3EJZD

Structure of e203v mutant e.coli cl-/h+ exchanger, clc-ec1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intracellular proton-transfer mutants in a CLC Cl-/H+ exchanger.
pubmed doi rcsb
molecule keywords H(+)/Cl(-) exchange transporter clcA
molecule tags Immune system/proton transport
source organism Escherichia coli
total genus 46
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejzD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ejzD01
4MQ7B 4P2OA 3QFJA 1H15A 5EU6D 1FN4B 4PRHD 4MXWL 2CR6A 4Z0BL 4P4KD 1CIDA 2M8XA 2V5YA 3WKML 2CXKA 4YGAB 4FN0A 1P7QB 1UM6H 4Y19E 2DQHH 1X6LA 3LKOB 4FTVA 4DUXA 1QLRA 5J9PB 2NY6C 5E9DD 3ILQD 4LGRB 4NIKB 5J11B 3GSVB 4Y19D 1I7TB 1FL6A 3JV5A 1W8OA 1IGYB 4N90D 4ZD3L 2VR5A 3CVHH 4JFFB 1CLOL 1KXTB 5GPRA 2Q1EA 3HE6A 3TIEB 1FH5H 3ZSSA 5IMLB 4HPYL 1WUNT 4RGMC 3U4AA 1XCTA 4JCLA 5EZIH 5FYJL 4EI6B 2J6EH 3ILPB 1DQTA 5DUML 4JFDE 4MWFA 4WHTA 3L5WB 4P5KA 5FYLE 3ZE1F 3W0WB 2IAND 5EUOB 5IOPA 3FB8B 1TJGL 3Q6FA 1ZHBA 1CN4A 3MRFA 4JDVB 1P5VA 1T20B 1QA9A 5E8NB 1KBGL 1WEJH 1SBSH 1LO3H 1JZ8A 1BQHG 2FYYA 5FO9A 5ADOL 5EDXA 3SDXE 1L4IA 3DX7A 4ZNCD 2VE6B 1HE7A 4FQPA 35C8L 4Z77A 4KK8C 4WU7A 4MVBD 1IAII 4KK9C 2JJUA 1YY8A 3PABA 2NXZB 3V8CA 3E6FB 3CPLB 5FHAL 4NT6A 2YN5A 3RZCB 5DD0L 1Q0XL 2OTWA 1H9VA 1R5IB 2VXSL 2E6PA 3SBWC 2X9YA 1BEYL 1IGIH 1ZGLM 3FQXB 1A6TA 3BHBB 4GS7B 4HKXA 3FQRA 1J8HB 5FCSH 1PSKH 4P23C 3KR3L 1CDBA 2GJ6A 3IKCB 3QEQA 1V3KA 4QXTA 2NW3B 4FMKA 5JMOC 3FO0H 3O9WB 3OX8A 4NQEA 2YD9A 3FN0L 2O5ZH 4JKMA 1P4BH 5I1IL 2C3HA 4HWUA 4PJXF 4UIMB 1QO3B 1IC4H 2CKBL 4IMKA 1P53A 1A7QH 5GISH 1Y6MR 1JPTL 1QYGH 5DD3L 1JL8A 3W9EB 4P3DB 3QJFA 5DFWH 1KCUL 3I2CL 5EPMA 4AG4L 4Y4HD 1KCKA 2I60H 1FZJB 1LO0L 4UB0H 3QDGE 3C2AH 4JN1H 4F7TB 5EZLB 1UWXH 3CCHB 1HYSD 2EICA 2CGRH 3D18B 4PG2A 1OLLA 1RJZA 4XNYL 1QSFD 1KT2B 3TV3L 2VWEE 2UWEE 4L4VA 4TRPL 3I6KB 5I2IA 1SM3H 1T0NB 5J1AA 1OSPL 1ZANL 2B2XH 3CGTA 5C0AA 1X5XA 2WP3O 3MUGA 4OAWB 2H9GA 3R4DA 1A47A 3RUGB 3TN0D 3CVHB 1SJEB 2ZSVB 5ID1A 1QSVA 4EIGB 4MCZA 4D94A 4G8GB 4DGVH 3BD4A 4OT1L 3QUXD 4HPOH 3UC0L 4LSTL 3GNMH 4G6JL 3NTCL 2QSCH 3QXTA 1K2DB 3RVXD 4KWUA 1S5HA 4LBEA 4BSJA 4PGCB 3I3BA 2Z35A 1FFPA 5SX5K 2H1PL 3QQ3B 2FNBA 5LQBL 1MNUH 3PNWB 4OCWL 3TBVB 1MFCH 5J1SC 3D3VB 2CLVB 5T1MA 5DEZA 3DV4B 3VH8B 1BWMA 4IMLB 2P8MB 1QG3A 3TVMA 3QP3A 5DZLA 2W9DL 3G6AB 3VI4E 5DI8A 1HHIA 2XTJE 4FXLA 5AWNH 4NJAH 4FMFA 1DCLA 1NCCH 3WD5H 3GMRA 3NCMA 1Q9WB 2DAVA 4JFQA 5D1XC 5H37H 4XCNA 2YPVL 1PAMA 1WV7T 1S9WA 4Q9BA 3PWLA 3OHXB 3WNKA 3LRSA 4LSSH 2YUXA 1SQ2N 4QCIA 5EZJA 3ARFB 4A2LA 5E5RB 4M48H 4OI9A 4H5SA 5HHOE 1WBYA 4WENB 5JO5B 1H8SA 2HFGL 4RFEB 4H1LA 3PHSA 1R3IH 1B88A 1P5UA 5CEZE 1GXEA 1XR9A 1DE4B 4GAYA 3BUTA 2M2DA 3QIUD 4GXUM 3SKJH 3JTTA 4EDXB 2PXYB 3CSYA 4Y2DD 5DJZB 5DR5L 1OPGH 4PJ5A 5GGQL 5JQ6L 1ZA3B 1MUJB 5I9QB 5JDJA 4PLOB 3DV6A 4L5FL 2IAMC 3KGRA 3RL2B 1DLHA 5DQJA 3MBEA 2VO5A 3QIWB 3P77B 3H9SD 5EOTA 3H3PH 1A6UL 2K9UA 4TOYL 5T5NG 4M61B 1B4RA 4OZHF 4YDKL 4ZMAT 2FATL 1U8JA 1KPUB 2BHZA 3QEGL 1KG0A 2CUHA 5KVFH 3MLTB 2A1WH 4UT9L 1HQRA 2R9HC 1K4DB 1AR2A 1K6QH 2H3NA 3PJSB 5CEXB 5I16B 4M62H 5JW5B 5ICZB 3HNVL 2IFGA 2B5IC 1UEMA 3C6LD 4NKDB 1AD0A 4GG6A 1LK3L 2VC2L 4QY8A 3ZE0F 1MIEH 4XNZC 4KVCL 4RIRB 3JWNC 3HZYB 3MJ6A 4R97C 1AIFB 4XP1L 1LO4H 5I1LA 4KXZH 1OD7A 4MZ2A 4QT5B 4XP5L 3BW9B 2WBJC 4G8EA 3QHTC 2W0FA 2XWBB 5FUCC 3MPCA 3MRIB 1A1NB 5F6HJ 4BK4A 5F1KC 4KHXL 4HC1A 5DS8B 1VGEL 1AH1A 2X1XR 4ODSH 4X4YB 3MNZB 3ZLQC 2HTLC 3RHWF 2VABA 4KKCD 4MJ6B 4BA8A 4NFCA 3IRPX 5CSBA 4PJEA 5EIVA 3X3GL 1RPQA 3BJ91 3RX7A 5F9WC 3PIQB 1YYMH 3MLVH 3NA9H 1D5IH 4MQ7A 2BVPB 5JIIA 3T3ME 2VLJD 3C5SB 1FN4A 3K7UA 4PJXB 4OJFH 2ENSA 4J3UA 2UUDK 4I0KA 3BIBX 2IBZY 2VDRH 1D9KB 5J06A 1V8HA 1A7NL 4BFBD 1OP5H 4JREB 1TDQA 1P7QA 3LKOA 4UU9B 2Q7NA 4S1QH 3H2WA 5J9PA 3N50A 4Y4FC 5FYKL 1EHLL 3GSVA 4PGEB 5E00B 4JM2C 5IW1B 1I7TA 2HVJB 3JZ7A 1CU4L 1IGYA 2E3VA 4WDIB 2FH6A 1CR9H 5BRZD 3WFEH 4JFFA 2WBKA 3UTSE 4ONHB 1PD6A 4Q97A 1LEIB 4KZDH 3TIEA 1YJDL 3NCCB 5IMLA 4HIEB 3N1MC 4DVRL 4YZFF 3BP4B 4X80H 1MCPH 1O7VA 4EI6A 2NY6B 3V6ZB 5C09D 4KK5C 3ILPA 3QFDB 3QUZC 3MRCB 3L5WA 1CGWA 2Q8AL 3RIFK 3W0WA 1JZ4A 2Y7QB 3SDDC 1QEWB 1LP9E 5EUOA 1CFSB 5E8PB 2IALB 1KF9B 3FB8A 3MV8E 1OLZA 4JDVA 1T20A 4RGMB 1YN7B 4WTXA 5E8NA 3TZVC 3DJ9A 4O9HL 4GAGH 5FM4A 4PJ7B 1V3MA 4MSWB 4X83A 2Z92B 4WU5B 1IC7H 2NX5D 2VE6A 3OAZK 4J4PC 1A4JB 3VG9C 1NPUA 2GEEA 4QTHB 4RA0C 1VPOL 1GZQB 2VOTA 2PETA 4GQ9L 1EDQA 3VJ6B 3E6FA 4TTDD 4J3SA 3CPLA 1ITBB 2EC9U 2R0LH 3O6LL 3RVWD 3RZCA 4AM0B 1R5IA 4FZ8L 4I1NB 4JLRB 3FQXA 1VFMA 3BHBA 5HGHB 5A3IC 3GBNL 4UV7L 1J8HA 5CLTA 1VB9A 2GT9B 4QXGL 5F93C 3RVTC 4L9DA 3MX0A 3IKCA 4M6NH 1LE9B 4DEPC 2NW3A 3RBGA 1MCJA 4ZO6A 3O9WA 1JRHL 1RZFH 1TCRB 1IARB 1DP0A 3ZTJH 4UIMA 1P69B 1Q9KB 2ZJSL 3BRGC 2Y36H 5T1KB 1QO3A 4RSVA 4NZJA 4PRAB 1YNLL 5FYJU 4HAFA 3WO4C 4QHMB 2X1WL 4IS6B 2XZAL 4P23B 2I5YL 3W9EA 5F97E 4BKLB 4P3DA 1M4KA 1TTFA 2X5PA 2YRLA 5MEOB 5F7UA 1J05B 1U6AL 4GKOA 3PDGA 4OKDA 2DL2A 4X5XB 1FZJA 2E7LC 3KPNB 4F7TA 5EZLA 3CCHA 3A67L 3ARGD 5IBUB 3IXTB 5B8CC 1AI1L 4OZHB 3D18A 