7VA 4PJEF 4Y5XA 1TMCB 3PF2A 3FMGL 3OSKA 5GS2H 2R4SH 1MF2L 4F7TA 1D9KB 1J1PH 3HZVB 1WBXB 3WCYA 5E4IA 2VQ1B 2H2SC 5E00A 2FB4H 2N7BA 4HLJA 1ETZA 3E6HA 2YA1A 2Z31C 4OI8A 1PQZB 1QBAA 5CMAA 4PJ8D 4L8SC 4Z5RB 3S8WA 1AH1A 1JHLL 3UTPD 1GGIL 1OM3L 1S9XB 5C6TL 1GPOH 2E27H 1CT8A 2XXCB 5F89A 1WLHA 1I1RA 2X1OA 2CLVA 2DBJA 4M7LT 3PHQB 1RUKH 5MHSD 3DUHA 1BOYA 2HAZA 5JQ6L 3RFZC 4BH8B 5JNYA 1INEH 1GYAA 1A14L 3MV9A 4HJGB 5DVLA 5C08A 3QQ3B 1PGRB 4Q9BA 5HD8D 3GRWA 4KVNH 4L4TE 1GZQB 3CX5J 4X6EB 5DJ6A 4OSUL 2AW2A 4U33A 5EWIL 1HQ4B 1AHWA 1XIWB 1XF1A 3NZHL 3LN4B 4LIQE 4TVPE 2NY4C 4OFYA 4KQ3L 3DRTB 4OKVA 5C0CA 5DC9B 5EBMA 3DUUB 2AGJH 5L2JA 4UIMA 1J8KA 2DYPD 1JV5A 4KMTL 4GMSH 4UBDD 1RIHL 1DLHA 1QEWB 1MCHA 1PDKA 4ETQB 3G5YA 1ZMYA 4PYHA 3S5LA 2CRIA 4OZFG 3HRPA 2QBWA 1G9ML 2F54A 3L7EA 5F71A 2VDKH 3MOAL 5FDWB 4ELKB 5CJ8A 4XPTL 2DQCL 2BFVH 4P9HL 3REWA 4LPWA 4ZS6C 3O0RH 3DMMB 1BFOA 4RFEA 4WTZG 5DDHA 4ZSOA 3FB5A 5D72H 2P5EA 1JHTA 2VLRD 4HEPG 2WZPD 3CFKB 3RWEA 4LFHD 3AS3A 2VXQH 2BC4B 5EU4A 4YPGB 1MH5B 4OIIH 2ESVB 1H9VA 4JY4A 1HWGB 3QYCA 3TZVC 1NGWA 4XCEB 2MSPA 3EAKA 3NGBB 1IM3A 1G7IA 1SM3H 2RHEA 4MDJB 3SGEH 3QNZB 1NCCL 4QHMB 1DBJH 1DANT 4LLYB 1MJJB 1S9VB 4JO2H 3LKOA 5I1DA 2CMRH 1GIGH 3VCLB 3O8XA 5KTEH 4ELME 2NX5E 1FZMB 4NOFA 2ARJA 5F1NA 2IPKB 3DUSB 2R8SH 3B83A 3L5XL 1RZJH 4KDTA 2L4OA 2WQ8A 5H94B 1JGVH 3T0DA 2JIXD 4AG4H 1Q9OB 2R4SL 2X05A 1KTKE 3VXUD 1KYOK 4ELMF 1J1PL 1YNTA 2BP3A 3MNWB 2OL3A 3CVHH 4AM0B 4YC2C 4Z76A 4ZO7A 4MJ2A 5D7IB 1K5NB 2FB4L 3QDMD 3PWVB 1K6QH 4EI6A 3GM0A 4ZFOL 5H35A 4TULL 4CN4A 3QCTL 3BZ4B 1FGNH 1BGXH 1GPOL 2E27L 2HH0H 1RHFA 5F6HJ 1I3UA 4LSUH 1PKOA 2PW1B 1XR9B 5GRXG 3IXAB 4WFHD 4GT7A 2XTLA 3KPRE 5F72S 1RUKL 5I18L 1X5HA 2HRPH 1G7MA 3P30H 1QSEB 1K8IA 3FO1A 4CJ0A 1INEL 1RZ8B 3MRMB 1Z3GH 2A74B 1QRNA 5EU6E 5EZLB 1JWUA 3LAFA 1LMKA 5B39B 4EUPG 4XI5C 4KVNL 43CAA 5DZOA 5ID1B 3GJEA 5EU3A 3VMPA 3BEVB 3P0YH 3QZWB 2R1YA 1U3JA 1YMMD 4XAWL 3V6OC 3MV8E 2XA8L 4ZUTA 1SJXA 2W0FB 1FYTE 2VDLH 3TBWB 5KS9A 4M7LH 1WGOA 3OKMB 1FZKB 3U0WH 4XX1G 5EORL 3NPZB 4R7DA 2W60B 4GMSL 1FIEA 1Y0LA 3FB6A 3KPTA 5IR1A 1GJIA 2NY3C 3RGVD 1OW0A 1J8HE 4Y4FD 3G08B 4N90D 4KZEH 1F8TH 4YIQB 5L8JB 2P8MA 3T3PE 5D9SB 4W6XB 1J5OH 4YHLH 43C9A 4PGDA 2BOCA 4UTBH 2R0ZH 4JQVC 3TN0C 2VDKL 4QRQA 4Q6YA 3CX5K 2AJXH 3QIWA 3GEWB 3QI9C 2BFVL 2VB5A 4MD5A 3EYQD 3O0RL 3PHOA 2Z91A 3AB0B 3LY6A 3O9WA 3H2WA 5D72L 1JNNL 1JN6A 4JLRB 4PRPB 4BFEA 2XN9B 2QSCH 2VXQL 4MDIA 3LCYA 4UB0H 3DLQR 4HPYH 4OIIL 4XWOD 4OZGB 2X4QB 1XCTB 4XC1H 3Q6FA 5ICXA 3GSWB 3RVUD 2AK4A 5HGBB 1JZ3A 4FQ1H 4JO2L 3RIAK 5MEPB 2X4NA 5E8EA 1AO7D 5IB2B 5KTEL 1YEKH 2EKSB 5ESVA 4PJCF 2E7HA 4ONFH 4Y2DD 2DQHH 1IAOA 2ZNWA 3ARPA 4PRHB 5D2NA 3MJ9A 4MCZA 3WYRA 2BY3A 1T4KA 1RZJL 3NTCH 1KC5H 4CVZA 1ROWA 5J13C 4AG4L 2XRAL 3CH8A 4YJZL 2MQ3A 1MWAH 5FOBB 4W4OA 3O3DB 5T1KA 3CVHL 3F6LA 5E94B 4PJDB 3TVMC 5DXWA 6CGTA 2N1KA 2FZ3B 4NT6B 1K6QL 3M8OL 3LD8C 2VOTA 4TN9A 1LVEA 4LF3A 4Y5VC 1BJ1H 3OR7A 1F58H 4UU9B 3NCYP 3MBEA 1FGNL 4XXDB 2ICWB 3WN5C 1FFPA 2HH0L 1FNFA 5JW5A 3OGOE 1FL5B 4EDXA 3I3EA 4LSUL 1M7DB 3ARRA 3H0TB 4MD0B 4XNXH 1S7QB 4ZXBC 3ARTA 4JO1H 3HC0A 4K8RD 4HBQA 1YN7A 4JRXE 5L2KB 3SCMA 1FHGA 2OTUB 1Z3GL 2VR9A 4JANB 1MCCA 4XCNA 2Z31B 1B9ZA 3K4AA 3GMNB 4L8SB 4MB3A 3GIVB 4OAWA 3P0YL 3FB7B 4PRIE 4L4VB 1AGBB 3ULVD 2QTEA 3MSPA 2YEZA 3IDJB 2DQUH 3C6LD 1PZ5A 4NYLB 1N59A 4XZUB 4M7ZC 3ZTNL 2VDLL 4TSBH 4M7LL 3VGHA 4Z18A 2V7HA 1BQHB 3U0WL 5B38A 1UZ8B 1U3ZA 1WWAX 3I85A 4K94C 1B4JH 3MUJA 3OKNB 2P4AB 4S2SA 1HCVA 3SGJC 2JJVA 3VFUA 2NYYC 3VXSB 3LKPB 1G6RH 3QWOA 4IOIA 3VFPA 1NCTA 5CEZD 5FECB 1J5OL 4YHLL 1U3HC 4UTBL 2R0ZL 5ALBH 2AJXL 1MFBL 2NY4B 1D9KA 3HZVA 1WBXA 1KELH 4POYA 5ICYA 2VQ1A 1TZHB 4ZFGH 4HWZB 5CHNA 3PABB 1PQZA 4Z5RA 2QSCL 1J1XL 5TQ2H 3U7YH 5J0BA 1FG2B 3V7MA 4UB0L 1S9XA 4KJQD 2J12B 4HH9B 1OAKH 4IHOB 3RVWC 2EDJA 3EO1B 5IM7B 3H9SD 1KJVA 1GZPB 2DMBA 3D6GA 4OIAA 1A22B 3PHQA 2ZNXA 2HKHH 4MJ5A 3FFDB 5H37H 3EFFB 4S1DD 3VXQB 4YUEL 4JPKH 4BH8A 1AGDA 4FQ1L 4U3HA 4HJGA 2FO1A 1NUDA 3QQ3A 4G6FD 4ONFL 2DQHL 2C1OB 3OGCB 1GZQA 4X6EA 1UWGH 3G5XB 4NSKB 4HJ0C 1HQ4A 1XIWA 3NTCL 3LN4A 1KC5L 1QNZH 3CH1B 3U9UB 1BD2B 1XGYH 3DRTA 2ATPB 4DN3H 1FC1A 3DUUA 3UTTD 3TH2T 1TENA 1YN6B 3BKCH 2YPKB 1ZSDB 1IGFL 3G6AB 25C8H 4BFIB 4HUVB 1QEWA 4OB5H 3UYRL 1F58L 2Y25A 3BI9X 5FUOH 3SQOH 1P6AB 4ETQA 3P9WB 3MLZL 4WWKB 4ZUSB 5HHMD 4XX1E 1N7ML 1BQUA 4XNXL 4ELKA 5FDWA 3Q5YA 4JO1L 5J3HD 3DMMA 4UDTB 5LGHH 5LVEA 4YC2B 4LSQH 1RPQA 3P2TA 3LPWA 2D2OA 3CFKA 5GGUB 2BC4A 4YPGA 1MH5A 5MEOB 3PGFL 4MYWB 5C0IB 2EIBA 3RU8H 1I1FB 2ESVA 5F6IC 3WIHA 5IGXH 4XCEA 2DQUL 1UXWA 3D18B 2DM4A 3BP4B 4MDJA 3QNZA 1RK0A 3MV7B 4TSBL 4JAMB 1U0QA 3QFJB 4JFDB 5ANMB 4KTEH 4QHMA 2CR6A 2BHZA 4LLYA 1U3YA 1MJJA 4KTDL 1S9VA 3UO1H 1ZT4B 3REVB 1B4JL 5H2BB 3VCLA 5E99L 3CNKA 1FZMA 5KZCD 