3EJZD

Structure of e203v mutant e.coli cl-/h+ exchanger, clc-ec1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intracellular proton-transfer mutants in a CLC Cl-/H+ exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Immune system/proton transport
molecule keywords H(+)/Cl(-) exchange transporter clcA
total genus 46
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejzD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejzD01
1E4XL 4JFQA 4HXAL 1WQVT 5K9KA 5GSRB 1A3RH 4YC2B 3PXHA 5ACZB 1SMOA 2EEAA 2CIIA 5IBUG 4ZD3H 5L2JB 3KGRA 3EJYD 3PL6A 2D7TH 3LPGA 4P5MB 5C0BA 1MFBL 4RGND 2BNRE 3GIVB 3B3IB 1UM4H 4JPKL 5HGHB 5T5FL 3SKMA 5A43C 2FR4A 3SDXE 4NQCD 1YEIL 3FB7A 3INUL 3WL9A 3DMMA 2H3NB 3VFRB 4QGYA 6CGTA 5TDNA 1IE5A 4IM8A 4PRIE 2GTZB 5J13B 1CQKA 2ADIB 3KPRE 4AIZA 4D2NA 4HBCL 5EN2A 5MI0C 2W07A 5D7JC 1RQ5A 3KJ4C 3KLDA 5E1AB 3GMLA 5J57B 4K71C 3RJQB 2A1WL 5BV7C 5KSAD 1CFQB 5CJ8A 4TSBL 5ESQA 3HNSH 4ZUTA 3RWEB 4N0FA 3ZKNC 2VWEE 1QLFB 2VC2H 3BKMH 1QFWH 3VXUE 4F58L 4N8VA 4N0UA 2J8UE 3H42H 4UMGA 4UV7H 3L3KB 5HDBF 5A3IC 3LH2L 2BVUA 5IUSA 4ZFZA 1XGUB 2ITCA 5CHNA 4PJAB 3B2UC 4P46B 1OARH 1CBVH 5SX5K 1BZ9B 1BZ9A 5CCKL 4ZDHB 3TNMB 2V2XB 2ARJB 4QRRE 5GGQL 5ICZB 1G7QB 5GS0D 5D7JA 4XPFH 4LPTA 2WAHA 4HS3B 4Q74A 1INQA 1PQZB 4KHTL 2QHRL 2X4PA 3ZYIA 3RWGB 2J6EA 3KS0J 2OMBA 3VFTB 1SYVB 3H9SD 3BP5B 2AS5M 3CXDH 1C5CH 4H1LG 5GGQH 4XMLL 5ITFB 4NQVA 4P3CH 5EZJA 1L0XA 3GUTB 3OGOE 5EO0A 1F4AA 1H5BC 2VIRA 5LQBH 4G6AC 1SBSL 2HG5B 3WUWB 3O6ML 1DLFH 1Q1JH 2D9QB 1INEH 4RCAA 5F1KC 5I1DB 4AIZB 5T1LD 3CVIL 2V5MA 3NPZB 1U8KB 2YOCA 1QG3A 5FOJA 4K8RD 5CP3H 2MNUA 4WO4A 1IAIL 2MQ0A 2W38A 5BCAA 5CEZE 1WAAF 3FRPG 3RIFF 4GKOA 2R0LH 2NW3B 2HWZH 3IU4H 5FKAA 3ZKMD 3NCBB 2R4SL 4Q6IB 3QFDA 4JY4B 4NRYB 4NDMB 1YZZA 3QUXA 4FS0A 1EZVY 4MS8C 5IHZA 1W0YT 3GMOB 4JY4A 5AUMA 1LK2B 2NY2D 3I6KA 4XNXH 1LILA 3VGBA 1NGPL 4QWWD 5JIHA 3MXWH 1RULL 1DEEB 3O6MH 3BGMB 3VXME 4L9LA 4ZNEA 4WFHE 2J3SA 2V2TA 1UA6H 3TCLA 1A9EA 3TZVB 3FKUS 3V52L 4NM4L 5BVJB 2XZCL 3LN5A 5FDWB 3C60D 4GXVL 1VEOA 2B1AH 2Z8VC 2HFFB 1OSZB 1HXMB 1NKOA 5HHNB 3T3MF 3L3IA 1ZLVH 4XAWH 3MX0A 4QGTA 4P4KD 5E9DE 3UAJD 5GJSL 3TCXA 3GSWA 3PQYE 4R90H 2AJYL 3FQNA 4Y5XA 3VFVB 3T3PF 1ZLUH 3HRZA 1U8MA 4O4YH 1YNTB 3EYVB 2A9MH 1HZHL 5ALCL 4NO2A 3GSNL 3VFTA 4KV5F 1MLCB 3GKWL 1A6PA 1GXEA 3ARFA 4CMMA 3PWPB 3H9HB 1ZMYA 3MBXH 3H7BA 2DM3A 3BQUD 4HKJB 4F58H 1NMAH 2AI0L 3CJJA 3EAKA 1AIFB 3V5HA 2VDNL 1F6AB 4ZDHA 5L0QB 1QPXA 1NDGA 4FQXD 4P46A 2BVTA 2Y1VA 5TDOB 1WTGT 2EE6A 2PW1B 1SY6A 3VMPA 3IAPA 3RIAF 3IDMB 1C5CL 5T3ZD 3CVHA 1MHPH 3FMGH 5HHMB 3J7HA 5L2KA 3TVMA 3EIFA 2AXGB 5IVOA 3BUTA 3S5LA 4L4TA 4FABH 1U95B 3N1QC 4DZBB 4KJQD 3V4UL 3QIBC 3Q3GB 5FIEA 3BWAA 1J0HA 4YC2C 3DROA 4RZCB 2YD7A 1S7TA 1CDGA 2H2SD 2WZPD 2CIKB 4PGBA 3RX8A 1U42A 2LU4A 3AVEA 1T0NB 1T5XA 4QHKI 4X9GA 1M7XA 5HVFB 4OJFH 3U7WL 4H26A 4Y1AE 1RY7B 3QI9D 3FB7B 5D2NA 4PG2C 4FNLL 5HGHA 4G8FB 1KN4H 1CE6B 2NYYC 4R7NA 3AS0A 4X5WB 1YEHH 5J6GA 4K23L 5F89B 4JM2B 2NY0D 4LCUB 5L2KD 1JI1A 3TPUB 5C0AA 3S3SA 3W9DB 3HZMB 5E94B 3PL6B 1U9KA 3A6BH 3PNWA 3VI4E 1X5YA 4OBSA 4EI6B 5SWZD 5BV7B 2E6JA 3ZKMC 1CVRA 4G9FD 4JY5H 5EIQA 5GZNC 5IG7B 2VDQH 1BGXL 4YO0B 2DWDA 5IWLC 1MAJA 1NMCB 3BH8B 4NKIL 4GBXA 1TZGH 5ID0B 3LRGA 2OL3B 1QA9A 5E4IA 3T0EA 5FFLA 4XH2A 3MRBA 1J87A 4MJIA 4PJCA 3TV3H 1A6VL 2W0PA 4WUKH 3BW9B 5JHDE 1U93B 3GMRA 4N0YL 4N8CL 3TFKC 3OF6A 1WBXA 2R4SH 2VLKB 3IFPB 4KKCD 4P2RB 4UT6H 3VGFA 1SHMA 2NNAB 5DR5H 3MRFA 5IVXE 4F15B 4EKXA 2JK5B 4Y4KB 1I9JH 3MLZL 4YDIL 3L3JB 2QKIB 1NUGA 4KMQA 5HDOA 1AFVH 2R29L 4NNPH 1MJJA 2VDOH 1XMWA 3RKPA 3VWJA 4OLVL 4JJ5A 4ORZC 1T0MB 1X5JA 3RBSA 2V7HB 4XHQA 2DL9A 1UZ8B 3BQUC 2ZOLB 2DB8A 4Y16B 1EAPA 4FQPA 5E24E 3RVXC 3KNBB 4X6BA 3T77A 2DI8A 1MCWM 1I8MB 3QEQB 3C8KA 1SEQH 2J88H 4QY8A 4FFZL 4KRPC 4GRWB 4Z8FH 4JFEE 2GITA 2YUZA 3PG2A 4TVSa 3MFFA 3M8OH 5E8PB 3UZVB 1RI8A 4XNMB 3NA4A 1QRNE 3HPJA 3K3QA 3OKKA 1S8DA 5IF0B 1RVFL 5F3BA 1NEUA 1EHLL 2PO6A 4JM2C 5C08B 1V7NH 1QBLL 4S2SA 3WNNA 3MRIB 2VXUL 1J10A 1TZIA 3CCHA 4Y4HC 3ZL4L 25C8H 2BFVH 2DN7A 2CDFB 2ICWI 4XP5L 1HOCB 4CDHA 3EYFA 4XVSL 2PO6D 4X4YB 2ZJSH 1HSBB 3SQOL 5I1JL 1M71A 1BBJB 4LRIA 1XGQA 5LWYL 4G7YH 4YHKH 1FL6B 2ZCKL 1HHIA 5SWSE 4EZMA 2R2EA 4LRNL 1G7LB 3IJHB 3EJZD 4YDVA 4JFOB 4HZAA 4FFZH 2DI9A 4ZS7H 3B9VA 3AAZA 4U1KB 4P2RD 1HI6A 3RP1A 2X89D 4Y1AA 4ZS7L 4YHPA 1E6JL 2RR3A 3DTXB 3O8XB 4H20H 5BS0E 3X14A 2E7CA 3WXWH 4LGRB 5GRJL 1RD6A 3TA3D 3W0WB 4U7KA 5JDSB 4PJCE 2QQLL 5CMAA 5SWQA 1QQDB 1EO7A 1GL4B 3TNNB 1N5YL 3NIFF 4OV5B 2WIIA 4LDEB 1YEGL 3UCRA 4WO4C 2R23A 4Y8DC 1OP5K 4H25A 2X4RB 4XCEA 4F3FB 2HMID 2W60A 5A2JH 3CDYA 4PJGF 2WWKO 1BJMA 3P11L 3PGDB 4NZRL 4LGPB 3PQYD 2NY1C 3WKMH 1RJYB 2DLFL 4LLVB 1JF6A 4S1QL 1HYSC 2AVGA 4WU5B 1ZHNA 3BGFB 3ZYZA 5DQ9B 2AJZB 1T4KA 4KKCC 4HKZA 1T20A 5FUOH 3BD3A 4C56D 3GSXB 3CDFA 3K2UL 4HK3N 4KTDL 1M1SA 4KJYA 4I48A 4UOW0 5C0GA 3WDJA 2BNQA 4NBZB 1A4KB 3F58L 4WJ5A 1N0XL 4FZEH 4Z7UA 5JMRA 1KPRA 2EXYC 5LQBL 5KG9A 3I9GL 1GIGH 4AQOA 1RJYA 2DM2A 1QLEH 2NY5H 1HYRC 4OCNC 5EU3A 3QDJE 3PUCA 2HP4A 2N7AA 3HPLA 