3TFKD 4X4MA 1KT2A 5D7KE 4BZ1H 5D8JL 3QNXB 1YPZE 2WBWB 4G6AD 2VL4A 3HUJE 4U6TA 3I6KA 4M7ZC 5KVMC 1T0NA 2FGWL 1VENA 1OARH 4Y8DC 4OAWA 2XYCA 3RUGA 4JM2F 1T2QL 3CVHA 2HT3D 1SJEA 2ZSVA 3DI3B 1BPVA 1A0QH 4G8GA 2FX8H 5A43C 1W72L 5DLMH 5I0DA 2ZSWB 4NQCE 1UWEL 3NMEA 1ACYL 3CFDB 1K2DA 5JHDD 3HE7C 3QO1B 2BC4B 15C8L 5EOCL 2J6EA 4NQCD 4PGCA 4B53A 3RY4A 4H88H 1YEEH 3QQ3A 2AQ2A 2VDPL 3M45A 2FECL 3PNWA 1A3LH 3TBVA 1H3PL 1QR4A 4JGJA 3OKYA 3D3VA 2CLVA 2R4SL 4G9FB 3DV4A 3VH8A 4IMLA 4MNGE 4N68A 2P8MA 5ICXB 1CLYH 5FUZL 2OR7A 1FYTD 1T3FB 3GUTB 3G6AA 3K8MA 5DVMA 5C0GB 3H6JA 1GGUA 1I8LA 3MMEB 4W81A 2MCPH 3MLXH 1Q9WA 1HHHB 3SOBL 1I1YB 1JGUL 2RQ8A 2F8VA 5SWSE 4XWOD 3RWCB 2J4WH 4ZPVB 4WHDA 1ZE3C 2DRUA 4EQ2A 1F2QA 2APXA 3OHXA 3KJ4C 2OR9L 1CFVH 2YMXL 4CW1B 4LVNC 3KPOB 4GSDL 3ARFA 3SGKC 1N6QL 4HWBH 1BZ7B 2XTLA 3P9LB 3TT3H 3VG0L 3UBXB 2Y5TB 5JO5A 4K3DH 4R96B 4RFEA 5D1XB 3KXFD 4YEEA 3CC5B 5F1IB 1AJ7L 3V8OA 1DE4A 5DEFB 4EDXA 2PXYA 1EJOH 4JFZH 5DJZA 1MWAH 1ZA3A 1MUJA 4LHJB 3RL2A 2DQIL 5IVNA 2YPLB 1AO7E 2W9EL 3QIWA 3P77A 3EJYC 3EYQD 4GRLD 4KMTL 5GGTH 2UUDH 3MXWH 4LP4A 1S7RB 4M61A 3VFWB 1EFXD 4WFFE 1T83A 5T33L 1KPUA 1XIWB 5L6YH 4ENED 2VLKD 1KACB 3Q5YA 3PWUB 3MLTA 5FUOL 4R26H 5IFHH 1E4KC 3O6MH 3N1FC 1K4DA 4GRWE 3S3JA 3PJSA 5CEXA 5C0NC 5I16A 4KPHH 5ICZA 5JW5A 2J3SA 4KRPC 1F42A 4NKDA 4MB4A 1F90L 1RUQL 3VGDA 3LEVL 4PRIE 1V7ML 1KEGL 5HVFB 1QQDB 3QPQD 4RIRA 4PJ9B 3HZYA 4HH9B 5EG6C 1AIFA 2PF6A 5E2VH 4Z7VE 2XACC 1IC5H 4L4JA 4I4WB 1OGAB 4P3WA 4QT5A 4JEGB 3BW9A 4RISL 1C12B 5EC2B 1OTSC 3KNBB 2AS5M 1NCBL 4F9LC 2XWBA 3L95B 3DVIA 4LARH 1MCWW 3MRIA 3STZB 1A1NA 4FZEH 1IM9B 1CDIA 2B5IB 5DS8A 2W07A 4W4OC 5D7IB 4X4YA 3F7YB 2X9WA 3MNZA 4XNZB 2NZIA 1KIUA 4R97B 5MHSD 4MJ6A 3RP1A 5IUSA 3U7WL 2WBJB 3MRLB 4JG1L 3U6RB 3PIQA 2OLDA 4L8DB 1RIHH 2BVPA 3OAZH 5MENB 3C5SA 3FZUC 4PJXA 1P6FA 3F12B 4M7KH 2AEQH 2P5WB 5GSRB 1D9KA 4EN3D 4WV1C 2UZYB 4JB9L 3V6OC 4KK6D 2DKUA 4M6MH 2EKJA 4KI5C 1A6WL 1KC5H 1REIA 5EU4B 5CILH 3VWKC 1I8MB 1Z0MA 5BO1L 4D3CH 3SKMB 4UU9A 1NGWB 3HI6H 1Q72L 3A0OA 3BH8B 2DD8H 3UROR 1NUGA 2NY0C 3BT2H 4PB9L 4PGEA 4QKXB 5E00A 5F9WB 4YQXL 5IW1A 4OIIL 3SDYL 2HVJA 5JW4Q 2XNAB 4Z7QE 4O02L 4HLJA 1FFQA 4WDIA 4OV5B 4BZ2H 1GOHA 3EYUH 3QPXH 4ONHA 1LEIA 4JDTL 4Z7WF 3NIFF 3VD4A 3KPRE 5T1LD 3DHMA 4HIEA 1CD0A 1DN2A 3BP4A 1BQUA 3FHAA 3V6ZA 4FA8A 3EYSL 2EYTB 2WLYA 3HI5L 3QFDA 3MRCA 5IESL 1ORQB 1PQZB 1MWAB 2Y7QA 4UT7L 1QEWA 3WFBL 2DOCA 1CFSA 4JO3H 5E8PA 2IALA 4MAUH 6FABL 1P6AB 2QQNH 2YWZA 1CXKA 1PYWB 1SJXA 1U58B 4L8SC 1YN7A 3CDCA 4PJIE 4C59B 3W2DL 5DURD 1GGTA 4LCWB 4PJ7A 3T0WA 4M5YH 4MSWA 2Z92A 4WU5A 5EU7C 1FHGA 5DWUL 4LPCA 1A4JA 1LQSR 4KDTC 3QUZB 1NC2B 4QTHA 2K7PA 5EB9A 1GZQA 4RX4D 2ZUSA 3VJ6A 4NHUB 3SDDB 4AL8L 4ELMF 2Q6WB 1AGBB 4AEHL 4OD1L 32C2B 3GKWL 1V7NL 3RVVD 4YDVB 3WFCH 1K3ZA 3O3UN 1TJHL 4FXGB 4KQ3H 4G3YL 1OAXH 4AM0A 5I1JL 4KKLC 3VD5A 3S34L 4JLRA 2G5RA 1U3HD 5HGHA 1VACB 3GSNH 2HRPH 2XIDA 4YR6B 3VG9B 3RPIB 5GS0L 2G60L 2GT9A 1CXLA 1I9EA 3IAQA 5DO2D 2HJKB 1WAAE 4EEEA 2ARJQ 2EXWC 1LE9A 3KLHC 3JV6B 3ARDD 2NY1D 4DGYH 4KDWA 4WI2A 1N8ZB 1RZ7L 1TCRA 3SBWA 3NZHH 1CGTA 3GSOB 2R29H 3P11L 1Q9KA 3T3PE 5I1AB 3IT8D 5T1KA 1RULH 4PRAA 5DJCB 3O2WH 4QHMA 5I1KL 4LOUD 2GK0B 5F96L 3ULUL 3AB0C 4M6AA 4IS6A 5HYQB 4QOKD 4P23A 1T1XB 1A3RH 1UWGL 4BKLA 4Y16D 3WE6B 5MEOA 4NHCL 1J05A 4I2XB 3THML 4NQUA 5IHUL 4X5XA 1R3JB 3KPNA 1BFOB 2BDNL 2WUBL 4JN2B 3IXTA 5CS7A 4OZHA 2XI9A 1KENL 3WO4B 3L3HB 4H20L 2F5AL 3QNXA 3NCYS 1XF4B 3Q1SL 3MLZH 4AEIH 3DXAB 4N8CH 2DM3A 5KTEH 4TPRL 3P30H 3FO9B 2CIKB 4OLZL 4I3SL 3MLUH 4XNQB 1JF1B 4L4TB 5TPWL 4WFGE 3MCLL 4FS0A 1RU9H 1S8DB 5B8CB 3QDMB 4JRXB 2ZSWA 1ZLVH 2VYRE 4YE4L 5J7CC 1I1AC 3CFDA 3U30C 3RIAK 3QO1A 4XHQA 4M7ZB 2BC4A 5L2KD 1NFDE 3BESR 4U1KB 3F7PC 1IGFL 2AI0L 1UKQA 1BMGA 2DIJA 1AC0A 3Q6GH 5CJQL 1DQMH 4PJGE 5D2LF 1TTUA 4XZUB 4G9FA 1IVLA 5ICXA 2Z8VC 1NC4B 5KG9B 4GMSL 1T3FA 3GUTA 4PRPB 3HE7B 1FGVH 5C0GA 4FTVD 2FIRT 4ETQB 3MMEA 3CD4A 2V9RA 4ZTPL 5SX4I 1JWMB 3BRDA 1YNKH 1HHHA 1I1YA 4IRSC 3RWCA 4ZPVA 4OCRH 4ZTOH 1N5YL 4DWHA 2AJUH 1EO8L 4YXLH 2E7BA 3OPZH 5HDOA 4G8IB 4CW1A 3CLEH 3KPOA 1LEGB 1FE8L 5DA0B 5IQ7H 3B9KC 1BZ7A 1YMME 4B0MM 3P9LA 3ZKMC 3GSNB 4Q74A 3UBXA 2Y5TA 3MJ8B 3M8OH 2NLJB 4Z7UB 4KAQL 2JELL 4X7EC 1CQYA 12E8H 4R96A 5DFTA 5D1XA 5IG7B 1N59B 3CC5A 5F1IA 4KJQD 3VFTB 1I85C 5DEFA 2R69L 3KJ4B 3AC0A 5MEPB 3QHZH 2DJUA 5C0DB 2DWEB 1VHPA 1KNOB 4C83B 2YPLA 1G6VK 3KYKL 2R23B 4YC2C 4KQ4L 1S7RA 1XT5A 3VFWA 3EBAA 4G5ZL 3GIZH 3PGFL 4TVPH 3ZDZE 1XIWA 4HQQH 5D7LB 2YKLH 4UV4L 3PWUA 4NGHH 4DW2L 5C6TL 3UTQB 3LHPL 4R2GD 2OI9C 3BH9B 1CD9B 1OP3K 2K3TA 2IADB 2DIBA 1QQDA 3VWJC 4PJ9A 4HH9A 4B7LA 3T08A 4I4WA 1DBKL 2EYSB 1OGAA 2GJ6D 4XAWL 5DVKA 1CDGA 3QEQD 1C12A 4LEXL 1JGLH 5EC2A 3KNBA 4Y4KD 2AABL 3L95A 3STZA 4NQED 5CSZB 1FNFA 4UT6H 1IM9A 1JRHI 4MNQE 4U7SA 1KCRH 5D7IA 3FOMB 2BVTA 2FSEB 4OLYL 2NZ9C 1EAJA 1RUKL 1WFUA 2RCSH 2BY1A 3F7YA 3QDJE 1D6EB 4LAJH 4K2UL 2F54E 2EEBA 3NOIA 4KV5E 1JTPA 2WBJA 3MRLA 4MD0B 3U6RA 1MY5A 3ZL4H 4L8DA 4TSCL 1RIVH 1GGBH 5MENA 1Z3GH 3F12A 4Z8FH 2VLRE 3PHQB 3RA7L 4KHTL 4M1GL 2P5WA 5GSRA 