2AEWA 1LDPH 5ITBL 2IPKA 2QHLA 2EXYC 4LPUA 1G6RL 3DUSA 3O2DA 1S7WB 3MLPA 5H94A 2YA0A 2HN7A 4CU8A 2XZQH 2EEAA 4AY0A 4JKMA 1Q9OA 5DGRA 1ZT7B 3MNWA 4A6YB 1KELL 1SMAA 1VESA 2WP3T 1Q8MA 4AM0A 3VA2C 4EVNB 3MV9D 5D7IA 1K5NA 3TLRA 4ZFGL 3PWVA 5C08D 1FZOB 4CMHC 4YHYC 3G5VB 2YBRA 4ZDHB 5TQ2L 3AAZB 3U7YL 3BZ4A 2NY3B 4GW1A 3ORJA 1OAKL 4LAJH 1HDMB 1NUGA 2QSTA 2E9WA 3VMNA 4OFYD 1XR9A 5SX4H 3U82B 3V8CA 3NIGE 2B1AH 3IXAA 3TN0B 5C0CD 1ZGLP 1G9NC 2VUOA 1QSEA 2V9TA 3DX8B 2YXFA 4JPKL 4GRWB 3OKEA 1RZ8A 3MRMA 3HZKB 2A74A 5CKGA 1OSZB 5EZLA 5B39A 3NIGF 2YD1A 1UWGL 3BIBX 1X5KA 5ID1A 1CLOH 1V5JA 3BEVA 3QO1B 3QZWA 2Y9RT 3CDFA 2BVOB 1XF4B 1E4JA 2F54D 1QNZL 2PETA 2VTFA 1XGYL 3NA9H 1WAAA 2W0FA 2J6EH 4XVTH 4DN3L 3TBWA 2E6QA 3NABH 2HFTA 3OKMA 5I8EB 1FZKA 1J0YA 4UT9L 3F65A 3SKMB 2WQRA 2P5ED 4OLUL 2GAZB 3QEHB 4OB5L 1LO5B 3QUYC 1QRKA 3OJ2C 2L7JA 5FUOL 4M1DL 3G08A 4ZAKC 3U1SH 4YIQA 4YHML 3CFDB 4RMRA 5D9SA 1NEZG 5HVHC 5JW3L 3FO0H 3MRKB 1NAMB 2NY6C 1OAUH 2DMCA 1IT9H 3ULUD 1IARB 4FS0A 5LGHL 4OGYH 3BYTA 4QWWD 2EEBA 4LSQL 3O8XD 3O6FC 3CD4A 4JLRA 3NA4A 4PRPA 4YPJA 3GI8H 2XN9A 3DV4B 4RMUA 2ZZUT 1F3RB 4PJXB 1KPVB 4DZ8B 4OZGA 3WN5B 5GXBB 2X4QA 1TJHL 4UINL 1PZUB 1XCTA 2PYEE 1TFHA 1C5BH 4H1LG 1UB5B 3BGAA 5B21A 4LOUD 1EGJA 1V3JA 1T80A 4AIZB 4ZXBB 4KTEL 3UO1L 4FFYL 5MEPA 1N64H 1HH6A 4Z7UB 3DTXB 1YECH 4XNZC 5SWSE 5IB2A 2EKSA 2V17H 5CZXC 1LDPL 2R9HD 4PRHA 1QUNA 1JZ6A 1U42A 1ADQH 4WCYL 3UC0H 2C4XA 4JFYB 4TNVF 2IMNA 2XZQL 4GKOA 4QNPE 4JRYB 4UI2A 2A9NH 3C6SB 4ZTOH 4DEPC 2GW5A 4IMLB 4WUKH 5BVJB 4YQXH 3G5ZB 4D9RE 5F97E 5FOBA 3O3DA 4M7ZB 4MJ6A 1PKQB 5E94A 4PJDA 3LQAC 4DGIL 1IEBA 4RA3A 4WI7A 2FZ3A 4NT6A 1QRND 4NCDA 1DJSA 4QNPF 2UWEE 4M1CC 1S7XB 4XXDA 1FQ9C 2ICWA 3B5HA 4WVRA 1FL5A 3CLEH 1BBDH 3RWIB 2C9AA 1M7DA 3H0TA 4MD0A 5AZEH 1U3HB 4GMTL 1S7QA 2B1AL 1FCCA 5A2LH 4QRRB 2UWEF 2J4WH 5L2KA 2XKSA 2JE8A 2C26A 4HSQA 2OTUA 4WFFD 4JANA 1MRCH 5BV7H 4W70A 3B2UD 2Z31A 1YNLH 3NIDE 1S3KH 3GMNA 4L8SA 4WHCA 5K59E 1A64A 3GIVA 1MELA 3BP5B 2EDRA 1CLOL 5FUZH 3FB7A 1X5IA 2F8XC 4L4VA 1AGBA 4J12A 4LK4A 4UT7H 4YR6B 3IDJA 3QIWD 3NA9L 4NYLA 3WLWC 2J6EL 4XZUA 4XVTL 5DD0H 3NIDF 4I1NB 3NABL 5EOQH 1WIUA 2NXYC 3O9WD 1BQHA 4MLSA 2MNUA 3RVTC 3GRWH 2ICES 4QXUH 4O2FB 5KVFH 1JF1B 2KZWA 1MSPA 4WFGE 3OKNA 2VLJE 4WJ5B 3GI9H 5HY9B 1A7PH 1TETH 3VXSA 3LKPA 2O61B 2W9EH 5FECA 4Q9RH 1A4JB 2IH3B 3FO0L 1EDQA 4LHQB 2XG5A 4CUCA 1OAUL 2FJFB 1IT9L 2AK4D 3Q3GB 3L3GB 2FX8H 4OGYL 4JZJC 3TYGH 1TZHA 4G6JH 2ADFH 4N0CC 4HWZA 1KN2H 3PABA 4P2CG 3GI8L 4GW4B 1FG2A 5JDSB 5C86A 2I25N 4HH9A 4IHOA 1LILA 3EO1A 4KI5E 5E1HB 4BUHA 5IM7A 1WWCA 3ESUF 3QQ4B 1I75A 5EDXA 5TE4H 5TFSH 1GZPA 4IOFC 1MCPH 3DVIA 3FFDA 3EFFA 5T1KD 3VXQA 4WFED 5DC4B 5DD6B 3MO1B 4KI5F 1Q9LB 1YECL 5HVGB 2FD6H 3UMTA 4DUWA 2V17L 2C1OA 3OGCA 3MBED 3G5XA 4NSKA 1TITA 1ADQL 4ELMB 2NX5B 3UC0L 2BNRB 3FN9A 1B2WL 4RCAA 5F6IB 3CH1A 3U9UA 1YMHB 5JW4M 1BD2A 2A9NL 2YD7A 4WUKL 2VXTH 2LTQC 4YQXL 3LOWA 1DQTA 2ATPA 4Q6IB 2OI9B 2X10A 8FABB 3SCMD 1YN6A 5D5ME 4HPOL 2YPKA 1ZSDA 3WV0A 1W2KT 3G6AA 2VZSA 4BFIA 4HUVA 1BWWA 3U0PB 5I1LB 2MWCA 3WMSA 4ENED 3MACH 4WWKA 3TESA 2D0FA 5J12C 3CLEL 2MJWA 1BBDL 3HB3C 1PG7W 3MV01 4GUPB 5AZEL 5BS0E 2OL3H 2NY2D 4BQ8A 12E8H 1UVQB 1YEGH 1U8QB 2J4WL 4UDTA 2C7UB 4YHZH 3EHBC 3KPRB 4XNYL 1ND0A 5E08H 4MJIE 1MRCL 5BV7L 4JFOB 1IZJA 1YNLL 3VGAC 5GGUA 4YHYB 2F5AH 3MC0A 3QPQD 5LWYH 3LIZH 4IIQB 3T1FB 5MEOA 5C0IA 4LKCB 1I1FA 4YGAB 4OCWH 4UT7L 5TQ0L 1UKSA 4NQCD 3D18A 1PVHA 1EJ6A 4X8XA 1D9KD 3BP4A 1EO7A 1RIUH 5EUOE 3MV7A 5EOQL 4JAMA 4JFDA 3QFJA 5ANMA 2Q7YB 1YY8B 3WKNA 2DI9A 3VD7A 1GL4B 3R0MA 4QXUL 5KVFL 1F3DJ 1ZT4A 3TV3L 3OXRB 5H2BA 1DBAH 4ERSL 5IBLC 2GUOB 2O93L 3GI9L 4YX2L 1WZKA 4N8PA 1EVTC 1A7PL 5E2JA 3IAGC 5EUOF 1S7WA 5T3XD 2UVEA 4Z8FH 1VKXB 3CFEB 4Q9RL 1F00I 4QTHB 2NY0B 3V6OA 5JA9A 1ZT7A 2IPTH 1R3HB 1TVBB 3BSZH 4A6YA 2FX8L 2CR3A 3SQBA 4EVNA 3TYGL 2ADFL 1ZAGA 1FZOA 1KN2L 1V3MA 4GQPH 3V2AR 3G5VA 4ZDHA 1G7PA 4R2GC 1WBZB 3AAZA 3QUYB 4LLWB 4X7SH 2C3GA 1HDMA 1XIWD 4P3CH 4A2MA 4ZNEE 3QDAA 5TE4L 5TFSL 3TN0A 1MCPL 1LD9B 5IHUH 1MRFH 3DX8A 3TWCH 4LAQH 2X1QA 3HZKA 2DM3A 5IW3A 4AZ8A 4K3EH 4MCYB 1OSZA 5DEGB 4D2NA 1TQBC 4KK6C 4OBRA 3CSBA 1LEIB 4YDVB 2FBOJ 2FEEI 3QO1A 4PBVC 2BVOA 3UROR 2WBWB 5IT2H 1C7SA 2NLJB 3WJLC 2VXTL 2BVEA 3NCCB 4P99A 1TJIH 4LVEA 2ZSVB 3DMMD 1DL7H 1WFTA 4P2YA 5I8EA 3SKMA 1XMWA 1A9EB 4JG1L 3D48R 4ALAH 1CBVH 1T5WB 2B1HL 1IE5A 2FIRT 2GAZA 3QEHA 1LO5A 4PJBE 2ZOLB 4MAYB 6FABH 1AXSA 1A3QA 1FSKC 2MMXA 3CFDA 2ESVD 3MACL 2AXFB 3QJHA 2JB6A 2XI9A 3ZT6A 3MRKA 1U8PB 2EO9A 1NAMA 4MMXC 3TPKA 1RQ5A 4DEPB 4XNUL 2IQAB 4PJBF 4R4FH 2ZUTA 12E8L 1YEGL 5I0ZA 4JB9H 4MXWH 4CNIA 1TCRB 2E3VA 1BVKB 3TVMA 3EBAA 3GNML 1BPVA 4XT1C 5E08L 3Q0HA 4JRXB 2YZ8A 1KIRB 3ZKND 1WV7T 3DV4A 2F5AL 2QQNH 3IDIB 5LWYL 4Y5VA 4PJXA 4OZFB 1KPVA 4DZ8A 1T2QH 