3RI5F 5DWUH 1NEZB 4IOIA 3MLZH 1WCQA 3TPKA 1WISA 3O3DB 3SKJL 2ERJB 3ARGA 4ZFGH 4PJ7B 5L8KB 1VEMA 3BH9B 5SWQB 3QB7C 4TTDD 1QSVA 3DOSA 4GAJL 2P5WE 5IFHL 1Q9LB 1TXKA 5CLTA 4JLRB 5DI8B 4RX4D 4LSVH 1FV1A 4L3EE 5DRZB 4HC1L 2LAAA 3WN5B 1FPTH 3TBVB 8CGTA 4YE4L 3HUJB 5F1IA 4P9HC 4HBQA 5EA0H 1U8PA 2BSTB 4YDVB 5JQ6H 1VESA 5DK2A 4JVWA 4HEPG 2X40A 3W9EA 5EO9B 4MQTB 4XI5C 3OXSA 2ZPKL 1OAXH 1N6UA 4H5SB 3S97C 3QWOB 3MJ8B 1MCOL 3EYQC 2VXQH 1T04A 5D71H 1OAXL 3QQ3A 1TZIB 1A1MB 3CCHB 4RGNB 3D0VB 4BK5A 5AAWA 3EJJX 4FQ1H 3PWNA 4PJEF 1TIUA 3RL1B 3B83A 1D5IL 5I71C 2F8OA 1Q0YH 1II4E 4JO2L 1KCSL 3MV8A 5F9WB 5E2TH 2VZVA 1E4JA 3RL2B 5LGHH 1EFXD 4HV8A 3T2QA 4KUCD 4NUJA 5FKPB 5HI4C 1UKSA 5FDYA 4ZD3L 3PWVB 4QEGA 2BRRH 4Z7VF 3SBWA 3G5XB 2HTLD 1PVHA 4OZHE 4H0IA 4Y16A 3MO1A 5F7KC 1CG9A 1I9IH 2XY2A 1OAUH 4RAUA 3ARTA 3BKJH 4KI1A 4PJBE 2CQVA 5L7XL 5DJ2A 1JMZA 1HYSD 4OD1H 4KFZC 3QXAB 1OL0A 3PF2A 5IW1B 4D3CL 3LPFA 3ULVH 4KKLC 4BYHA 3QH3B 3I2CL 3P0VH 4QRPE 2XRAH 5B39G 1AKJD 2ICWB 3SQBA 5DD6A 4EIGB 2YD1A 4XCNB 3O6LH 4MA8H 4U3XA 2VJXA 5GRWA 1E27B 2DJ4A 4EIZC 5JLZB 3HUJF 2B1HL 2XZQH 3RY6C 5DQDL 2C5DC 1H3UA 5C0RH 3VRLF 3P77B 3SGEH 4FG6C 5F7HA 2H1PL 5EIIA 3GGWB 3L3OA 4OD2A 1P9MC 4WO4D 3B9KB 3WLWD 1KIPA 3T2NH 2CDEA 4BQCA 1LNUA 3SDXF 3BRGC 5D7LE 4QTIL 1I1AD 3UDWA 1MCQA 4TTDC 3WKNA 2NXYC 4TSAL 3WJJC 1YEKL 3LQZA 3MUJA 3D6GA 5TPWL 1XF3A 1KPUA 5EDXA 4PJIB 3QUYC 4JZNA 5FM4A 4BZYA 1Q9KB 4PRBB 1JE6A 4PJFB 3L1OL 1C12B 3JTTA 1JGDA 4RGNC 3RQ3A 4F57L 1G6RA 1HE7A 4JM2A 2IAMB 4C83A 2FZ3A 3B5HA 1P1ZB 1LK3H 4X5WA 3RU8L 2FH6A 4CU6A 4X0KB 5DHYB 2EDHA 2RIKA 4PJ8C 2P44B 4ZUSA 1J5OL 1A4JA 4L29B 3T8XB 2D31A 4G3YL 1H5BB 4PJ8B 1CFSA 2YWZA 4ZOAA 5HDBE 1U6AL 4XCCL 4PGBB 2X4OA 2ICEA 4CVZB 1NC2B 2VAAB 4CKVX 5CINL 3VRLE 1U58A 3KPRA 1WCBB 3T08A 4X4XA 3O41B 4Z18A 3FRUA 4XC3L 4YZFF 1Z3GH 1LO3H 1AQDB 2HKFL 1L0QA 3OMZA 2EC9T 5IVXB 1TNMA 3OQ3B 4GLRH 4URTB 4WDIB 1KV3A 5DEFA 2NY0B 4RBPK 4X6CB 1KIQB 4J3XA 4ZFOA 1CFSB 3TBWA 4P2RE 4OGYL 1OHQA 1PX3A 2VLKE 1YNLL 3DX6B 4LVNB 4P23A 1EVUA 3FN0L 4M93C 4WEBH 5D1ZC 3LQAC 4YX2L 5JHDB 2BVPA 3SJVD 5T3ZH 4YIQB 1L7IH 4C83B 3KDMB 2C1OB 3IJSA 2B8OT 4QRUA 1G6RB 4ODWA 3MV9B 3N1PC 3T0XA 4ZUVB 4O2EA 3CMOH 5DSCA 5EORH 4POZC 1F4HA 5DZLA 3T2PA 4C4KT 2PO6C 1I7RB 3WFCL 4HUXA 4NIKB 3CGTA 1TCRB 4RMQA 2DTMH 2KDGA 2CDEB 5IB1A 3OZ9L 4W6WB 5B3NA 1XGYL 1U91A 3L3DB 3QUXD 4K9EC 2OJZL 4XPTH 1MHCB 3ME0A 3ZLQC 4U1MB 5EC1B 2OJZH 2FD6L 4JE4B 5E6ID 3MV01 4OSUH 5KSAC 3BD4A 4AJ0A 2FYYB 2X10A 3SE3A 2FJFA 1KCKA 1KNOB 3WUZA 4OZFA 2ZUTA 5CZVL 5HHNA 4DCQB 3MV8D 3GHBL 2DMBA 3I3BA 5EU7C 5I6XC 4R0LB 4OAWB 1HXYB 1MJUH 4PRPD 1JHKH 2BHYA 5CJQH 1F4XH 4Y19D 1NCNA 3D25B 4P57A 4PJ9C 4OZ4B 1PZUB 1DEEA 1FVCA 4ZNEE 4NN7B 4NBXB 5CJQL 2A6IA 3NFPA 4EI5A 2ENSA 3SCMA 1FH5H 3T0VA 4F7EA 3LEXA 4N0RA 1BQLH 3UTZA 4RFEA 2XG4A 4L4JA 4NKIH 3P9LA 1LP9A 4L8SA 4KK9D 3SDDA 4YUEH 2QQNH 1IM9A 1YN6A 1X5ZA 3WYRA 4XPTL 4L4VD 2QL1A 3L7EA 2GQHA 4GRMB 1T1YA 3GJEB 1ZEAH 4RGMB 3IAQA 4OZHA 5J12B 5CJBA 3D87B 1NCTA 2YA2A 5J7CC 4PJ8D 2G9HB 4YR6B 5D7IF 3PWPE 1WWCA 3MOAH 3IDXL 4MQXC 3ULUL 1RK1A 4A6YA 3VDCA 5F8QC 4HIJB 1IAKB 4I18B 4BUGA 4TYUA 4X6DF 4NQVB 5EZJB 1JPSL 3X13B 2W9DL 3GI9L 1EUUA 1U0QA 4OIIL 5IEKB 3D0VA 5HHMD 2IH3B 1YQVL 1T1WB 3RWGA 5I1JH 3MNVB 3FAWA 4PGDA 5K93A 4OGAD 4R9HA 1N59A 5I1IL 4HUMB 2IWGA 1KENL 4BH8B 1MAML 2P5EA 2JLLA 4K94L 1OSPH 3FTGB 1FLTX 4O9HH 3SDCD 4Z7OF 4PJAA 5JW4R 1YC8A 5CHNB 3MGAA 2DWEB 3VJ6A 2YK1L 3BMWA 1KLFA 3L3KA 1CD9B 3OKMA 1HHKB 1FGVL 4KUZH 1CD0A 3OXRB 3W11D 2JIXD 4NO0B 4YFDB 4N1CA 4KC3B 5C0DA 1LDSA 2QADC 4BSJA 1MREL 2QJDA 2CGRL 5DJDA 1CFQA 3TO4D 5JPMB 4ZS6D 2YD4A 1G84A 4YHLH 1ND0A 4M6OL 1DQQA 4PJ7A 4KQ4H 4P23C 3CLFH 4WWKB 4X83A 5HDLA 5HHVL 3DXAB 2GTZA 4KI5F 4ODBD 4FQ2H 2ZUVA 3Q5OA 4UV4L 1DE4B 2VOTA 5MEQB 2DYPB 3RWDA 3DX9B 4CAGA 4NPYB 1KPRB 2ZUSA 1JMXA 3S88L 3EHBD 4UILH 3VXRB 3TO2A 2XV6B 3VG0H 5DWUL 5C0AE 4U1HB 5D1ZD 4B7IA 3O6KL 3QJFA 1NBZB 2HTLC 3GSXA 5DD5H 1F02I 4M6NH 3IDJA 3WS6C 1DVFD 4JY6A 3L95A 1ZHNB 3G5YB 5CBAB 4PG2A 4HFWB 1JNHB 4XVUD 1DVFA 1WFNA 4K3JL 4PYGA 5DUBB 5GPRA 4ZUWA 5IHUH 1F58H 1WITA 1KIRA 2EDLA 4P2QD 5DD5L 3JVGC 1ZA3A 1DLHB 3KPMA 4PJEA 2XNAB 4JN2B 1EO8H 1QR1A 5EOQL 1MI5A 3EYSH 4H0HB 1Z0NA 3CZJA 4M02A 3D69A 3LQAL 2ILLA 4NJAL 2ZOKB 4PJGA 4NRZB 1KJ3H 3SDCB 1BVKA 4OJFL 4CMHB 5E00B 4ELMA 1AQKL 2ZKHL 2WWKT 2G5BA 3BKCH 3FCTA 1JYNA 4NQSA 1X5IA 3MNZA 4OZGE 4MXWL 4OCWL 4XZUA 3ULVF 2YKLH 5EUOA 5E2TL 1T6WA 5IQ7H 1NBVL 1GZQA 5KAQF 3I6GB 2A6DA 4J4PD 1BFTA 3LD8B 2BNRB 3LKSA 3SKJH 1YY9D 8FABB 3DECA 3S35X 4I9WD 4JRXB 4HH9A 3UJTH 3RX5A 4V2BA 4TNVK 4KK9C 1OT2A 2YK1H 4E41D 4YBQD 3WO4C 1NANI 3HMXA 5E7FA 1CT8B 3KPRD 1I8LA 2XA3A 4PP2A 4J8RB 3D9AL 2R0ZH 3QG7L 1UADC 4J6RH 3VWKA 2AJ3B 4HXBH 2WP3T 5BJTA 2ZKHH 5M95B 4BSVB 2EDDA 1NMAL 3B6SA 4XP4L 3U82B 3HC0B 3D1MC 3T0EE 2BSRA 4Q9CA 4HMCA 1EXUB 2XWJB 2FEDD 1A7PH 1BD2B 3QDMD 4XNYL 3ZT5A 4S1DD 3RDTA 1G7PA 2A6DB 4NRXB 1YY8B 3VRJA 1PX4A 3ALWA 4ZOBA 3VXSE 1T0MA 5JO5B 4K7FA 4QHUB 1RZ8A 3C6SB 1HCVA 1RV6X 1X6NA 2Z31D 3MNZB 2X4SB 4OLYL 3QDME 1K2DA 4UT9L 4OGAC 3OJDB 3WFEH 1Z0MA 