2DQEH 2NXYC 4HGWB 2OJZH 2HP4A 5EU4A 2RJMA 4HUWB 1I8MA 3S4SB 3O8XD 5AZ2L 3CIQA 3SKMA 1MHEB 1NGWA 4YBHA 5C0AD 3BH8A 4Q9CA 1C1EH 3PP4H 1GJIA 3QQNA 5GRUH 2XNAA 1ODAA 3HS0B 4LDEB 4RFOL 1B4JL 1JIBA 1GAFL 4LHUB 4OV5A 3L5XL 1DN0B 4L3EB 3TWCH 5F70A 1BGXL 5HVHC 5E2UL 1NGYB 5IK3B 1WTLA 5HI4D 3VWKB 4PJCF 2GSIB 3RL1B 1MCKA 5LVEA 3BPCB 1G7QB 2NY0B 4APQD 5AYUH 1RV6X 2EYTA 3PL6C 1U8OB 3RNQB 4WEBH 2FECI 1CFNB 5GS0D 1ORQA 3W11D 1PQZA 3LKPB 4FP8H 1MWAA 2FH8A 2XRAH 2FD6H 1UT9A 4UQ2B 4V1DE 1FZMB 1UM6L 2DQHL 5C3LD 4CU8A 1CDYA 3MUJA 3AAZB 1PYWA 1U58A 5GGTA 3DYPA 2XA8H 3B6SB 4YEFA 4X7DC 3CFJB 3K4ZA 4LCWA 1G9NL 3CVHL 2DQTH 3QUZA 1NC2A 5E99H 1I3VA 3IDGB 3I84A 4NHUA 3SDDA 5D96B 2Q6WA 4AJ0A 1AGBA 5E4EC 5IJKC 2ADGB 32C2A 4UAOC 3QDAA 2X7LB 3ULVC 1HN1A 4YDVA 4FXGA 4L8SB 2IF7A 5E2TH 4LASH 2EDDA 2APWA 2J6EL 3BKJH 4BH7B 5SWZB 1BJ8A 1Y6KR 4ACPA 1ONQB 1VACA 5EBLB 4YR6A 4P4KC 3RPIA 1ZTXH 2VH5H 2EXYC 4NWUL 2HJKA 2ZUUA 2EE2A 3MR9B 1LEKB 4YH6A 5J13C 3JV6A 3PWNB 1N8ZA 4HWEH 4OCSL 3MBED 3L7FB 5IM7B 3GSOA 5BS0B 5I1AA 4P2RB 4OQTA 2KKQA 2P24B 5DJCA 3BI9X 4WUUE 1HCFX 2GK0A 3DVGB 1BZ9B 5HYQA 5BZDB 1T1XA 3ROOB 2K1MA 3WE6A 2P45B 3O11B 5DMYA 4I2XA 3S35H 4ISVB 1YEFH 4UDTB 2XQBL 4PJHB 1R3JA 2FBJH 2DJSA 2YRZA 3OWEA 3QQ4B 4C57C 1BFOA 1DBJH 4JN2A 5KS9E 1FC2D 1I9IH 3MRRB 4HIXH 5GRZA 5D70H 1PSKL 3L3HA 4KROC 2XICA 4OCMC 4XWGH 5C08B 5JXEC 3AB0B 4G7YL 1XF4A 4K94L 5EWIH 3DXAA 1HH9B 4OGAC 1NCWH 1JPST 3FO0L 3FO9A 1KPRB 2CIKA 2FO1A 1P4BL 1BFSA 3VXTB 4XNQA 2RAMA 1RZIB 3LB6C 4K23H 1JF1A 4L4TA 2WK2A 3GMMB 2E7LA 3J7HA 1IC4L 5GSVB 1S8DA 4MVBC 2ZPKL 4NNXB 3QDMA 4JRXA 5B8CA 1A7QL 5GISL 1VDGA 1X5HA 4YHMH 4WI8A 4RNRB 4DGIL 4NQXB 4M43H 4NC1E 4LVHC 4TSAH 4IOFC 4IBLT 2HKHH 1EEQA 1OWWA 5ITBH 2XFXB 5DRXB 2FLRT 5GRYA 5ISZD 2I60L 5TGBB 4U1KA 4NCC2 3C2AL 4JN1L 1ZV5A 3K4AA 2CGRL 1MCRA 5HDLA 3UP1A 5HHME 5I1DB 3TYFB 3MLSL 4XZUA 5GGRB 1VFUA 3GB7B 1RFDH 1NC4A 5KG9A 1I1AB 1SM3L 1QPXA 4PRPA 3ES6B 2W0LA 3U30B 3HE7A 1F4WH 1JGDB 4ZFFB 4ETQA 2O5XH 4PGZA 2DDQL 4PD4J 1ERNA 1JWMA 4DGVL 4Y2OA 2EIBA 1Q8MA 2DQFB 3WS6C 1MQ8A 3V4UH 5HD8D 4JFFD 1HZHL 1H8OA 1BIIB 4G8IA 3VI3F 3NPZB 1LEGA 4K8RD 4PS4H 3ULVF 3GSNA 4KKBC 3Q5OA 1MNUL 2ADFH 3MJ8A 2KPNA 2NLJA 4Z7UA 4DFIA 1OW0C 3VXSB 5IG7A 4JZJC 1N59A 5CGYD 4R90H 4IRSB 1IGMH 4QGYA 4GW1B 3EFFB 2R2EB 2I07B 1J0ZA 3BZ4B 3VFTA 3WEXB 3G9VA 1NLDH 3W0WD 2UZIH 4IJ3C 1IC1A 4CVXB 4C4KT 1S7TB 5MEPA 2VWEC 5C0DA 2DWEA 4PJCB 5AWNL 4LLVB 4NJAL 1KNOA 3B9KB 1ZLSH 5C0CE 4C83A 1NCCL 3WD5L 3VA2C 4ZFGH 1KCSH 1CG9B 4OGXH 2NY4D 2R23A 1QBAA 2VZSA 3QUXC 4QWWC 4LQ1A 5A2IH 1BF8A 1NDMB 4LSSL 1DQLL 3IAGC 4NQTA 2OMNA 4L9LC 5D7LA 3H0TB 1XF3B 4JRYB 4AMKH 4KRLB 4GW5B 2VN7A 4GAJH 4M48L 3UTQA 5HHPB 4MXVF 3TBWB 5JW4N 2VITB 3BH9A 3C60D 1X5LA 5HYJE 5IT2H 5FFLA 2R1YB 4YC2B 3MODH 2IADA 4ZS7H 4WI6A 5F9JB 4NZUL 4P5TC 1QLEH 1C5BH 4MS8C 2NNAB 3SKJL 1J8HD 5IR1B 4ONFH 5EIIB 2EYSA 3EOTH 5T3ZD 4W4NA 3PWPE 4PV9B 1E4KA 1JZ6A 5DMGC 2XTJC 2OI9B 3O9WD 4KUZH 5CSZA 2R56H 2VRAA 3EFDH 3ULVH 4CBPA 4J6RH 1CDHA 2DN7A 5DD5H 3VDAA 3FOMA 2FSEA 3H9HB 3SDXF 1MSPA 1U8LB 1WSST 1TVHB 1QVOB 1FLTX 5GZOC 4M7LT 3VWJB 3SJVE 4F8TA 1D6EA 3IDUA 4GUPB 2A1WL 1FNLA 4B50A 1AY1H 3D9AH 2CPCA 2EDWA 3SE3A 3QWQB 1K6QL 3KLSA 1CIUA 4MD0A 3BUYB 4M62L 4F7MB 4F9LA 5DQDH 4C58B 1LD9B 2BJMH 1U8NB 3ARXA 1MREL 3PHQA 1NANH 2QSQA 1HINH 4E41D 1AXTL 1MIEL 4W4OA 1D5BB 1HQ4B 2CDFB 1JWSB 2C7UB 1ZLWK 1LO4L 3B2VL 3IFLH 4HGWA 3QI9D 3T2NH 1QPPA 3MCG1 4HUWA 5BJTB 5I8CB 1YEKH 3IFOB 3OJVC 3MJGX 3S4SA 4MB3A 4MB5A 1MHEA 4PJAE 3CFCL 4NUGH 3CDFA 4FQ2H 3BDYH 3HS0A 5KJRL 1MI5E 2BXYA 5FYJE 1OL0A 5D71H 3KYOB 4LHUA 4ODSL 1P2CB 5HPMB 3HC4H 1DN0A 4L3EA 2NXYB 3V6OA 4EBQH 1NGYA 5IK3A 3B5GA 3SDAD 3VWKA 4FFWD 3FAWA 4Z95H 2GSIA 3RL1A 4JKPH 5FYLH 1YYML 3BPCA 3MLVL 3NA9L 4MZ3A 1G7QA 5JA9A 3B3IB 2X09A 3S5LB 4OJFL 1CD8A 4NC0B 1U8OA 1CCZA 3RNQA 1CFNA 2E7CA 3UTPD 3RX5A 1TJIH 3LKPA 4I3RL 1HOCB 2D4DA 5IROC 1J1XH 1OF2B 3DROB 4UQ2A 3O4LE 2OYPA 1FZMA 5HVHB 3GMLB 4Q2ZB 3SDCD 5K9KB 2UWEF 3AAZA 3U7YH 3B6SA 3CFJA 2XG4A 4KTDH 1T21B 3MJ7B 2DMBA 3WFEL 1A64A 4H1LG 3BEVB 3NCEB 1AE6H 4KZDL 2DTSA 4LLWB 3IDGA 1AD9B 4U1LB 2ADGA 4S1DD 2ESVB 1MVUB 2X7LA 3ARFD 4L8SA 4OFIA 3K2UL 4BH7A 5SWZA 4BELD 1ONQA 4M6OH 3O2VH 1UJ3C 1F8TH 2VR4A 5C6PB 3LN4B 5EBLA 4OM0L 4KDTA 4R4ND 3LY6A 2NR6C 3X3FH 4U49A 4U1HB 3MR9A 1LEKA 5D72L 3BSZL 2N4IA 3CUPB 3MACH 2PXYD 3RDTD 3MRPB 5E4EB 3TC9A 2EDQA 5ESQB 5GXBB 3PWNA 4GAGL 3VI4F 2APTA 5EU6B 3H3BC 3AXLB 4PRHB 2ZCLL 3QIWD 4R4FH 3L7FA 5BMFL 5IM7A 1DLFH 5BS0A 3LAFA 5CCKL 4P2RA 2RGSA 2P24A 3VXRD 2DQGL 4P4KB 1T04B 3DVGA 3EHBD 1BZ9A 5BZDA 1M7IB 3ROOA 4JHBA 1MCLA 5DJAB 3GSRB 3O11A 4KGLA 5J13B 4ISVA 5TFSL 2BVEA 4UDTA 4PJHA 4Y19B 1GC1L 3NIGE 3QQ4A 4WFED 1TNNA 3NAAH 1IKFH 3MRRA 3WXWL 4TUKL 1OT1A 1IGTB 5C08A 1YC8A 3G9AB 4XMLH 4M6NL 1HH9A 3ECBB 1BM3L 1DVFC 1OGTB 5EOQH 1H3TA 1KPRA 3OAUH 3VXTA 1RZIA 5DFVC 3CU1A 3GMMA 4LSUH 5GSVA 3WMSA 4NNXA 4KJWD 3FFDB 4RNRA 3AY4C 3HNSH 4NQXA 4JFDB 4KROB 4LSVH 3K81A 4NOFA 4FHBD 1OWRM 3D1MC 5A16B 2XFXA 4MJ2A 3IDJB 5DRXA 1EVUA 1CGVA 4ZOCA 5JUEH 5TGBA 1WFNA 4BH8B 2WSKA 1RZJC 4O2CB 