4OCWL 3WN5A 3HFMH 1MIEH 2GJZB 1UB5A 5MP6H 3BIAX 4LL9A 1HSBB 1OTUD 2VQUA 4BQ6A 1RIUL 2IFFH 4AIZA 4ZXBA 1QQDB 5BO1H 2LU3A 3SKUD 4RRPG 1JYNA 5JPNB 4RNRB 5C0FB 3AC0A 4Z7UA 3DTXA 1DBAL 3CCHB 2YK1H 3P4OB 5KW9H 4CU6A 4UOJA 2BZDA 2B2XL 5EZOH 3UPAA 4JFYA 5JZ7D 4Z8FL 5FO7B 3T0EE 1G0XA 3BRDA 4PJHE 1QFWH 5HI4C 4JRYA 1EVUA 3C6SA 3ALPA 4IMLA 2IPTL 5BVJA 3G5ZA 3BSZL 1QSED 1PKQA 4KRPC 1D5XB 3LB6D 4XC3H 2UZXB 1F3DH 1MFNA 4PJHF 5JA8B 4FQLH 5B4MC 3IRPX 4X83A 1S7XA 4X7SL 3SGJA 3T2QA 1JTOA 4P3CL 4XMLH 1FNSH 1U3HA 4UOW0 1N6QH 3BT2L 4PLKC 4QRRA 5DYOB 5IHUL 1QKZH 4ZUWB 3TWCL 2XACC 4LAQL 1RJLB 1UT9A 2M8XA 4K3EL 1AC0A 4Z7WE 3KYKH 3VRLE 2DIAA 1JZ7A 1T7YA 3BP5A 5IBTL 4OV5B 1IL1B 4YR6A 3BW9B 1TZIB 3VRLF 4Z7WF 5M7QA 1TJIL 1TVHB 3D9AH 3IDYB 4EUPB 4ALAL 1AFVL 1AXTH 4O2FA 4DGYH 1CBVL 1JF1A 4OCXH 4PRPD 5E6IC 2XN9D 4WJ5A 6FABL 1FPTL 3IVKB 1E6JH 4RISH 1CDGA 2O61A 4PJGE 3CSYB 1VA9A 4OT1H 1A4JA 1L0XA 2V5RA 2I24N 4KI5C 2L7UA 5I2IB 1KG0B 4JDZB 5C07E 4R4FL 2LTQB 3LQMA 1ZHKB 1A6ZB 4L9LC 3Q3GA 5ENWB 3QEQE 3L3GA 2DKSA 4MXWL 2VE6B 2KDGA 2FL5B 5HGHB 2UUDK 4PJGF 2AJUH 3WO4B 1NL0H 5H37G 1A7RL 4K07A 4QTIH 4PRHD 4LSSH 3TCXA 4KKCD 5JDSA 3TGXA 1J86A 4K9EC 2BCKB 1MHPL 4C57C 3HFML 1MIEL 3QQ4A 5J12B 3FJTA 3VFOB 5MP6L 5FHBH 1N6VA 3FN0H 4GAYB 2QJDA 1MCRA 3FQXB 4R0LC 5DD6A 5E4EC 3GB7B 1A3RL 1NCAH 1CGWA 1T1ZB 1Q9LA 3MO1A 3OAYH 4WI6A 1ERNA 2YK1L 5KW9L 1T20B 2ADGB 4IMKC 3ZE0E 2V9QA 3HC4H 4QHLB 3VGAB 3KAAA 4ELMA 2NX5A 1FYHB 1EUUA 1QFWL 1GOHA 1EHXA 2W0LA 1YMHA 2H26B 2OSLB 4KGJA 4Q6IA 1YQVH 3ECBB 8FABA 3ZE0F 5L2KD 3EFDL 4Z95H 3JWOH 4XB8A 4XC3L 1U36A 3S96B 2H2SD 4DVRH 1WBYB 3C08H 2ZKHH 1A3LH 2Z31D 4DQOH 2ICWJ 2Q3ZA 3O2DH 2XG4A 2YN3A 3U0PA 5LQBL 5I1LA 3SO5A 4L4VD 5TF1H 4MZ2A 3U79A 2EZ0C 5JMRA 4C54A 1OGAD 3BESR 4XMLL 1FNSL 4GUPA 4K3JH 1CDBA 1N6QL 3ZLQC 2GK2A 4G8EB 2HLAB 1FC2D 1UVQA 4MS8D 1U8QA 1YYLH 1Z9OA 1QKZL 5EOTB 2C7UA 2QSVA 3KPRA 2HA1A 4J1UB 5AD0B 2Z8SA 1C5DB 4PBXA 1SEQH 5IB4B 4H88H 3DETC 4JFOA 3DSFH 5I30H 1W8NA 4WV1C 2O26U 3VXSD 4IIQA 3T1FA 2ZSWB 4LKCA 3NFSH 3N50A 1Z9MA 5DGQA 5ICZB 1F2XK 3ILQC 2NY4D 1JE6A 3RBGA 4OD3H 1W72H 3D9AL 1ACYH 4MNGB 2Q7YA 2FGWH 5EZIL 2OK0H 1YY8A 4FXLA 3MR9A 1N2RB 2ZOKB 2EICA 4NQDB 1BF2A 4DGYL 4OCXL 4FHBD 3OXRA 1Q38A 3WUWG 2GUOA 5DEZA 3IGAB 3KYOB 1JPST 3LMJH 1TQBB 5FXCH 1VKXA 4LSVL 1G7HB 3CFEA 3ARBC 3BN9C 4H8WH 4QTHA 2CXGA 3T2PA 4V2BA 4Y0GA 5DVOA 4ESKA 1R3HA 1TVBA 3T8XB 1KTDB 4ZS6D 4KJPD 2WANA 4O9HH 2AJUL 1JI1A 4R3SB 1CD0A 2YSSB 3TBSB 5HYEA 4S11A 3U2SA 2VKWA 4QTIL 1FFNB 2O5XH 1WBZA 2DLIA 1MFAH 3QUYA 4LLWA 1X3DA 2F9BT 1T7VA 1FSKB 4CVUA 5DJAB 3D25B 1LQSR 1NJ9B 1BD2D 1XH3B 3RWCB 3OB0H 5GSRB 2ORBH 1FL6A 5FB8B 3OWEA 1LD9A 1NFDF 3FN0L 1PX4A 2I9LB 1U8MB 5F88B 1NCAL 4MCYA 3DYOA 5DEGA 4KJYB 2XTJB 4UILL 1LEIA 4YDVA 3MLTB 1J0ZA 5SWSB 4WWKD 3CUPB 3CXDH 3VXUE 5CP3A 4U3XA 2NLJA 1UH2A 2XFXB 5KSAB 2D31B 1YQVL 2ZSVA 3D0VB 3GZKA 3F7PC 3V5KB 1AQDB 4Z95L 4JFQB 1A9EA 1MAKA 1UH4A 3D1MC 3C08L 2ZKHL 1T5WA 1A3LL 3CU7A 4DQOL 2ZOLA 3EOTH 1EIBA 4M8VA 5C0DB 5TF1L 2UWEB 1IGIH 4WFHE 3JTTB 1OAQH 2AXFA 2AERT 2FEDC 4K3JL 1U8PA 1CL7H 2IQAA 3MV7D 4JFDD 3QFJD 1YYLL 4GBXC 1XCQB 3C60C 4MSWB 2VDQH 3LRHA 3FQWB 4G3YH 1TCRA 3O6KH 1BVKA 4N1EA 2OYPA 5E2VL 3MLSH 1F5WA 1SEQL 5HI5D 4H88L 4JRXA 1KIRA 4FN0A 2YUXA 2Y7QB 3DSFL 5I30L 2YR3A 3U0TB 3IDIA 1YMME 2VDRL 3WFDH 4OZFA 2W91A 5DFVC 5FA4B 3IAPA 4P9MH 1E4WH 1UFUA 3T0EC 2GJZA 1YEHH 3T04D 4NN7C 4WTZA 1A7OL 2FH8A 1A6TB 2KQMA 1MVUB 4OD3L 1W72L 1D5BA 1ACYL 1QQDA 4NC0B 5MENE 2FGWL 1KB5B 2BNQB 4HIXH 5HHXL 2XIDA 4AIXA 4PJ5E 5JPNA 3RL1A 5JORB 4RNRA 4C83B 5C0FA 2APWA 3CCHA 1HHHB 3P4OA 5M94B 4G43B 3BE1H 3LMJL 5FYLH 2NY3D 1T0MB 2W65B 4YHNB 5K9QI 3S3SA 3QXDB 2VLJB 3T0BA 5FO7A 3QA3B 5D1QC 1A7QL 3I6LE 1R5WB 3TN0D 4M5YH 4RGNE 5J1TC 3HMXH 3OHXB 3TYFB 4X6DE 1ZANH 1QO3B 1NKRA 2J5LC 1D5XA 3UBXG 1S5IH 2UZIH 2GI7A 4M3KB 1FAIH 2BVPB 2O5XL 5E6IB 1MFAL 2PCPB 4PTUB 4QGYA 5DJZB 4KQ4H 4X6DF 4R26H 5DHVA 5JIHA 1BREA 2ZP0T 3O11B 2NY7L 5TJWK 2ITDB 2ORBL 5DYOA 2FLRT 5JIIA 4ZUWA 4L9LB 2EYTA 1CD8A 1RJLA 3BJLA 1IGMH 2AQ2A 3ARZA 5B3NA 2EO1A 1OAZH 1NSNH 4JY6B 4WU5B 3UYPA 4MHHG 3CXDL 4OV5A 1RZJC 5FEBA 1IL1A 4GLRI 5HDLA 3BW9A 3NPSC 4J3SA 4MNQE 1TZIA 1MCWW 2DQFB 5DZLA 1SYSB 3VFNB 1TVHA 1DBKL 3VFMB 2VISB 4FRWA 3TVMD 3NIFE 4EUPA 3C09B 4R0LB 5E4EB 3OKYA 3X3GH 4B53A 3H9YA 5D5MB 3U4EB 5BRZE 2DM2A 3IVKA 2B0SH 1IGIL 4KXZI 1P5VA 2EYSB 4WO4C 2E7LC 3CSYA 4XAKE 4MQXC 2K1MA 3NIFF 5DJXB 4P59H 3RI5F 5I2IA 1CIDA 1FO0A 4OF3A 1KG0A 4WTWA 1OP5H 4JDZA 4ZXBD 1ZHKA 1A6ZA 5BS0B 5ENWA 2EDNA 2VDQL 5AAWA 4G3YL 3O6KL 4L29B 3SOBH 1WK0A 2FL5A 2J8UE 5HGHA 3MLSL 2BSRB 4KJWC 5C7XH 1K2DB 1V7NH 3EW3B 4MJ4A 3WFDL 2FECI 4MJIB 1NEZB 4WU7B 4NZDA 4MB5A 5KANI 2BCKA 3FHQA 2WK2A 1E4WL 1WISA 4G80B 4NO2B 4JRYD 2J8UF 4LMQI 4RMQA 1KGCD 1JRHI 3VFOA 5C0JB 4P5KB 1C1EH 