3EK7A

Calcium-saturated gcamp2 dimer
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
409
structure length
389
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 128
structure length 389
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ek7A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ek7A01
1OXEA 5EXUA 2FJUB 4KAGA 2ICRA 4PPLA 1RWYA 3LSAA 4NWSA 1KP5A 1YX8A 2O5GA 3UG0A 1J7RA 4W6IA 2MLFC 1CKKA 2AUCA 3ST0A 3I5IB 3ICBA 4QJ4B 1SPYA 1QLKA 1Y1AA 2ISDA 2DDCA 1R2UA 2SASA 2L2EA 3NF0A 5HBDA 4L13A 1JF0A 1AJ4A 1V1FA 1SW8A 4CFQA 4KF5C 2MHHA 3BXAA 4OCIA 2ZRSA 4N1FA 1F55A 1CFPA 4DXQA 1A75A 1JBAA 1CB1A 2O2BA 1PALA 3P8UA 1F8HA 4Q7RA 2LV7A 3O4YA 1J7OA 3PSRA 5HYDA 4KW9A 5AXIA 3NEDA 2JWWA 1NX3A 2I18A 1W7JB 1CDLA 2K7DA 5J3XA 4PHKA 2V4EC 2KGBC 3BXKA 5LTRA 2LLUA 2H5OA 1V1GA 1LA0A 5FVIA 2VADA 3VRPA 3SRYA 2KHNA 3LA1A 5EHUA 1XFXO 4MZJA 1XQMA 4IZNA 5AQBB 3SSHA 2BECA 1H6RA 2JRFA 2YDZA 4HQ9A 4DKMA 1YJ2A 1UP5A 3CB9A 4H3LA 2IE2A 1QXPA 2WHSA 1DJWA 3I5HB 2H5RA 4AOMA 4I5KA 3RM1A 1G7KA 2JNXA 4I5LB 2QPTA 4GGFC 4W7FA 4MRXA 1DJZA 4B30A 1Q4AA 5F6TA 2AAOA 2G6YA 1IG5A 4W7DA 4H3NA 1QYQA 1SR6C 2HETA 3DQFA 1BMOA 3S05A 4J8AA 3DQKA 3NSKA 3GJ2A 2H5QA 1B8LA 2EC6B 3BUNB 2KYCA 1TNWA 2DUGA 1WLZA 4DXPA 3I19A 3VHTA 1YVHA 1C4FA 3MSEB 4QJ3B 3C1VA 1ZMZA 2M7NA 3CD1A 5GQQC 5AANA 2KAVA 2L4IA 3TDZA 4PPJA 3LF3A 1FI6A 1OSAA 3DQ3A 3TS5B 2HJOA 4YI8A 3BYAA 1XAEA 4GNKB 1G4YR 3D0YB 4W77A 2CNPA 1RK9A 1EMBA 3OP0A 1YTZC 4KGEA 2WIQA 2KAXA 3GEXA 3LCPC 1FBVA 1TOPA 1QS7A 2FOTA 1MOUA 3KO0A 2Z6ZA 3PN7C 3SSYA 3LF4B 5B8IB 2O60A 3A8SA 2IB6A 4MEWA 4W74A 1BR4B 1KQMB 4PDZA 1IQ5A 3SG3A 2L4HA 1Q80A 2LMTA 1BFPA 3LVDA 1S6JA 4H47A 5F9GA 5FVFA 5J2OA 5AEQA 4GFTA 3ST4A 1SL7A 2KSPA 3PFVA 2LVKA 1XO5A 4C0LA 2GGZA 1KYSA 2VZXA 4YGEB 4NQGA 2WISA 2VRGA 1RROA 1SNLA 1N0YA 3IP2A 1BT6A 4JEOA 4RTCA 1CDMA 1CLLA 1JWDA 4MLWA 4ORCB 2KGRA 3DQ4A 1F54A 1QVIZ 4B30B 1ALWA 3CGAA 3DVEA 2LANA 3GOFA 1UUSA 1AP4A 3SVOA 2KFHA 2MRDA 1UHKA 4GBAA 5DQBA 2VAEA 5BQLA 3E5TA 1B8RA 3SVEA 2WSNA 4P2YB 4JF9A 2ZRTA 5BPJA 5CSNA 4R6BA 2L50A 3EKHA 2LCPA 4CPVA 2EMNA 2JTZA 3LS3A 1ZFSA 1CMGA 3I5GB 1GGXA 3DVMA 2LLTA 4DXNA 3CR4X 2B3QA 5PALA 1X02A 1KQVA 2QLIA 3BOWA 1LA3A 2E6WA 4W7AA 1KWOC 4W7EA 5HKZA 4ANJA 1XFVO 2H61A 3DQIA 3O78A 2VVIA 4PHMA 5HZUA 1NUBA 4M2PA 2KFFA 4W6KA 2JU0A 2C9JA 2OS8B 1XMZA 2BL0B 4JFGA 5TNCA 3TUYB 5DRFA 1YVLA 4MZKA 2OGRA 4YI9A 3M22A 3DQNA 1EMMA 4C0JA 1CDNA 3DQUA 4CLNA 2WCEA 4W6FA 1CLBA 3JVTC 3AKBA 3NEZA 3SG5A 5DPGA 2M29A 1ALVA 4ICBA 1JBZA 1IJ6A 4J88A 4PCWA 1LKJA 3GJ1A 2Q57A 5DTZA 3SVSA 1IH0A 1BLQA 3ZUJA 1MXLC 3DPXA 5DTYA 4GAOA 2PRUA 1GGWA 4JWQA 4AQIA 2Y1MA 5I8NA 2BE4A 2L98A 1SY9A 3P28A 3BXBA 3NSOA 5KTYA 1BU3A 4W7RA 1DJIA 3ZTFA 5ER5A 3DQ6A 2E30A 2B3PA 1QATA 2OPOA 3IR8A 4CIDA 3OX6A 2Q4UA 1CLMA 1YZWA 2Z6XA 4GESB 4XJKB 1KFXL 2Z1OA 2DUIA 1JFKA 4FTGA 5LTPA 4HRHA 3W1DA 1L2OC 4RYWA 3BOWB 1YURA 2EMOA 1DF0B 2JXLA 2LLSA 3DQ5A 2H5PA 1DJGA 3TZ1A 5DTXA 1M46A 2HPWA 4W6GA 4YGAA 4EULA 3BUXB 1SCMC 1XK4C 1W7TA 5BTTB 1FF1A 1H4UA 4W72A 2HGDA 1Z1PA 1YRTB 1K96A 1J1EA 3FS7A 1FI5A 1XFUO 3DVJA 1K9KA 1GJYA 1UHIA 1YHGA 4AR7A 3U0MA 2JZIA 4GF6B 4W69A 1F4OA 1OZSA 2MAZA 4OKHA 1UWOA 2OTGB 3DF0B 5HZSA 3GK1A 1KYRA 2RH7A 5H89A 1M39A 3DQCA 3PATA 5DY6A 2K7BA 4IK1A 1WDCC 5CSIA 3WLDA 3ZNIA 4EDOA 1FPWA 3U8PA 1PRWA 4NDDA 4XOVA 3OSRA 1DT7B 2BCAA 3QRXA 1EH2A 4DRWA 2K7OA 1B9CA 5DKNA 2HGYA 1IKUA 4HVFA 4WRIA 2Z6YA 2YE0A 3CFFA 1CDPA 2BBNA 2F2OA 3G9AA 4H48A 1MWNA 3NXAA 2P6BB 1F4QA 3SS0A 4N5XA 3LL8B 5DPHA 2QU1A 2JTTA 4U8DA 3D0YA 1EMKA 1YUSA 2LNKA 1DJXA 2K2FA 4I2YA 5KU1A 3VROA 3CWGA 2I2RE 4M2OA 3VGOA 1EMFA 3M24A 3SSTA 4W6BA 1DGUA 4HREE 3TDIA 3UFZA 3E3RA 3WNXB 4MVFA 2LVJA 2A53B 3DQOA 2H2KA 4LJDC 3PJBA 1EG3A 2VVHA 2WNDA 2R2IA 1QV1A 2JPTA 5ER4X 1KFUL 2GGMA 2HQWA 3E5VA 3NSLA 1XSSA 1F71A 1AJ5A 2A50B 1H8BA 1JC0A 4Q04A 4NDCA 1FW4A 1C7WA 2DD7A 5DKRA 4ZINA 3VK1A 2OTEA 3SSPA 1QXTA 1RMOA 2IOVA 1YHIA 3PJ7A 4MBEA 1DTLA 3O77A 3NT9A 1W7IB 1EG4A 1J7PA 1M63B 3K21A 1BG1A 1SRAA 4Q9WA 1SKTA 2COLB 1B1GA 5IBWA 3OHMB 5FHVA 3LLEA 2Y5IA 3KCTA 5G08A 3EVUA 4M2QA 1Q4EA 3DQJA 3SJSA 1JC2A 1M45A 3H1OA 1VRKA 5LK4A 4DKNA 2AMIA 4OY4A 1SK6D 2Q91A 2PALA 4W6TA 3SSLA 1GQMA 1SBJA 3DQ7A 3TMTA 2ZFDA 4Q7UA 2DUEA 1ZGOA 1QIWA 4ZCUA 1GGZA 4HE4A 2F2PA 1SYMA 4LQTA 2QACA 5AFPA 1HT9A 