1VEOA 5I1DA 1ADQA 3D87B 5DHXB 3TYFA 2VZ1A 3IDNB 4GBXC 5GGRA 2PYEE 1D9KD 2JJSC 3GB7A 1ZA6B 3OJ2C 4G6KL 4N0YH 2D7TH 4ODBD 1I1AA 5F7NC 4LVHB 2QQLL 3VXUD 1NMBH 3ES6A 3OB0K 5DT1H 1KV3A 3N1GC 3OKNB 1JGDA 4ZFFA 1MCFA 4NQDD 1T1ZB 3S98A 3LQZB 1A0QL 1UQSB 1S9YB 4BQ8A 3BOVA 4KTEL 1GIGL 1CBVH 4EI5D 2DQFA 4LLAA 3P73B 2VAJA 1IEAB 1BIIA 3UYRH 5FO7B 2IBBA 1KCVL 1L0XA 5JZ7C 4H88L 4O58L 1YEEL 3EO0B 5CEZH 3G04B 4YFDB 1TLKA 3FFCE 4Q9QL 3QHFH 2AVGA 3VGHA 3VFNB 1A3LL 4X5LA 3LN5B 3VXSA 3T3MF 4IRSA 4GW1A 3EFFA 2R2EA 3BZ4A 2I07A 4CN6A 1CLYL 3WEXA 4H8WL 1IILE 4F58H 4CVXA 1S7TA 3IS0X 1OAZH 3V0AC 2XZZA 2XA3A 4PJCA 2XN9E 4LLVA 3V4VL 4X99B 1E6OL 3QRGH 3B9KA 3MLRH 2EH7H 3MLXL 4TN9A 3RU8H 4F33B 1CG9A 2EKSB 2J4WL 4GH7B 2OM5A 4X7TB 1ZLWH 1IBGH 4JZJB 3QDGB 1NDMA 1CFVL 1I85A 1IQWH 3H7LA 4IIQC 4IJ3B 3H0TA 4O4YH 3S96B 4QRRE 1XF3A 2OCFD 4JRYA 2W59A 3QEHB 4GW5A 1QNZH 4JO2L 4OCYH 5HHPA 4QRRD 3TBWA 2FHCA 4K3DL 3G5VB 2VITA 3MXVH 3PP3K 2R1YA 5F9JA 3UYPA 3QUXB 2QR0B 1KXVC 1J5OL 4PD4K 1G9MC 1MCDA 2NNAA 2YN3A 5C71A 4KK8D 4ERSH 5IR1A 4QRSB 1D6VL 1EJOL 4JFZL 4KK9D 1MWAL 5EIIA 2IFFH 4L9LB 2A2QT 5I1GH 2V6HA 3U48A 4PV9A 3RWGB 1JHKH 2DJ4A 4MX7B 1CLZH 5DQ9B 5T3XE 4ZDHB 2VL5B 5GGTL 2KQNA 5I0ZA 3H9HA 5T1KD 2R39A 3QXVA 1U8LA 4P5TB 1TVHA 1QVOA 3VWJA 3CZFB 3MV11 4GUPA 4P3CH 4WUKH 1XH3B 4W6YB 4RA3A 4M4RA 3BUYA 4F7MA 3PG2A 3MOQA 3JWDC 1LD9A 2XTJB 1U8NA 4UTAH 1QBMH 3F58L 2DB8A 1RUAH 3LD8B 5FYKE 5CP3H 2AQ3A 2IG2H 1D5BA 1HQ4A 1I3GL 1YECL 2CDFA 1JWSA 5E2VL 2C7UA 4PV8B 1IC5L 1P4IL 3LPGA 4YAQB 3VXME 5BJTA 5I8CA 3IFOA 4OM1H 2AAVA 3OAYH 2QADC 5F9AC 4LARL 4Y7MA 5I73C 4W70A 2DMKA 3QIBC 3ZE0E 4HHAB 3P4NB 5D1ZD 5HHOB 3KYOA 1P2CA 5HPMA 4OZIF 2A9MH 4OQTL 2Z0BA 3VH8G 2Q8BH 3GK8H 1KEMH 5FK9B 3SQOH 3R1GH 2R1XB 2Z8RA 1G0YR 4NKQB 2QSVA 1XGUB 5JPNB 1RIHL 2MCG1 3B3IA 2V2WB 3S5LA 4WW1B 4M7KL 2YR3A 4ZUSB 2AEQL 3DYOA 5MEQB 4EOWL 4S1RH 1HOCA 3BYYA 1UCTA 4OGZA 4DQOH 1OF2A 4G9FD 2G75B 3DROA 5CILL 2VDKH 3GMLA 4Q2ZA 4D3CL 3CVIL 1A6VH 5K9KA 1YPZF 3I50H 2DD8L 3S35X 4NP4H 3H3KA 3F62A 4LVEA 5D9SB 1T21A 1CS6A 3MJ7A 2P7TB 3C6LB 5FGRA 1WZ1H 4BZ2L 5DJDB 3EYUL 4AY0A 3QPXL 3BEVA 1RZJH 4LKXB 4F37K 2G2RB 5TE4H 4LLWA 3HNTH 2DQDL 1AD9A 1L6ZA 4U1LA 4EVNB 3CMOL 3FQTB 2ESVA 4XMKH 1MVUA 4RMWA 3OKKB 5HYIA 5ESAB 3LPFA 2CUIA 3Q2CA 2QTEA 1NGPL 2YHGA 3WUWB 4ZSOB 3LN4A 1XF2B 1HXMB 4Y5YC 4KK6C 5D1XD 4AH2B 1PKQB 2HWZH 1CFQB 3RTQC 4OGYH 4JO3L 4U1HA 5JNYB 4JFED 4MAUL 4PY8J 4FQCH 3CUPA 3FN3A 3MRPA 2D0HA 4G7VL 4GXUN 4KMLB 5IJKA 4UIKH 4LLDB 3VRJB 5ESQA 4HUMB 1J1OH 3BWAB 2VLJB 5EU6A 4M5YL 3D6GA 3AXLA 2YPLD 4PRHA 5C0FB 3PDDA 3VDCA 5BV7C 1QBBA 5E8EB 3ZKQD 1UJ3B 4P4KA 3IU3B 2JCCF 1T04A 1FORH 4DCQB 3OB0H 4MHHI 1T6VN 1M7IA 3TPUB 5DJAA 3GSRA 4KJPC 3WFCL 2EYRB 4KQ3L 1OAXL 3GDBA 4E5XB 4QEGA 2Z91B 2HLFC 2VIRB 4ZO8A 4Y19A 1X4YA 2IAMD 1BQLH 3GSNL 4BUHA 2HRPL 4NOBA 1Z2KA 3ZHLA 1FL5B 3KPLB 2I9LB 5BRZB 1CXEA 3CU7A 3IXAB 4RGNE 4XVUC 1IGTA 2FJHB 1TQBC 2W0PA 3ECBA 3SE9H 1OGAD 1ZSDB 1OGTA 3FCTB 1E27B 4S10A 3KPTA 1I9JH 4NO5B 4GMTL 4S0SD 4U3HA 5I8KL 1JYVA 5F1OB 5C07E 5C09B 2BNRE 2R9HD 3B9DA 4XP6H 2R29L 2X9XA 4F7CB 3KAAA 1IEBB 2ICCA 4K7PH 3FFDA 1A3RL 4JFDA 5JXEA 4JE4B 3BGAA 1S7VB 3LS5H 5C92A 1G9MH 4ZG1A 5A16A 4PRNB 3IDJA 1LP9B 1DVFB 5CKAA 2WBJD 2P46B 5H37G 4BH8A 4X6EB 3LKQB 4XPBL 2QL1A 4O2CA 5MEND 1S5IH 4GRWF 2Y25A 4MHHG 3IDNA 3NACH 5DO2C 2DBLH 1ZA6A 4N8CL 3D5OF 1KJ3H 2AJ3B 2J5LC 3QCUH 1DBAH 2JJWA 1WWCA 5HGGS 5KTEL 3MRBB 2HLAB 2HTLD 4KXZI 3NFPB 3P30L 2GI7A 3WDHA 4XMPL 3OKNA 2AW2A 3C6SB 4HS8H 1T1ZA 1DANT 5DRZB 3LQZA 4TTGA 1UQSA 1RU9L 2KZ1B 4Q7DA 1S9YA 5JOPE 2XXCB 2P1YA 1PZUB 4LOUC 1RMFL 3P73A 3JWDH 3T77B 4U1JB 1DEDA 3MUHL 4GBXB 4J8RB 5L0QC 1IEAA 3QFJE 4Y16C 4JHWH 5C70A 4M00A 1D5MB 5FO7A 1QZ1A 4HKZB 5TQ2H 2WWKT 3EO0A 3ZYJA 3G04A 5K9QI 5AG9A 4Y4FD 3VFNA 3Q6GL 2W60B 1DQML 1MCSA 3LN5A 3BX7C 4JM2D 5D93C 3GZKA 1ZVYA 4CJ0A 3T2OA 5BXFB 2VNCA 5GJTL 1WWBX 3WS6A 4UOW1 4XCCH 1DQDL 1F2XK 5I1CL 1CICC 1FGVL 1MFBH 1JHLH 1P4LB 4M7LL 2E6QA 3FT4B 4X99A 5GS2H 4HLZH 1KUMA 4F33A 1YNKL 1NBZB 2EKSA 4LCWD 2H2SC 4KK5D 1OW0A 4X7TA 4JZJA 4OCRL 4Z7QF 2DI8A 3QDGA 2AJUL 1LO2L 4YXLL 3UTTD 3OPZL 3S96A 2P8PB 4WW2C 3SDDD 3QEHA 5GRVK 2OL3H 2YD1A 3HUJB 4C4KO 1WGOA 3QXWA 2BERA 3M8OL 3G5VA 3TZVD 12E8L 2QQKH 4X5WB 5IP4A 1FSKC 4CUCA 3QUXA 2QR0A 4J4PD 3LS4L 4K3EH 3MGTB 1K85A 4UINH 4QRSA 3QHZL 4IIQB 4L9LA 1DQQB 4NQCB 3JV4B 4N5EC 2ICEB 3RWGA 1BWWA 4MX7A 4WNQB 4MA3B 5DQ9A 4ZDHA 2VL5A 4ZUVB 4PJIF 4F3FB 3BVNB 1MPAH 1E4XL 4YIQB 5IBUG 3GIZL 4P5TA 4TVPL 5LXGH 1G1CA 4HQQL 1FYTB 5A2JH 2YKLL 4JGMA 1OAYH 2BSED 3CZFA 4QRPD 3RVTD 4NGHL 4MNGB 1XH3A 2IGFL 1FPTL 2BVUA 5GRWA 4EDWH 4YHLH 1BLNB 3FTGB 3UBXI 4OI7A 4PV8A 5BV7H 5DC4B 4YXHL 4YBQC 2NW2B 4YAQA 4YWGH 3KPPB 4LQFH 3DXAD 5ADPH 1JGLL 1CYGA 2UV3A 3SGJC 5L8LB 5MP6H 5E2JA 4UT6L 1X4XA 3LQAC 1R5VB 3KXFB 4HHAA 4L4TD 3P4NA 1KCRL 5ACZB 4GW4B 5HHOA 3PQYD 4NQVB 3QDMD 2ZOKB 5C2UB 4KKAD 2HFEB 1B2WH 5FK9A 1MCOH 3MRQB 2R1XA 1EX0A 2BK8A 3MRMB 5DK0B 3U83A 1XGUA 5JPNA 2QADB 1RIVL 5JIKA 1GGBL 4GRLB 4L4VE 1Z3GL 2V2WA 4Z8FL 4WW1A 3QZWB 4ZUSA 3QIBB 4PYHA 4U7MA 1AO7B 2DQEL 4PFEA 4D9RE 