1FNLA 3JUYA 4GAYA 4OLVL 1JZ2A 1B90A 3FQXA 3L95B 2PO6C 4FABH 2Z8RA 1X5GA 5EUOB 3C2AH 3GB7A 1T1ZA 4L1HA 1T20A 2ADGA 3VXME 5FYLL 4QHLA 4WV1B 5DMJB 4H1LB 2NYYD 1C16B 4YDIH 5CLTA 2H3NB 1MCWM 3P40A 3RX5A 1U3HD 4CKVX 2H26A 4HKJB 5IVXE 4M5YL 2CJUL 3JV5A 5CJQH 4WW1B 2OSLA 3HMXL 2NW2B 4WENB 4QRRD 4EDWH 3KYAA 1ZANL 2NW3B 2EDFA 3G6JE 3MRPB 4I0KA 1BVZA 5CJXC 4KZDH 3P4NB 1FLRH 3MRJB 3S96A 1WBYA 3DWTA 2UZIL 1PFCA 3VXPB 1FAIL 1TNMA 5IVXF 3QXVA 1FH5H 2CKBL 4AQOA 1E6OL 3H9SE 4JFZH 4KQ4L 4U05A 1JPSL 3G6JF 1HOCB 3CFIC 2VKXA 4R26L 4BZ1L 4J3UA 4I3RH 2Y23A 3ARBB 1R6VA 4A6YH 1HNGA 4G8EA 5DEFB 4KAQH 1P1ZB 2HLAA 3D39B 4TVPD 5DFTA 5CSZB 5EOTA 5IP4A 5E2TH 1M7XA 4J1UA 5AD0A 4UBDC 4R90H 3P3YA 1C5DA 2CO7B 5IB4A 1UC6A 1IGML 4DK3A 4LQ1A 3TBVB 1OAZL 2ICCA 5E56A 1NSNL 1L9MA 4U1SB 4JVUA 3N1MC 4XNQA 4S0SD 2ZSWA 3ARXA 1FGVL 1B4RA 2ZG3A 3QG7H 4HJ0D 3VWKB 3F7QA 4PJIE 1FZJB 4YLQT 2F15A 4YHKH 3RA7H 4DK6A 5ICZA 1EK3A 4M62H 1W0WB 5L0QB 2D7MA 2HP4A 4MNGA 4MZ3A 1N2RA 2ZOKA 4NQDA 5I17B 4P4RB 2P7TB 4PJIF 3IGAA 1KN4H 3LN5B 3KYOA 2FDBP 1G84A 2B0SL 1H3GA 3LKQB 3OB8A 1G7HA 2V2TB 4P59L 4GXVH 1WT5C 4QLRA 3MOBL 2ZPKH 4BK4A 1I8IA 3WJLA 1UJ3B 1JZ4A 5FYJD 3T8XA 1KTDA 3SOBL 4X7EC 4R3SA 2YSSA 3TBSA 3VI3E 4S1QH 1FFNA 5C7XL 3MRLB 3QEUB 4ZFOB 3WDHA 1HEZB 2OJZL 4BH7B 2NX5D 3OMZA 3AVEA 1F6FB 5DJAA 1DQQB 1NAMH 2V6HA 3D25A 1NJ9A 2DDQH 1XH3A 4XCCL 3RWCA 1BEYH 1NMBH 3CU1A 5GSRA 4NQEE 3S35H 2XYCA 1OF2B 3VI3F 5FB8A 4RFNC 1OPGH 1UCBH 2BY1A 1H3XA 3ZHKA 3LH2H 4LARH 2I9LA 2DL2A 3C60B 4FABL 3V79C 1TQCC 1U8MA 3C2AL 4JKLA 5F88A 5JMOC 3O81A 4KJYA 2DICA 4NIKB 1YUHB 4QRUB 4U6TA 3MLTA 4LKXB 5SWSA 2EXYD 3CUPA 2AP2A 4YDIL 2VDPH 4WHYH 2WIIB 3BJ91 5CJQL 5IQ9B 3T0EB 2XFXA 3SO3C 1JF6A 3CLFH 3D0VA 3V5HB 1QACA 1JFQH 3V5KA 1XAUA 1AQDA 3BRFA 4JFQA 5JTWA 3KPRD 4KZDL 1FLRL 5CLWA 1PAMA 4NO3A 4Z7NE 4G6KL 2AEIT 1PY9A 1FH5L 3PL6B 3QB7C 5CSBA 2UWEA 3JTTA 3QXTA 3WNKA 1MUJA 1MJ8H 4I3RL 4K71C 5D1QB 4Z7NF 3O4OC 3P11H 4KAQL 4JQIH 4MSWA 1XCQA 5E2TL 3FQWA 4NC2B 4R90L 3VFRB 3OKKB 2Y7QA 3U0TA 2F54E 4PG2C 3IJSB 3ZL4L 3EIFA 5FA4A 2AXHA 3QG7L 1NGZB 1IEHA 3RA7L 4ZS7H 1PJ9A 3VGEA 2NY0D 4M62L 4Y1AB 4HGMA 1A6TA 3JUZA 1MVUA 4RGNC 4OZHB 1KB5A 2D4DA 2BNQA 4XP6H 1ES0B 1IAKB 3GJFH 1MLCB 5JORA 2E9JA 4C83A 5FYJU 2CUMA 4HFUH 1HHHA 1I85C 4G43A 3QUYD 2W65A 1T0MA 4GW5B 4U7SA 4YHNA 5BXFB 3QXDA 2VLJA 2CDFB 3QA3A 4Q9QH 3BKMH 1R5WA 1S9KC 3DYMA 3RVUC 4PJGB 4FFZH 3OHXA 3GGWB 1BX2B 3NPSB 5CZKA 4HMEA 3TYFA 4LCWE 1KTRL 1CFQB 1QO3A 1G9EA 5EB9A 4M4PA 3CVHB 4ZO6A 5C07B 2XZCH 1ZEAL 3MTRA 3QEQB 4ZQKB 3MJGX 3ZDZE 2BVPA 4LCUB 5E6IA 2NY1B 4H5SB 4OM1L 2PCPA 5GRUH 5KVEH 1JJUA 4ZD3L 5DJZA 1Z9SA 3K8KA 4WI2A 2AXJA 3QFDB 2DDQL 3O11A 1BEYL 1NMBL 2ITDA 3ZDZF 4CL7A 1OPGL 4LU5H 1UCBL 3F7RA 4L9LA 3LH2L 4LARL 4LQFH 3RDTC 1KXQE 4YGVB 3WS3B 3QUMH 4JY6A 2XZAH 5CZXD 4WU5A 2YD2A 2Z35B 4YO0B 3RAJH 3R8BB 3QQNA 1NDGB 4NHUB 4P2RE 2AJYH 4DUXA 4GRLC 2DQFA 5FYJH 1SYSA 3VFNA 5C0RH 3CLFL 4GXUM 3VFMA 1JFQL 4XPHH 1DQDH 2A6JB 1KT2B 2VISA 5F9WC 4JR9H 1RZGB 4R0LA 2PO6B 4JRXD 1JYWA 5D5MA 3KLHC 3Q48A 3U4EA 4TSAH 4IMKA 2HVKB 4FQHB 5BOZG 2EYSA 1MJ8L 3C6LC 4HKBB 5DJXA 2IC2A 2AEQL 2JK5B 3P11L 3TIDB 4TUOB 2PXYC 4HAGA 2DWDB 1CWVA 4WFFE 2QEJA 4JQIL 4NP4H 5BS0A 4QRSB 2J8OA 2CIKB 2VLLB 2VDOH 3EOYG 2BSRA 3IFOB 2R56L 4M8QB 5KS9F 5ERWB 1YA5A 5CSGA 1K2DA 4U7MA 4MJIA 1NEZA 4WU7A 3ROOB 1YEDB 3CSPA 2VR4A 3W11D 1XGUB 4ZS7L 4G80A 4NO2A 2Z93B 5C0JA 4P5KA 2C3WA 3WLWD 1A1NB 4ACPA 4PPTA 5F7FA 3UTOA 2MQCA 4XP6L 1EO8H 2G5BA 3ZSTA 3L95A 3HS0B 4HW6A 5L8LB 3VFVB 5BCAA 2CSPA 2YUVA 5EUOA 3RVTD 4HFUL 5F44A 5D7KE 1VGKB 4WI8A 5C09E 4WV1A 1OLZA 1CFVH 4H1LA 4Q9QL 1C16A 2H3NA 3BKML 4XVUD 1ORSB 2AK4E 4HKJA 4X4ME 4AEFA 4FFZL 3K8LA 4WW1A 2NW2A 5FGBC 2KH2B 2NW3A 2P1YA 3MRPA 5JXEC 3P4NA 2XZCL 2A6IB 3MRJA 1U8OB 4MB4A 4YXKH 3VXPA 3KVQA 3U7WL 2EE3A 4RAVB 2FLBT 3S36X 5I73C 1HOCA 1E4XH 2NQCA 4DCQB 2VZ3A 3ARBA 4RBPK 4WFEE 4IOFD 5DEFA 1P1ZA 3WEXB 4ZNEA 1BHGA 4LU5L 5CSZA 5KBNC 3EYOB 1X4YA 1MOEA 3JV4B 1ZLWH 4LQFL 1CF8H 2QHRH 3SKJH 5IFHL 1ZLUH 2WV3A 2R2BB 3M07A 3TBVA 2NZ9C 3QUML 2XZAL 4U1SA 1MQKH 4Y4HB 5E8OB 3RAJL 1EO5A 2AJYL 3VWKA 1FZJA 1AGCB 3IDUA 5LBSL 5C1MB 3K2MC 1WF5A 2ZUUA 1W0WA 2WP3O 5JHLH 2VUYA 4HUKB 3HHRB 4LRIC 4RFNB 4XPHL 2VABB 1DQDL 4LP4A 5B22A 3W9EB 4Y88A 5I17A 4P4RA 4JR9L 3DVGB 3S3JA 1S9YB 5JOPE 3LN5A 1G1YA 3MRCB 3FAWA 3LKQA 1OD9A 4PJBA 1FFQA 1ZGLM 4LLVB 1ULVA 1G6RB 4S10A 1U91A 4UQ2B 1RSFA 2V2TA 4C59B 3DO3A 3HB3D 4G8FB 4PGCB 2UYLB 2NY5H 1UJ3A 4NP4L 1UM5H 3P9LB 3LS5H 3WJJC 2VDOL 3EHBD 5BV7C 5EIIB 2D9CA 5INDB 4D9QD 3MRLA 3QEUA 4ZFOA 1HEZA 4LCIH 1OWWA 4NM4L 4BH7A 4HKXB 3SE4A 5IHLB 3JXAA 1EHLH 4R7NB 1DQQA 4IRSC 4LP5A 3SDDB 3S4SG 1I8LC 2JTDA 4K71B 2Z4QA 1OF2A 5E2WH 4NUJB 3C60A 5MENB 3TH3T 4AEHH 5IBLD 4PJ5B 1YUHA 4QRUA 5T1MA 2WBJB 2WINB 2F8VA 1T3FA 4LKXA 4OCYH 3DV6B 