1IKNA 2ESVA 2X7LB 4M4RA 3WHXB 3HC3L 3B9DA 4OFPA 4M48H 3TF7C 3VGAC 1F8TH 3O3UN 4JGJA 4XWGL 5BQ7A 1A1OB 2PETA 2VABB 5T1MB 2QQLH 3KAAA 5H2BB 1B6DA 1KJ2A 5ETUB 1JL8A 4GKZB 3V4VL 2EDFA 5JHLH 3F7PC 1AXTL 5E2WL 1WTLA 3I84A 1BFVH 3PDDA 4IRSA 1DLHA 1U2HA 3FHAA 4IRSB 4UOW1 5KVGL 3OB0H 3JSSA 2VMFA 4QCIB 2OL3A 1MH5A 2C4XA 3U79A 1KXQE 2CUMA 3DLQR 3JV6B 3FAXA 3QUXC 5FK9B 5HHOB 4JO4L 4U3HA 2ADGB 4HCRA 1U3ZA 3ZTJH 2YA1A 3MXVH 1TJGH 2FBJH 3DRTA 4UT7L 5F9WC 3QULA 2GAZA 2PR4L 3DBXB 4G8IA 4M7JH 3RGVB 1I8IA 5GZOD 2AXFB 1MFNA 4R8WL 1K2DB 3BEVA 2PUQT 4IS6A 3DXAE 2VLMD 4YFLF 5E08H 2H26A 2Q3AA 2P8MB 1U8OA 4R3SB 2VUYA 5E4EC 4P5TD 1P4LA 3RY5A 4G8FA 5GGVH 1MF2L 5F7WC 4Z0XB 3ULUE 4LQFH 1DE4A 5EU5B 1SYSA 1U3JA 4X7FC 1AD9A 1U2CA 1G0DA 3M8OL 5BV7L 2BNUB 2IPKB 2Y7QB 3RWIB 4X9IA 2F54D 2I07A 4YHIB 3R8BB 3RNKA 3DRQA 4Z95H 5IR1A 4NFDA 3REVB 5I30L 4MNQA 2VDML 4HLZH 4ODHH 5D96C 5DJ6A 2XYCA 4HPOH 4OCRH 2EICA 4PP2B 1T22B 3CZFB 2DQFA 3ARFC 5JIPA 3TBYB 5EU6B 1BQSA 4LBEB 1JPFB 1WC7A 4YH6A 1K9TA 4MAYA 4DUXA 1YNLH 1HCFX 3LRSB 2G75A 2BNRA 3LKSB 1UJ3A 4DVRL 2D0HA 1J05B 3FQTB 4JO2H 3QDJB 4ZPVB 5GGVY 2MJWA 2XKSA 3KJ6H 4NQEE 1FVEA 2VLJE 5GS1A 5C71A 4ETYA 4HKBA 4OF7A 3UJJL 3B2VL 3PWPA 4CMMB 4Q0XH 3QEGH 3QIWD 1REIA 3IXAB 3U46B 2CXGA 3W82A 3NH7H 3ARRA 2COQA 1A7QH 1S7WB 3IS0X 3WJLA 2MKLC 3CDGA 2HT2C 3D69B 1VGKB 2BVOA 4ODXB 4N0UE 4I13B 1N3NA 2IAMD 5DVKA 4FQIH 4JDTH 4Q7DA 4KK5C 4JN2A 1IQDA 4CU8A 1L7TL 2X1OA 4UNTA 2HFFA 2EYTB 3EGSA 2UVFA 3SJVB 3LN5B 5AG9A 4I0CC 5CBAA 2OS7A 2RFXB 1KCVL 4PRID 3L95B 2W0KA 4MXVF 3O45A 4M7ZC 3P9LB 4GRLA 1CDHA 3W0WE 1LK2A 3I6KB 3OX8B 4RDQG 5DC4B 4RAVB 3BEWA 2A83A 1FL3A 4ZPTA 3SDAA 1FDLL 5D7JD 3ECBA 1NAKL 5I66A 3BIBX 1D6EB 3KYNA 3MRGB 1AR2A 4WHDA 4K3EH 1CXKA 1XCTB 3SGKA 1EAJA 2R9HC 1P7KA 1UQSB 2EECA 5T3XL 3VWJD 5ADOL 4ETQB 3IDUA 5TDPB 3IF1A 1NGPH 1ACYL 1ADQL 3HKFA 4QRTB 1V5JA 3GMNB 4GH7B 4TNVF 4OAWA 4I77L 1BQLL 1NSNL 1VHPA 1FJ1B 1WEJL 4RQQB 3RAJH 5FO8B 1AGFB 3MGTB 5IFJA 3X3GL 1YJDL 4GW4B 2EKSA 1GGYA 2IFFH 4I8DA 3IDIA 4PGZA 5ACMA 3VXSA 4KZDH 4YXHL 4JPIB 3K8MA 4PGCB 2FH8A 1L6ZA 3GUTA 1MHCA 3HNTH 4GJTB 5E7BA 2FL5A 3O4LA 5C6WH 1I7RA 5EU6D 1VPOH 5GISL 5BZWB 3VCLA 4XP4H 3DUUA 3P4OB 5IMKB 4KY1H 4JFEB 5E8EB 4TULH 4X7CC 4FXLA 2DWEA 3W5MA 1HQRB 4CBPA 2WV3A 2PNDA 4KV5E 3QHFH 1I3VA 4XC3H 3MUHL 3KDMA 4RFNC 2E7MA 3AREA 4XWGH 5D1XA 4W6XB 4PJHA 3FTGA 2BVPB 4UDTB 2JB6A 1BLNB 3BD5A 4MNGA 1CK0H 1IGMH 1QSEB 3WV0A 3FT2B 3BIAX 1JWMB 2IH3A 3G9VA 5DEFB 3VFUA 1PG7X 2UWEA 1NMBL 2AEQH 4XP1L 5HYEA 1KGCD 1QSEE 5T3ZL 4X7DC 1RSFA 3U9UA 3ZDXF 3PQYB 3UC0L 4MXWH 4S11A 1B2WH 3UROR 5E1AA 1XIWB 5CP7A 1N8ZB 1MQKL 3BUYB 1SM3L 5GHWH 3VDBA 3UJIL 2HLAA 1L4IA 1OAQH 2Y5TA 3PGCA 4DZ8B 4NWUH 4WHTB 5I8OH 2EZ0C 4KMLB 1FL5A 1KT2A 3V6OC 2FX8H 1DN0B 2PN5A 5D9SB 3F7YA 5GS1C 1AO7B 1G6VK 2DKUA 4PLOB 1JHLL 3V6ZA 2HWZL 3VH8B 2SEBA 2XQBH 1GZPB 3VRIA 1QR4A 1P2CB 3MROB 2UYLA 5C0RL 3S3JA 4N1EA 4PRPA 2P49B 3UTZB 1IC5H 3VXPB 2B5IC 1HIML 2X4NA 3O0RL 4QXTA 5IHUL 2DQTH 4C55A 1WIOA 1NCBL 2OZ4H 5EZOL 5HGDB 1OP5H 4C59B 1ACYH 3FB8A 1FFRA 2FHFA 2B4CC 5DK0A 5EFIB 1RHFA 2APBA 2IH1B 4OLVH 1GC1H 4HUWA 1LDPH 1UA6L 5E6IC 5GRJH 3MZGB 5FYJD 1JZ5A 3GJFK 3G5VB 4W4OA 1MY5A 4WFEE 4F2MB 1JGLL 4F2MA 3ALPA 1I7ZA 3QXWA 3MODL 3NIGE 1HQ4A 4KTDH 2GJ6B 1A7OH 1NGYB 4LQ1A 1V8HA 5I0DA 4X7EC 4PJ7F 2A9NL 2FX7L 1MWAB 3MCKA 1PLGL 1V7MH 5KOMC 4Y4KC 3QUKA 2LAGB 1Y18B 4O2CB 1TCRA 5C6TH 1H8NA 4RWYH 5DEGA 1FE8L 3B5GA 5JR1L 1L9MA 1PKQB 5C9JA 2YD2A 4OFKA 4YHMH 5FYLD 4FP8H 4I77H 2XWBB 25C8L 2UYLB 1P2CA 5IMOA 3MLTA 2Y07L 3T0EC 2R0ZL 3QG7H 1DEDA 2YPVH 3LKOB 3KPQA 1FSKC 1MFCL 2CKNA 3AXLA 4JKPL 5DJAB 3W39B 5DMGC 1R3IL 1UXWB 2P24B 2P5ED 3QI9C 2I60L 5CIPB 1EFXB 3AM8C 4XHJD 2OP4H 5F21B 4YDLC 1T2JA 3MRPB 4HPYH 1OP3K 2QSVA 3G9AB 3FO1A 2N4IA 3RL2A 3BUYA 1FZOB 3GSUA 3D2UA 1A8JH 1KTRL 4Z7UF 4ODUA 4XCFL 1U36A 5JORB 3R4DA 2EDEA 2YKLL 4OKVA 2C3HA 2Z4QA 4FOMA 5C8JB 2K7QA 2X4OB 4LEXH 1EFXA 1BIIB 1QO3A 3A6CL 1IKFH 4J1UA 1UXWA 2P24A 2VXUH 3KPQB 1I1AC 3AM8A 5MERA 3TGXA 2IGFL 3AREB 5D1XB 1UZ6F 2ED9A 2IAMA 3U0WH 1BVZA 3LHPL 1J8KA 2ADFL 2VL5B 3HTLX 1XH3A 2APTA 4PJFA 2XWBA 2BVQA 3IKCA 1DBKL 2L0DA 1EPFA 1D5BB 1KPUB 2NR6C 1DP0A 1U8HA 3EYUL 4FQLH 1DL7H 1FV1B 1U8QB 1MFCH 4JKPH 4P2OC 3X3GH 1R3JB 4EVNA 1RMFH 5FOBB 1QFWI 1ORQB 4HIIA 4Q58C 4HGWB 4RMSA 4DK3A 4Q9BA 3HI1B 4WY7H 3ZE0F 4MDJA 5C86A 3V95A 3L3OB 3HHRB 4OD2B 1GJIA 1NCCH 1XCQA 3QUMB 1JPST 2AJUH 3ARGB 3VGDA 1XF2A 3ZSSA 3KPPB 1LO0H 1V3JA 1R3KA 4KTEH 2R69H 3HPLB 4M7LT 4MMXC 3C60A 1CDYA 1T3FA 4OLXH 4MX7A 5EU3B 5FB8B 3V6OE 1FCCA 4QRPB 5TDPA 4LCYB 3N1GC 3STLA 4Z5RB 5ITBH 4AEIH 5DK0B 1P7KB 4KDVA 1XCTA 3BKJL 4FQXA 1MCRA 3QH3A 1AHWC 1RUPL 1P7QD 1JZ3A 3MACL 3BEWB 2YBRB 3I6LE 4GG8A 4X7SL 1AI1H 1YN7A 2CK0H 3MROA 2WLZA 1HEZA 1T20B 3VRIB 3A0OA 1WBZA 1S7XA 4HFUL 2Y23A 2EDJA 1IJ9A 5E95B 4UTAH 3CUPB 4WTWA 4Z7QE 4RAUB 1N0XH 4M61A 1H8SA 4G8GA 5T1KD 5LGJB 4P5TB 4LF3B 3K2MC 1XGPB 1UWEL 4WENB 3VFWA 5HJ3B 5FF6A 3TJEL 4JRWA 3PWVA 3UBXA 1FNFA 4Y5YB 3SO3C 2FJGA 3MA9L 5K9QI 4NZUH 4I0PA 3LQMA 4EUPB 3W0WD 2A77L 3NFSH 2PCPA 1ZHBB 5B3JE 1AGEA 5CP7B 