1IQ3A 5D7FA 2G3DB 4KW4A 4ORBB 1AHRA 3O2PA 1QASA 4I5NB 3NSIA 3I5IC 2M0RA 4LJCA 5DRGA 4F0ZB 1IRJA 3DVKA 4OV2A 3U0LA 3JVTB 4PE0A 2CCMA 5HZTA 2F3YA 3KEVA 4Z4KA 4PE1A 1ZUZA 1K95A 2PVBA 1LINA 2WORA 3TMRA 3U0KA 1MHOA 1K93D 1Q4DA 4YRUA 4W6UA 1DJHA 2WOSA 3RLZA 4Q7TA 4XVPA 2BCXA 4WQ3A 4GOBA 2BKIB 1RJVA 4W6OA 2POXA 4USLA 5CPVA 4KF5A 1K90D 1YR5A 3DQMA 1Y0VH 4W6SA 3AKAA 1CM1A 1YFPA 3KCSA 3DQ8A 4YBHB 1L7ZA 1S6ZA 1HQVA 1CV7A 2QRFA 2HPSA 3PLFB 4TNCA 3GL4A 1XYDA 1QIVA 3CGLA 1JUOA 2G9BA 2LMVA 4W73A 5HGEA 4KGFA 2A48A 4IK4A 1SMGA 1WY9A 1L2OB 1ZUXA 2V4EA 3SG7A 4XJKA 4CFRA 4HRGA 4EN1A 1UURA 1OMVA 3DQHA 4RYSA 2EHBA 2HQKA 3DQ9A 4L12A 2AWJA 1ZGQA 1NP8A 2KAYA 4IK9A 1KK8B 4H3MA 1DF0A 1C07A 2AHAA 1IWQA 4XOWA 2FWQA 2F3ZA 2ZNEA 1TN4A 3RWAA 2F8PA 4A4CA 1CFCA 1MR8A 1BOCA 4ORNA 4BDUA 5BTTA 1J7QA 3SVDA 5EBJA 5H87A 4GGFA 1S36A 2A47A 1NX0A 3SSKA 2KI4B 2EMDA 2DUFA 1M31A 2WHUA 3GK2A 4BY5A 2A46A 4IK5A 2HRSA 1QY3A 1MOVA 2ZNDA 3EVPA 4N1GA 3DF0A 1CMFA 1EMCA 3H4SE 4MZLA 3DPZA 1RM9A 2LUXA 4ZBLA 1J1DA 2LVVA 2H9WA 2G16B 4L9MA 3I5FC 2AWKA 4AS8A 4GPLB 4ZIOA 3CR2A 2LUCA 3AI4A 4ETOA 1OMDA 2ZMWA 4KEXA 2AH8A 1EMAA 1K9PA 1A4PA 2DD9A 4PE4A 2OKYA 2GW4B 4PHJA 2M97A 3BXCA 3ST2A 2KBIA 2LP2A 1S5GY 2L5XB 1C7VA 5FVGA 1HCJA 1NX2A 1Y1XA 4MRYA 1GFLA 2JQ6A 1RECA 3FIAA 1B9AA 3EK7A 3CD9A 3BUMB 1EMEA 4W6AA 1B47A 4UPGA 2BKHB 4P76A 4W6LA 2V4EB 4P1QA 1NPQA 2LE9B 1E8AA 3SVUA 4L1IA 1GL4A 1NWDA 2KQYA 3SG6A 4KW8A 5HZOA 2FCEA 5EXCI 1MUXA 3SVCA 1AVSA 4ZF5A 1Y1UA 1B7TY 1RTP1 2Y1NA 2CT9A 1CFDA 4JGEA 2DDDA 2M7LA 3EVVA 1PVAA 2MLEC 1A29A 2NZ0A 3CR5X 1S26D 3SVBA 1AK8A 3SIAA 1YUUA 4OJ0A 3LVCA 3ZULA 1Z1QA 5D69A 4BY4A 4R6DA 2AWLA 2NCOA 4TZGA 4W6HA 3AKOA 1B8CA 2HFCA 1YUTA 3WHTB 2C9IA 3I5GC 5HKWA 1IGVA 2G6XA 4MSPA 4NDBA 1SR6B 1OZOA 3DQEA 2ZKMX 3WXAA 5KTGA 3AI5A 3WCKA 3KPXA 3OGOA 4PE7A 2KNEA 3V3DA 1NSHA 2DUHA 2OKWA 5EB7A 4XL5A 2QZ0A 3AAKA 1F70A 4E68A 2MJWB 1JC1A 2O29A 1BODA 2WCFA 1OMRA 2RGIA 3IQOA 1KCYA 5FYXA 4PHNA 4YGDB 4D1EA 1DMOA 3IF7A 2BL0C 2FL1A 2KI6C 3OB2B 3JTDC 2CTNA 1ZGPA 1YX7A 4IL1A 4XYNA 2YE1A 3EK8A 1S6CA 2GV5A 2ZN9A 1IJ5A 1JFJA 1WLMA 3KF9A 4DCKA 1HUYA 1Q73A 3DQ2A 1A2XA 2HQ8A 2JT3A 1KSMA 1LXFC 1W7SA 1N2DA 1CTRA 4HSZA 1XA5A 1K9UA 3PN7B 1TTXA 2JXCA 2BBMA 3BX9A 1UHHA 2M1KB 4ZB1A 1ZACA 4W6RA 3SG4A 2KI6D 3CLNA 3DQDA 5I2OA 4I5JA 2I94A 2EGDA 1EMGA 1UHJA 2KOTA 1XFYO 2BTJA 2ZN8A 1KK7Y 3O6BA 5BT0A 2K2AA 2M3WA 3MGFA 2A56B 4W6PA 2SCPA 1RFJA 1NCXA 3LK1A 2VVJA 5I2QA 2QLGB 2D8NA 3D10A 3ED8A 3FWCA 2GW3A 2A54B 1CM4A 1QV0A 3DQ1A 2G3OA 3GB3A 1SL9A 4DUQA 2PSRA 2A52B 4OVNF 1OE9B 1DGVA 2JT8A 3E5WA 3WLCA 1QLSA 1MF8B 1XA9A 1EMLA 2JC2A 1PSBA 4R1EA 2QT2A 3RWTA 1D1OA 3DQLA 4DXIA 1JSAA 3PIBA 3GK4X 2G2BA 3FWBA 2BCBA 3U8AA 2H61C 4DXMA 1UISA 5LTQA 4KF4A 2JOJA 4KA9A 3OSQA 3HCMA 4PFEA 1LVCD 1QX5B 1S1EA 5EXBA 4GGNA 2BE6A 2M9GA 1EXRA 1U5IA 5EJUA 1KWOB 1K8UA 5DPJA 1OXDA 3ZUFA 4W76A 3LVAA 4JQ0D 1TNQA 2CBLA 3SG2A 1XK4A 1F0BA 2KFGA 3SVNA 4FQOA 2OTGC 1YJFA 2NLNA 2KQ6A 2LHLA 2QLEA 1ZOTB 1UHNA 3SVRA 2P4MA 4LW5A 1Y6WA 4PALA 4TZAA 1TNPA 1QJTA 5JOLA 1YHHA 4OR9B 4QJ5B 5T3IA 4JRBA 2FCDA 1JBYA 1RMMA 1CFFA 5EB6A 1A75B 4HQ8A 2ZO6A 1TIZA 2H8QA 4WQ2A 3VRRA 4JC2A 3I5FB 3LK0A 5K89A 2G6EA 3VRQA 3SV5A 3EVRA 4KPIA 1XFZO 1A03A 4ZF4A 2H6VA 2LAPA 2ZMUA 4YGCB 2PXSA 4LJBA 1K2HA 1DVIA 1BF5A 2WURA 1G33A 3W1CA 4OGSA 2WCBA 4UTSA 2F33A 4YGBB 2HF5A 5CSFA 3K1KA 3ADFA 1EL4A 3EKJA 1G8IA 1W7UA 2PMYA 2JT0A 4W6MA 4ZFSA 1EJ3A 4W6NA 3PJ5A 5DPIA 1MXEA 1DJYA 4W75A 3SSVA 1QTXA 2JULA 2WC8A 5KSZA 4N3DA 4GUKA 1KFXS 4IK3A 4U2VA 3CFAA 4DS7A 3VRNA 1MYWA 1U5IB 1Q4CA 3CFHA 4LJDA 2NCPA 3I5HC 3VICA 3A8RA 2G5ZB 1MQ1A 1SCMB 2LC5A 4OHSA 2GX2A 1S5GZ 1JF2A 2IB5A 2L51A 3BUOB 2MA2A 3SIBA 5HLVA 1H4BA 2FZUA 2HCGA 4DXOA 4Z4MA 3DPWA 5HW9A 1NCZA 1BR1B 4W6CA 1WRKA 4A4BA 2KYFA 3CS1A 3VHTB 2G2SB 2OJKA 4W7CA 5I2LA 3A4UB 2EC6C 3OB1B 2M49B 3EK4A 2O24A 1PVBA 3H1RA 4IK8A 3PM8A 4J89A 2KBMA 1KYPA 2LMUA 1PULA 2K0JA 1Q4BA 1WDCB 5HKYA 1NIWA 3PALA 3TDUA 3WHUB 1WRLA 3CBEA 5CSJA 4W7XA 2MBXA 2LM5A 1B7TZ 1BJFA 3JTDB 2L0PA 4P5OE 2LVIA 2ARLA 1CNPA 2M8UA 4OQWA 2I7AA 3TS5C 4C0KA 2CXJA 3BQ3A 1QVIY 1K94A 1TCFA 3ZWHA 4XGYA 2WSOA 3OX5A 2NXQA 3BUWB 2IS9A 2Y0GA 3ST3A 2M1UA 1SL8A 3HX4A 2Q6PA 1TRFA 4HQCA 1OOJA 4W6JA 1TCOB 1NX1A 1PK0D 1TNXA 1KQMC 4ZCVA 5DKQA 2YFPA 5HLOA 5AERA 4W6DA 2B1UA 1NCYA 3AAJA 4JPZB 2WHTA 4LQUA 1F09A 1QX7A 4ORAB 1SCVA 4AQJA 2GX0A 1OXFA 3DQAA 2K61A 2KDHA 2Y4QA 5DQMA 3U0NA 1OQPA 4EDSA 2ZO7A 2DOQA 2AWMA 1S3PA 3F45A 2PXWA 1RMPA 1R6PA 1KFUS 1QYFA 3KHEA 1WRZA 1QYOA 5H88A 2JADA 1N65A 1YRUB 2QLGA 2QLHA 4B5YA 3U8CA 4ZF3A 2A4JA 1PSRA 1J55A 5JJGA 4Q9XA 1XVJA 5DU0A 2LHIA 2V53A 1KSOA 2HQZA 3CTNA 2LP3A 1AUIB 2K7CA 1S6IA 1KK8C 1XFWO 1B4CA 1ODBA 1KK7Z 4EMQA 2PASA 3DD4A 3M0WA 2TN4A 2OTBA 4MN0A 1RRXA 3IQQA 1NYAA 3CZTX 2JNFA 5DTLA 4DIRA 4PPKA 2OS8C 2KI4C 3NT3A 2K8MB 3TUYC 1QX2A