5F1SA 1MAML 1ZS8B 2VZUA 2WIIA 3EZ8A 5F7DB 3AS2A 5IQ9A 3T0EA 1GH7A 3S98A 3QDJE 2A2QT 2X40A 4PJHA 2HT3D 3X3FL 3V5HA 1N6UA 1Q94B 5I8CB 4RGNB 3IRZA 2UVFA 4X6DB 2RFXB 3S3PA 4YXKL 3EDFA 1MCQA 4HGWB 3KDMB 3PL6A 3UX9B 4J3VA 1D5IH 1F4HA 2J2ZA 2Q20A 3PE9A 1GSMA 2BK8A 1E4XL 3MXWH 3RVXC 2EKJA 1E27B 1YQ2A 5D1QA 5D93C 5JW4R 5GS1C 4B5EA 2LAGB 4JDTH 3O45B 1FDLH 4TTDC 1AD9B 1LO4H 4NQDD 4NNXB 3O2WL 1CF8L 2QHRL 3SKJL 3JWNC 2J8HA 3VFRA 3OKKA 4AQ1B 1JMXA 2MCG1 1OAYH 1MQKL 3W5MA 3IJSA 3H42L 4S0TD 1WJ3A 2IANE 3P0GB 4MQ7B 1NGZA 5GQBA 3MROB 2OTWB 3N1GC 4Y1AA 5JHLL 4XCYB 3SJVE 1RAMA 4OZHA 4MNQB 1MIML 1ES0A 1JNLH 1IAKA 1MLCA 4YZFE 5DT1H 1RURL 4JKKA 4NNPH 3SBWA 3NZ8B 2ZG2A 3L3DB 4YDKH 2ESVE 3RDTB 4PGBB 2R0WH 4LLMB 5BXFA 4OLXH 4BSVB 2CDFA 1WTLA 1J0JA 5BRZB 1Q1JL 2VAJA 4YZFF 3BGFC 4PJGA 5C0AE 4NWUH 1BX2A 1NBZB 2CPCA 4GRLB 4EUPH 1UM5L 2RGSA 1CFQA 3LS5L 3VXOB 3IU4H 3OL2A 3WUWB 5IEKB 5IESH 3CVHA 5C07A 5TE6H 5FYKD 2VWEE 4HBCH 5BJTB 3QEQA 1TIUA 4ZQKA 1A02N 1EX0A 4DN4H 4LCUA 2J8UB 4H5SA 4JFHD 4Q7DA 2A6DB 2KKQA 3MLYH 4LCIL 5SWSD 1EHLL 3B3IA 2DQEH 3WKMH 5FKPB 1L4IA 4QRTB 3QFDA 2E7LA 2ZCKH 3I50H 5D7IE 5E2WL 1I9JL 2PXYB 3WNPA 4MA7H 4D9RD 4U0QB 1T1XB 5LKNA 4LSRH 4YGVA 3WS3A 4RZCB 2X4TB 1SY6H 4OF0A 5D7IF 2ICEB 2Z35A 4YO0A 1F4WH 1NDGA 5F1KC 3VXMB 4OCYL 4NHUA 3B5GA 4WEMB 4X5XB 3KPSB 3BAEH 3ES6B 3UPRB 1IZKA 3KJ4C 5E8PB 1O5DT 1PEZA 5F6HI 5IVXB 1KT2A 4XHQA 1AI1H 1ZHNB 3B2UC 1RZGA 5KVGH 1OW0C 1RZKL 2PO6A 3G6JB 1NCDL 2YUZA 1VFMA 4MXQD 5B4MD 1KEGL 1CXIA 1S7SA 4PV8B 2X4RB 1D5IL 2HVKA 1JPGB 4KKBC 1I7ZB 1DTUA 3MXWL 4QRPB 3ARDB 3FAXA 4HKBA 2JK5A 3DXAE 3TIDA 4TUOA 4JDTL 5IB3B 3PQYE 2DWDA 3F58H 1RUMH 1FDLL 3O9WC 4CBPA 4FQ2L 4O02H 2BNQD 2Q7NA 3L7FB 4ZO8A 4QRSA 1LO4L 2CIKA 2VLLA 4LSTH 4PLNC 5CJXA 4K2UL 3MPCA 4JJHA 3IFOA 3L5HA 4M8QA 4LEXH 5ERWA 5C92A 1CQKA 3ARQA 4P3DB 1OAYL 3ROOA 1YEDA 2VLJD 4JPIB 1PW3A 3LN9A 2VH5H 1XGUA 5IEHB 2OZ4L 2Z93A 1Z0MA 4YK4C 1A1NA 4ORGB 5DT1L 2XN9E 2NCMA 3HS0A 5F70A 4X7TB 1NMCB 3MODH 3VFVA 4NNPL 4H0GA 1L9NA 3DVNB 4YDKL 5E6ID 4DUVA 1VADB 5FYKU 1VGKA 2R0WL 4OLXL 5FF6B 1Q0XH 2CGRH 3HI5H 4PJ9C 3MX0A 5GS0H 3ZYJA 1ORSA 3FRPG 4RRPA 2J88H 4OCSH 4XTRC 1D5MB 3IU4L 4PLJD 5IESL 2MQ0A 2H6PB 5TE6L 5IMMA 1U8OA 4HBCL 4DAGH 4UT6H 4OBSA 3ZT5A 1CR9L 4OD2B 1FLTX 3KJ6H 3MLYL 5D8JH 1BFSA 2DTMH 4RAVA 5EO0B 5EH1A 3ZE2E 5DJ2A 4OJFH 2DQEL 4GS7C 5E70A 4UAOC 3TCLB 5HJ3B 3MRBB 3TNMB 2WUBL 5HGDB 1FORL 4PJDE 3I50L 2V2WB 1WT5A 3SEPA 2FRGP 3WEXA 3SCMC 4X9GA 3UBXB 3EYOA 4MA7L 2CKNA 4N9GB 3RGHA 3P0VH 4NQEB 1OP3K 1BVLB 2Y36H 3JV4A 3ZE2F 3E6FB 1JGDB 1SY6L 2R2BA 4PJDF 5BV7B 1UYWH 4Y4HA 2B4CC 5E8OA 1F4WL 2HFEB 3HN3A 5BMFH 5C70A 1AGCA 3BAEL 4Z0BH 5L2KE 4IRSB 3JV6B 1UKTA 4ODVH 2HTKC 5EZJB 5BS0D 4XBEH 2VABA 5FYKH 3W9EA 1AI1L 2AAVA 4PRDB 1G7QB 3DVGA 5FCSH 1S9YA 3VGFA 1WUNT 5FYLE 4NCC2 2X09A 4HK0B 5JUEH 1NLDL 2WWKT 2X2YA 4MJID 3MRCA 4TNVK 1EAPB 3RWDB 3U30B 1OGTB 5I74C 2CK0H 2MCPH 1G6RA 4O51B 4UQ2A 4X6CB 1PG7H 4EIGB 4G8FA 1NH6A 4PGCA 3JWDH 2UYLA 5DVNA 3F58L 1RUML 1B6UA 4GAJL 3UDWC 3PV7A 3P9LA 5AZ2L 2Q6WB 4OCRH 5CJBA 4F58L 4MQTB 3VXSE 1JPFB 4EBQH 4LEXL 2DTSA 5INDA 5EIIA 3DETD 3V9FA 5EOCJ 4HKXA 2VH5L 1INDL 5D70H 4F9LA 2QLVB 3P9MB 3Q2CA 4R7NA 5HDQH 3SDDA 2RAMA 4XVSH 1LO0H 3ILQD 5D93B 4LHUG 5GS1B 4JHWL 3EOBB 4NUJA 5MERB 2AJ3B 3PP4H 4WHYG 5FM5O 1P4BH 3MODL 5SX4I 3UTSE 3FONB 3V6FB 5MENA 2V5YA 7FABH 5TE7H 5GGRY 2B5IB 4PJ5A 2F8OA 1BWMA 3KPPB 2WBJA 2WINA 4JO3H 2APBA 2CGRL 3DV6A 1ZS8A 1KPUB 5GS0L 2HT4C 1ZVSB 1NCNA 2VNCA 3ARBD 2XPGB 1ZKAA 2ENYA 1P9MC 5F7DA 1UM6H 2GYSA 3BN9D 3R8QA 2KL6A 2J88L 4P23C 4OCSL 3KR3H 1Q94A 5I8CA 1HHGB 5KAQG 4LCWB 4X6DA 4NZTH 4DAGL 1HK6A 5GZNC 2RFXA 1MFCH 3PNWB 3DGCR 5EC2B 3CPLB 4HGWA 1JNJA 1J12A 1I85A 3KDMA 3KJ6L 4LEOB 1N8ZB 5D8JL 2DTML 3B2VH 4MA8H 4HS8L 1MI5E 4OJFL 3VWKD 1E27A 1KNOB 2ERJC 3UPCA 4KMQA 1U8NB 3A67H 1MAJA 3O45A 4HZAA 4Y8DC 4JZNB 3RZWA 5IVNA 3P0VL 3TFKC 1KTLB 1IGJB 4NNXA 4LVOB 1UYWL 3C5JB 1IC5H 4U1GB 5HVWA 1U95B 2IQ9H 2PW2B 4MQ7A 2DJ4A 3MROA 2OTWA 4Z0BL 3H3BC 1DUZB 4LPTA 3LPFA 4P2RB 4XCYA 4ODVL 5GS2D 5J7CC 2JJSC 4XBEL 1EH9A 4MNQA 3JWOC 4H20H 4KVCH 5I1AB 3ZKNC 3NZ8A 3L3DA 4MX7B 2VWEC 4J3WA 3OJDB 3V52L 5JUEL 3RDTA 4PGBA 4DKDC 4LLMA 4BSVA 1ZOXA 4JM2B 2NZIA 3K2UH 2MCPL 3HNTH 1H8SA 5BRZA 1N5YL 3ELAT 3MV7E 1PG7L 3QFJE 3UAJC 4HX1B 3GDBA 2QR0B 2D7OA 1NBZA 4I13B 5GRVK 4GRLA 3KJ4B 3VXOA 4QHNB 3WUWA 3C60D 5IEKA 3P73B 5BJTA 3WFEH 2ZJSH 3RWHB 3LSOB 2ZCLH 3NCJH 2J8UA 5LG1A 2A6DA 2JJWA 1L0QA 1DLFL 2M2DA 3ALWA 5HDQL 5FKPA 4QRTA 3ARYA 5FIEA 3BHBB 1LO0L 3SDCB 1MF2H 3T0ED 5HDOA 2BRRH 2PXYA 1M6OB 2D7TH 3L1OH 3MLXL 3PP4L 3BWAB 1P4BL 4NRZB 5HHQB 2B20A 7FABL 5TE7L 3ARVA 2AV7B 3IS0X 2X4TA 4RZCA 1QSVA 3L5IA 1GGIH 3PL6D 5EOCH 1WZ1H 1OM3H 2ICEA 2EC8A 1X6LA 4O00A 3VXMA 5D1QD 4BSWB 5C09B 4X5XA 3ES6A 5I9QC 4H8WC 3UPRA 4KROB 3C5SB 