4ODXA 3VD7A 3CAFA 4UIMB 2XIDA 3F8UB 4YHKL 3VFSB 5KSBF 4Y4FB 3IVKA 2MQ3A 3RL1A 3PWNB 4V1DD 3VD3A 4BQ9A 3IXAA 3U46A 4JHZA 5CUSL 3STZB 1AC0A 4J3WA 4CVWA 5DURD 2FD6H 2Q7YA 1DANU 3LY6A 1BAFL 5E8DH 5ALCH 3QNZB 2R2EB 5MEPB 5J1TC 3QI9A 2XTJE 4H20L 3OKLA 2W9EL 2FX9L 4I3RH 4HPOL 2FHBA 1UB5A 4TUJB 2IG2L 4NBYB 4CVUA 1HSBA 5E4EB 4X4ZA 4L4TD 3WN5A 3M17A 5DHVA 5CSZA 3QCTH 2DMKA 3QNYB 3SGJC 3CFCH 1WC7B 2Q8BL 5HHQB 1RU9L 2BERA 3BGAA 4GXVH 4R96A 1S8DB 5MP6L 4L4TE 3QDGB 3OWEA 1LEIB 4MNQB 4WCYL 1IZJA 3CC5B 4MA7H 5BRZD 1S7VA 1PKQE 3B9AA 1JPGB 1MLBA 1UM5L 1MPAH 3TBTB 4NNPL 3WFBH 4WFGD 3KWWB 5EOTB 5K9OA 1MCWW 5KZCB 4S1DC 4RIRB 4HF5L 4PJHE 1WBYB 5C07A 4KKAC 4Z77B 4F9LC 4DUWA 1A5FH 2JF1A 1EK3A 2P8MA 2A9NH 1JHLH 4N8VG 4Z7UB 5KJRL 1F42A 3RZWA 3SE8H 4E42B 4KK6C 2IQAA 4LVHB 1FZMA 4OUOA 1T7XA 1I7UB 2CD0A 3INUH 3EOTL 2NY3C 5HHOD 1HH9A 1KBGH 2Z91B 3ZDYF 3AS2A 1T83A 3EJYC 4G8GE 5DQ9A 3V4VH 2OXGA 3JV6A 5HHOA 4X6FA 5TQ0L 4AQ1B 2APWA 2ZWLT 4QCIA 3C5JA 2O5XL 1T5WA 2DTML 3KYMB 3NACH 3CX5K 1B3JA 2IF7A 2X4RA 4PJCB 4XCEB 4F3FA 1I1YB 5B38B 4OI7A 3OHXA 4APQB 4NSKB 2EH7L 3EOBA 5GGUB 3RTQB 2XQBL 3O6FB 4QXUH 1AO7E 2MCG1 5IB5A 2DWDB 4HK3J 1WAAE 3BO8A 5EU4B 5F70A 1WLHA 2PYED 2OJEA 2EIEA 1T83C 3LRHA 1BAFH 5E8DL 1JGUH 1CLOH 3VFNB 1F3JB 3RWHB 3HI6H 4M4PA 3WHXA 4CNIA 3CLFL 5HHVH 2C3WA 1NGXB 1KJVB 4M6OH 1K8DA 3JWOL 1TZGL 5HI3C 3QNXA 4J2XA 3FQWA 3RZCA 3VE0B 5JO5A 5DK3A 1JBJA 3T4AB 5JW5A 6FABL 2JKXA 5GGTH 4ZPVA 4XXCC 3VRJB 5AD0A 4OI9A 5L9DH 2KZ1B 2V17H 4ZFFB 3RDTB 1VSCA 3ZT6A 4DGYH 3BVNA 3MRCB 1IQWH 1ES0B 2V2WB 4GRWF 4H26B 3CFCL 4LNRA 4JAMB 4FA8A 2GK0B 1ZT7B 2P8LB 2BOCA 2C3XA 3V4PH 5I8KH 5D6DA 2JTDA 4YK4C 5JMOC 4WUUE 4RZCA 5TE4L 3D2UD 5JQ6L 4X7TB 3RY6A 3PP3H 3JUZA 4X7TA 4ODSL 1MFDL 5BOPA 1MOEA 3RGVC 3ARGC 4NKDA 4R4FH 5DHXB 5F7MC 4PJXF 2VWEC 4IBLT 3TYGH 2MQCA 2IALB 4OIIH 1F11B 1Q9OA 2F9BT 3CVHB 3C5ZB 1VACA 3H3KA 3MACH 2A6KB 4KI5D 3BRDA 1YEKH 5C0BE 4NHUA 1IGTB 2XOTA 1QFWL 2YPLD 2X1WL 5DDHA 4XBPB 2FGZA 4WHYH 3QPXH 3QXDA 1P4LB 3FN3A 1YA5A 1UVQA 3QNXB 3QIUC 3OPZL 5F3HA 1RZJC 3FCTB 3DVIA 3BYYA 1I8IB 4ELMB 1YEDB 5HSFA 2ZUQB 1KB9K 3UPRB 1IQWL 4NT6A 4WUUD 4PRNA 5F7DB 1UWGH 4G5ZL 5IB3A 1JI2A 4QOKE 2HT2D 2NZIA 3I3DA 1RFDH 1S7SA 1D5MA 2ZSWB 1R6VA 5IB5B 4MCYB 4QT5A 3QFJA 5INDA 4UIKH 5GXBB 1IM3A 3VXUA 4MSWA 43CAB 4WEMB 5DT1L 3ARFD 4QHMA 1I1YA 5B38A 1WBXB 4LLDA 4NOBA 3L3IB 3QWQB 5CP3A 2FEEL 4QHMB 2HVJA 3BP4B 1DVFB 4AH2B 1JNHA 4JRXD 2FX7H 3VXTB 3B9EA 3TESA 1A9EB 1ZVHA 5FYLE 5IP4A 2I5YL 2QSCH 4OGZA 1IC4L 3U30C 3FONA 2FEDC 2J6EL 3TN0B 2DQUH 1QBML 2FLBT 2VISB 1KG0B 5F7DA 5AZ2L 5I15L 4ZQKA 1ZVSA 3QDGD 3N9GL 3IDNB 2HH0H 4CU7A 4KQ3H 4EI6A 1Q9WA 4NRYA 2XZCH 2YMXH 3HNVH 2E8YA 3DYOA 3MRKB 4WGWB 3HZMA 3QO0A 1UVQB 1WWAX 1EHXA 2CKBL 5DXWA 4HKXB 5D1QA 4LSRH 1J7VR 1S7UA 2C4FT 4Z7UE 3FFCD 4XWOD 1TPXC 1WBYA 5DDHB 1OGAA 1RUMH 3NCJL 5D2NB 1W8NA 2A2QT 3DJ9A 3MA7A 4MQSB 1BFSA 2NY3D 2UZYB 4KK5D 3P73B 5DS8A 1PGRB 3B6SB 1EO5A 3MUY1 1A6UL 3D18B 4NQEB 1JFQH 3L7FB 2LQRA 1MI5D 4PLJC 3QDGA 3DROB 1NFDA 4F8TA 4FHBD 1OGTB 5GSVB 2IGFH 5CBEB 3C09C 2ATPA 2AI0H 1IGCH 1S9WB 2F53A 2XFXB 4F37K 1KYOJ 1FGNH 1NFKA 4XPBH 2GK0A 4TOYL 4E41B 1PQZA 4EUPH 1UKQA 1I1FA 2PYEE 3QCUH 3Q6FB 1OF2A 5GJTL 2V2XA 4GAJH 5ICZA 5IFHH 4GOSA 2HT3C 4DGVH 5JW5B 3RDTD 4HK0A 5I16B 3TBSA 1UXSB 1ZHLA 2EO9A 4FFWD 5BO1L 3VWJC 1AH1A 3SDDD 4BH8A 5DGRA 1SEQL 4H8WC 4OCXH 5E00A 3D48R 4FMFA 1E4WL 1BVKB 4N8VB 1QLFA 5D7SL 4MB4A 1OP3H 3CNKA 3VFSA 5I18L 1XAUA 2BOBA 5E9DB 5DYOB 1MRDH 2IPTH 3UBXI 2FIRT 2N56A 3DPBA 4HQQL 3F7QA 4XVSH 4WI8A 3SOBL 4UAOC 5F71A 3WEXB 4IDJL 4ZXBC 1CLYL 1J0JA 3ZDZF 5C08D 4EN3A 1QBMH 3L7EB 2GIYA 1YNKH 5FDWA 1UCBH 1RVFH 1IRAY 2GFBB 1ZTXH 4K7PL 3B3IA 4G6JH 3HZKB 4QRQB 1FFQA 3EYSL 2EE3A 2RAMA 2AQ2A 3QEUA 4X9HA 4U1NA 2Z92B 1NBZA 4PTTA 3FFCB 3MTRA 2FX8L 4ORGB 2HLFD 1I7UA 1JTTA 2OTUA 4G8GD 5DT1H 5T1KA 3U2SA 1LMKA 4E42A 1H15B 2DI7A 4PD4K 1XGRA 1DFBH 4FFVD 4HQQH 1J0KA 4XVTH 3NIDE 3D25A 2FNBA 4POUB 1E4XI 2R0KH 1N26A 5EWIL 4RMUA 2C4FU 4K9EL 4NHCH 4OI8A 3C09B 5KSBE 1Y6KR 1X6LA 3DXAA 2FYYA 1IAIM 2OTWA 5TF1H 5ESVA 2Y36L 4HJGB 4MD0A 5E03A 1JZ6A 3P30L 1CK0L 5DZNA 5KJRH 1CGWA 1U92B 4GAFB 4L4VB 2FO4B 4LHUB 5D72L 1U91B 5CCKH 4Q2ZA 3IFLL 3L3HA 1CD1B 4PY7A 2BC4B 3BP5A 1IEAA 3HE7A 3SHSA 1NUDA 1KFAL 1KEGH 4C4KO 5KVDH 5HYFA 1D5BA 4LU5L 4X9BA 1PJ9A 7FABL 4X8JB 2NY4B 3J8F7 3BPOB 4ZS6C 3TA3A 4GUPA 4PJAE 5HXMA 2VKWA 3OKLB 5D4QA 4YGVA 4P9HH 1RFDL 1I3RA 4IRJC 4TRPL 2K9UA 3QNZA 1GOGA 1GGIL 4LSPH 1HSAA 2BP3A 3EJZC 4H1LB 2ARWA 5C0CE 2R1XA 4JM4L 1JRHL 1S9KC 3O9WB 1KXTB 1RUAL 4ZYKA 1CXHA 3MJ7B 3OKEB 1IGYB 1PBYA 3MLRH 3QP3A 4XB7A 1QVOB 1F3DJ 1JYXA 1EDQA 4N0FB 1GGIH 2QEJA 3UPAA 2F5AH 3IVKB 4I18A 1FRGL 1TVHB 3EO0A 3H9SA 2VXSH 4I2XA 2R2CA 1U58B 3KPRB 3TA3C 3O2DH 3ZTJG 3QUZD 4OCWH 4OCYH 3FHQA 3PWPD 4FQHB 4FRWA 4K3EL 1Y6MR 2J12B 1T21B 3FFDA 1WFOA 4KUCF 3QUZA 3UBXB 1T1YB 2HH0L 4GRMA 4HXAH 2RJMA 4P5TA 4O00A 1IARB 4LASH 4JFHE 3EYOA 5I1LB 3M1BB 4L1DA 3QAZB 3SDDB 4NYLA 5I8EA 3F62A 2FIKB 4F7PB 5DC9B 4ODVL 4D0BB 4DFHA 4WI5A 2E9JA 3PL6C 3K1DA 4RFEB 4PRBA 3NACL 3QXVA 3WJLC 3V5DA 5FA3A 