chains in the Genus database with same CATH superfamily
1OXEA 5EXUA 2FJUB 4KAGA 2ICRA 4PPLA 1RWYA 3LSAA 3SS4A 4NWSA 1KP5A 1YX8A 2O5GA 3UG0A 1J7RA 3OBVA 4W6IA 2MLFC 1CKKA 2AUCA 3ST0A 3I5IB 3ICBA 4PT1A 4QJ4B 1SPYA 1QLKA 1Y1AA 2ISDA 2DDCA 1R2UA 2ERBA 2SASA 2L2EA 3NF0A 5HBDA 4L13A 1JF0A 1AJ4A 1V1FA 1SW8A 4CFQA 1OOFA 4KF5C 2MHHA 3BXAA 4OCIA 2ZRSA 4N1FA 1F55A 3DZTA 1CFPA 4DXQA 1A75A 1JBAA 1CB1A 2O2BA 1PALA 3P8UA 1F8HA 4Q7RA 3DXLA 2LV7A 3O4YA 1J7OA 3PSRA 5HYDA 4KW9A 5AXIA 3NEDA 2JWWA 3CYZA 1NX3A 2I18A 1W7JB 1CDLA 2K7DA 5J3XA 4PHKA 2WCHA 2V4EC 2KGBC 4KYNA 3BXKA 5LTRA 2LLUA 2H5OA 1V1GA 1LA0A 5FVIA 2VADA 3VRPA 3SRYA 2KHNA 3LA1A 5EHUA 1XFXO 4MZJA 1XQMA 4IZNA 5AQBB 3SSHA 2BECA 1H6RA 3SS5A 2JRFA 2WC5A 2YDZA 4HQ9A 4DKMA 1YJ2A 1UP5A 3CB9A 4H3LA 2IE2A 1QXPA 2WHSA 1DJWA 3I5HB 2H5RA 4AOMA 4I5KA 3RM1A 1G7KA 2JNXA 4I5LB 2QPTA 4GGFC 4W7FA 4MRXA 1DJZA 4B30A 1Q4AA 5F6TA 2AAOA 2G6YA 1IG5A 4W7DA 4H3NA 1QYQA 3FE6A 1SR6C 2HETA 3DQFA 2PQLA 1BMOA 3S05A 4J8AA 3DQKA 3NSKA 3GJ2A 2H5QA 1B8LA 2PYQA 2EC6B 3BUNB 2KYCA 1TNWA 2DUGA 1WLZA 4DXPA 3I19A 2KLDA 3VHTA 1YVHA 1C4FA 3MSEB 4QJ3B 3C1VA 1ZMZA 2M7NA 3CD1A 5GQQC 5AANA 2KAVA 2L4IA 3TDZA 4PPJA 3LF3A 1FI6A 1OSAA 3DQ3A 3TS5B 2HJOA 4YI8A 3BYAA 1XAEA 4GNKB 1G4YR 3D0YB 4W77A 2CNPA 1RK9A 1EMBA 2P70A 3OP0A 1YTZC 4KGEA 2WIQA 2KAXA 3GEXA 3LCPC 1FBVA 1TOPA 1QS7A 2FOTA 1MOUA 3KO0A 2Z6ZA 3PN7C 3SSYA 3LF4B 5B8IB 2O60A 3A8SA 2GTEA 2QEVA 2IB6A 4MEWA 4W74A 1BR4B 1KQMB 5FI2A 4PDZA 1IQ5A 3SG3A 2L4HA 1Q80A 1GM0A 2LMTA 1BFPA 3LVDA 1S6JA 4H47A 5F9GA 5FVFA 5J2OA 5AEQA 3D75A 4GFTA 3ST4A 1C3YA 1SL7A 2KSPA 3PFVA 2LVKA 1XO5A 4C0LA 2WCLA 2GGZA 1KYSA 2VZXA 4YGEB 4NQGA 2WISA 2VRGA 1RROA 1SNLA 1N0YA 3IP2A 1BT6A 4JEOA 4RTCA 1CDMA 1CLLA 1JWDA 4MLWA 4ORCB 2KGRA 3DQ4A 1F54A 1QVIZ 4B30B 1ALWA 3CGAA 3DVEA 2LANA 3GOFA 1UUSA 3CZ1A 1AP4A 3SVOA 2KFHA 4JD9A 2MRDA 1UHKA 4GBAA 5DQBA 2VAEA 5BQLA 3E5TA 1B8RA 3SVEA 2WSNA 3BFBA 4P2YB 4JF9A 2ZRTA 5BPJA 5CSNA 4R6BA 2L50A 3EKHA 2LCPA 4CPVA 2EMNA 2JTZA 3LS3A 1ZFSA 1CMGA 3I5GB 1GGXA 3DVMA 2LLTA 4DXNA 3CR4X 2B3QA 5PALA 1X02A 1KQVA 3FE8A 2QLIA 3BOWA 1LA3A 2E6WA 1DELA 4W7AA 1KWOC 4W7EA 5HKZA 4ANJA 1XFVO 2H61A 3DQIA 3O78A 2VVIA 4PHMA 5HZUA 1NUBA 4M2PA 2KFFA 4W6KA 3B7AA 2JU0A 2C9JA 2OS8B 3NHTA 1XMZA 2BL0B 4JFGA 5TNCA 3CABA 3TUYB 5DRFA 3DYEA 1YVLA 4MZKA 2OGRA 4YI9A 3M22A 3DQNA 1EMMA 4C0JA 1CDNA 3DQUA 4CLNA 4INXA 2WCEA 4W6FA 1CLBA 3JVTC 3AKBA 3NEZA 3SG5A 5DPGA 3R1PA 2M29A 1ALVA 2JPOA 4ICBA 1JBZA 1IJ6A 4J88A 4PCWA 1LKJA 3GJ1A 2Q57A 5DTZA 3SVSA 1IH0A 1BLQA 3ZUJA 1MXLC 3DPXA 5DTYA 4GAOA 2PRUA 1GGWA 4JWQA 4AQIA 2Y1MA 5I8NA 2BE4A 2L98A 1SY9A 3P28A 3BXBA 2L5YA 3NSOA 2BAPA 1BU3A 5KTYA 4W7RA 1DJIA 3ZTFA 5ER5A 3DQ6A 2E30A 2B3PA 1QATA 2OPOA 3IR8A 4CIDA 3OX6A 2Q4UA 1CLMA 1YZWA 2Z6XA 4FQTA 5FI7A 4GESB 4XJKB 1KFXL 2Z1OA 2DUIA 1JFKA 4FTGA 1C3ZA 5LTPA 4HRHA 3W1DA 3S0EA 1L2OC 4RYWA 3BOWB 1YURA 2EMOA 1DF0B 2JXLA 2LLSA 3DQ5A 3EG5B 2H5PA 1DJGA 3TZ1A 5DTXA 1M46A 2HPWA 4W6GA 4YGAA 4EULA 3BUXB 1SCMC 3FE9A 1XK4C 1W7TA 2WC6A 1Z2CB 5BTTB 1FF1A 1H4UA 3CDNA 4W72A 2HGDA 3QMEA 1Z1PA 1YRTB 1K96A 1J1EA 3FS7A 1FI5A 1XFUO 3DVJA 1K9KA 1GJYA 1UHIA 1YHGA 4AR7A 3U0MA 2JZIA 4GF6B 4W69A 1F4OA 1OZSA 2MAZA 4OKHA 1UWOA 1OOGA 2OTGB 3DF0B 5HZSA 3GK1A 1KYRA 2RH7A 5H89A 1M39A 3DQCA 3PATA 5DY6A 2K7BA 3D74A 4IK1A 1WDCC 5CSIA 3WLDA 3ZNIA 4EDOA 1FPWA 3U8PA 1PRWA 4NDDA 4XOVA 3OSRA 2KPHA 1DT7B 2BCAA 3QRXA 1EH2A 4DRWA 2K7OA 1B9CA 5DKNA 3BFHA 2HGYA 1IKUA 4HVFA 5HL1A 4WRIA 2YGUA 2Z6YA 1Z4HA 2YE0A 3CFFA 1CDPA 2BBNA 3R1OA 2F2OA 3G9AA 4H48A 1MWNA 3NXAA 2P6BB 1F4QA 3SS0A 3D73A 4N5XA 3LL8B 5DPHA 3UNWA 2QU1A 2JTTA 4U8DA 3D0YA 1EMKA 1YUSA 2LNKA 1DJXA 2K2FA 4I2YA 5KU1A 3VROA 3CWGA 2I2RE 4M2OA 3VGOA 1EMFA 3M24A 3SSTA 4W6BA 1ORGA 1DGUA 4HREE 3TDIA 3UFZA 