1UM6L 4Y19E 1CGYA 5F9AC 5E8PA 3KR3L 5E5UB 1RZIB 2J6EA 2H1PH 5JQ6H 4YK4B 1WZLA 2E5EA 5T5FH 5IVXA 2YD5A 1ZHNA 3OJMB 3A6BH 3B6SB 5C0BE 3G6JA 2YMXL 3Q1SL 1MFCL 4YBQD 4NBXB 4O2EB 4PV8A 2X4RA 1PSKH 5EWIH 1JPGA 3B2VL 4MA8L 3NZHH 4WW2F 3DURA 1KCLA 4QRPA 3ARDA 5T33H 2IGFH 4PJ9B 4Y1AD 3A67L 3HA0A 1AQKL 5IB3A 4TNWK 2CLRB 3AB0C 3GSNH 4EKXA 3CZJA 4IJ3B 5L7XL 5JXEA 4KMTH 4ONOA 2Q86B 4EI5C 4OLEA 1RIVH 4P3DA 1F97A 1KCRL 3T0WA 1IC5L 1MJUH 4JPIA 3WD5L 1VFAA 2IQ9L 1OTTD 4N0UE 5IEHA 2XICA 1G9MH 1QR1B 2I27N 3MOAH 1EA9C 1QLEH 1DBBL 4P9HH 3ETBF 4PJIA 4OUUB 3S97C 4ORGA 1NC4B 5C07D 2VL5B 4H20L 1U8JB 1VACB 4X7TA 5DQJB 2ZUVA 4KVCL 3TO2B 3QEQD 3MRNB 3OTTA 4NJ9H 2Y5TB 3DVNA 4KKCC 2VLKE 4O5LH 1WFNA 4HDIB 1VADA 2NY1D 5DTFB 1DQLH 3JSSA 4M7KL 1P4IL 5FF6A 4LPXA 5DJCB 4ZFZB 1ADQA 3HNTL 1I7RB 3DROB 1Q9WB 4MQXD 1AY1H 3QT2A 4HWBH 3QNXB 2YPLE 1X6NA 1R0AH 1NCCH 2DAVA 1D5MA 3EDDA 2H6PA 2BDNH 1FNHA 4URTB 2ZJSL 4KJWD 2ZCLL 5JW4N 1BZ7B 4OD2A 4G8IB 1LE9B 4NM8H 4JRYE 2OR8A 5KOVC 1NAKH 5EO0A 5I74B 4XBPB 3TCLA 3NVQA 5HJ3A 3MRBA 3TNMA 1PKQE 5HGDA 1MEXH 2V2WA 4LVNC 2BRRL 1IC7L 2D7TL 3L1OL 35C8H 4L8DB 3UBXA 4N9GA 5HTSA 4NQEA 1BVLA 5C8JB 2OS7A 4C56B 4L9DA 3WJJA 2PO6D 1OARH 3E6FA 5KAQF 4LPVA 1JGDA 4IRJB 4TULH 3QCTH 3E3QE 3H9ZA 2P5WB 1WZ1L 2J7LA 5EOCL 1P84K 5F7UA 1CVSC 3QDGB 3MFFB 5DUPH 5KVMC 1CCZA 4QRRE 5D1XB 3BZFB 4ZG1A 3VXTB 4IRSA 2PR4H 3JV6A 1I8LA 4MS8C 5I18H 5IV2B 3RQ3A 2H1PL 3JVGC 5EZJA 5T5FL 5JLZA 3QDJB 3X12B 5I8KH 3QR2A 1LO3L 1DE4B 3A6BL 4PRDA 1G7QA 3BP6B 5J4MA 3L3OB 4HK0A 4N0FB 4CRPA 5DRNB 2CDEB 1EAPA 3RWDA 1P6FA 1PSKL 1OGTA 2B39A 1KJMB 2GFBB 3DARA 4O51A 4XAWH 4X6CA 1ZLVH 4HQQH 5T33L 2IGFL 4HXAL 2XA8H 1ZLSH 3CMGA 3MCG1 5BQ7B 2PF6A 3OKDB 4PBWD 3GSNL 4R6UA 5IHBA 4P23B 2Q6WA 4F7EB 5EORH 3TP4A 4IS6B 3KPLA 1JPFA 1F3JB 1RIVL 1PX3A 4HCRL 5EIVA 1MJUL 4UV7H 5DO2C 3CAFA 3P9MA 4CVXB 4OI7A 5HYJE 1SBBA 3AS0A 1QLEL 4HV8B 2ERJB 2IANB 3EZJB 5F7EH 5GS1A 4KJPC 3VXRE 1F4AA 5MERA 4F8QA 2AJ3A 4U1KB 2XQYG 3F62A 3VMOA 4U31A 5J89A 3SJVB 5CEYB 1JNNH 4K94H 3FONA 3V6FA 3WHE1 4NJ9L 3V0WH 2NNAA 5J1AB 4O5LL 2K9UA 1DQLL 4P3WA 2P44B 3KPPA 4R4BB 4QKXB 3WHXB 1KPUA 1ZVSA 5FYJE 1AY1L 3KYMB 2XPGA 1RJCA 4WEUD 4YBLB 4YHOH 4HWBL 4MXVE 4MGXA 1R0AL 4FQIH 5L8KB 4D3CH 2OTPA 5C0AB 1HHGA 3N9GL 4LCWA 2BDNL 1FCGA 3GMRB 2BNRE 1BJ1J 1CGXA 3MJ8B 3PNWA 5EC2A 4Y4HD 4NM8L 4WWKC 3NACH 4P2QB 4LEOA 1J9CT 1N8ZA 4NKIL 1NAKL 4RX4A 1KNOA 2XRAH 1MEXL 3GHBL 4N8VG 1Z2KA 1K3IA 4JZNA 35C8L 3CXHJ 4X9BA 1D6VH 1DP0A 1DN0B 1IGJA 3M8OH 3QPXH 5LCVL 1OARL 1CZ8L 4XP1L 3VG9C 3BOVA 4APQC 5FO8B 3L9RB 2EECA 1FL3B 3C5JA 5SWZB 1KPRB 4PIRF 1QA9B 1NUNB 2VR5A 4NCC1 5FHAL 4KRNA 1U95A 2E8YA 2DRUA 4MD4B 5DUPL 2FNBA 2PW2A 4EIZC 2BOBB 5HHNB 2DI7A 3B9KC 4P0DA 3LZFH 1DUZA 2PR4L 3GSUB 4P2RA 3MV11 1XGRA 1JIBA 1QSFE 1W72B 1JGEB 3QH3B 1EXUA 5I8KL 5HI5C 2CRYA 1G0YR 5I1AA 3T09A 2LU4A 4A2LA 1CXFA 4MX7A 4XMPH 3OJDA 4H26B 4ZO9A 2EC9T 4JM2A 5K33A 3DGGB 3SDDD 2DJSA 4HQQL 1ZLSL 4HX1A 3ARGC 5I9QB 2QR0A 3ZTNH 3TF7C 3X17A 1YNKH 4GO6B 3DXAB 4QHNA 3P73A 3PQYB 3QHTC 5MEND 1U8IB 4PR5B 3RWHA 3V8OA 3LSOA 4PJ5D 2R2EB 3MRHB 1SJEB 2DJUA 4HK3N 4KK9D 2WBJD 3LEVL 3BUYB 5T1LB 4UV7L 5EG6C 1HSAB 1HHJB 1DANU 1I3GH 3IT8D 4D0BB 1RHHA 5HXMA 2Q3AA 3QRFM 1MFBH 3BHBA 3S6CA 4N1CA 3SDCA 2VXUH 4NWTL 4TUJB 3I6LD 5F7EL 1MFDH 3QIUC 3D2UB 1M6OA 3C2SA 4RGND 3M1BB 3T3PF 3BWAA 1HHKB 4K94L 4NRZA 4WW2C 5HHQA 1ITCA 4PY8J 2C3VB 5TPWL 3V0WL 4DVBB 1UEMA 2AV7A 1J1XH 2YD9A 4EI5B 2ATKB 5I1HL 3I75B 3S4SB 3KG5A 1T6VN 3H8NA 4BSWA 5C09A 2VL4A 3C5SA 5L9DH 3C8HA 1S7UB 4YHOL 4X5LA 5F7LB 5CWSB 1RZIA 3V4UL 4FQIL 3V5DB 4D3CL 3BEWB 4X4MA 4QXWA 4YUEH 4G8GB 4IDLA 2X4PB 5DRZB 1XGPB 3B6SA 5IJVB 4EOWH 3FB8B 2I07B 2ZUQB 4NKDB 4YDLB 4BJLA 3EO0B 3NACL 4O2EA 1EERB 1H3VA 1VGEH 2C3XA 4YAQB 1FN4B 4DWHA 4LPYA 4NQTA 4MA1C 3SE8H 4PJ9A 3QWQB 2WSKA 1XEDA 4M3JA 1BBJB 2CLRA 4MNQD 3ARSA 1ONQB 1ZA3B 1D6VL 1MVFA 1TVDA 2EC9U 2DQJH 3QPXL 4KFZC 5E8DH 3T1WA 1IGFH 4HH8A 3IXTB 3UJJH 2Q86A 3UYRH 4JPWH 2SEBB 1RJZB 3RDTD 3K8MA 3P77B 3MLZH 4LSDA 1D3CA 2QQLH 2LFGA 5BRZD 4J6RH 4JFXA 4NUGL 1N7MH 1U92B 4QYOB 3LZFL 5FGSA 4I3SH 4XAKD 1A9BB 4HIJB 4GRLD 4ZPVB 1PG7X 1AJ7H 4LVNB 4OUUA 1NC4A 2QADB 2VL5A 1U8JA 1VACA 5DQJA 4FQJL 1SVZA 2R23B 3TO2A 3MRNA 2Y5TA 4XMPL 2YZ1A 3ZKMD 4HDIA 3KLHD 3HKFA 3CXHK 4NPYB 5DTFA 3PGFH 1C5CL 1AR1D 4XGZB 3CSGA 3SY0B 5DJCA 4ZFZA 4MLIA 1I7RA 1N3NB 4J8RB 4F33B 5GGSA 3DROA 1Q9WA 3D0LB 4M02A 1S78D 5CUSH 2PXYD 1WEJH 3IFLL 3QNXA 3V4PH 5BZDB 1YNKL 3FTGA 1RZFH 4KTDH 1NEUA 3MRQB 3QDMB 4HXBH 4OLYH 5GGQH 5E99H 1AKJB 1VSCA 3KS0H 1MJ7L 1JK8B 5ITBH 1BZ7A 4G8IA 1LE9A 2R0KL 3E3QC 4XPBH 4JGMA 3VXMD 2CKBB 1I3GL 1T22B 4M03A 3LV3B 4OF7A 1C08B 3MA7B 4XBPA 1YY9C 3K80A 2VXUL 1MFDL 1KXVC 2XWTB 1GOFA 4L8DA 4DW2H 1AGEB 3UDWA 4FP8H 3F6IA 2GY5A 5T5NG 4IRJA 2W59A 3H6JA 3RTQC 3UTSB 2P5WA 