4GG8B 3MV9D 4LLMA 4YPJA 5JUEH 1BBDH 4NM8L 2BSSA 5DD3L 4K9EH 3T04D 3NPSB 2WBJA 2X4QB 5EWIH 2OXHA 4U6XB 3ILPA 2VLLB 3IXTA 3Q6GH 4YUEL 4HLZG 1MWAA 5DVMA 4KRPB 4LCWE 2WINA 1QSFE 4LCYA 5F7EL 5E08L 3FQRA 2CR3A 1N0LA 3DURB 4L4VE 3B43A 5K59E 2M1KA 1CGSL 5DJCA 5HDQL 3FB6A 4DCQA 3P77A 2N7BA 4UBDD 2FJFB 3DO3A 3SE4A 1CCZA 3DARA 4RGOL 3G5VA 3FB6B 1NAMB 3UTPD 1K6QL 3U0PB 1FAKT 1PYWA 1QACA 4NO3A 5GRUH 1NGQL 4HUWB 3U6RA 5L7XH 1EJOL 4JDZA 4I9WE 1YEHL 1F90L 5IB1B 1H0DB 5DRWB 2CUIA 5E9DD 1D5ZA 3UTTB 2VN4A 1KENH 1U8QA 4WTXA 1MCPL 3MRHB 1CTNA 1NFIA 4ZUVA 2CMRL 4X6DA 4ODWB 3FFCE 4F7PA 2AK4D 3V6ZB 3O9WC 4ODSH 1CFVH 4NQTA 4D0DA 3PHOB 5MERB 3BP6B 5FGRA 3UYOD 1P4IL 4O58H 4U7SA 1D5IH 3NTCL 4Q9QL 4IRJB 5DF0A 1CU4L 3ZMRA 1LO4H 1BIHA 2X2YA 4OCXL 3QUZB 1PG7H 1QEWA 4PGEB 1W72L 5FHAL 4DZ8A 3EYQD 5I17A 4Q0XL 3T65B 5EO1A 1DBML 1J1OL 1RZKL 2JJTA 3G04A 5EBWA 2Z4QB 1OM3L 3FQUA 4QOKB 1FO0H 5I1KH 3JVGA 1LP9F 1H3XA 2WW8A 3OR7B 4GMSL 4ODUB 3QQ4A 4P59H 1JRHI 2IAND 3V0WL 2NXYB 4F7TA 3FO1B 5ERWB 5DFWH 5LXGH 3TZVC 2BNQE 3QQ3B 5HI4D 4EDXA 1QNZL 2YZ1A 4KKNA 1BLNA 1MEXL 5FHBL 4GQPH 4OIBA 3QZWA 4APQC 3W9EB 1X4ZA 3MRRB 5LCVH 4ZXBA 4GUPB 1WJ3A 1N64H 2QQKH 3H6JA 3TA3B 4DW2L 2WWMD 5FM8A 5TE6L 4KK8D 4X8JA 1Q9KA 4NKMB 1AXSA 3UTQB 4JFEA 1T1ZA 3F7RA 1QPPA 5IMKA 3LKRA 2IEPA 3AMKA 4NNXB 4YAQA 3THMH 3AC0A 4JQIL 5DI8A 1IEAB 3HE7B 1MCIA 4JGMA 5IMMB 1KIPB 2ICCA 4R2GB 1GYAA 1OWWA 2BCKB 2VN7A 5IB2A 1U92A 5DQJA 5H94B 1NGYA 3R0MA 1R0AH 1AI1L 4NZTH 2E5EA 3PWUA 3SY0A 4DKDC 2HJFA 1IC5L 3CMOL 1NFDF 5I1CL 2QSCL 4DKAA 4UBDC 2Z31B 1OD7A 4XPGH 4HWZB 3MV7D 2H9GB 5A3ID 2J4WH 5EOCL 1VFBA 3GM8A 5D1ZA 3ULVC 3MRLA 2H8PB 1AY1H 1EGJH 3IDGA 4PB0H 4ELKA 3B9KC 5E2UL 3FFCA 1G7HA 4GG6A 3QXAA 2Y9RT 4MA8L 3HMWH 3VGHA 1AC6A 1NCCL 4JG0L 4X4ME 4XTRD 1GZPA 3CFKA 1S7QB 4XP9H 3RWJA 1FQ9C 4GLRI 3VG9B 1D5XA 1MRDL 5DLMH 3WS3A 4KTYA 4HIEA 5E56A 3MO1B 5D7IE 3GSOB 2RCSH 5ENWA 4WNQA 3QO1B 4QRRA 3VFMA 4LEOB 3BN3B 1D9KC 4LLYA 4LPCA 3O3AB 4JVUA 4WHTA 2K3TA 4ZTOL 1BZQK 1UYWL 2ADFH 4O51B 4RFOH 2AV1A 3CVHH 3PDOB 4D0CB 3UTTE 3UYPA 3SE9L 1VGKA 4FTVE 2BOBB 2R2HB 2BHZA 1HHJB 3AU1B 1J8HA 2XZAL 3WE6B 1U8LB 4ZOEA 1CGVA 3KLAA 1X44A 3RZCC 4Y1AB 3OAZK 3HZYA 4LLUB 2HN7A 5IGXH 3LH2H 3RVTD 4Z78A 3X17A 4HUUB 4JFDB 3T4YB 4RA3A 4BA8A 4HKBB 1IC7H 2JB6B 1IGIL 3QJHB 3X3FL 1UXSA 4PJHB 4R97C 1CD8A 5HYSB 5HYSA 2CLVA 2VDQL 3SGEI 1HHIB 3N1MC 1EHAA 1FYTD 3B8YA 3TM6A 3BFOA 2ZG3A 1NGZB 4JRYA 1U8IA 2KBGA 1QHOA 2G75B 1A6UH 3EYFB 5J06A 43C9B 2HN7B 4OLUL 4RRPG 3CH8A 3UJJH 4OM1L 4JLRA 4ELMF 2NZ9C 4OB5L 1NC4A 3S96B 4Y7MA 4UU9A 3MJ6A 3ZDZE 5I9QB 2DD8L 4PJDB 5IMLB 1A14H 4JPIA 4WFED 5CZKA 3TT1L 2AJVL 1JF1B 5KS9F 1RUKH 5DJYA 4NO5B 4QY8B 3L5IA 4NQXA 1T03L 4GW4A 5JNYA 2RHEA 3MGTA 5IFJB 3I75B 3EZ8A 3HRPA 5D7LB 3QDJD 3BDBA 2DQEH 1FJ1A 3ZDXE 5GISH 3NFNA 4ZTPH 1EAPB 4QTIH 3GMNA 2XI9A 4JO1L 1S7UB 3KYKH 4R3SA 4D8PB 2RQ8A 2X70B 5INCB 2X89A 5GGSB 5D70H 3WNOA 1D6EA 4ENEC 3K8KA 2DLTA 2I9LA 4LHQB 4R2GD 1M6OB 3RAJL 3BPNB 3O11A 1T0PB 4PUBL 5J12C 4P3WA 1F13A 3PV7A 4XP6H 3MLUH 2Z31A 4JHWH 4YJZL 3ZE2E 3VXOA 4AH2A 1LE9A 2WSKA 2AJSH 1RJLA 3EDDA 1MCCA 3BQUA 4NM8H 1MCOH 5EZLA 5ICXA 3NCEB 2IBGA 43CAA 3QEQD 3HLAB 4GBXB 3VXRD 1CLZL 3ARPA 5BRZB 1ZTXL 5HYSG 4L8DB 1W0VB 4LCCA 3CDGB 5F96L 3MLVL 2FGWH 1ZLSL 2HT4C 3BXNB 2Q7NA 1K8IB 1MCNA 4L5FL 4XBGB 3UPRA 4YHPB 1XR9A 5GGSY 3LKRB 1YEDA 4RBPH 2X7LA 1IEBA 1IC1A 4EN3D 4U1KA 5I76A 3OJDA 4GRLC 1X5AA 4Z9KB 3DUSA 3O2DA 4GAGH 5DD0H 4DTGL 1RZ8B 3C6SA 5ANME 2D3VA 1G7LA 3MRRA 5J6GB 3RGHA 3QXDB 1B6UA 4LP5A 3ULVD 4LMQE 2ARJQ 5JZ7C 3HR5A 4KHXH 4JVPA 3SE9H 4M48L 1UJ3B 4MNQD 2IALA 1F97A 2BSRB 4OV6F 5B8CB 4FFYL 3MRIA 3IT8D 3BAEH 5F9OH 1FZJB 1M4KA 2PO6B 4LFHD 4I5BB 1GGBL 2UUDH 4JB9L 4MNQE 3G6JB 5CKGA 3Q3GA 3WHE1 1D9KD 3X12A 2PTUA 4M1CC 4L4TB 3X3FH 3DV6A 4JFED 1OLZA 3S4SB 1Q72H 3IKKA 1ULVA 4YE4H 1UJTA 4YWGH 2WBKA 1OAQL 1VB9A 4WTZA 4PB0L 3TYFB 4NC1C 1FNEB 4QLRA 2YPKA 1CDUA 3MSPA 1JGUL 3BRFA 3BP6A 3UC0H 1FO0L 5I1KL 4YHZH 4TVPD 1U8OB 3VE0A 1RJZB 5I1EL 1CL7H 3E6HA 1GHFL 5DO2C 1MJUL 2FECI 3H7BB 4A2LA 2AXFA 1NC2D 3RUGB 2R1YA 2XA8L 4HEME 4E9LA 2X1XR 3GI8L 4LDOB 3QULB 4NRZA 3WFDH 2VB5A 2FX9H 4MWFA 3LN4A 4XMKL 2B1AL 1JGVL 3HG1E 5T3XH 2CJUH 4APQD 1GIGL 4JDZB 3U6RB 2NNAA 2I26N 1GC1L 1YEFH 3GJFH 5JOPD 3U0PA 2GJZA 3N0PB 4APQA 1AQKH 5T33H 1IMHC 2P47B 4R4NC 5J9PA 2GY7B 4TSAH 1MUJB 1OAKH 1A1NA 3JV5A 1A6TB 2VC2L 3BKML 3MBEB 3KYMA 2XACC 4LPVA 1HXMA 4MJ5B 5IM7B 2J6EH 1TQBB 1BQUA 3ARWA 5I6XB 1QA9B 5KVMC 4M5YL 2FHCA 4JPWH 4F7CA 1TTFA 3LZFH 1KLUA 3ARDC 3NIDF 3D39E 2OL3H 4KI5C 2VABA 5HYJB 3U48A 4U6XA 3LZFL 3F12B 3U4BL 3LMJH 5C0IA 4HF5H 1DUZB 3FOLB 5H37G 1A7PL 4AIOA 1FO0A 3KVQA 5DJ8A 2ESVB 4JFYB 2DMCA 3QIUD 1TETH 3UZQA 4G6FD 3S34L 5E94A 2HAZA 5T3XE 4NZDA 1KEMH 5C0AB 1YMHA 5D2NE 3P9MB 3AGVA 5BS0B 4K8RC 2Q76A 1C7TA 4Z77A 3ARXA 5MEQA 1G7PB 5FA4B 3ARED 5D1XD 2GJJA 2OR7A 3RVUD 4L3CB 1U8KA 3VXSD 4Z8FL 4KRLB 1FIGH 5E6IA 3DVGA 3TBTA 2Q20A 3OPZH 2JJSC 4ZXBD 4MA1C 1W8OA 3VGEA 4OLYH 4PREB 4G7VL 4NNYA 4DZBA 2B5IB 1FNGB 3WIIL 4CGTA 5HY9A 2PXYA 4PS4H 1H3GA 1F2QA 4L8CA 1IVLA 1HHKA 3CD4A 5MI0B 