4XPAH 2G75A 3AM8C 3OQ3B 1I1RA 3OL2A 4Y4KC 1A3QA 4ODHH 3PP4L 3HE7D 3UYOD 5L7XH 3BYTA 3V7AG 1ZT4B 1UCBH 2D7QA 5GRUL 2WZPD 3IDXH 5FXCH 5D9SA 2X1OA 3UBXG 2P7TA 3C6LA 4FQLL 5IVXE 3W5NA 5ALCH 5DJDA 1C8PA 3TWCL 1FL3B 4LKXA 2Z4QB 2G2RA 5IROA 5L88L 4XVSH 1UKTA 2OL3B 4CMMB 3MRHB 4FQIH 4PTUB 2YD7A 4EVNA 3FQTA 2QJDA 4Z7VB 1DL7H 3OKKA 2X4UB 5ESAA 3ME0A 1I75A 3ZTJG 1NFDF 5AYUL 4U0RC 2Z8SA 2R0ZH 3WUWA 4ZSOA 1XF2A 1HXMA 1GHFL 4AH2A 1PKQA 3VE0B 4DKFH 4Z7WE 3GBMH 3NIFE 3BZEB 1CFQA 1ADQL 2FD6L 4PJGF 4RQQB 3AMLA 5DJ2B 3LEXB 2R1WB 5JNYA 4JKWA 4XC3H 3ULUE 5D5ME 2AJYL 2XA8L 4LLDA 3VRJA 3BWAA 2VLJA 3EO9H 5GGUB 5C0FA 5HDQH 3DPBA 4ZNEA 5E8EA 1UJ3A 4IRJC 5E99L 5AAMA 2CK0H 3IU3A 3S8WA 1W2KT 4C56E 3RTQB 4DCQA 1BOGB 5HI4C 4HIHB 1KN2H 3HZKB 3TPUA 2NPLX 1DFBH 1D3CA 3MA7B 5HGDB 1NGXB 2EYRA 5E2TL 4LASL 4TSBL 4E5XA 3SGEH 4YPJA 2Z91A 2BVOB 2VIRA 5CP3A 3T04D 1SEQH 1NGZB 4XAKD 2H41A 3EDEA 3EJYD 5KN5B 1FL5A 3KPLA 2I9LA 5BRZA 1ZTXL 3FAXA 1LVEA 4ELME 3IXAA 2I25N 3BDXA 2VJXA 2FJHA 4UZGA 5T1LB 5C86A 1ZSDA 3TNNB 3FCTA 1E27A 1NCDH 4XI5C 4F9PC 3MYJB 2YD8A 4NO5A 4JM4H 4HWEL 5C09A 1U3JA 2F15A 5I8OL 2AEPH 4CDHA 4F7CA 1AQKL 1VFOA 3B2UC 5C0ND 2H26B 1IEBA 3OKOB 3RWJB 1NFIB 4HT1H 4S0TD 4KRPD 5HHVH 1NH6A 3GJEB 3QCTH 4M8QB 1TQBB 1S7VA 2L4OA 2WANA 3C09C 4GG6E 3EDDA 4PRNA 1YEFL 1LP9A 4KJYB 1DVFA 1GYAA 2Z8WC 5DURB 1EZVY 2FBJL 1OTSD 4X6EA 3LKQA 2E7HA 4BUGA 1IAIH 1DBJL 1FYHB 4NBYB 1I9IL 1A9EB 3DETC 3TA3D 4LRIA 4X98B 3X14B 5D70L 3DRQB 5JHLL 4XWGL 4HCRH 3BIAX 4NJ9L 1L6XA 4QHKI 1CGSH 4I0PC 5IB1B 4ODVH 3AY4A 2AJ3A 5LBSL 5FO8B 2DLIA 4J1UB 4XC1H 3MRBA 2HLAA 4MJ5B 3NFPA 5E6YA 4DKDC 1C7TA 3EW3B 4HWNA 4K3JL 3C6SA 5F1SA 5AUMB 1AFVL 3GSWB 5DRZA 1TPXC 1GPOH 2EDRA 1IKNC 4EJ1C 1L9NA 2GW5A 4R4BB 4XVJL 4KTYA 4YHML 4U1GC 3F5WB 4LHUD 3WIHH 3HZMB 4M43L 3T77A 4U1JA 4GBXA 3JSSA 4J8RA 4TSAL 3R8QA 2JJSA 3H42H 1RUPH 2MKLC 4L3ED 2HKHL 4R0LC 5ITBL 3B43A 5DDHB 2OS7A 1D5MA 1A5FH 5T5NF 3WLBB 3GMNB 4HKZA 3MGAA 3RKPA 4KV5F 4H0HB 2BVYA 4Z6AT 2W60A 2NY0D 4LVOC 4D0BB 3RY6C 5I75C 3PWVB 2CJUH 5BXFA 4K7FB 1G6RH 3LQAH 1RFDL 1F4HA 4MAYC 1T7YA 1B0GB 5L0QB 4Y16B 1YZZA 1F4WL 2A6KB 4FQXC 1P4LA 2P47B 2O5XL 3FT4A 3MGOB 2MQ3A 1YMHB 1NBZA 5J6GB 1JI2A 3X13B 4ZUUB 1WICA 2N1KA 4H0IA 4TVPD 5D93B 3REVB 5C0EB 3RI5K 1F3RB 3NBNA 2CO6B 2P8PA 4LL9A 4PS4L 3VW3H 4NC1C 2HRLA 3HUJA 2ADFL 5DMIH 3BPNC 3CXDH 5EUOE 4X5WA 5SWZD 3QUMH 1KFAH 4R90L 5KW9L 3PE9A 4RAUB 3V95A 3P4MB 2UZIL 1O5DT 3MGTA 1XAUA 3TO4C 1MELA 1U8QB 4IIQA 2BNQD 1DQQA 3K46A 1KB9J 4NQCA 5FIEA 4WW2B 2J8UB 3JV4A 4M9OA 2ICEA 1ULVA 4ZFGL 2APFA 1KCSL 4WNQA 3OZ9L 4MA3A 3KYMB 4OGXL 1INEH 4ZUVA 3GO1H 4F3FA 1CVRA 4QYOB 3BVNA 2GTWB 3K74B 3KDMB 4YIQA 3S6CA 4P2RD 4E9LA 3MLWH 3HZVB 1KGCE 2LAAA 2X1PA 1KCLA 1XEDA 4OLVH 1PY9A 1FYTA 4AMKL 5DD6B 4NM4H 5FV2A 4ZXBC 2VXTH 5DF0A 4GAJL 4MNGA 1RHFA 4QTIH 2EXWD 1NDGB 3KWWB 5IT2L 3KLHD 2BNUB 5HBBA 2O26U 4ZS7L 1Q9OB 1QLEL 3SE4C 4ZOAA 1BLNA 1C5BL 2VDMH 3FTGA 1VADB 4ONFL 2NW2A 3EOTL 5F7EH 4O2EB 3KPPA 2SEBB 2RR3A 1B6DA 2WAHA 2DLEA 4KUZL 3U36B 1SEBB 2R56L 3RGVC 1ZEAH 1EO7A 1R5VA 4J6RL 5DD5L 3KXFA 5ACZA 1KTLB 4GW4A 3EUUA 4NQVA 2ZOKA 5D6CB 1QRNE 1GOFA 2HFEA 3GSQB 3C87A 3D9AL 3MRQA 3MRMA 2F19H 5DK0A 1QRND 3C60C 5DQDL 4GRLA 2BJML 3O4OC 5CZKA 3HHRB 1G6RB 1HINL 3QZWA 1A7OL 1PLGH 3MUY1 3QIBA 2YOCA 1AO7A 4G43B 1A6ZB 3IFLL 3G6JB 3T2NL 4TULH 1YEKL 1JI1A 4G8GE 1SVZA 4UTBH 1D5XB 3MTRA 3CJJA 5EO1B 2IPTL 2KZWA 2FGZA 3CK0H 3MA9H 2V7NB 4LSRL 4NUGL 3OG4B 4FQ2L 1B90A 1ZT4A 3BDYL 5FCUH 5HTSA 4FQQB 3MLYH 3MRKB 4NZRL 3TH3T 5T5FH 3VXPB 3CXHK 1KIRB 4HEME 3HC4L 2Z93B 4EBQL 4JY5H 1FL3A 2Z4QA 4JQVC 2OL3A 4CMMA 2GCYB 3MRHA 2W91A 2H2PC 4PTUA 4Z95L 1EFQA 4JKPL 1BFVH 4U6VL 4ALAH 5F89B 3D3VE 5FYLL 4Y4KB 4Z7VA 2X4UA 3A6BH 4LRNH 4P2QD 4NN6C 2HTKC 5F1NB 1MCQA 7FABH 3TO2B 4CGTA 3VE0A 5ACMA 3U9PH 3BZEA 4IRSD 4RQQA 2VDLH 5DJ2A 3LEXA 4N0UE 2R1WA 1K4CB 1LMKA 3V7MA 3AS0A 2EDFA 3U7YL 2OR8A 2D9CA 3QDJB 3B9KD 4LEOB 5FGCB 2C4FT 1A7BA 5GGUA 3ZKMD 3DO7B 4G6MH 4U0RB 3RAJH 1NCAL 4NRYB 2CRYA 4XVTH 2B8OT 2VLRB 3SDAC 3RTQA 3HG1E 2MNUA 1BOGA 4HIHA 3BD5A 1JTOA 3HZKA 3BRFA 5SV4A 3O8XB 5L9DL 5HGDA 3MA7A 4JRYD 1NGXA 4WGVB 3HG1D 2BVOA 1KJ2H 4M6OL 3O2VL 1NGZA 1IJ9A 1F8TL 2R0KL 5KN5A 1EA9C 5F7MC 1WWAX 5EH1A 5IQ9B 3QA3B 1INDH 3BKCH 3MACL 5T1LA 1JNJA 2DBJA 2Y07H 4QXWA 4HGMA 3TNNA 1MJ7H 3MYJA 2A0LD 3HFML 4HJGB 4R4FL 1ZLUK 4APQB 1DLFL 3IU4H 5C3TA 2H26A 2CIIB 3OKOA 3RWJA 4YFEA 1NFIA 4MA8H 2EDTA 4BQBA 1E4XI 3RZWA 2OBGA 1EGJL 3GJEA 4M8QA 1TTGA 4PPTA 5EBGA 2H6PB 1ZVHA 3BO8B 4UQ3B 4LLQB 1UJTA 4KJYA 4DKAA 3S4SG 1N0XH 2A77L 3MV01 1I7RB 5FHBH 1JUFB 1ZK9A 3W39B 2ZKHH 3TIDB 4PRDB 1A9EA 2NQCA 3TPKA 1GRWA 4ORGB 4X98A 4XX1E 3X14A 5CZXD 3DRQA 5FM8A 4LHUG 5IB1A 4RX4A 4XMLL 4PJBF 3RDTC 5FO8A 2NZ9D 4J1UA 4RAHA 4MJ5A 3VFGH 4JO1H 2LABA 3C09B 1HWHB 5AUMA 3GIVB 3GSWA 4NM8L 4RRPG 4LSUL 5CJXC 3O6FD 1FNSH 4R4BA 2R2BB 3F5WA 2QKIB 3HNSL 1CE1H 3HZMA 4LSVL 1Q0YH 4YHIB 3RWFB 4I0PB 2NXYD 2XKUA 5DDHA 3MV7D 1KB5H 3WLBA 3L3KB 3GMNA 5JUEL 1WAAA 4PIRF 1ORSB 4PLNC 2WINB 5LKNA 4Z18A 5IGXH 1KELL 1F13A 4D0BA 3GMOB 1QUNA 3GM8A 3PWVA 1JPGB 4K7FA 4U1GB 