1I1CA 4OQTH 4ZOBA 3QDGA 3MFFA 4QRPD 3ARDD 32C2B 5D1XA 2D7NA 3BZFA 2EDDA 4NC1E 3VXTA 5L9DL 5IV2A 4ODBD 4PGEB 5HYFA 3MQIA 5JXED 3QDJA 2FHFA 3X12A 4QXGL 1LK3H 1JTTA 1MCJA 1DE4A 2OQJB 2WMPA 3BP6A 1I4FB 3L3OA 4EOWL 5E2UH 1BAFL 3OF6A 3STLB 4D0DB 4N0FA 4QHKI 2DLEA 4RDQG 5DRNA 1VGEL 2CDEA 3VFWB 2YD8A 3U4AA 1KJMA 2APXA 2GFBA 1FVDB 2HKFH 3ZTJG 3PGCB 3SE8L 2DL9A 1MI5B 5BQ7A 1G9NL 1P9MA 3OKDA 1J88A 4P23A 4UT9H 4L5FL 4BQBA 3CC5B 1QR4A 4F7EA 2QKIB 4IS6A 1F4XH 4OLUH 2DQJL 3QNYB 5E8DL 3RJDA 3TJEL 1F3JA 1HINH 3UJJL 4JPWL 3L3HB 1GOGA 5EUKB 4M1DH 9CGTA 1U41A 2NZ9D 2QQLL 2IPUK 4YHMH 3T4YB 2APVA 3RIFF 4PGJA 4J6RL 4CVXA 2EIZB 5JW3H 1TLKA 1RUAH 5F1OB 2PTVA 4HV8A 4I3SL 2IANA 4NO5B 1AJ7L 3MRDB 3ZDXE 4U1KA 5GISH 4WUUE 3OAUL 3SJVA 5KSUB 3SE3C 5CEYA 3DPBA 3SDAC 3B9VA 1HIMH 5J1AA 4OGXH 3VG9B 4J7RA 4GKNB 4APQB 1P7QB 4WGVB 4LDLB 3TIEB 4R4BA 4PP1C 4L3EE 4HUUB 1TJHH 1OTSC 2IAMC 4ONHB 3ZDXF 3N1FC 4U1LB 4UINH 5DWUH 3ULSB 1HWHB 3WHXA 4Q6IC 2OI9C 3KYMA 3B9KB 5CUSL 4Y8AA 1WEJL 3V4PL 1B3JA 2YC1B 3RVVC 2VZTA 2VZVA 3WXWL 1RZFL 4NQED 5C0AA 4FFYH 2JJSA 4HXBL 4D9QE 4OLYL 5GGQL 2VN4A 3GMRA 3MJ8A 1BIIB 1KENH 4P2QA 4WCYH 4XPBL 4GSDH 4KUCD 5CBAB 3FO2B 4F9PA 1F2QA 4YEEA 2APFA 3RI5K 5AYQA 4IRSD 4L8BB 2EDYA 2QV2A 3ARGB 2BVQB 5HHOE 2A38A 3UJTL 3WIFB 3RX7A 4DW2L 4DGIH 3F7VB 3IFPB 1DN0A 3O3EB 4FP8L 1CL7I 3K0WA 3SDYH 5FO8A 1CTOA 3L9RA 4IIQC 4DKEH 4K3DH 1FL3A 5SWZA 4G5ZH 1KPRA 4OQTL 1QA9A 1KBGL 3IYLW 4MD4A 1JPTH 2BOBA 3BFOA 4NN6C 2BERA 5HHNA 2ICWI 2PW1A 5DMGD 4GMTH 4CMMB 1DN2A 3GSUA 2DS4A 3RNQB 2Z8WC 1V3KA 3LRSB 3ZYZA 5J57B 3QIUB 4Y19B 1W72A 1JGEA 3QH3A 1LK3L 1MCOH 4WW2B 2AJZB 5E2UL 4H26A 2BJML 5C0BB 2W07A 3IETB 2HTLC 2HKFL 2NY0C 5FO9B 4MNGE 3RVXD 5AG8A 1YEJH 2JKXA 4NQDE 3AFLA 3NAAH 4NQSB 3DXAA 4TTDD 5BVPH 3PQYA 3PGDB 1F4XL 3BH9B 2W60A 1CXHA 4GG8B 5F8RC 1U8IA 5ID0B 5AG9A 1HINL 1CDUA 4PR5A 2R2EA 3MRHA 1SJEA 4U0RB 3K7UA 5EFIB 1P7KB 3BUYA 2H45A 5T1LA 3VD5A 5DUML 3GK8H 1HSAA 1HHJA 5FAAA 2DIJA 2GK0B 2VSCA 5TDPB 4D0BA 1RUAL 1KJ2L 3R4DA 1H3UA 4MA1B 4N0UB 3K1KC 4TUJA 3HC3L 5GGTH 3QUXC 1G6VK 3D2UA 1KF9B 4I9WE 1UA6L 5GISL 3NCMA 3M1BA 4LCWD 1ZVHA 2GEEA 2C3VA 2F53E 4Z6AT 1S5HB 4DVBA 1HIML 4OGXL 4EI5A 2ATKA 4Z7VE 3I75A 4G7VL 3S4SA 3BMWA 4LCYB 4YE4L 2DLGA 2VLKB 4M6NH 4F57H 4LHUB 3KPMB 5DWUL 4RX4D 3VH8G 2BSSB 3GSWA 2LVCA 1S7UA 5FYKE 5CWSA 2NY5C 3V5DA 3BEWA 3UTTB 5HGBA 2AQ1A 4G8GA 4Z7VF 2XTJE 3H9HB 2YPLB 2X4PA 4JFHE 5DRZA 1XGPA 4MAYC 5IJVA 4W4NA 3FB8A 2I07A 4NKDA 1QG3A 1DR9A 1KENL 3EO0A 3EYVB 4GSDL 5IKCB 3VXNB 5TH2B 1FN4A 4YAQA 5CJ5A 3FHAA 1B2WH 4O2CB 3L6FB 3K46A 2HWZH 2P8PB 4G42B 1NPUA 2DM7A 4HULB 4P2RD 4OLWH 4GH7B 1BBJA 4OM0H 3QG6B 3TNNB 3F5WB 1ONQA 4GQ9L 1ZA3A 4HPOH 1IEAB 4KXZH 3M17B 3RPKA 3NOIA 4FZ8H 3IXTA 3SDYL 2SEBA 3C8DA 1RJZA 2EDHA 1PLGH 4ODHH 4QGTA 4UU9A 4DKEL 1RD6A 4K3DL 1N0XH 3P77A 4G5ZL 1RMFL 4HUXB 1MRDH 4JM2D 3MNZB 4RDQF 4JREC 1B6DA 1JPTL 2IBBA 3QXWA 5CAYB 1U92A 2JB5L 2RB8A 4KHXL 1OP3H 4QYOA 2FATH 3AS1A 4HIJA 4ZPVA 3UZQA 1DQML 3NCYS 3L3IB 4XNYH 4AT6B 4ZUVB 2CH8A 3MRFB 2NXZC 2R23A 2ZCHL 3GJFB 1MCOL 4YHIB 5I1IL 2L0DA 4UNTA 2E6JA 3BPOC 1JRHH 4NPYA 3RTQB 3SGDH 4XGZA 3W11C 3SY0A 4KKBD 1N3NA 4J8RA 4CDGC 4F33A 5TQ0H 2DI8A 3BQUC 3SDCD 2BNQE 1XF3B 1YEJL 3D0LA 4X7CC 5BZDA 1PEWA 3NAAL 3HMXA 4GJTB 5K59F 5BVPL 3JVGA 4Y5YC 4HWEH 1UZ8A 3MRQA 3TV3H 4ERSH 1JF5A 1YPZB 1AKJA 1NMAH 5FM5M 4YX2H 1JK8A 3DX9B 2X89A 4D9LH 1L7TH 3AY4A 3GK8L 5D7KD 4BFBD 2CKBA 1T22A 4XVUC 3LV3A 1C08A 5C09D 3MA7A 2KQNA 4KROD 4BZ2H 4NC1C 5GGTL 5HYJB 4NRXB 1U9KA 1AGEA 2BNUB 3GKWH 3VXRB 2OX5A 5AWNL 1UGNA 4EXKA 5JOFB 3UTSA 1CFTB 1MCIA 3I02B 5CBEB 5C0GB 3QUMB 3PWNB 1CFNB 2O5ZH 4BQ9A 2W9DL 4M6NL 4F57L 1FNGB 32C2A 4PJ9D 3PWUB 1ZXQA 4FQPA 3IDYC 2CDGB 2Q8BH 3IDMB 4ZSOB 4XTRD 2OQJA 5GGRB 2HMIC 1I4FA 3TT1H 3B8YA 1Q0YH 3SDAB 4D0DA 3STLA 1EEUA 5EU4B 3W5NA 3GMPB 3BIKB 2AJVH 3LS4H 3VFWA 3R06B 1EMTH 1FVDA 5JXAH 3ARFC 2IAMB 3PGCA 5L88L 2HWZL 5I19L 1BFVL 4ODSL 1MI5A 4OLWL 4OM0L 1J7VR 3VD9A 1P5UA 5LXGH 1NC4D 4NKMB 3BWUC 3CC5A 3WO4C 4JG1H 3RHWF 2QKIA 2GITB 4FZ8L 2B1HH 5D6DC 3L3HA 2DLFH 2ARJB 1PLGL 4ODHL 5EUKA 1R24B 3P4LA 1N0XL 2YRPA 1MRDL 2DQGH 3T4YA 5CIPH 1K85A 4FA8A 5JOPD 5DHXB 5D5MF 4ZUSA 4M48H 2EIZA 2IADB 4RWHA 5DD1H 3ZYOA 2VXSH 2FATL 3BN3B 4XNUH 3UTZB 4NO5A 2FECL 3MRDA 3O4LE 2HTKD 4B7IA 2OBGA 3TM6A 5KSUA 3GNMH 3VWJC 1QSFB 5SX5H 3ZKSD 1JRHL 4APQA 4GKNA 1P7QA 1IC1A 2G2RB 3C87A 5IROA 3OKOB 4U1NB 4HUUA 2BHYA 4LASH 4ONHA 5IFJB 2FSEB 4U1LA 3ULSA 1BMGA 3HUJE 4NN6B 3B9KA 3GSRB 1WIPA 2YC1A 4HWEL 4LPCA 5I71C 3REVA 4IRJD 5J56B 5EULV 1NMAL 4KKAC 4Z0XB 4MMZC 1BIIA 2P5WD 2B2XH 4D9LL 1L7TL 1NQBA 4HIHB 3MZGB 3QIBC 4K7PH 3QDGD 3FRPA 3E0GA 5CBAA 1IAMA 3FO2A 5D1XD 3CFBB 1N26A 4G9FB 3QAZC 4BZ2L 4L8BA 2HT3C 2LAAA 1OHQA 3ARGA 2BVQA 4PD4J 4TNWF 1IKNC 1U58B 3WIFA 2NR6D 3QDJD 3F7VA 3IFPA 3O3EA 