3O9WA 1EVTC 2X1QA 5KOVC 4HS3A 2V7NB 1ONQA 3IRZA 1G7JB 3NBNA 2XWTB 1QRNB 1F4WH 1I1RA 5E99H 3QA3A 4LSSH 2YPLA 5AYQA 4XZUB 5D7KE 5BZDB 3U83A 1FYTA 4AMKH 2ZZUT 2CDGB 4PJDF 1IGJB 2OBGA 5GS0H 4F33B 3CFDB 1MVFA 2ICWJ 2GSIA 1FFNA 1NGWB 3ARFB 4UTBH 4UDUA 2UZIH 2ED7A 1T1WA 5CKAA 5FGSA 1KCLA 2PXYB 5DQDH 1ZK9A 2YUXA 4PJGB 1UFUA 4PY7B 1FNGA 5ESQB 4TQEH 1OTTD 1PEZA 2D7NA 3IFOB 4LHUA 2GK2A 3GZKA 3HR6A 1CYGA 3HRZB 5DC0A 2OR9H 5BW7C 5TGBA 1AGEB 2DQJH 1MFBH 3PHQA 1ZA6B 1GCFA 4NJ9L 4Y5VB 1PEWA 5I71B 4DJMA 4YQXH 1OSZA 5BS0D 4CN6A 2A9ML 5BVJA 4NC1E 4YDIH 1CFNA 4XPAH 1MFAH 2VH5L 2Q76B 4JY6B 1RUQL 3GIVA 2HFEB 4AEIL 4Y5VC 5KVFH 1IM9D 1D6VL 1AP2B 3K4DA 4XAWL 3DO7A 4UT6L 1R24B 2DQGH 3QWRA 2G60L 3HMXL 3MQIA 1FO0B 5IIEB 4MJIE 4DAGH 3U0TB 2H2SC 4PTTB 1ED3B 5C0IB 4NDMA 4FFWC 4XI5D 3QFDB 1OB1B 3RTQC 5E70A 3SDAD 4EI5B 2DM7A 4Y5YC 2EIZB 4S0SD 2R0WL 1KULA 3A67L 5AYUL 4FN0A 5T5NF 4XP6L 1JTOA 1HXYA 4NKQB 2YD9A 5J11B 1ZT1A 2GSGA 5KW9H 5E2UH 4KVNH 3O2WL 4MX7B 4EN3B 3MOBH 4TSCH 2AERT 4UQ3A 1VFAA 3OKNB 1I1AB 5J9PB 4FQLL 1Q94A 2LABA 3U4BH 4XVJH 3BESR 3VXRE 1XF2B 1EMTL 3LKNA 3MLYL 5EC1A 1QYGH 5KTEL 1G6RL 5DYOA 4WHYG 1BWMA 4MDJB 3HI1A 4XNYH 1NPUA 4HW6A 3UP1A 2D03H 3AB0C 4G9FB 3T3PE 4H0GA 4NQCB 4Y16D 2EEBA 4UDUB 3OKMB 1Z5LB 1DLFL 4FXGA 1KJ2L 3MNWB 4RMVA 2EYRB 5C6PB 4U7MA 4JCMA 2VL5A 1A6WL 2V5YA 5D7JB 4KAQH 3TFKD 4MA1B 4Y2OA 1NCWL 1JGVH 1OF2B 1OQXA 1VKXA 1NCBH 3T0DA 5GRVK 4J1UB 1MNUH 3TBWB 4DVBA 2QLVB 4M62L 4XPFL 2F53B 2XFXA 3DV6B 5BV7H 1TJIH 2ATPB 4X6CE 1L7IL 5BXFB 2PXYC 4LCWD 4P4RA 3GMLB 3JV4B 1WCBA 3D2UB 5CZXD 2GT9A 4LAQH 2BY0A 4OF5A 2DAVA 5IVNA 2KL6A 4KY1L 1LVEA 1BOYA 5KS9A 3KXFB 3M45A 3HMWL 3P73A 3FT3B 2VZSA 4BFBD 2A0LC 3MA7B 5IGXL 3HI6L 3KPSA 3S4SG 4LLQA 4YBLC 5FA4A 4JQVA 2PR4H 3NPSC 1XIWD 1TITA 3CSYA 2YD8A 5SV3A 3GI9H 2ZUXA 4CMHC 3GO1L 3MV11 3O9WD 4M43H 1KCRH 5L2JA 5I76B 1HILB 1UYWH 1R3LA 1F58L 2CH8A 1XF3B 3MRJB 2BXYA 3HG1D 3SEPA 1QSED 4XX1E 1NFDE 1KG0A 3KJ4B 3WJJA 4ALAH 3QUKB 4WUUB 1CFVL 4QKXB 3ARZA 1GGTA 3QUYA 4G42A 5FYKH 5GGRB 3RTQD 4R0LA 2HVJB 4DKEL 1ERNA 5KVEL 1E4XH 3NCMA 4ZO9A 3LVEA 4F9LA 4GW5A 4OT1L 5HI5C 4EUPG 3VFPA 3VGGA 2PW2B 1CFTA 1KCRL 5INDB 4N5ED 4HIHB 4QT5B 5CS7A 1E28A 2JE8A 2ZUUA 3LN4B 2O93L 3O11B 5ISZE 1YNKL 4X80H 4R4ND 4M8QB 1QNZH 2OM5A 1MIMH 2NY7L 2X4NB 4QXTB 3C9NB 4U1JB 3VI4F 3PABB 4PRPB 1FGNL 3QXUA 1N6QL 2HMIC 1X5XA 2BJMH 4QRUB 4JGUA 2X70A 3Q48A 5IBLC 2C1OA 2VZTA 3F6IA 4TQEL 2A1WH 3GMPB 3VH8G 5IJVA 3IU3A 5JHDA 3VXNA 4XMPH 3F7YB 3MRNB 1IGTA 5D9SA 5B21A 1P5UA 1CICB 1FGVH 1KB5A 4KUZL 4WW2F 2JELL 5JXEC 3SJVE 5F6IC 4NQXB 4LMQI 4ODVH 2Y5TB 3QG6B 3P0YH 1FZKB 3DVNA 5DJZA 1J5OH 1MAKA 4CW1A 3ZHLA 5ICYB 5DUPH 1N64L 5C07D 4XNUH 1K85A 4I5BA 5EC2A 3DGCR 3WSQL 2ZCKH 5EUOF 1MFEL 3C5SA 2ICEB 1MEXH 1KLGB 3QR2A 3BPLB 3FT2A 1A3RL 4U6VL 4AY0A 4H5SA 3GHEH 3DX8B 1QSEA 4OKDA 3ZL4H 4GBXC 1TMCB 3HN3A 4PY8I 4QHLB 2Q86A 5F6HJ 1KELH 4YDLB 3GNMH 4JPVH 1VGEH 3MZTA 2X4TB 1F2XK 1CN4A 1IGFL 2EH8H 1NGQH 1DSFL 4M3KB 2JCCA 4JR9H 1XIWC 5F9JA 3E6FB 1TLKA 5FO7B 3HUJA 4OLUH 1N5AB 2H1PH 4C57C 1MCBA 4PJIA 1ZLVK 5DRZA 1MVUB 4JM4H 1OGAD 1EERB 4JKLA 3UTTD 3DGGA 4KPHL 4EI5C 5DJXB 3O4LB 2FL5B 1IZKA 2NY1B 5F7LB 2W0LA 3ZYOA 4GSDH 4OFYA 4LCCB 2R2HA 1F4WL 3UPCA 1ACZA 2P5WB 2GY5A 4AEEA 3Q6GL 4XB8A 1YDPB 1W0WB 3OHXB 2IBZX 4OBRA 3S35H 1TPXB 2XY1A 5L0QC 3BQUB 3KG5A 1NEZA 1AGFA 5C0NC 5JLZA 3RA7H 4CRPA 5TQ2L 3JWDC 4MAYC 4YLQT 4QXUL 3O4OC 4ZO6A 1D5XB 2APFA 3GK8H 3P30H 1UQSA 5ECJE 4K23H 1OAYH 3V2AR 3DXAD 4JZOA 1LE5A 1SQ2N 1W2KT 1YMMD 1JWUB 1BMGA 2VE6A 3RVXD 4LKCB 2I9LB 3BOVA 3PXJA 3NN8B 1ZEAL 1BZ7B 4DQOH 4MD4A 2IQAB 2DIAA 4LKCA 5HGBA 4WUKL 2KQMA 4JREC 5FGBA 4KK8C 1M7DB 3GMMB 5DFTA 4TTGA 2OR9L 1S9VB 2QR0B 3O3EA 3U36B 1BGXH 3SJVA 1ZGLB 4R4BB 5IBLD 4PJCF 3U9PL 5A2KH 2OI9B 3NIFE 5D7LA 2DICA 5K9OB 3H3BC 3C6LC 3FMGL 1JPGA 1MLBB 2HT3D 1C5DB 5EBLB 3LKQB 2IBBA 4X99B 5DRNA 3G6AA 1LEIA 5DURB 1AR1D 3MFGB 5H94A 3HCVA 4J3SA 4G6AD 3BISA 4AMKL 2NLJB 2ADJA 2KZWA 1RK0B 1N4XL 3OR6A 4S10A 1ZWIB 2XXCB 4JO3L 1I9EA 1IC7L 1ROWA 3QNYA 2IC2A 5A16A 1N6VA 3M17B 5DHVB 4GRLD 1NBYB 1HI6B 4LKXA 4D9RD 4ISVB 1WFUA 4TNWF 4JZJB 4PR5B 1Z9MA 2DBLL 1UEMA 3QDMB 1TTGA 4Y8AA 5MEPA 4NP4H 2Q86B 1SY6L 2ATKA 2ZCLL 1NCUA 1Y6NR 2MOVA 4JFDA 3T4YA 2IANE 3CVHL 1LO2L 3R06B 3GBMH 4Z95L 4R7DB 3WFEL 1RIVH 4HG4J 3K74B 4LSTH 5CJOH 3MREB 1KLGA 4N0CC 1R3IH 3QRFM 3TBYA 1HHJA 2I27N 4YHZL 4NM4H 1CXEA 3HCVB 2DL2A 5FHBH 4M1DL 4G7YL 3VA6A 3TVMD 2PCPB 3G6AB 3G04B 5EBWB 2QQQA 4OCMC 5C09B 3T09A 1HNGA 1QEWB 1I8MA 4NZJA 1V7NL 2CO7B 1YYML 5C1MB 3VFMB 4BQ6A 4LF3A 4P59L 3RUGF 1A22B 4H88L 3VXNB 4R0LC 2R8SL 1HZHH 4GFTB 4YXHH 1T7VA 1S7QA 4TPRH 5CINH 3IDYC 2VDPL 4YFLI 3RWJB 4K7PH 5JW4N 4IOSD 1UKTA 4CJ1A 1A7OL 4MAYD 1A4KA 3KPLB 4M62H 3NZHL 3MRHA 4JFFD 1K4CA 3I3EA 1JGLH 1IT9H 1MPAL 1GC1C 3HB3D 3RU8H 5DRWA 4ZMAT 2JK5A 2UY7A 4HKZB 1E28B 2CKBH 3CSBA 2GJ6D 3ARVA 4Z5RA 4HIHA 3STLB 1EEZB 2MSPA 3QEHA 1QTYT 4ZAKB 4XVTL 3ARQA 3G6JF 1ZGLP 4K8RH 4DAGL 4YBQC 3AY4A 1LQSR 2PYEB 4GXUN 5C70A 2HJFB 3QIUB 1U93A 3GMRB 5D5MF 3HC3H 3VG9C 1PKOA 2FGWL 1ZLSH 3LKPB 5EORL 3K2UH 5GRXG 3BDYL 5FYJU 