3E3RA 3WNXB 4MVFA 2LVJA 2L2CA 3PM2A 2A53B 3DQOA 2H2KA 4LJDC 3PJBA 1EG3A 2VVHA 2WNDA 2R2IA 1QV1A 2JPTA 5ER4X 1KFUL 2GGMA 2HQWA 3E5VA 3NSLA 1XSSA 1F71A 1AJ5A 2A50B 1H8BA 3O4XA 1JC0A 3CZ0A 4Q04A 4NDCA 3Q8IA 1FW4A 1C7WA 2DD7A 5DKRA 1LS8A 4ZINA 3VK1A 2OTEA 3SSPA 1QXTA 1RMOA 2IOVA 1YHIA 3PJ7A 4MBEA 1DTLA 3O77A 3NT9A 1W7IB 1EG4A 1XFRA 1J7PA 1M63B 3K21A 1BG1A 1SRAA 4Q9WA 1SKTA 2WCJA 2COLB 1B1GA 5IBWA 3OHMB 3S0BA 5FHVA 3LLEA 2Y5IA 3KCTA 5G08A 3EVUA 4M2QA 1Q4EA 3DQJA 3SJSA 1JC2A 1M45A 3H1OA 1VRKA 5LK4A 5I94A 4DKNA 3SS3A 3S0AA 2AMIA 4OY4A 1SK6D 2Q91A 2PALA 4W6TA 3SSLA 1GQMA 1SBJA 3DQ7A 3TMTA 2ZFDA 4Q7UA 5EL2A 2DUEA 1ZGOA 1QIWA 3L4AA 1DC1A 4ZCUA 1GGZA 4HE4A 2F2PA 1SYMA 3L4LA 4LQTA 2QACA 5AFPA 1HT9A 5D3OA 1IQ3A 5D7FA 2G3DB 4KW4A 4ORBB 1AHRA 2QEHA 3O2PA 1QASA 4I5NB 3NSIA 3I5IC 2M0RA 4LJCA 5DRGA 4F0ZB 1IRJA 3DVKA 3OGNA 4OV2A 3U0LA 3JVTB 4PE0A 2CCMA 5HZTA 2F3YA 3KEVA 4Z4KA 3VB1A 4PE1A 1ZUZA 1K95A 2PVBA 1LINA 2WORA 3TMRA 3U0KA 1MHOA 1K93D 1Q4DA 4YRUA 4W6UA 1DJHA 2WOSA 3RLZA 4Q7TA 4XVPA 2BCXA 4WQ3A 4GOBA 2BKIB 1RJVA 4W6OA 2POXA 4USLA 5CPVA 4KF5A 1K90D 1YR5A 3DQMA 1Y0VH 4W6SA 3AKAA 1CM1A 1YFPA 3KCSA 4INWA 3DQ8A 4YBHB 1L7ZA 1S6ZA 1HQVA 1CV7A 2QRFA 2HPSA 3PLFB 4TNCA 3GL4A 1XYDA 1QIVA 3CGLA 1JUOA 2G9BA 2LMVA 4W73A 5HGEA 4KGFA 2A48A 4IK4A 1SMGA 1WY9A 1L2OB 3D76A 1ZUXA 2V4EA 3SG7A 4XJKA 4CFRA 1OOIX 4HRGA 4EN1A 1UURA 1OMVA 3DQHA 4RYSA 2EHBA 2HQKA 3DQ9A 4L12A 2AWJA 1ZGQA 1NP8A 2KAYA 4IK9A 1KK8B 4H3MA 1DF0A 1C07A 2AHAA 1IWQA 4XOWA 2FWQA 2F3ZA 3N7HA 2ZNEA 1TN4A 3RWAA 2F8PA 4A4CA 3S0FA 1CFCA 1MR8A 1BOCA 4ORNA 4BDUA 5BTTA 1J7QA 3SVDA 3B86A 5EBJA 5H87A 4GGFA 1S36A 2A47A 1NX0A 3SSKA 2KI4B 2EMDA 2DUFA 3S0GA 1M31A 2WHUA 3GK2A 4BY5A 2A46A 4IK5A 2HRSA 1QY3A 1MOVA 3B87A 2ZNDA 3PJIA 4IJ7A 3EVPA 4N1GA 3DF0A 1CMFA 1EMCA 1T14A 3H4SE 4MZLA 3DPZA 1RM9A 2LUXA 4ZBLA 1J1DA 2LVVA 2H9WA 1QWVA 2G16B 4L9MA 3I5FC 2AWKA 4AS8A 4GPLB 4ZIOA 3CR2A 2LUCA 3AI4A 4ETOA 1OMDA 2ZMWA 4KEXA 2AH8A 1EMAA 1K9PA 2OKYA 1A4PA 4PE4A 2DD9A 2GW4B 4PHJA 2M97A 3BXCA 3ST2A 2KBIA 5FI6A 2LP2A 1S5GY 3BJHA 1SSEB 2L5XB 3CZ2A 1C7VA 5FVGA 1HCJA 1NX2A 1P28A 1Y1XA 4MRYA 1GFLA 2JQ6A 1RECA 3FIAA 1B9AA 3EK7A 3CD9A 3BUMB 1EMEA 4W6AA 1TUJA 1W9ZA 1B47A 5DICA 3K1EA 4UPGA 2BKHB 4P76A 4W6LA 2V4EB 4P1QA 1NPQA 2LE9B 1E8AA 3SVUA 4L1IA 1GL4A 1NWDA 2KQYA 3SG6A 4KW8A 5HZOA 2FCEA 5EXCI 1MUXA 3SVCA 1AVSA 4ZF5A 1Y1UA 1B7TY 1RTP1 2Y1NA 2CT9A 1CFDA 3R1VA 4JGEA 2DDDA 2M7LA 3EVVA 1PVAA 2MLEC 1A29A 2NZ0A 3CR5X 1S26D 3SVBA 1AK8A 3SIAA 1YUUA 4OJ0A 3LVCA 3ZULA 1Z1QA 5D69A 4BY4A 4R6DA 3D78A 2NCOA 2AWLA 4TZGA 4W6HA 3AKOA 1B8CA 2HFCA 1YUTA 1IIOA 3WHTB 2C9IA 3I5GC 5HKWA 1IGVA 2G6XA 4MSPA 4NDBA 1SR6B 1OZOA 3DQEA 2ZKMX 3WXAA 5KTGA 3AI5A 3WCKA 3KPXA 3OGOA 4PE7A 2KNEA 3V3DA 1NSHA 2DUHA 2OKWA 5EB7A 4XL5A 2QZ0A 3AAKA 1F70A 4E68A 2MJWB 1JC1A 2O29A 1BODA 2WCFA 1OMRA 2RGIA 3IQOA 1KCYA 5FYXA 4PHNA 4YGDB 4D1EA 1DMOA 3IF7A 2BL0C 2FL1A 2KI6C 3OB2B 3JTDC 2CTNA 1ZGPA 3L47A 3RZSA 1YX7A 4IL1A 4XYNA 2YE1A 3EK8A 1S6CA 2GV5A 2ZN9A 1IJ5A 1JFJA 1WLMA 3KF9A 4DCKA 1HUYA 1Q73A 3DQ2A 3BFAA 1A2XA 2HQ8A 2JT3A 1KSMA 1LXFC 1W7SA 1N2DA 1CTRA 4HSZA 1XA5A 1K9UA 3PN7B 1TTXA 2JXCA 2BBMA 3BX9A 1UHHA 2M1KB 4ZB1A 1ZACA 4W6RA 3SG4A 2KI6D 3CLNA 3DQDA 5I2OA 4I5JA 2I94A 2EGDA 1EMGA 1UHJA 2KOTA 1DQEA 1XFYO 2BTJA 2ZN8A 4F7FA 1KK7Y 3O6BA 5BT0A 2K2AA 2M3WA 3MGFA 2A56B 4W6PA 2SCPA 1RFJA 1NCXA 3LK1A 3UO9A 2VVJA 5I2QA 2QLGB 2D8NA 3D10A 2BNXA 3ED8A 3FWCA 2GW3A 2A54B 1CM4A 1QV0A 3DQ1A 2G3OA 3GB3A 1SL9A 4DUQA 2PSRA 2A52B 4OVNF 1OE9B 1DGVA 2JT8A 3E5WA 3WLCA 1QLSA 1MF8B 1XA9A 3NGVA 1EMLA 2JC2A 1PSBA 2K60A 4R1EA 2QT2A 3RWTA 1D1OA 3DQLA 4DXIA 1JSAA 3PIBA 3GK4X 2G2BA 3FWBA 2BCBA 3DY9A 3U8AA 2H61C 4DXMA 1UISA 3D77A 5LTQA 4KF4A 2JOJA 4KA9A 3OSQA 3HCMA 4PFEA 1LVCD 1QX5B 1S1EA 5EXBA 4GGNA 2BE6A 2M9GA 1EXRA 1U5IA 5EJUA 1KWOB 1K8UA 5DPJA 1OXDA 3ZUFA 4W76A 3LVAA 4JQ0D 1TNQA 2CBLA 3SG2A 1XK4A 1F0BA 2KFGA 3SVNA 4FQOA 2OTGC 1YJFA 2NLNA 2KQ6A 2LHLA 2QLEA 1ZOTB 1UHNA 3SVRA 2P4MA 4LW5A 1Y6WA 4PALA 4OZDA 4TZAA 1TNPA 1QJTA 5JOLA 1YHHA 1TWOA 4OR9B 4QJ5B 5T3IA 4JRBA 2FCDA 2FJYA 1JBYA 1RMMA 1CFFA 5EB6A 1A75B 4HQ8A 2ZO6A 1TIZA 2H8QA 4WQ2A 3VRRA 4JC2A 3I5FB 3LK0A 5K89A 2G6EA 3V2LA 3VRQA 3NHIA 3SV5A 3EVRA 4KPIA 1XFZO 1A03A 4ZF4A 2H6VA 2LAPA 2ZMUA 4YGCB 2PXSA 4LJBA 1K2HA 