4U6YB 4X8XA 5HI3C 1B0GA 1N5AB 1NMBL 4Y16A 4M7JH 2A6KA 4R0LB 4HEPG 3CFEB 1N6UA 1P7HL 4NCC1 3VRLF 3MGOA 3G5XB 2IBZX 4GAFB 1YMHA 1IM3B 4PJAF 5J6GA 5E7BA 2WWKO 3X13A 4ZUUA 4LVOB 1R3HB 3JWOL 1J8KA 5C0EA 3REVA 5I75B 3D69B 3PL6D 2EDXA 2R4RL 3VFUB 5KS9B 3NABL 3UYRL 4OLWH 3O0RH 3C5ZC 1FAKT 2CRMA 3BGFC 4W6WB 5CEZL 4FQXB 5D4QA 4RWYH 5DC0A 3STLB 1UGNA 25C8H 1OVZA 2FEEL 3V4PL 1UVQB 4RAUA 1XMWA 3P4MA 3BD3A 3GI8H 3E3QE 3GM0A 3VI3E 3HB3C 4PJ7E 3UPCA 1OAZL 4AT6B 1U8QA 4X0KB 5F7KC 3GI9H 5GHWL 4WW2A 3QYCA 2J8UA 2WWMD 1F3DJ 5ISZB 3ULVD 3KYMA 3BPNB 1X7QB 1GSMA 1JYNA 5HHXH 4QYOA 2ZNXA 2ICWJ 1IBGL 2GTWA 4EI5C 3KDMA 3P9WB 3HZVA 3WKMH 1CL7L 5IW6B 4O4YL 3ARBC 3TO4B 3L7EB 5DD6A 2CLRB 2EXYD 3HKFA 5C0RH 3E2HC 3PUCA 2A6DB 1JE6A 1S7UB 4GLRH 3WJJC 1ZT7B 1CK0L 1NDGA 3KWWA 3ELAT 3MXVL 2BNUA 5JTWA 1PG7X 2GFBB 4HCRA 4XNUH 2CKNA 1MCWM 4HJJH 5E94B 1CLOH 1Q9OA 4I8DA 4XB8A 3IAPA 4ERSL 4YHZL 1VADA 2X42A 2JK5B 1P84J 2P44B 4O2EA 4MXVE 2B1AL 5DRWB 4ZXBB 2SEBA 5FYJH 3O2DA 5SV3A 2JJTC 1NGQH 3EOBB 1U8IB 1NAKL 3RVUD 1V5JA 1FVEB 1SEBA 3U36A 4XNMB 4POUB 1CDUA 1KTLA 4YXKL 4NBXB 3UZQA 1ZWIB 1UADC 5D6CA 1KB5B 1Q1JH 1U92B 4P3CL 3VDBA 4WUKL 3GSQA 4JFDD 4KROD 3SCMC 2CO7B 5JXED 2BY3A 5MI0C 2KQMA 5FYLD 1KBGH 1UG9A 4OGAD 4U7KA 5DHVB 4EIZC 3BN3B 3SGJA 1I8IB 4HK3N 4OTXH 3FONB 2NY4B 4UTAL 3RGVB 1QBML 1RUAL 1G6RA 2DKMA 5C0CB 3LB6D 2IG2L 3NIGF 4G43A 3G5ZB 3IJYB 1A6ZA 1EVTC 3G6JA 4FFZH 4Z5RB 2B4CL 5HSFA 4M3KB 2O5YL 1FCGA 2MQCA 1D5XA 1OP5K 4NO3B 4FNLL 5DGQA 1YEJH 5EO1A 3VGFA 4IOFD 2VXSH 3IDIB 1AQDB 1BEYH 2V7NA 4JZNB 4X7FC 2IPUG 4Q9RL 1EHNA 3C60B 4FQQA 3MRKA 4OD3H 1CFBA 2KL6A 3O4OB 4TNWF 3ALPA 4OZGB 3VXPA 1KIRA 3UJIL 5GJSL 2Z93A 2YWYA 5B38B 1JMXA 4H0GA 5FV1L 3DWTA 2GCYA 4Q0XH 3SQOL 3R1GL 3S88L 4AQ1B 3EIFA 5F89A 4Y4KA 1ZLUH 5I1IH 5IV2B 1Z9MA 3PWPB 2EO1A 4M8VA 5F1NA 4I13B 4GJTB 3TT1H 3TO2A 1UA6H 2N7BA 4WWID 1NUNB 4S1RL 4DQOL 3VFVB 4LLUB 1YEHH 3KS0J 4HBCH 5DD3H 2P48B 4WCYH 2VDKL 3CMGA 1K4CA 3I50L 4NP4L 3I2CH 3QDJA 1CXIA 5KSVB 1WCBB 4IEFB 1LO0H 4LEOA 1P7KB 1Y18B 1HNFA 4LSQH 4NN6B 3RHWK 3DO7A 4KKBD 2J12B 5D1ZC 1WZ1L 4XNYH 4E41B 2ATPB 3PDOB 3V7AE 4NRYA 1N3NB 1RZJL 2VLME 5TE4L 3IVKB 3QI9B 2VLRA 3QDGD 3S9DB 1OSPH 3O8XA 4XMKL 5IBTH 2E5EA 4OLUL 2Q86B 4OT1H 4PJAB 3QT2A 2P5EE 3UC0H 2R8SH 3ORJA 4OGYL 5K9JH 4QWWD 4FFYH 5LJYH 4FQHB 3SKOB 5AD0B 5E5UB 5IQ9A 2P5ED 3QA3A 3LVEA 3SDAB 5LGJB 4FQCL 5LCVH 3B5TA 4OCNC 5FF6B 3BQUC 4LFHD 4UIKL 3UXFA 1MFAH 2ADJB 1UACH 2H1PH 1J1OL 4HJGA 4APQA 2FB4H 2MQ0A 4DZBB 2CIIA 5HVWA 4M3JA 4RAVB 1FORL 4KRMB 1YN6A 2DQUH 3DIFB 4P5TD 2YD2A 1CD1B 4NZTL 3P0YH 4MS8D 3SDCB 1CWVA 2H6PA 3BO8A 5B4MD 4UQ3A 4LLQA 3WNNA 3O4LB 4F9PA 3R8BB 1I7RA 1NMAH 4PR5B 1JUFA 3D39E 5F7DB 3SE8H 4LAQH 3TYGL 3W39A 4Z9KB 1N4XL 3B9VA 3TIDA 2YPVH 5EULV 4PRDA 5DMGD 2XTJD 2EIDA 4ORGA 5EO0B 5HYSB 4DOHE 1JJUA 4ZS6C 1HK6A 1VEMA 5J4MA 5GZOD 3ARED 4ZAKC 5GIRB 2B7DT 2C4XA 1I9JL 3LIZL 4XP6L 4I9WE 4DZ8B 3GIVA 4DN4H 1MCCA 1OTTD 3S5LG 4K7PL 1J87A 2R2BA 3ARWA 5HHOD 2QKIA 4YHIA 4MLSA 3RWFA 4I0PA 5GGQH 1S7WB 1FO0H 3JV0A 1G9ML 3C5JB 4U1NB 3RDTB 1DANU 5CEZD 4L5FH 4OIAA 2LU4A 3L3KA 3STBA 1ORSA 2WINA 1A6UH 1S5IL 5E8DH 4HIJB 4PP1C 1J0KA 3GMOA 4X6DE 3VXRB 1IKNA 1JPGA 3FO1B 1B9ZA 3MZGB 4U6YA 1KJ3L 5C8JB 3CDGB 4HG4K 3WUZA 1N5AA 3HAEH 4UT9H 3PXJA 3UTOA 3ZSTA 4R0LA 3CFEA 3BPLC 4EZMA 4I18C 2DL9A 4HS8L 3ABZA 3G5XA 3HNVH 1IM3A 1TNMA 5FDWB 4ESKA 4XXCC 1R3HA 1A1MB 3RY6A 3D69A 4FFVC 4HXBH 3VFUA 5KS9A 4XP5H 2ZUQC 3LDBC 5E08L 5TQ2L 4U05A 4FQXA 1TETL 4XRCB 4KUCD 3STLA 1H3GA 1L7TL 4YHOH 1UVQA 5CBAB 4ZFZB 2GY7B 4KY1H 4XCCL 5T3XH 4AT6A 4X0KA 1MFBL 1X5JA 3X3GH 3C5ZB 3AU1B 5ISZA 3BGFB 3QQ9C 6CGTA 2F8OA 3ARVA 1X7QA 1H3WM 1EPFA 2JB6B 1A7NH 1F4XH 4OI8A 3WYRA 4AIZB 5IBLD 2X70B 5IW6A 3TO4A 3L7EA 3VXUB 1P9MC 2CLRA 2NR6D 2A6DA 4UILL 5SX4H 1S7UA 4EXKA 1ZT7A 4NQDB 2J7LA 1OTUD 1WBZB 1CU4H 2FJGB 2QQKL 1FJ1B 2NMSA 3DTXB 3NZ8B 4KFZC 2ZG2A 2GFBA 4ZUTB 3K8KA 1X4ZA 5E94A 3BN9C 4POYA 4EI5B 5JXAL 3QXAB 5DZOA 4UINL 4N1HB 3H7BB 2JE8A 2JK5A 1GCFA 4NSKB 2F58L 5DD1H 4XP4H 5DRWA 5L2JB 3E2HB 4MMXC 4ZXBA 3JVGC 4M9PA 3UTSD 3EOBA 1U8IA 2V5RA 5E0QA 4D0CB 1FVEA 3K4DA 4XNMA 1G84A 4UNTA 5SWQB 4WI9A 1QKZL 2W65B 3HE6C 4BM7A 1FO0B 5IF0B 3SE4A 3NFNB 5LXGL 2YRPA 4DKEH 1ZWIA 1DSFL 2EEAA 1KB5A 1U92A 1OAYL 1CFTB 4F57L 1S9KC 5CD5C 3OXSB 2J8HA 1F6FB 5AZEH 5L8JB 5DHVA 3QUYD 4O9HH 1I8IA 3U9UB 1DVFD 2X4TB 4O2FB 4XTRD 4EDWL 3FONA 1IFHH 3MV8D 3RGVA 2YA0A 1M7XA 4YHLL 5C0CA 3DVNB 5DFVD 1QFWM 5F7LB 4HUUB 4OD2B 3G5ZA 3HAEB 3IJYA 1VPOH 4WO4C 4Z5RA 1SBBA 5IVOA 4YWGL 4LQFL 3O6LH 5ADPL 1T66D 1TZGL 5J8OA 3SCMB 4NO3A 4GO6B 3IDIA 4JRXE 1AQDA 4FZ8H 2RFXB 2D7OA 4QRRB 4JZNA 4TUJB 2KH2B 1TQCC 3C60A 3MRDB 4YPGB 5CZVL 3T0EE 2HJLB 4OZGA 3N1PC 4HW6A 5B3JF 1KPVB 5I76B 1DZBA 4QXGH 2ED7A 5B38A 1G7JB 4GBXD 1MCOL 1OAQH 5J56B 4DUWA 4XH2B 1F02I 2WUCL 1JRHH 5GGRY 4JFXB 1P84K 5IV2A 5GGVL 1CE6B 2FDBP 1BVLB 3PWPA 1NQBA 2ZJSH 3ZHKA 4PRPE 3SKUD 3CX2A 4OZIE 3VFVA 3L3IB 4LLUA 2P8LB 4XPAL 1R24B 2I5YH 3MRJB 4JQVA 4AZ8A 1U2HA 1U6AH 3K1KC 1RJCA 2Q87A 4ODHL 4ZOEA 5KSVA 1E28B 1WCBA 5L7XL 2AQ1A 1UCBL 5JZ7D 5KSBF 2D7PA 1P7KA 1Y18A 