1IC4H 2HJKA 1KJ2B 5ETUA 1DZBA 4JHAL 3T1FB 1RZFL 5ILTH 4HGWA 2MCPL 1NLDL 2R8SH 5TJWK 5C0ND 2P46B 3E3QC 4NNXA 4YAQB 4JDVA 4LLMB 4WU7B 5HDQH 1AXSB 2MPAL 2JCCB 3O6LL 4UIKL 5IBUB 3BZ4A 2X4TA 4K7FB 1ZLWH 5MEOA 2DIJA 3PDGA 3M1BA 2VUOA 5KSUA 1WUNT 1YY8A 3B2UD 1VADB 2UWEE 1QO3B 3R1GL 5DTFA 5D7SH 35C8H 5D8JL 1CE1L 3HFML 5BOZG 3C2AL 4G3YH 4ERSL 2YZ8A 3FOMB 1I9RH 3RVVC 2D0GA 2YRPA 4LRNH 2WUCH 3KPSD 1CT8A 1NKRA 1NCWH 1MHHA 4G6MH 4M7LH 1TVDA 3UEZA 1J1PL 4M7KH 3QIBA 5I17B 2IMNA 3TVMB 1XF5B 3MJ7A 3UTSD 1NCAH 5CIPA 2YSSA 2AQ1A 5DD1L 5IWLA 5LGHL 3W39A 5FM5M 2W9DH 5DJAA 2DJSA 3MRNA 4JHBA 1IFHL 4OCRL 4D9LH 2YD5A 1QKZL 4D0DB 2MHAB 5FYLH 4MQXD 4BJLA 3L5WA 2XQYK 1RZKC 4HT1H 2NY0C 3HFMH 4OF0A 4N90E 1XF4A 2UZIL 3CK0H 2L4OA 1JFQL 4Q9RL 2YS4A 4X98B 2E27H 3EZJB 3BPNC 4FG6D 2IADA 3UTTA 4S1RH 4N9GA 2ZNWA 3L3HB 2FEEI 1RUML 3NCJH 2VZ3A 4Z6AT 3MCKB 3SO3B 1J8HE 2K1MA 1TNNA 1JZ8A 5ADOH 1PYWB 5E1HB 4HUKB 3QIWB 1NAMA 4HJGA 3VD9A 3BT2H 1MIML 4P2QA 2VLKA 4OZFH 4ONHB 5IW6A 1Q94B 3KPMB 2F54E 4RWYL 1ZA3B 2VLRE 5CEXB 1J0ZA 4PBWD 2MCPH 4ZUWB 5DUBA 3ZHDA 2GSGB 1R5IB 5D72H 4O4YL 4JO4H 5ID0A 2OQJB 1Q38A 3TCLB 4JKWA 3MMEA 5E8OA 4LARH 4OD3H 4KWUA 3QUYB 4G42B 5EFIA 7CGTA 3GK8L 5I74B 1OAUL 4F7MB 2ZNXA 4M1GL 4UV4H 3U2SB 5T1KB 4Y2DC 4QHNA 5D2LA 2Q87A 3SO5A 4OZFG 2PTTB 3CMGA 4K8RL 4ODTL 1E6OL 4Q6IA 2A73A 4P49A 3VXRA 4YPGA 2AEIT 4WIQA 4MDIA 3VH8A 5F1NA 4U05A 5I1LA 5HVWA 2NXZD 4XNUL 1JNNL 4XNQA 3GSVA 4XNZC 3UXFA 5C0CD 1U8NB 3H3PL 4PJIF 4WO4B 2XG5A 1O7SA 5IVZA 1UWGL 3FT3A 4Y5VA 2FRGP 2X9XA 4ONFL 5ESAB 3KXFA 3PP4L 2VXQL 2Y6SD 5I0ZA 3EYUH 3O81A 2VLME 1CL7L 3L5XH 2HVKB 3JTSB 1I1CA 2OLDA 4NC0B 1S5HA 2WWMC 3JV4A 4BKLA 3N06B 1AXIB 1IGFH 3HE7D 4V1DA 1HDMB 5I1CH 3GNML 4JPVL 2QSQA 4K94H 5D5MB 3S5LB 1EBAA 1TDQA 4D9RE 4JM2D 5L2KB 4XCYA 3GHEL 1WIPA 5A40E 2C1PB 2NW2A 3C6LD 4OSUL 5C7XL 2E7LC 3VJ6B 4F33A 5SX4I 4PJBB 3OJ2C 5JPNA 1F4YH 1JN6A 3VI3F 1CIDA 2W91A 3SDAC 3TNMA 4HK0B 5E2VH 5I16A 1I3RB 4TN9A 2EE9A 1P4BH 1HINL 5D2NC 3SE3C 1G7JA 1I85C 3CU7A 2G2RB 2J88L 2HFGL 4HS8L 4XHJC 2JCCF 4PGDB 1LO2H 2QADB 2HFGH 4HS8H 4U1IA 4N0UB 1I8KB 1MLCA 1MI5E 5FUZH 4LSRL 4YEFA 1XR8A 2J8UB 2PXYD 1F00I 1IAKA 4UNUA 2IPUG 1H9VA 2Y4SA 3DWTA 3MJ9H 4P2QE 5JHDD 4RDQF 2HVKA 3JTSA 3LEYH 1Z6JT 5J4MA 4MD0B 4TOYH 1GGUA 4TUOA 2ADIA 2EKSB 3OKNA 1GAFH 3B5TA 4KKBC 1I85A 3BJ91 4L3CA 1FN4B 2AV7B 3RVVD 4PRHA 5DR5L 3TZVA 1EJOH 1V7ML 1ETZA 3QDGE 3BGMA 3OSKA 1YMHB 3QISA 4XPGL 1Z2KA 3DX7B 4Z7NE 4L3EB 4FXKA 4FZ8H 4S1SH 2ZP0T 2OTUB 1LO4L 4QYOA 5EOCJ 5K9KB 4OT1H 4QYOB 5C92A 4K3JH 2J1KA 4RAVA 4JRXE 3DO7B 3F12A 5KSVA 4NN5B 3K81A 2H32B 1DQDL 3BPLC 2OQJA 3ZZ1A 4JQVC 2GFBA 3GSQA 3NCCB 3EGSB 2FCBA 1NAKH 3CLEH 3WFDL 1A6TA 4U1SB 3FO2A 1BF2A 4TVPE 3HC4L 3T1WA 3O0RH 2DQUL 3QIWA 2B2XL 3WUWA 4UOJA 3VW3L 1EH9A 1EFQA 4PGJA 4HWBA 3IFOA 3BE1L 1D5MB 2B39A 4N9GB 5I2IB 4AL8L 3KR3L 1SYVA 4P3DB 2BRRL 1A6WH 2D7PA 4K3DH 3CFJB 3RIFK 3NIGF 1EEYB 1CZ8L 5FYJL 1EX0A 2AJSL 2VRAA 4KQ4L 2GSIB 4OZIF 3LSOB 4Y4HA 5HHOE 2QADD 3DYMA 2YA0A 3QFJE 2F15A 2ARJA 1CR9H 3L5WB 5AEAA 1Z3GL 1QRNA 3HS0A 5DVOA 3AFLA 2FJHA 4U6YA 4JFPA 5IOPA 1ONQB 2YPKB 5DD3H 4XXDA 3MLRL 2EDXA 1C7SA 3DX6A 3K4AA 4P23B 4WWKC 5E0QA 4DKFL 1VACB 1X5KA 1UG9A 2YSSB 1P7HL 1LHZA 4NZUL 1QFUH 1A3LH 2C3VA 1L6XA 4XCYB 5GS0L 1G7IA 3BX7C 1WIUA 2QHRH 3QIBB 3RRQA 3RWEA 4W4OC 5EU6A 1PDKA 1CVSC 2DJUA 4PRDA 5KW9L 4FQJH 2R1WB 1ODAA 1AQDA 2GHWB 5GSVA 2ID5A 2ZCLH 1JNLL 1JPTH 1FLRH 3AS3A 1BQHG 3FRUB 5IHBA 4KJPC 3ZO0A 1CF8L 3H9YA 3FOMA 5EN2B 2X44D 5B22A 3REVA 2E6PA 1NL0L 3TH4T 5E6IB 2UY6A 1T03H 1QFPA 2I9TA 2VLRD 5H37H 1CLOL 3U30B 2CKBA 5JA9A 4GBXD 5TDNB 1KGCE 3H42L 1U8NA 2YC1A 4XNQB 4GQ9L 1DVFC 4B7LA 4OZIE 3MCG1 3MRQA 2W0FA 1P1ZA 1L0YA 1BD2E 3JWDH 1A7RL 5C0FB 35C8L 5D8JH 1KJVA 5CLWA 1TVBB 1QSFD 1HWGB 3LQZB 2E8ZA 1DUZA 3HUJE 3VXMA 1K8IA 3CU1A 4DOHB 4WW2C 3EFDH 5DLML 3BXNA 4YBLB 3I9GH 2YN3A 5CSBA 5CGYC 4IMLB 5F93C 3MMEB 2WIMA 3O6FA 3OB8A 4XPHL 5GGUA 2ZCHH 3BKYL 3EBAA 1MH5B 5FUCC 5EIIB 4O02L 4GO6B 4M6NL 5EZLB 5ICXB 1A7QL 1JK8A 2EXYD 2GKIA 3UTSE 2E9BA 4UTBL 3U4EB 2G60H 3HMXH 4JKKA 3C5JB 3ULSA 1ZT4B 2LTQC 4GKZA 4NKOB 1F4XL 4XCNA 5FYLL 1AD0B 1MFAL 2VH5H 4MS8D 5IB3B 1MSPA 1HH9B 3KPOB 1M6OA 2IADB 1SJVA 4QWWC 1YY9C 3RA7L 3RX7A 2DKSA 2YWYA 3GBLA 1J8HD 4CN4A 5C3LD 3RUGA 5T33L 4F15C 2DM4A 2R69L 2UWEF 5FECB 1OCWH 2R0KL 1QBBA 4P9ML 1GRWA 4BQ8A 1ZHKA 1C16A 4YBHA 3WSQH 3NZ8A 1BQHA 3MXWL 5D6CB 5C0AD 3NA9H 2FATH 1B0GB 1T66C 4POZD 4KH2A 5BMFH 4G6KL 3C5ZA 4MZ3A 1Q9OB 5TFSH 4LHUG 4MA3A 5CJXC 5D7IA 3S3PA 2FB4L 4PV9B 1Q8MA 5F7YC 4TVPL 1R5VA 1AR1C 2J4WL 4MMZC 3X12B 5IT2H 3BPCA 3GSRB 3VWKB 2GCYA 4OFVA 5DO2D 4LSPL 3G6JA 5CEZL 5I1HL 4HT1L 3QCUL 4OQTH 3RHWF 6FABH 5MHSD 2E7LA 1WZ1H 1NC4B 3QAZC 3S96A 2BJML 3TJHC 3L5JA 4N5EC 5CSZB 43C9A 3A6CH 1W72B 1INEL 3QWOA 1MY7A 2V2WA 4N90D 3BP7A 4LCIH 3FB5A 1RURL 2YRZA 2XZAH 1GGBH 32C2B 4G6ML 5GZND 5MENB 1JCKA 2CLVB 5GS0C 2IBZY 5EUOB 1XF1A 2J8UF 2L7JA 1E4KC 1K8DB 2FB4H 4JQIH 4YXLL 4ISVA 2G5BB 1NGXA 3WFZA 9CGTA 4PJXE 3QIBD 3PJSB 1RZJH 1RZIB 4ACPA 4OZHF 1IAII 2ITDA 4GKSA 4MZ2A 3ZKXB 5IJKC 4Y4FA 1UWXK 3PGFL 4UIMA 