4XPGH 3GKWL 1SEBB 4R7DB 3E8UH 4M5ZL 4JCLA 4FQXC 3OF6D 15C8H 4FMFA 1EUTA 3BYYA 3CX2A 1H8NA 3F7YB 4G9DB 1MQ8A 1RU9H 2O5ZL 1IGYB 3HI6H 3D39E 5HYQB 4OFPA 5GS0C 4CMMA 1CXEA 2HT4D 2R2HB 3BT2H 3RNQA 2Q8BL 3LRSA 3MLUH 4P23D 3QIUA 3QUXB 4Y19A 5GZOC 3MFGB 1I3RB 3AREC 4BM7A 3K74B 1CGUA 1MLBB 4WW2A 3TT1L 2AJZA 5GZND 1Q0YL 4AYFA 5IBTH 5C0BA 3AGVA 1RV6X 5IB1B 1Z5LB 1WIOA 3LS4L 2AJVL 1EMTL 1XF4A 3PP3H 4G7YH 5JXAL 3MGAA 5FO9A 4I48B 1EEZB 4PJAB 1HH9B 2IAND 3PUCA 3IF1B 4XPAL 4NQSA 5DZNA 5LXGL 3SJVD 1XGTB 4H0IA 4JGJA 1AFVH 5IJKA 1UM4L 3PGDA 3BH9A 3WO3B 3TFKD 4GG8A 5ID0A 4P2OB 4HIEB 1FG9C 2EYRB 4FG6C 4RA0C 4NGHH 4H0HB 1FPTH 2DLFL 5T3ZH 4L3AA 1DDHB 4FTVE 1YZZA 5D1ZC 4MCZB 5EFIA 1P7KA 2Z8VC 2DQGL 1UWXH 2GK0A 3V4VH 5TDPA 4M48L 1WITA 5HPOA 4Z77B 5DD1L 4XVJH 3QHFH 2VXSL 4RWYH 4M6MH 4N0UA 4J23A 1BFTA 5C0AD 2EH7H 5INCB 1WTGT 5C0EB 3LEXB 3AROA 4JFPB 1EBAA 4RFOH 5C9KA 1QLRB 2XWJB 4UMGA 2XTJC 2OR7A 1XGQB 5GIRB 1S5HA 1A7RH 2JELH 2X44D 3OR7B 5IF0B 4P2QD 2OMNA 5CGYC 2OLDA 3CFCH 3BDXA 1H5BC 2ZUYA 1OT2A 4LCYA 2VLKA 3AM8A 4N0RA 1MHPH 2FCBA 3MJ7B 4LASL 1NBQA 4JREB 2MTPA 4LHUA 5KJRH 5KSAC 3D3VE 2BSSA 1LEGB 2IFGA 3UAJD 2XKUA 3JWDC 1MNUH 1GGCH 2IMMA 3WL9B 3H9HA 2YPLA 1OVZA 1A3RH 3PDGA 5E7BA 5EC1B 1E4KC 2NXZB 1VEMA 2R1WB 3A6OA 4YHPB 3VD3A 4PTTB 1HILB 3IKCB 5SWZD 3EYVA 3BPOB 1KYOJ 4K9EL 4K7PL 4QT5B 5IKCA 3VXNA 5GRVL 4J2XA 4GXUN 4QHUB 2GCYB 4O2CA 2MOVA 3L6FA 3KPNB 2P8PA 1NFKA 4G42A 3BQUB 4ZFFB 1KLGB 4C4KT 3QG6A 3TNNA 1ZE3C 3EFDH 3F5WA 4PJEE 1CDJA 4XPGL 1IEAA 1D6EB 1L7IH 2BRQA 2AEPL 3M17A 4Y5YB 3E8UL 4MXQC 3FRUB 1NC2B 1BZQK 4H25B 15C8L 5LQBH 4M00A 3W82A 4UNVA 4HUXA 4OGAC 3MNZA 1RU9L 3HI6L 4N8VB 3RWIA 4LCCC 1K3ZA 2Y1VA 1H3WM 4K3HA 4NQCB 1TJGH 3MLUL 4QHKJ 4P5MB 3DXAD 5ICYB 3L3IA 2RR3A 1F42A 3PQYD 4AT6A 1KB9J 4ZUVA 3MRFA 5CHNB 3GJFA 2EXWD 1OQXA 2WUCH 4YHIA 5ESQB 4PD4K 2EE6A 1N0LA 4JDVB 3RTQA 3HE7C 5T1LD 4Y1AE 2D7QA 2ZUXA 4G7YL 1KJVB 4OZHE 1XF3A 3N1QC 3GMMB 4MJ5B 5IB5B 3D2UD 3V0AC 3WNOA 1MCDA 1M7IB 5EZIH 1AGDB 2CRMA 3EJJX 4X8JB 2XY1A 1YPZA 1OCWH 4NGHL 4OZHF 5T3ZL 3DX9A 4EI5D 5F9OL 5HY9A 1X4XA 1HKFA 3GMOB 4LSVH 3V4VL 2IH3A 1YYML 4PRBB 4XVJL 3QUZC 3QHFL 3ARFB 4F8TA 4U1JB 3WUZA 4RWYL 4M6ML 1EHAA 2FJFA 2Z92B 5HYJA 4PLJC 1E4XI 2AQ3A 4NRXA 4G8GD 2EH7L 4L8CB 3QRGH 3G9VA 5JR1H 2BNUA 4RFOL 1G7JB 2WWKO 3VXRA 2ILLA 2JELL 4WUUB 4GW4A 4WI9A 5JOFA 3LEYH 5JQHC 1CFTA 3I02A 5CBEA 5C0GA 4KUZL 3CFCL 3QUMA 3PWNA 1CFNA 5HYSG 3D69B 3MRIB 1FNGA 2P43B 5KJRL 2A77L 1WCBB 3FCTB 3PWUA 4L3EB 2PTUA 4HFWB 1CG9B 1MNUL 2CDGA 3GHEH 5D7SL 3T0XA 1GGCL 4POUB 3IDMA 3C09C 1JGLH 2F19H 1K4DB 2X1PA 1SVCP 5ACMA 4Q97A 3SE3A 5GGRA 5J9PB 1I1AC 5C2UB 5ISZE 2PYFB 1Y6NR 3SDAA 3VWJB 4UILH 4X80L 2BNRA 3GMPA 2DMKA 3BIKA 2LVEA 3OAYK 3R06A 5J06A 5KSVB 2IAMA 1Q72H 4I0PC 1UXWB 5A40E 1RK0B 3UZEA 2AK1H 1NANI 3DX6B 3LKRB 4NKMA 1RZ7L 2QADD 3ZHDA 3ALXA 1KCUL 1L7IL 5HHOB 3BPLC 2GITA 5K9JL 5I71B 2CRZA 4O4YH 4BFGA 1CGVA 1R24A 4I3GA 1OB1B 2MKWA 4X6BB 5FYLD 3THMH 4GG6E 3HZMB 3QIBB 2HN7B 2IADA 4LSPH 3OAZK 1GCFA 5GRJH 3QAZB 3UTZA 1TJGL 1T2XA 3WFCH 2A9MH 2JCCB 2YA2A 3ABZA 3BMVA 1NBVH 5E2VH 4GG6F 1Z9LA 2WUCL 3C8KB 1AKJD 1QSFA 2YBRB 2X89D 1KCSH 2BXZA 2VDRH 3HNSH 4FQXB 4GW1B 1IVLA 2G2RA 3OKOA 4U1NA 1VCAA 3RZCB 1CS6A 4CVWA 5IFJA 2FSEA 3PXJA 4P4KB 3BD5A 3I9GH 1A7OH 3T65B 1NUFA 3GSRA 3MCLH 4JFFE 3E2HB 3BKJH 5ECJE 3MRGB 4OFKA 1H8OA 3N06B 3OKEB 5HHXH 5M95B 2FR4B 1P7HL 3VFSB 3AREB 1OCWL 4CU7A 2GKIA 3BKYH 4Z0XA 2BX5A 3UTSD 2X9YA 1QBBA 4HIHA 5IIEB 1KB9K 5DO2D 1A7QH 1FVCB 2A0LC 2BXYA 1G9MC 2UY7A 3CFBA 3WXVH 1D5ZB 1KJ3H 4G9FA 3O3UN 3GSOB 4P9HC 3BPNC 3RJQB 2AGJL 1U58A 5F96H 3MCKB 3QRGL 2HJKB 5JR1L 2BY2A 1SEBA 4XMKH 3QDHA 3KXFE 3HR5B 1T5XB 2KUTA 5EPMB 3LEYL 3BDYH 4XP9H 2F53B 3VWKC 2QSQA 1P2CB 5D1ZB 3F7YA 4G9DA 1IGYA 4XXCC 5HYQA 4S1RH 4Z7VB 1J10A 5L0QC 4FFVC 1U8LB 2NY7H 1MI5D 2R2HA 4NQXB 5JIKA 3GHEL 4AMKH 1VPOH 2LU7A 1WFOA 2EIEA 3SE9H 1UB6B 2DF3A 4HC1H 3QUXA 2XWBB 1JGLL 1I3RA 2F19L 4OFVA 4OD1H 3OB0K 1MLBA 3S36H 2VDMH 5K9QG 5IB1A 1Z5LA 1H5BB 3VGDA 4PJCE 4I48A 1Q72L 1CU4H 1EEZA 4PJAA 1HH9A 5IBUG 1UJ3C 1SM3L 3IF1A 4OF6A 2X7LB 1DBKH 2AK1L 1DBJL 1R3LB 4M1GH 1XGTA 2CMRL 1GIGL 1HH6B 4P2OA 4HIEA 4M6AA 2EYRA 4O4YL 2NTFB 3O6MH 3FN3A 4MAYA 4APQD 1DDHA 3SE4C 1P7QD 2B7DT 2ITCB 1QTYT 3THML 2R8SL 4MAUH 5F7MC 1JGVL 4PV9B 1HYRC 4LSPL 4Z77A 1NGPH 3B9KD 5F8QC 5GRJL 5I75C 3WFCL 4OZ4B 2A9ML 5DJDB 3OBAA 4MJ6B 1F02I 5CINH 1NBVL 3BPCB 1IEBB 2EH8H 5INCA 5C0EA 3LEXA 4JFPA 2MFNA 1QLRA 2XWJA 1XGQA 1V7MH 5GIRA 3TJHC 4E42B 4J4PA 1EFQA 1KCSL 3HNSL 5IF0A 1BGXL 4KDWA 5I15H 5CGTA 3MJ7A 1UKQA 2IH1B 3I9GL 4BA8A 1HE7A 1LEGA 3D87B 4ODUB 4LCCB 1HSBA 3MCLL 3ARGD 3BKJL 3VDCA 2HRPL 1RJYB 1SJHB 4K3GA 2DWEB 3P30L 3FOLB 2X1XR 4OLVH 3WL9A 1JWSB 3ZZ1A 5EC1A 1P53A 2R1WA 3PL6C 2B8OT 3OR6B 4YHPA 5H8DA 3BKYL 5A3ID 1M05B 4PTTA 1HILA