1DVIA 1BF5A 2WURA 1TUZA 1G33A 3W1CA 4OGSA 2WCBA 4UTSA 2F33A 4YGBB 2QEBA 2HF5A 5CSFA 3K1KA 3ADFA 1EL4A 3EKJA 1G8IA 1W7UA 2PMYA 2JT0A 4W6MA 4ZFSA 2H8VA 1EJ3A 4W6NA 3PJ5A 5DPIA 1MXEA 1DJYA 3IVTA 4W75A 3SSVA 1QTXA 2JULA 2WC8A 5KSZA 4N3DA 4GUKA 1KFXS 4IK3A 4U2VA 3CFAA 4DS7A 3VRNA 1MYWA 1U5IB 1Q4CA 3CFHA 4LJDA 2NCPA 3I5HC 3VICA 3A8RA 2G5ZB 1MQ1A 1SCMB 2LC5A 4OHSA 2GX2A 1S5GZ 1JF2A 2IB5A 2L51A 3BUOB 2MA2A 3SIBA 5HLVA 1H4BA 2FZUA 2HCGA 4DXOA 4Z4MA 3DPWA 5HW9A 1NCZA 1BR1B 4W6CA 1WRKA 4A4BA 1DEKA 2KYFA 3CS1A 3VHTB 2G2SB 2OJKA 4W7CA 5I2LA 3A4UB 2EC6C 3OB1B 2M49B 3EK4A 2O24A 1PVBA 3H1RA 4IK8A 3PM8A 4J89A 2KBMA 1KYPA 2LMUA 1PULA 2K0JA 1Q4BA 1WDCB 5HKYA 1NIWA 3PALA 3TDUA 3WHUB 1WRLA 3CBEA 1OW4A 5CSJA 4W7XA 2MBXA 2LM5A 1B7TZ 1BJFA 3JTDB 2L0PA 4P5OE 2LVIA 2ARLA 1CNPA 2M8UA 4OQWA 2I7AA 2KLEA 3TS5C 4C0KA 2CXJA 3BQ3A 1QVIY 1K94A 1TCFA 3ZWHA 4XGYA 2WSOA 3OX5A 2NXQA 2P71A 3BUWB 2IS9A 2Y0GA 3ST3A 2M1UA 1SL8A 3HX4A 2Q6PA 1TRFA 4HQCA 1OOJA 4W6JA 1TCOB 1NX1A 1PK0D 1TNXA 1KQMC 4ZCVA 5DKQA 2YFPA 5HLOA 5AERA 4W6DA 2B1UA 1NCYA 1OOHA 3B88A 3AAJA 4JPZB 2WHTA 4LQUA 1F09A 1QX7A 4ORAB 3R72A 1SCVA 4AQJA 2GX0A 1OXFA 3DQAA 2K61A 2KDHA 2Y4QA 5DQMA 3U0NA 4JKTA 1OQPA 4EDSA 2ZO7A 2DOQA 2AWMA 1S3PA 3F45A 2PXWA 1RMPA 1R6PA 1KFUS 1QYFA 3KHEA 1WRZA 1QYOA 2WCKA 5H88A 2JADA 1N65A 1YRUB 2QLGA 2QLHA 4B5YA 3U8CA 4ZF3A 2A4JA 1PSRA 2QEOA 1J55A 5JJGA 2WCMA 4Q9XA 1XVJA 5DU0A 2LHIA 2V53A 1KSOA 2HQZA 3CTNA 2LP3A 1AUIB 2K7CA 1S6IA 1KK8C 1XFWO 1B4CA 1ODBA 1KK7Z 4EMQA 2PASA 3B6XA 3DD4A 3M0WA 2OTBA 2TN4A 4MN0A 1RRXA 2QDIA 3IQQA 1NYAA 3CZTX 2JNFA 5DTLA 4DIRA 4PPKA 2OS8C 2KI4C 3NT3A 2K8MB 3S0DA 3TUYC 1QX2A
chains in the Genus database with same CATH topology
1OXEA 5EXUA 2FJUB 4KAGA 2ICRA 4PPLA 1RWYA 3LSAA 4NWSA 1KP5A 1YX8A 2O5GA 3UG0A 1J7RA 4W6IA 2MLFC 1CKKA 2AUCA 3ST0A 3I5IB 3ICBA 4QJ4B 1SPYA 1QLKA 1Y1AA 2ISDA 2DDCA 1R2UA 2SASA 2L2EA 3NF0A 5HBDA 4L13A 1JF0A 1AJ4A 1V1FA 1SW8A 4CFQA 4KF5C 2MHHA 3BXAA 4OCIA 2ZRSA 4N1FA 1F55A 1CFPA 4DXQA 1A75A 1JBAA 1CB1A 2O2BA 1PALA 3P8UA 1F8HA 4Q7RA 2LV7A 3O4YA 1J7OA 3PSRA 5HYDA 4KW9A 5AXIA 3NEDA 2JWWA 1NX3A 2I18A 1W7JB 1CDLA 2K7DA 5J3XA 4PHKA 2V4EC 2KGBC 3BXKA 5LTRA 2LLUA 2H5OA 1V1GA 1LA0A 5FVIA 2VADA 3VRPA 3SRYA 2KHNA 3LA1A 5EHUA 1XFXO 4MZJA 1XQMA 4IZNA 5AQBB 3SSHA 2BECA 1H6RA 2JRFA 2YDZA 4HQ9A 4DKMA 1YJ2A 1UP5A 3CB9A 4H3LA 2IE2A 1QXPA 2WHSA 1DJWA 3I5HB 2H5RA 4AOMA 4I5KA 3RM1A 1G7KA 2JNXA 4I5LB 2QPTA 4GGFC 4W7FA 4MRXA 1DJZA 4B30A 1Q4AA 5F6TA 2AAOA 2G6YA 1IG5A 4W7DA 4H3NA 1QYQA 1SR6C 2HETA 3DQFA 1BMOA 3S05A 4J8AA 3DQKA 3NSKA 3GJ2A 2H5QA 1B8LA 2EC6B 3BUNB 2KYCA 1TNWA 2DUGA 1WLZA 4DXPA 3I19A 3VHTA 1YVHA 1C4FA 3MSEB 4QJ3B 3C1VA 1ZMZA 2M7NA 3CD1A 5GQQC 5AANA 2KAVA 2L4IA 3TDZA 4PPJA 3LF3A 1FI6A 1OSAA 3DQ3A 3TS5B 2HJOA 4YI8A 3BYAA 1XAEA 4GNKB 1G4YR 3D0YB 4W77A 2CNPA 1RK9A 1EMBA 3OP0A 1YTZC 4KGEA 2WIQA 2KAXA 3GEXA 3LCPC 1FBVA 1TOPA 1QS7A 2FOTA 1MOUA 3KO0A 2Z6ZA 3PN7C 3SSYA 3LF4B 5B8IB 2O60A 3A8SA 2IB6A 4MEWA 4W74A 1BR4B 1KQMB 4PDZA 1IQ5A 3SG3A 2L4HA 1Q80A 2LMTA 1BFPA 3LVDA 1S6JA 4H47A 5F9GA 5FVFA 5J2OA 5AEQA 4GFTA 3ST4A 1SL7A 2KSPA 3PFVA 2LVKA 1XO5A 4C0LA 2GGZA 1KYSA 2VZXA 4YGEB 4NQGA 2WISA 2VRGA 1RROA 1SNLA 1N0YA 3IP2A 1BT6A 4JEOA 4RTCA 1CDMA 1CLLA 1JWDA 4MLWA 4ORCB 2KGRA 3DQ4A 1F54A 1QVIZ 4B30B 1ALWA 3CGAA 3DVEA 2LANA 3GOFA 1UUSA 1AP4A 3SVOA 2KFHA 2MRDA 1UHKA 4GBAA 5DQBA 2VAEA 5BQLA 3E5TA 1B8RA 3SVEA 2WSNA 4P2YB 4JF9A 2ZRTA 5BPJA 5CSNA 4R6BA 2L50A 3EKHA 2LCPA 4CPVA 2EMNA 2JTZA 3LS3A 1ZFSA 1CMGA 3I5GB 1GGXA 3DVMA 2LLTA 4DXNA 3CR4X 2B3QA 5PALA 1X02A 1KQVA 2QLIA 3BOWA 1LA3A 2E6WA 4W7AA 1KWOC 4W7EA 5HKZA 4ANJA 1XFVO 2H61A 3DQIA 3O78A 2VVIA 4PHMA 5HZUA 1NUBA 4M2PA 2KFFA 4W6KA 2JU0A 2C9JA 2OS8B 1XMZA 2BL0B 4JFGA 5TNCA 3TUYB 5DRFA 1YVLA 4MZKA 2OGRA 4YI9A 3M22A 3DQNA 1EMMA 4C0JA 1CDNA 3DQUA 4CLNA 2WCEA 4W6FA 1CLBA 3JVTC 3AKBA 3NEZA 3SG5A 5DPGA 2M29A 1ALVA 4ICBA 1JBZA 1IJ6A 4J88A 4PCWA 1LKJA 3GJ1A 2Q57A 5DTZA 3SVSA 1IH0A 1BLQA 3ZUJA 1MXLC 3DPXA 5DTYA 4GAOA 2PRUA 1GGWA 4JWQA 4AQIA 2Y1MA 5I8NA 2BE4A 2L98A 1SY9A 3P28A 3BXBA 3NSOA 5KTYA 1BU3A 4W7RA 1DJIA 3ZTFA 5ER5A 3DQ6A 2E30A 2B3PA 1QATA 2OPOA 3IR8A 4CIDA 3OX6A 2Q4UA 1CLMA 1YZWA 2Z6XA 4GESB 4XJKB 1KFXL 2Z1OA 2DUIA 1JFKA 4FTGA 5LTPA 4HRHA 3W1DA 1L2OC 4RYWA 3BOWB 1YURA 2EMOA 1DF0B 