1PZ5B 2J8OA 4RWHA 4R7DB 2LU7A 4E41A 1JYXA 2ATPA 1OAKH 3MOBH 3PDOA 4N0RA 1N3NA 4M1CD 5T1DH 4KKAC 3IVKA 2MOVA 4XVSL 3QI9A 2W38A 5DJ0B 4OLXH 1LWRA 1FLRL 4FQIL 1I8KB 5IHBA 2XWJB 4LFHG 1I3RB 5D7KD 5AEAA 2CDGB 3QH3B 3VXMB 5ENWB 4AEFA 4C55A 2FX7L 2Q86A 4PG2C 1EH9A 1OM3H 1FRGL 4PJAA 3AROA 3NCJH 3I6LE 5D1ZB 4DKFL 4AQOA 3GBML 4FQHA 3SKOA 4DN3H 5AD0A 4A2MA 1SY6L 4TVSa 4XC3L 3SDAA 2OXHA 5LGJA 2VXQL 2IMMA 5D7SH 2CXGA 3BAEL 4OSUL 5FF6A 5ANME 2MSPA 4P2YA 3UJTH 2A6JB 3G5YB 3UJJL 3ARUA 4BK5A 2ADJA 1RIUH 4J3WA 3EO9L 4U3CA 5HDQL 5D7LE 4IDLA 4DZBA 2AJVH 3R0NA 2PTUA 2R4SH 4OF7A 4RAVA 2CK0L 3BZDA 3VCLB 4RMVA 5FUZH 3DIFA 3BP5B 1NUFA 1CD1A 2OTUB 1F6AB 1KN2L 2CUMA 5DUPH 3SDCA 1CL7I 1DFBL 3V0WL 2AK4E 4LDLB 4NFBA 3ZDXF 1ITCA 3O4LA 1SEQL 4PR5A 5F7DA 1CZ8L 3FQUB 2JCCE 2ARJB 1U3ZA 4KGJA 1RHHB 1ED3B 5EO0A 5I18H 1DJSA 5HYSA 1UZ6F 4U33A 3SQBA 3U4BL 1NL0H 2YMXH 4GSDH 5SWSD 4OZFH 5FAAA 7CGTA 5GIRA 2DQCH 1EEYB 1RVFL 4GKZB 4BSWB 2DTML 2HMIC 4N9OB 3VG0H 2F8XC 5I15H 3ULUC 1JMZA 3NFSH 4Y1AE 4DZ8A 2VTFA 2AEPL 2BY0A 2Z9TA 1J9CT 1RUML 4HUKB 1S78C 4HT1L 1JF6A 5HHVL 3LN9A 1NEZG 1BREA 3DMMD 1U2CA 1CQKA 2VKXA 3BFOA 3ZHDA 4JFEB 4LGSB 1S7WA 4ODUB 4U1NA 1ZLVK 3C5JA 3RDTA 5BVJB 1LDPL 4ZAKB 4XCFH 2DQIH 4HGKC 4R7NB 4KMTH 4AIOA 5IFAH 1IAIL 2QADD 2PUQT 2VSDA 4MD5B 4HIJA 4NWTH 5K33A 5CD3B 5T33H 3VXRA 5CJXA 4P9HC 4HCRL 3QIBD 2XZCH 1AO7D 3FO1A 1J0JA 2M1KA 3WNPA 1DBML 2DF3A 5C8JA 1R3LB 3CDGA 3BP7B 4XC1L 1GGIL 5GRVL 2XWTB 3TBSB 3U46B 4WFFD 1N7ML 5GS2D 1YDPB 5H2BB 1EERB 3LKRB 3O2DL 1NKOA 2IAMB 5FDWA 4J3OC 1GPOL 1YA5A 3WS3B 2O93L 1KEGH 5I19H 1A1MA 3WUWG 5EORH 3SO3C 3U2SB 1HHGB 3KPSE 5C1MB 3V9FA 1CGYA 1QACA 4RISH 3LQMA 1A5FL 3KPSD 4PRID 5JPMB 2ADIB 3OKEB 4XRCA 3BPLB 4I18B 4WTWA 5I1HH 2ERJC 1MFDL 1WC7B 3TA3C 1HHKB 1AGEB 5C07B 1INQB 2BNRB 5CBAA 4ZFZA 1G6RL 3LQAL 3SHSA 2PKDA 4OFVA 1MF2L 4IRZL 4TNVF 4HSQA 3GHBL 5I6XC 1WK0A 1IGCH 5JQHC 3U7WH 4DUVA 2ZUQB 3G6DH 1ZS8B 3LDBB 2VQTA 3C5ZA 2YA2A 3AU1A 1BD2E 1F3DH 1BVKB 1YEGH 2MWCA 1CGUA 1X5GA 4G42B 4X9HA 3MJ9H 2JB6A 2LQRA 3EO1B 1GGCH 4AIZA 2D03H 2X70A 1A6WH 1NSNH 5IVXF 4JKKA 4RZCB 5BO1H 3VXUA 3RTQD 3VW3L 1Q72H 4H25B 2OZ4H 2V7HB 4YQXH 4NQDA 2HG5B 1WBZA 2FJGA 4K71C 1FJ1A 1U41A 3DSFH 3DTXA 2Q3AA 3NZ8A 4ZUTA 3LKNB 2FX9H 5ITFB 4EI5A 2E27H 3EAKA 3JTSB 4OZFB 3QXAA 4J3VA 3H7BA 5HXMA 5TE6H 5BS0E 4NSKA 2EE6A 3WIIH 5I30H 5L2JA 3P3YA 1NUDA 4JVUA 3WJJA 4KJPD 1INEL 4NN5C 3ULUF 4D0CA 5D5MF 5KZCD 4Y4FB 3KPRD 2HLFD 4JM2B 5IESH 5SWQA 2W65A 3MLWL 3IDYC 1FO0A 5IF0A 3NFNA 1FGNH 3TEUA 4KH2A 3LEYH 2YA1A 1CFTA 4XVUD 3UO1H 5C0BE 3OXSA 3QWOB 1SHMA 4QTIL 1YNTB 3W2DH 5CJBA 3HC3L 3BE1H 3U9UA 2X4TA 4O2FA 2X89A 5C08E 1JWUB 4XBGB 3O3EB 5DWUH 3F6IA 3DVNA 4JAMB 4HUUA 4K9EL 2VDML 4OD2A 3HAEA 4LPTA 4AL8H 1T80A 4QNPE 3UTTB 4CN4A 4LIQE 5F7EL 5E1AB 1BBDH 3SCMA 4X9FA 4OF8A 3AVEA 2RFXA 3S34H 4QRRA 5TDOB 4TUJA 3PWJB 3TZVB 3VU2A 3EJZC 3D2UD 3MRDA 5DYOB 4YPGA 5EIQA 2HJLA 3HA0A 3DO3A 2VUYA 1RURH 4D9QE 1KPVA 2G60H 5I76A 5TF1H 2X4RB 4P48A 5FYKU 4WO4B 1FZKB 1XZ0B 3RZCC 1G7JA 5KOMC 4Y5VC 2AXGB 3DRTB 4MJIE 1GH7A 1BZQK 1MHHB 2GSGB 5ILTH 4XH2A 2F19L 1M71B 2BX5A 4JFXA 4RBPH 1CE6A 4U1SB 4PJFE 1BVLA 4GG6F 3MFFB 3P11H 1U8HB 1TQCB 1MIML 1UYWH 1MLBB 3ULUH 3CH8A 3L3IA 5CFHA 2P8LA 1QRKA 1R24A 3RQ3A 1UWGH 3MRJA 4D9LH 3KS0H 4QRPB 4UTBL 3VFPB 5FGBC 1MRCL 5M95B 1PDKA 4KMQA 1E28A 4JFOB 4DEPB 5IVZB 5FCUL 1ZGLB 43C9B 3QXDB 2ICWB 1PZ5A 5T5FL 1BQSA 3GMQB 3SO5A 4R7DA 5HJ3B 2XXMB 3Q3GB 4JY5L 1HKLL 1FNEB 3Q1SH 4YHNB 5DJ0A 4J3XA 1H3XA 1C08B 1I8KA 4QHNB 4NC2B 4P9HH 1BFVL 5EN2B 2C4FU 3VXSE 2XWJA 1J0HA 1UC6A 1I3RA 4I3SH 1QSEE 1CICD 3A6BL 2CDGA 4LRNL 3QH3A 3VXMA 2D31B 5ENWA 1Y0LB 4WWKC 2FIKB 1EEZB 3EDKA 5D1ZA 3PQYB 3DUSB 4PY7B 2H2SD 2IPUK 2VDLL 2BHYA 3ESVF 4WFGD 4KZEH 1ZHKB 2LFGA 1B6UA 3RI5F 4EKXA 4JO4H 1G9NC 1IAOB 2A6JA 2GITB 2R0WH 4OFYA 3G5YA 2VZUA 3ARRA 1SVCP 4G6ML 3HN3A 3RAJL 3T65B 2R2HB 4XVTL 3VCLA 4MXQC 3BP5A 3VA6A 2OTUA 1F6AA 4XPTH 1DBBH 5E8OB 4BJLA 5D1QC 3D85D 4OQ1A 2HAZA 4N5ED 3BDBA 1I1FB 4F2MB 4JQIH 5E2WH 4GRMB 3FQUA 5F9OL 1U8MB 3BGMB 2AJSH 2ARJA 2BHUA 2ZCHL 5EUOF 1RHHA 1ED3A 2JB5H 4AK1A 1UFUA 1QSZA 1RZ8B 3LCYA 4HC1L 1INDL 1NLBH 5IVXB 4EUPH 4XT1C 1EEYA 4GKZA 4BSWA 1MJ7L 2BVQB 4XBEH 1M05B 4XPGL 3IU4L 3HMXH 4KAQH 2EDJA 2W1NA 2WQRA 5GGSB 1TZIB 1T22B 1YMMD 4MA8L 3V2AR 1HYRC 3QZWG 5CSGA 3ULSB 3ZO0A 3EDFA 1WZMA 1L9MA 1WCQA 1J1PH 4JFEA 4ODUA 3U79A 4YJZL 3I75B 4Z7WB 5BVJA 4ONGH 4YBQD 4ZAKA 1N0XL 4HLZG 4LVNB 2MFNA 2ZOLB 3MV9E 4R7NA 3QSKB 1MRFH 3MC0A 1QD0A 3RKDD 3MRGB 4K94C 5D5MB 4M1DH 4MD5A 2V17L 1KJMB 4I48B 5C7XH 1Z9OA 5CD3A 4B5EA 3DHJA 3DARA 4PB0H 3PGFH 1E6JL 1Z0NA 4DTGH 4Z7NF 1R3LA 3BP7A 1C16B 1MLCB 2XWTA 3EYOB 3TBSA 3VFGL 4FG6C 3U46A 3B8YA 4C56B 2A0LC 1YDPA 5H2BA 4K8RL 3H9ZA 3LKRA 2IAMA 4JPKL 3UTZB 4Q58C 4NKOB 4YFLI 3WS3A 5CMAB 1JK8B 2CR3A 2Y23A 1IEHA 3U2SA 1HHGA 2V5MA 2VSCA 2XPGB 3GRWH 1DBKH 4HUXB 4HS6B 2LTQC 4ELMB 1WIPA 4WVRA 1KB5L 3HPJB 2RIKA 4MMZC 3B83A 1TFHA 3VGBA 5JPMA 2ADIA 3OKEA 1VSCA 5TQ0H 1CXFA 2QHRH 3T2QA 4I18A 5GZND 1AGDB 3UZVB 4LU5H 2DYPB 2HT4C 2Q7YB 3T1WA 3WXVH 1H5BC 1WC7A 1HHKA 2F53E 4OLYH 