3T1FA 2HKHH 3RI5K 3QHFL 4AM0A 1LP9E 3HLAA 3V5KA 1MI5B 2AV1B 3PDOA 4M9OA 4OLZH 1J18A 5CGYD 3WD5L 4M8VA 2W1NA 1IGCL 1YPZE 5GRYA 2DYPD 1RJLB 4WNQB 2VDKL 3WHE0 1T6VN 5JIKA 5ITBL 4X6FB 2HFTA 3GJFB 3CUPA 5F8RC 5I75C 1LWRA 1J1XH 1OVZA 5FHAH 4Z7WE 5L2KE 2X6MA 4IOFC 4NC2B 4ELKB 2DF3A 3BT2L 5D5ME 5FO9B 1FZMB 1MCHA 1EGJA 4WWID 5BMFL 3CFEA 3UDWC 2VE6B 1JWUA 2FATL 3GMQB 3MV7B 5J6HA 4PBXA 4JZOB 1LE5B 3P4NB 4YHNA 4HWZA 1H3VA 4WU5A 4YHYB 1OCWL 4LVEA 3OAUL 1V3KA 3F5WA 3QRGL 4IHOA 4Y5XC 5F9OL 1TJHL 3I6LD 4JG1L 4M1GH 4ZAKC 1JF5A 4KHTH 5D96B 3NABL 5DJYB 4KJWD 2WIIB 5IROA 3V5KB 1JYVA 2NTSP 3P4MA 3C6LB 1GPOH 1SY6H 4PFEA 4MHHI 5F97E 2W9EH 3RWFA 2BNQD 3I02B 3VI3E 5IMMA 5IK3A 4DN4L 3ES6A 3IETA 2VLKD 2BXZA 3VXQA 2E6QA 5EZIH 3SKNB 1MRFH 5A1AA 1U8HB 3PJSA 1BHGA 3TV3L 3S35L 4WHCA 1N5AA 4XP5H 3KPNB 1S7RB 5J0BA 1U8IB 3P9WB 4JFOA 3WDIA 2P7TB 5LAXA 3E1F1 5GHWL 3N1FC 2NY2C 2CLRA 3V6OA 3MCLH 5ADPL 2DQIH 4I1NB 2DQHH 3EFDL 4PR5A 1FVDA 3PWJA 1BREA 3SGDH 4BSWB 1N59B 1J1OH 1RZKH 4MAUL 4JN1H 3BAEL 4JFFE 1HOCA 3MV7E 4Y4KD 4DKFH 3MNVA 3HZYB 4OLWH 5ERWA 5C08A 2YPVL 3TIDB 1OAZH 4OF8A 4P2OB 3TC9A 3P4LA 4JANA 2RBLA 3RPKA 4P4KC 1JZ7A 2ZG2A 3VA2C 1NLBL 4DEPB 4JFZL 4PV8A 1NJ9B 4OUUB 1M05B 4Z0BL 4EUPA 1C5DA 5EBLA 4F57H 1QFHA 4WW2A 2NY4D 2FJGB 4ODTH 2B4CL 1G1YA 3NVQA 2MWCA 3GSNH 2EXWC 4B53A 1AGCA 3HZVB 5ENWB 5HYIA 3ULUC 3VGAB 1KF9B 4MD5B 1UZ8A 1BQHB 2O5YL 2IJ0C 1RUQH 5GIRB 1M7DA 1S7XB 2I5YH 4LOUD 1U3HB 3DV4A 5EBMA 2P48B 1G7HB 4PJ9A 3CLEL 1JRHH 3NCYS 2NY5L 4IRZH 5DEGB 3NN8A 3OG6B 3MGOB 3IYLW 1BJ1J 4AT6A 5CEZD 3MOBL 3C87A 4KVCL 3DYPA 1AD0A 2H9GA 4P57B 5DMKA 2MKWA 3WNMA 3V0VA 1LGVA 1CFTB 3ULSB 3Q2CA 1MCLA 2DQDH 4GW5B 1WSST 3C60B 4GG6E 1KNOA 4K3DL 4ZO8A 4S1SL 3FJTA 1J1XL 1JK8B 4KROD 3MRBB 2EC8A 5ILTL 1DBKH 3LS4H 2J8HA 2NR6D 1RJCA 4UILL 2P5WA 4HCRL 2GUOA 5IB4A 3WKML 3JWDL 1YQ2A 3V79C 5CJXA 1GH7A 1U8JA 4Y2DD 2BY3A 3VXMB 3GSNA 1MQ8A 4PJ7E 1MVUA 3MRJA 3ULVE 1R3LB 3GM0A 4NJ9H 5DSCB 2AK4E 2BVQB 5J1SC 5EPMB 2FDBP 4G8EB 5L88L 3MV9A 1YEFL 5C9KA 3TPUA 3W9DA 5IHLB 3IJSB 3MRQB 2WBJD 1CE6A 1H3PH 4R7NB 2YEZB 1JPTL 3ARBD 4QHLA 5D93B 4JFFA 4HDIA 5FM5O 1XGTB 4U1GC 3ROLB 4YDJB 1T5XB 4RISH 1FL5B 4EDXB 4X6CA 1GOFA 2I9TB 1ZLUK 4L3ED 2I60H 3D85B 5C8JA 1HKLL 3UTPE 1DQLH 1OD9A 4X9FA 2LU3A 4DGYL 3SDYH 3WFHB 1E0OB 1ZKAA 2V17L 1TCMA 4KDTA 1EZVX 1BVLA 3GSUB 3CPLA 1TZHB 3V9FA 5CD5D 4WI6A 4HAFA 4UUJB 3DIFA 4EBQH 3T0AA 3QDAA 2VSDA 3VFUB 3KPSE 3H0TA 5FUCE 4EBQL 2D31B 4PJ8A 4U0QB 2WNGA 1CZ8H 3IDMA 2ZUYA 4BELD 4XXDB 4BM7A 5IOPB 1OW0C 3HS0B 5F6HI 4YGAB 2R15A 3MXVL 4UT7H 3KYOA 5IQ9A 2LVEA 5TE7H 4MQ7B 2NMSA 1JGDB 2ED8A 4G8EA 5E8EA 4JZNB 4NQED 2NY6B 5F44A 3C9NA 2WUBL 3P4OA 3VCLB 4E0RB 4LOUC 3VD4A 4M93B 4I3RL 3RVWD 2BC4A 4NP4L 5I2IA 4R6UA 1P4BL 2FWOB 3JWOC 2R4RH 4D9QD 2FO4A 4LQFL 4NFCA 1U8MB 3Q0HA 2DDQL 4U1LA 1LEGA 3PIQB 3FQNB 4RGNE 4Y5XB 2PW2A 4DUVA 3EO9H 4PP1D 3VXSB 2GJ6A 5SWSB 1PZ5A 3LKNB 1KBGL 1F6LL 3C08H 1U3HC 2P8PA 4XPBL 4XNXL 4PRHD 2KPNA 4U1SA 4GMTH 3RHWK 5EH1A 4X80L 5DJCB 4FQQA 2EDYA 1R3HA 3BZEA 1KCVH 4G6FB 2WINB 5I1EH 5HD8D 5DD6B 3G08B 2ICWA 2H32A 4U49A 4G6JL 2YD3A 3ELAT 3MRGA 5KSVB 2X4QA 1AGBB 1UM6L 5DMIH 5HGDA 4NN7C 1ED3A 4LSDA 2CXKA 1N7MH 5IIEA 1EJ6A 1HHGB 1G0XA 1UWEH 3V5DB 1HILA 2Z92A 3QEQE 1UH4A 1U3HA 3DX7A 2ENYA 2SEBB 3P2TA 5IESH 5LJYH 1C08B 3LV3B 1CIUA 2NW3A 2QV2A 3BWUC 2EC9U 2XRAL 3P0GB 4GSDL 3FT4A 1CG9B 1AO7A 4KXZI 5JZ7D 1I7TA 3BYTA 3KPSB 4EDWL 4NN6B 2H6PB 5FUZL 3ZT7A 4BZ2H 3FFDB 1SEBA 3FL7A 2HLAB 3PHQB 3WLWC 4DGIL 1M05A 1CXFA 1FCGA 2XICA 3QCVH 4X5LA 5HYJD 2GT9B 1N8ZA 2VIRB 3ET9F 4JFDD 4I2XB 1UACL 5E9DA 1S9XA 2NY1D 4RGMC 3B4NA 3GO1H 1MCEA 3UYRL 4ZTPL 3ALXA 3NOIA 4K71B 2LU7A 3OKEA 3BKCL 4DVBB 2X4PB 2EDKA 4P2OD 5M94B 3V8CA 2AJUL 5CD5C 4ZUUA 5TPWH 1INQB 5CUSH 2QBWA 4H1LA 4L5FH 2DLIA 2EO1A 4UDTA 1FLRL 4BFGA 4MVBC 5DUPL 2EKJA 1F90H 2F74A 1I3GH 2UZXB 1U8PB 1T89A 3SDYL 5JPNB 1DBJH 1FFPA 5F1IB 5EOQH 2A77H 4L3AA 4L8CB 5BZWA 1O5DT 2Z31C 1S9WA 1Q9LA 4H8WH 3VU2A 5HY9B 4FTVA 2DQDL 5D7LD 4LLAA 4Q2ZB 3I02A 4P9HL 1P4IH 4X5XA 4FTVD 4PGCA 4WFFE 4J4PC 3SE4C 4OTXL 5DJ6B 4BKLB 3RWCA 1WGOA 4HFUH 3D18A 3O3DA 4PJ9D 5ESVB 3S8WA 3FN9A 1T1XA 5ESAA 3IRPX 5EZIL 4LEXL 2BNUA 3LDBC 1T7WA 1MCPH 3VFRA 1AD9B 3ZKXC 4NUGL 5D70L 3WMSA 4LVOC 1KACB 2CK2A 1I9JL 4BFIB 4HKXA 4UINL 5F1NB 5GJSH 4MDIB 2JB5L 2E9IA 3L3GA 4PJHF 3GIZL 4IS6B 2A73B 1H15A 1KTDB 1YJDC 4PTUA 5KSAB 2OTPA 4J4PA 2VKXA 5C08E 3ECBB 3WLBA 3IDNA 2A83B 4NFBA 4FQCH 4JZJC 2XZQL 3IFNH 4F7MA 3RIAK 3ULUD 5HYJA 1AKJA 2NYYD 2ADGA 4NN6C 3SBWC 3T3ME 3U7AA 4N8PA 3GJFA 4GRWE 1A14L 1Q0YL 2Y06H 2VLJA 1ORSA 4C54A 2M26A 1FE8H 1G9MH 1HK6A 1EHNA 1IQDB 5HYQB 3CFBB 5SX5H 1BBDL 2GW5A 2DQGL 3HE6A 3VG0L 4MSWB 4OV5A 5CMAB 5GS2D 3GIZH 1DDHA 3C5ZD 5I1AA 3QFJB 4KZEL 1EV2E 1ZXQA 5EULV 3BDYH 1MRCL 3V7AG 3LAFA 3QPXL 5B4MC 1S7WA 4PB9H 4PRNB 4XAKD 2Z0BA 3O4OB 2B20A 5E8NB 5I75B 1FPTL 1OPGH 1N2RB 4PRAA 4AEHL 3CFDA 5T1LB 1LD9B 4J6RL 2BX5A 5TQ0H 4MNHA 3ZE1F 1FYTB 1RJZA 5BZDA 2VDRH 2VQUA 3TBSB 2YPLB 2OMNA 4GS7C 4X6DE 1G9NC 32C2A 4I0KA 5MENA 1IAMA 4EJ1C 3BP7B 5TE4H 1J05A 4K3HA 4NHUB 1BBJA 1P53A 1E6JH