2JXLA 2LLSA 3DQ5A 2H5PA 1DJGA 3TZ1A 5DTXA 1M46A 2HPWA 4W6GA 4YGAA 4EULA 3BUXB 1SCMC 1XK4C 1W7TA 5BTTB 1FF1A 1H4UA 4W72A 2HGDA 1Z1PA 1YRTB 1K96A 1J1EA 3FS7A 1FI5A 1XFUO 3DVJA 1K9KA 1GJYA 1UHIA 1YHGA 4AR7A 3U0MA 2JZIA 4GF6B 4W69A 1F4OA 1OZSA 2MAZA 4OKHA 1UWOA 2OTGB 3DF0B 5HZSA 3GK1A 1KYRA 2RH7A 5H89A 1M39A 3DQCA 3PATA 5DY6A 2K7BA 4IK1A 1WDCC 5CSIA 3WLDA 3ZNIA 4EDOA 1FPWA 3U8PA 1PRWA 4NDDA 4XOVA 3OSRA 1DT7B 2BCAA 3QRXA 1EH2A 4DRWA 2K7OA 1B9CA 5DKNA 2HGYA 1IKUA 4HVFA 4WRIA 2Z6YA 2YE0A 3CFFA 1CDPA 2BBNA 2F2OA 3G9AA 4H48A 1MWNA 3NXAA 2P6BB 1F4QA 3SS0A 4N5XA 3LL8B 5DPHA 2QU1A 2JTTA 4U8DA 3D0YA 1EMKA 1YUSA 2LNKA 1DJXA 2K2FA 4I2YA 5KU1A 3VROA 3CWGA 2I2RE 4M2OA 3VGOA 1EMFA 3M24A 3SSTA 4W6BA 1DGUA 4HREE 3TDIA 3UFZA 3E3RA 3WNXB 4MVFA 2LVJA 2A53B 3DQOA 2H2KA 4LJDC 3PJBA 1EG3A 2VVHA 2WNDA 2R2IA 1QV1A 2JPTA 5ER4X 1KFUL 2GGMA 2HQWA 3E5VA 3NSLA 1XSSA 1F71A 1AJ5A 2A50B 1H8BA 1JC0A 4Q04A 4NDCA 1FW4A 1C7WA 2DD7A 5DKRA 4ZINA 3VK1A 2OTEA 3SSPA 1QXTA 1RMOA 2IOVA 1YHIA 3PJ7A 4MBEA 1DTLA 3O77A 3NT9A 1W7IB 1EG4A 1J7PA 1M63B 3K21A 1BG1A 1SRAA 4Q9WA 1SKTA 2COLB 1B1GA 5IBWA 3OHMB 5FHVA 3LLEA 2Y5IA 3KCTA 5G08A 3EVUA 4M2QA 1Q4EA 3DQJA 3SJSA 1JC2A 1M45A 3H1OA 1VRKA 5LK4A 4DKNA 2AMIA 4OY4A 1SK6D 2Q91A 2PALA 4W6TA 3SSLA 1GQMA 1SBJA 3DQ7A 3TMTA 2ZFDA 4Q7UA 2DUEA 1ZGOA 1QIWA 4ZCUA 1GGZA 4HE4A 2F2PA 1SYMA 4LQTA 2QACA 5AFPA 1HT9A 1IQ3A 5D7FA 2G3DB 4KW4A 4ORBB 1AHRA 3O2PA 1QASA 4I5NB 3NSIA 3I5IC 2M0RA 4LJCA 5DRGA 4F0ZB 1IRJA 3DVKA 4OV2A 3U0LA 3JVTB 4PE0A 2CCMA 5HZTA 2F3YA 3KEVA 4Z4KA 4PE1A 1ZUZA 1K95A 2PVBA 1LINA 2WORA 3TMRA 3U0KA 1MHOA 1K93D 1Q4DA 4YRUA 4W6UA 1DJHA 2WOSA 3RLZA 4Q7TA 4XVPA 2BCXA 4WQ3A 4GOBA 2BKIB 1RJVA 4W6OA 2POXA 4USLA 5CPVA 4KF5A 1K90D 1YR5A 3DQMA 1Y0VH 4W6SA 3AKAA 1CM1A 1YFPA 3KCSA 3DQ8A 4YBHB 1L7ZA 1S6ZA 1HQVA 1CV7A 2QRFA 2HPSA 3PLFB 4TNCA 3GL4A 1XYDA 1QIVA 3CGLA 1JUOA 2G9BA 2LMVA 4W73A 5HGEA 4KGFA 2A48A 4IK4A 1SMGA 1WY9A 1L2OB 1ZUXA 2V4EA 3SG7A 4XJKA 4CFRA 4HRGA 4EN1A 1UURA 1OMVA 3DQHA 4RYSA 2EHBA 2HQKA 3DQ9A 4L12A 2AWJA 1ZGQA 1NP8A 2KAYA 4IK9A 1KK8B 4H3MA 1DF0A 1C07A 2AHAA 1IWQA 4XOWA 2FWQA 2F3ZA 2ZNEA 1TN4A 3RWAA 2F8PA 4A4CA 1CFCA 1MR8A 1BOCA 4ORNA 4BDUA 5BTTA 1J7QA 3SVDA 5EBJA 5H87A 4GGFA 1S36A 2A47A 1NX0A 3SSKA 2KI4B 2EMDA 2DUFA 1M31A 2WHUA 3GK2A 4BY5A 2A46A 4IK5A 2HRSA 1QY3A 1MOVA 2ZNDA 3EVPA 4N1GA 3DF0A 1CMFA 1EMCA 3H4SE 4MZLA 3DPZA 1RM9A 2LUXA 4ZBLA 1J1DA 2LVVA 2H9WA 2G16B 4L9MA 3I5FC 2AWKA 4AS8A 4GPLB 4ZIOA 3CR2A 2LUCA 3AI4A 4ETOA 1OMDA 2ZMWA 4KEXA 2AH8A 1EMAA 1K9PA 1A4PA 2DD9A 4PE4A 2OKYA 2GW4B 4PHJA 2M97A 3BXCA 3ST2A 2KBIA 2LP2A 1S5GY 2L5XB 1C7VA 5FVGA 1HCJA 1NX2A 1Y1XA 4MRYA 1GFLA 2JQ6A 1RECA 3FIAA 1B9AA 3EK7A 3CD9A 3BUMB 1EMEA 4W6AA 1B47A 4UPGA 2BKHB 4P76A 4W6LA 2V4EB 4P1QA 1NPQA 2LE9B 1E8AA 3SVUA 4L1IA 1GL4A 1NWDA 2KQYA 3SG6A 4KW8A 5HZOA 2FCEA 5EXCI 1MUXA 3SVCA 1AVSA 4ZF5A 1Y1UA 1B7TY 1RTP1 2Y1NA 2CT9A 1CFDA 4JGEA 2DDDA 2M7LA 3EVVA 1PVAA 2MLEC 1A29A 2NZ0A 3CR5X 1S26D 3SVBA 1AK8A 3SIAA 1YUUA 4OJ0A 3LVCA 3ZULA 1Z1QA 5D69A 4BY4A 4R6DA 2AWLA 2NCOA 4TZGA 4W6HA 3AKOA 1B8CA 2HFCA 1YUTA 3WHTB 2C9IA 3I5GC 5HKWA 1IGVA 2G6XA 4MSPA 4NDBA 1SR6B 1OZOA 3DQEA 2ZKMX 3WXAA 5KTGA 3AI5A 3WCKA 3KPXA 3OGOA 4PE7A 2KNEA 3V3DA 1NSHA 2DUHA 2OKWA 5EB7A 4XL5A 2QZ0A 3AAKA 1F70A 4E68A 2MJWB 1JC1A 2O29A 1BODA 2WCFA 1OMRA 2RGIA 3IQOA 1KCYA 5FYXA 4PHNA 4YGDB 4D1EA 1DMOA 3IF7A 2BL0C 2FL1A 2KI6C 3OB2B 3JTDC 2CTNA 1ZGPA 1YX7A 4IL1A 4XYNA 2YE1A 3EK8A 1S6CA 2GV5A 2ZN9A 1IJ5A 1JFJA 1WLMA 3KF9A 4DCKA 1HUYA 1Q73A 3DQ2A 1A2XA 2HQ8A 2JT3A 1KSMA 1LXFC 1W7SA 1N2DA 1CTRA 4HSZA 1XA5A 1K9UA 3PN7B 1TTXA 2JXCA 2BBMA 3BX9A 1UHHA 2M1KB 4ZB1A 1ZACA 4W6RA 3SG4A 2KI6D 3CLNA 3DQDA 5I2OA 4I5JA 2I94A 2EGDA 1EMGA 1UHJA 2KOTA 1XFYO 2BTJA 2ZN8A 1KK7Y 3O6BA 5BT0A 2K2AA 2M3WA 3MGFA 2A56B 4W6PA 2SCPA 1RFJA 1NCXA 3LK1A 2VVJA 5I2QA 2QLGB 2D8NA 3D10A 3ED8A 3FWCA 2GW3A 2A54B 1CM4A 1QV0A 3DQ1A 2G3OA 3GB3A 1SL9A 4DUQA 2PSRA 2A52B 4OVNF 1OE9B 1DGVA 2JT8A 3E5WA 3WLCA 1QLSA 1MF8B 1XA9A 1EMLA 2JC2A 1PSBA 4R1EA 2QT2A 3RWTA 1D1OA 3DQLA 4DXIA 1JSAA 3PIBA 3GK4X 2G2BA 3FWBA 2BCBA 3U8AA 2H61C 4DXMA 1UISA 5LTQA 4KF4A 2JOJA 4KA9A 3OSQA 3HCMA 4PFEA 1LVCD 1QX5B 1S1EA 5EXBA 4GGNA 2BE6A 2M9GA 1EXRA 1U5IA 5EJUA 1KWOB 1K8UA 5DPJA 1OXDA 3ZUFA 4W76A 3LVAA 4JQ0D 1TNQA 2CBLA 3SG2A 