1AGEA 1OAUL 4XXCA 4U2ZA 5CZXC 5C07A 5E7FA 1INQA 2BNRA 4KRPB 3SO3B 4K2UH 4M7JL 1QFWL 4BZYA 2EEDA 4MNQD 4LMQI 1ZS8A 1ZHLB 5A2KH 3QDJD 1QBLL 1BVKA 2F54D 5K93A 4WEMB 3O6FC 2ERJB 3DUHA 4YUEH 1I1CA 3TA3B 4G42A 3EO1A 2ESVE 5HHQB 1UENA 4NNPH 5IHZB 4OLWL 2FO4B 2VLRD 3O0RL 4RZCA 5I6XB 1KOAA 2DLGA 2NY3C 1IL1B 5K9OB 1HNGA 2YD6A 4H25A 2V7HA 4XCEB 5DUBB 5T3ZL 2Y06H 4RWYL 2HG5A 2E9WA 2DWDB 4X6BB 3ROLB 1SMOA 1JNHB 1GAFH 2AJXH 4LP5A 3LKNA 4JREC 1IT9H 3WL9B 5ITFA 4PJ8D 3JTSA 3GI8L 4JPWL 1BGXH 4OZFA 4EUPB 5HDBE 4IRJD 3X12B 4WV1B 5EU6E 3S3SA 4PRHE 1S9VB 4HWBA 2QQQA 3OG6B 3GI9L 5HYEA 4RGOL 1GVIA 1WT5C 1P9MA 4JANB 4O00A 4NKIH 4Y4FA 5AG8A 4JJ5B 5F44A 4K71B 4XHJC 4XGZB 5HHXL 4JM2A 3SGDH 1SYSB 3FL7A 5E9DE 2X4PB 4QO1A 5C0RL 4Y0GA 2HN7B 3DX8B 5DVNA 9CGTA 3QWOA 4N90E 1J10A 3GEWB 3OBAA 1YNTA 3ZKNC 3JVGA 2NYYC 4V1DD 3SGEI 4XI5D 4NN5B 1JWUA 4XBGA 3O3EA 4XNUL 1G9NH 4HJJL 2GHWB 4JAMA 4JKLA 4NBZB 5D2LB 4N8VB 3INUH 3B2UD 3IDYB 1R3KB 4XXDB 5TDPB 3UTTA 1FH5L 4O5LH 1CT8B 3MNWB 5E1AA 4HJ0C 3E3QC 1T89C 4S1SH 1QFUH 2WWMC 4PG9B 1URLA 3EKCA 3LKSB 1NGQL 4HK3J 3WNOA 4RMQA 2KBGA 1U42A 5CJOH 5EZIL 5FKPB 2IANE 3KVQA 5TDOA 2ZUYA 1RD6A 3PWJA 3TZVA 2YEZB 3P9MB 5DYOA 3WN5C 1HIMH 4E0RB 3CNKA 4J4PA 4NWUH 2X4RA 5JDSB 1WFTA 2WM0A 3DETD 4WO4A 3TNMB 1FZKA 4B7IA 1XZ0A 1Q1JL 2KUTA 2AXGA 3IRZA 2BNQB 3DRTA 5F21B 4I0PD 2CQVA 1MHHA 2GSGA 4YDIH 1M71A 4OCSH 1WEJL 2ORBH 1J18A 1SBSL 3LSOB 4OTXL 1LO3L 4U1SA 1AXSB 3GSUB 3MFFA 1MQKH 1TENA 1U8HA 5JIHA 4LCCC 1MLBA 3P2TA 5EC1B 4FFZL 1FVDB 4PGJA 4Y5VB 4QRPA 1HH6B 4LNRB 2IH1B 1YEJL 2LVEA 3VFPA 3OXRB 1N2RB 4WUUD 2XQBH 4JFOA 3RVUC 2A74B 5IVZA 3MJ9A 2YD5A 1ZGLA 43C9A 3QXDA 1IGIL 2ICWA 4OD3L 4CMHC 5F88B 4M03A 3GMQA 4URTB 5HJ3A 3Q3GA 4D0DB 1FNEA 4G7YH 4K94H 4MA7H 2MMXA 4YHNA 2OZ4A 4Q0XL 4FABH 1C08A 3C08H 4QHNA 2YUVA 1PKOA 5EN2A 2EDYA 4MAYD 3V52H 3L3GB 4LSPH 4WHYH 1J88A 4U1MB 2OTPA 4FQXD 2D31A 2O5ZL 3OKDB 1Y0LA 4AEEA 3TT1L 1VCAA 1BF2A 2FIKA 1EEZA 2AEWA 2ZPKH 1UA6L 3IETB 3PQYA 4L1DA 1YEHL 3DUSA 4PY7A 4DGIH 4HBCL 5KSAC 3B4NA 4WCYL 1ZHKA 4U1IB 1QYGL 2FRGP 5DK3A 3OSKA 4WTZA 3P4LA 1IAOA 2GITA 4IM8A 1QSFE 1QRNB 3DYMA 1WVZA 2BFVH 2BRQA 4LSQL 3E0GA 1HSBB 2K7QA 1LDSA 4UB0L 1K8DB 4NYLB 4WWKB 2JLLA 3MLSH 3T65A 2R2HA 3OB8A 2EDOA 3CLFH 2OP4H 4X4ZA 1JGVH 5DMJB 1IQDB 5HGAB 5HHMD 2C1PB 2FEDC 5E8OA 5IBTL 3TO4D 1IMHC 2QBWA 2B2XL 3QNZB 4QHLB 3WFZA 2YK1H 3MCKB 4HD9A 4I77H 2DDQH 3P40A 4P57B 3DGCR 4UDUB 1I1FA 2YZ1A 4F2MA 2C5DC 1KLGB 1PEZA 5KAQF 2CD0A 4GRMA 3RX8A 3J8F7 1U8MA 2VZOA 3BGMA 2R8SL 4HPOL 5K9JL 4FFYL 1BHGA 3RWEB 4BFEA 3GNML 1HZHH 3WHXB 1RZ8A 3T4YB 2QSCL 2YZ8A 4K7PY 5LCVL 5IVXA 1C5CH 2D2OA 2FLBT 5H94B 4PJ7F 2NY2C 1MFAL 2RB8A 1UACL 2BVQA 4UNUA 4ZXBD 5J89A 1M05A 4P2QB 5D1QB 2FB4L 3WCYA 4S11A 5GGSA 1TZIA 1MFCL 4HWZB 1T22A 3BJLA 3K2MC 4NFDA 3ULSA 1V3JA 2BXZA 2DQUL 4Q6YA 3L1OH 3P0YL 5LAXB 1GC1C 2OXGA 3I75A 4Z7WA 4N0UB 1NMAL 2ZOLA 2PO6C 3SGKA 3SE8L 4LAQL 2FL5B 3AFLA 3MRGA 5D5MA 4PJDE 4I48A 1KJMA 1FG2B 3RGVD 3TJHD 1OHQA 5C0CD 1GL4B 1DQLH 5JOFB 1FV1B 1C16A 1MLCA 3EYOA 4K07A 4C56A 1RZKC 3HG1B 5E03A 3MBXH 1U93B 4DN4L 1X6NA 3UTZA 4NKOA 4NZUH 3OR6B 5CMAA 1XIWC 1JK8A 1R3IL 4PJBE 3BXNB 5IW3A 8FABB 5CHNB 1P1ZB 3H9SE 2XPGA 5HYJD 4HUXA 1FO0L 5B4MC 4HS6A 1EBAA 4ELMA 1OPGL 3HPJA 2C1OB 1AGDA 4P59H 4N1CA 2Y72A 1F97A 2DYPA 2Q7YA 4ONOA 5TJWK 3H3PL 5ALBH 5E8DL 3PWPD 3OKLB 5TF0A 4PJ9C 3VXOB 4QGTA 1A22B 1S3KH 4RMSA 4XP9H 2JIXB 3F7RA 3QCVH 2CDEB 1I7ZB 2IQAB 3AREC 1S7QB 2ZUWA 1MCIA 2LTQB 5KVFL 4MA1C 4TQEH 1ZHLA 2H2PD 3KJ6H 1T7XA 4Q6IC 3SJVD 2YD3A 1MREH 1OTTC 2XKNB 1H5BB 1AXTH 2DM2A 3TA3A 2OX5A 2UY6A 2HTKD 1ES0B 3WSQH 5HHQA 4HXBL 3B2VH 2YPKB 2LV4A 3NCBB 3NGBC 3CSGA 5IHZA 1MAMH 5BVPH 2FO4A 5DEGB 3VRLE 4ZSOE 1IL1A 5K9OA 3CFCH 4XCEA 1W0YT 4JY6B 1PKQE 5DUBA 5E24E 3U0PB 4H8WC 2DWDA 2VXUH 4X6BA 3ROLA 5KJRH 1JNHA 4YHOL 5ICYB 3O6FB 4HK0B 5AYQA 3WL9A 4KY1L 1PY4A 4EUPA 4NN7C 3X12A 5T3XL 4WV1A 2VLJE 4JPIB 1S9VA 1MI5D 5FYJD 3MV7B 4ZNEE 3S7GA 2QV2A 3HMXA 2NY3B 4JANA 5F3BB 4PY8I 5J1TC 1FZOB 2WV3A 5ETUB 1D5IL 4RRPA 4QF1B 1XGRB 2Y1VA 4JJ5A 1EUTA 3VD3A 3C9NB 4XGZA 1SYSA 1F4XL 4I3RH 2VDRL 1YEDB 5MERB 3LV3B 2X4PA 4POZC 3JUZA 4PGBB 1QR1B 2HN7A 3E8UH 3DX8A 2YUZA 4G6FB 3X11B 4RMUA 5BRZE 3WKNA 4S1QL 3PF2A 3O4LD 5IMOB 1OSZB 3RPKA 3FOLB 1BP3B 3FKUS 1CDJA 1MJUH 1RK0B 1CR9L 3IKKA 3ISWA 1EMTH 3PL6B 5D2LA 4N8VA 1WFOA 1R3KA 4XXDA 5C09E 5TDPA 4DK3A 2N56A 1FNHA 1CT8A 5DD1L 4XP4L 3MNWA 2E9BA 3DNKA 5DMKB 4PG9A 4U3XA 3LKSA 4X80L 3N85H 1MCPL 3K2UH 5FKPA 1UM4H 5J0BA 2Q3ZA 2YEZA 2EH8H 3OAYK 3P9MA 2X44D 4IDJH 5EO9B 2BCKB 3GRWA 4OM0H 5GGVY 5IBLC 4CNIB 4F7PB 3VXQB 4E0RA 4BFIB 5JDSA 4DKEL 2NCMA 3TNMA 2F9BT 1KULA 1A7PH 5D72H 3BSZH 5D2NE 2YUWA 2BNQA 2NX5E 5AZEL 4RDQG 1OTUC 4UAOB 2D0GA 2ZCLH 3LSOA 5BMFH 1IFHL 1AXSA 3GSUA 5CCKH 4RFNC 2YSSB 1IC7L 1JNLH 3WN5B 2DQGH 5EC1A 1UKSA 1FVDA 4PBVC 4KDVA 3ARPA 5IEHB 4Y5VA 1HH6A 4LNRA 2IH1A 4LLYB 2R0LL 1N2RA 3OXRA 4U6HB 1FAIH 4YHKH 5TFSH 5CBEB 2A74A 1GC1H 1Q94B 2ILLA 2V9QA 5D7IF 5DTFB 5F88A 4HULB 4LCCB 3WXWH 4UOW0 5I17B 4TUKH 4D0DA 2X41A 4P46C 4OF3A 1IZKA 3RFZC 3TH4T 1LE5B 1BM3H 1OAQL 5E95B 3QWRD