1XK4A 1F0BA 2KFGA 3SVNA 4FQOA 2OTGC 1YJFA 2NLNA 2KQ6A 2LHLA 2QLEA 1ZOTB 1UHNA 3SVRA 2P4MA 4LW5A 1Y6WA 4PALA 4TZAA 1TNPA 1QJTA 5JOLA 1YHHA 4OR9B 4QJ5B 5T3IA 4JRBA 2FCDA 1JBYA 1RMMA 1CFFA 5EB6A 1A75B 4HQ8A 2ZO6A 1TIZA 2H8QA 4WQ2A 3VRRA 4JC2A 3I5FB 3LK0A 5K89A 2G6EA 3VRQA 3SV5A 3EVRA 4KPIA 1XFZO 1A03A 4ZF4A 2H6VA 2LAPA 2ZMUA 4YGCB 2PXSA 4LJBA 1K2HA 1DVIA 1BF5A 2WURA 1G33A 3W1CA 4OGSA 2WCBA 4UTSA 2F33A 4YGBB 2HF5A 5CSFA 3K1KA 3ADFA 1EL4A 3EKJA 1G8IA 1W7UA 2PMYA 2JT0A 4W6MA 4ZFSA 1EJ3A 4W6NA 3PJ5A 5DPIA 1MXEA 1DJYA 4W75A 3SSVA 1QTXA 2JULA 2WC8A 5KSZA 4N3DA 4GUKA 1KFXS 4IK3A 4U2VA 3CFAA 4DS7A 3VRNA 1MYWA 1U5IB 1Q4CA 3CFHA 4LJDA 2NCPA 3I5HC 3VICA 3A8RA 2G5ZB 1MQ1A 1SCMB 2LC5A 4OHSA 2GX2A 1S5GZ 1JF2A 2IB5A 2L51A 3BUOB 2MA2A 3SIBA 5HLVA 1H4BA 2FZUA 2HCGA 4DXOA 4Z4MA 3DPWA 5HW9A 1NCZA 1BR1B 4W6CA 1WRKA 4A4BA 2KYFA 3CS1A 3VHTB 2G2SB 2OJKA 4W7CA 5I2LA 3A4UB 2EC6C 3OB1B 2M49B 3EK4A 2O24A 1PVBA 3H1RA 4IK8A 3PM8A 4J89A 2KBMA 1KYPA 2LMUA 1PULA 2K0JA 1Q4BA 1WDCB 5HKYA 1NIWA 3PALA 3TDUA 3WHUB 1WRLA 3CBEA 5CSJA 4W7XA 2MBXA 2LM5A 1B7TZ 1BJFA 3JTDB 2L0PA 4P5OE 2LVIA 2ARLA 1CNPA 2M8UA 4OQWA 2I7AA 3TS5C 4C0KA 2CXJA 3BQ3A 1QVIY 1K94A 1TCFA 3ZWHA 4XGYA 2WSOA 3OX5A 2NXQA 3BUWB 2IS9A 2Y0GA 3ST3A 2M1UA 1SL8A 3HX4A 2Q6PA 1TRFA 4HQCA 1OOJA 4W6JA 1TCOB 1NX1A 1PK0D 1TNXA 1KQMC 4ZCVA 5DKQA 2YFPA 5HLOA 5AERA 4W6DA 2B1UA 1NCYA 3AAJA 4JPZB 2WHTA 4LQUA 1F09A 1QX7A 4ORAB 1SCVA 4AQJA 2GX0A 1OXFA 3DQAA 2K61A 2KDHA 2Y4QA 5DQMA 3U0NA 1OQPA 4EDSA 2ZO7A 2DOQA 2AWMA 1S3PA 3F45A 2PXWA 1RMPA 1R6PA 1KFUS 1QYFA 3KHEA 1WRZA 1QYOA 5H88A 2JADA 1N65A 1YRUB 2QLGA 2QLHA 4B5YA 3U8CA 4ZF3A 2A4JA 1PSRA 1J55A 5JJGA 4Q9XA 1XVJA 5DU0A 2LHIA 2V53A 1KSOA 2HQZA 3CTNA 2LP3A 1AUIB 2K7CA 1S6IA 1KK8C 1XFWO 1B4CA 1ODBA 1KK7Z 4EMQA 2PASA 3DD4A 3M0WA 2TN4A 2OTBA 4MN0A 1RRXA 3IQQA 1NYAA 3CZTX 2JNFA 5DTLA 4DIRA 4PPKA 2OS8C 2KI4C 3NT3A 2K8MB 3TUYC 1QX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXE A;  5EXU A;  2FJU B;  4KAG A;  2ICR A;  4PPL A;  1RWY A;  3LSA A;  4NWS A;  1KP5 A;  1YX8 A;  2O5G A;  3UG0 A;  1J7R A;  4W6I A;  2MLF C;  1CKK A;  2AUC A;  3ST0 A;  3I5I B;  3ICB A;  4QJ4 B;  1SPY A;  1QLK A;  1Y1A A;  2ISD A;  2DDC A;  1R2U A;  2SAS A;  2L2E A;  3NF0 A;  5HBD A;  4L13 A;  1JF0 A;  1AJ4 A;  1V1F A;  1SW8 A;  4CFQ A;  4KF5 C;  2MHH A;  3BXA A;  4OCI A;  2ZRS A;  4N1F A;  1F55 A;  1CFP A;  4DXQ A;  1A75 A;  1JBA A;  1CB1 A;  2O2B A;  1PAL A;  3P8U A;  1F8H A;  4Q7R A;  2LV7 A;  3O4Y A;  1J7O A;  3PSR A;  5HYD A;  4KW9 A;  5AXI A;  3NED A;  2JWW A;  1NX3 A;  2I18 A;  1W7J B;  1CDL A;  2K7D A;  5J3X A;  4PHK A;  2V4E C;  2KGB C;  3BXK A;  5LTR A;  2LLU A;  2H5O A;  1V1G A;  1LA0 A;  5FVI A;  2VAD A;  3VRP A;  3SRY A;  2KHN A;  3LA1 A;  5EHU A;  1XFX O;  4MZJ A;  1XQM A;  4IZN A;  5AQB B;  3SSH A;  2BEC A;  1H6R A;  2JRF A;  2YDZ A;  4HQ9 A;  4DKM A;  1YJ2 A;  1UP5 A;  3CB9 A;  4H3L A;  2IE2 A;  1QXP A;  2WHS A;  1DJW A;  3I5H B;  2H5R A;  4AOM A;  4I5K A;  3RM1 A;  1G7K A;  2JNX A;  4I5L B;  2QPT A;  4GGF C;  4W7F A;  4MRX A;  1DJZ A;  4B30 A;  1Q4A A;  5F6T A;  2AAO A;  2G6Y A;  1IG5 A;  4W7D A;  4H3N A;  1QYQ A;  1SR6 C;  2HET A;  3DQF A;  1BMO A;  3S05 A;  4J8A A;  3DQK A;  3NSK A;  3GJ2 A;  2H5Q A;  1B8L A;  2EC6 B;  3BUN B;  2KYC A;  1TNW A;  2DUG A;  1WLZ A;  4DXP A;  3I19 A;  3VHT A;  1YVH A;  1C4F A;  3MSE B;  4QJ3 B;  3C1V A;  1ZMZ A;  2M7N A;  3CD1 A;  5GQQ C;  5AAN A;  2KAV A;  2L4I A;  3TDZ A;  4PPJ A;  3LF3 A;  1FI6 A;  1OSA A;  3DQ3 A;  3TS5 B;  2HJO A;  4YI8 A;  3BYA A;  1XAE A;  4GNK B;  1G4Y R;  3D0Y B;  4W77 A;  2CNP A;  1RK9 A;  1EMB A;  3OP0 A;  1YTZ C;  4KGE A;  2WIQ A;  2KAX A;  3GEX A;  3LCP C;  1FBV A;  1TOP A;  1QS7 A;  2FOT A;  1MOU A;  3KO0 A;  2Z6Z A;  3PN7 C;  3SSY A;  3LF4 B;  5B8I B;  2O60 A;  3A8S A;  2IB6 A;  4MEW A;  4W74 A;  1BR4 B;  1KQM B;  4PDZ A;  1IQ5 A;  3SG3 A;  2L4H A;  1Q80 A;  2LMT A;  1BFP A;  3LVD A;  1S6J A;  4H47 A;  5F9G A;  5FVF A;  5J2O A;  5AEQ A;  4GFT A;  3ST4 A;  1SL7 A;  2KSP A;  3PFV A;  2LVK A;  1XO5 A;  4C0L A;  2GGZ A;  1KYS A;  2VZX A;  4YGE B;  4NQG A;  2WIS A;  2VRG A;  1RRO A;  1SNL A;  1N0Y A;  3IP2 A;  1BT6 A;  4JEO A;  4RTC A;  1CDM A;  1CLL A;  1JWD A;  4MLW A;  4ORC B;  2KGR A;  3DQ4 A;  1F54 A;  1QVI Z;  4B30 B;  1ALW A;  3CGA A;  3DVE A;  2LAN A;  3GOF A;  1UUS A;  1AP4 A;  3SVO A;  2KFH A;  2MRD A;  1UHK A;  4GBA A;  5DQB A;  2VAE A;  5BQL A;  3E5T A;  1B8R A;  3SVE A;  2WSN A;  4P2Y B;  4JF9 A;  2ZRT A;  5BPJ A;  5CSN A;  4R6B A;  2L50 A;  3EKH A;  2LCP A;  4CPV A;  2EMN A;  2JTZ A;  3LS3 A;  1ZFS A;  1CMG A;  3I5G B;  1GGX A;  3DVM A;  2LLT A;  4DXN A;  3CR4 X;  2B3Q A;  5PAL A;  1X02 A;  1KQV A;  2QLI A;  3BOW A;  1LA3 A;  2E6W A;  4W7A A;  1KWO C;  4W7E A;  5HKZ A;  4ANJ A;  1XFV O;  2H61 A;  3DQI A;  3O78 A;  2VVI A;  4PHM A;  5HZU A;  1NUB A;  4M2P A;  2KFF A;  4W6K A;  2JU0 A;  2C9J A;  2OS8 B;  1XMZ A;  2BL0 B;  4JFG A;  5TNC A;  3TUY B;  5DRF A;  1YVL A;  4MZK A;  2OGR A;  4YI9 A;  3M22 A;  3DQN A;  1EMM A;  4C0J A;  1CDN A;  3DQU A;  4CLN A;  2WCE A;  4W6F A;  1CLB A;  3JVT C;  3AKB A;  3NEZ A;  3SG5 A;  5DPG A;  2M29 A;  1ALV A;  4ICB A;  1JBZ A;  1IJ6 A;  4J88 A;  4PCW A;  1LKJ A;  3GJ1 A;  2Q57 A;  5DTZ A;  3SVS A;  1IH0 A;  1BLQ A;  3ZUJ A;  1MXL C;  3DPX A;  5DTY A;  4GAO A;  2PRU A;  1GGW A;  4JWQ A;  4AQI A;  2Y1M A;  5I8N A;  2BE4 A;  2L98 A;  1SY9 A;  3P28 A;  3BXB A;  3NSO A;  5KTY A;  1BU3 A;  4W7R A;  1DJI A;  3ZTF A;  5ER5 A;  3DQ6 A;  2E30 A;  2B3P A;  1QAT A;  2OPO A;  3IR8 A;  4CID A;  3OX6 A;  2Q4U A;  1CLM A;  1YZW A;  2Z6X A;  4GES B;  4XJK B;  1KFX L;  2Z1O A;  2DUI A;  1JFK A;  4FTG A;  5LTP A;  4HRH A;  3W1D A;  1L2O C;  4RYW A;  3BOW B;  1YUR A;  2EMO A;  1DF0 B;  2JXL A;  2LLS A;  3DQ5 A;  2H5P A;  1DJG A;  3TZ1 A;  5DTX A;  1M46 A;  2HPW A;  4W6G A;  4YGA A;  4EUL A;  3BUX B;  1SCM C;  1XK4 C;  1W7T A;  5BTT B;  1FF1 A;  1H4U A;  4W72 A;  2HGD A;  1Z1P A;  1YRT B;  1K96 A;  1J1E A;  3FS7 A;  1FI5 A;  1XFU O;  3DVJ A;  1K9K A;  1GJY A;  1UHI A;  1YHG A;  4AR7 A;  3U0M A;  2JZI A;  4GF6 B;  4W69 A;  1F4O A;  1OZS A;  2MAZ A;  4OKH A;  1UWO A;  2OTG B;  3DF0 B;  5HZS A;  3GK1 A;  1KYR A;  2RH7 A;  5H89 A;  1M39 A;  3DQC A;  3PAT A;  5DY6 A;  2K7B A;  4IK1 A;  1WDC C;  5CSI A;  3WLD A;  3ZNI A;  4EDO A;  1FPW A;  3U8P A;  1PRW A;  4NDD A;  4XOV A;  3OSR A;  1DT7 B;  2BCA A;  3QRX A;  1EH2 A;  4DRW A;  2K7O A;  1B9C A;  5DKN A;  2HGY A;  1IKU A;  4HVF A;  4WRI A;  2Z6Y A;  2YE0 A;  3CFF A;  1CDP A;  2BBN A;  2F2O A;  3G9A A;  4H48 A;  1MWN A;  3NXA A;  2P6B B;  1F4Q A;  3SS0 A;  4N5X A;  3LL8 B;  5DPH A;  2QU1 A;  2JTT A;  4U8D A;  3D0Y A;  1EMK A;  1YUS A;  2LNK A;  1DJX A;  2K2F A;  4I2Y A;  5KU1 A;  3VRO A;  3CWG A;  2I2R E;  4M2O A;  3VGO A;  1EMF A;  3M24 A;  3SST A;  4W6B A;  1DGU A;  4HRE E;  3TDI A;  3UFZ A;  3E3R A;  3WNX B;  4MVF A;  2LVJ A;  2A53 B;  3DQO A;  2H2K A;  4LJD C;  3PJB A;  1EG3 A;  2VVH A;  2WND A;  2R2I A;  1QV1 A;  2JPT A;  5ER4 X;  1KFU L;  2GGM A;  2HQW A;  3E5V A;  3NSL A;  1XSS A;  1F71 A;  1AJ5 A;  2A50 B;  1H8B A;  1JC0 A;  4Q04 A;  4NDC A;  1FW4 A;  1C7W A;  2DD7 A;  5DKR A;  4ZIN A;  3VK1 A;  2OTE A;  3SSP A;  1QXT A;  1RMO A;  2IOV A;  1YHI A;  3PJ7 A;  4MBE A;  1DTL A;  3O77 A;  3NT9 A;  1W7I B;  1EG4 A;  1J7P A;  1M63 B;  3K21 A;  1BG1 A;  1SRA A;  4Q9W A;  1SKT A;  2COL B;  1B1G A;  5IBW A;  3OHM B;  5FHV A;  3LLE A;  2Y5I A;  3KCT A;  5G08 A;  3EVU A;  4M2Q A;  1Q4E A;  3DQJ A;  3SJS A;  1JC2 A;  1M45 A;  3H1O A;  1VRK A;  5LK4 A;  4DKN A;  2AMI A;  4OY4 A;  1SK6 D;  2Q91 A;  2PAL A;  4W6T A;  3SSL A;  1GQM A;  1SBJ A;  3DQ7 A;  3TMT A;  2ZFD A;  4Q7U A;  2DUE A;  1ZGO A;  1QIW A;  4ZCU A;  1GGZ A;  4HE4 A;  2F2P A;  1SYM A;  4LQT A;  2QAC A;  5AFP A;  1HT9 A;  1IQ3 A;  5D7F A;  2G3D B;  4KW4 A;  4ORB B;  1AHR A;  3O2P A;  1QAS A;  4I5N B;  3NSI A;  3I5I C;  2M0R A;  4LJC A;  5DRG A;  4F0Z B;  1IRJ A;  3DVK A;  4OV2 A;  3U0L A;  3JVT B;  4PE0 A;  2CCM A;  5HZT A;  2F3Y A;  3KEV A;  4Z4K A;  4PE1 A;  1ZUZ A;  1K95 A;  2PVB A;  1LIN A;  2WOR A;  3TMR A;  3U0K A;  1MHO A;  1K93 D;  1Q4D A;  4YRU A;  4W6U A;  1DJH A;  2WOS A;  3RLZ A;  4Q7T A;  4XVP A;  2BCX A;  4WQ3 A;  4GOB A;  2BKI B;  1RJV A;  4W6O A;  2POX A;  4USL A;  5CPV A;  4KF5 A;  1K90 D;  1YR5 A;  3DQM A;  1Y0V H;  4W6S A;  3AKA A;  1CM1 A;  1YFP A;  3KCS A;  3DQ8 A;  4YBH B;  1L7Z A;  1S6Z A;  1HQV A;  1CV7 A;  2QRF A;  2HPS A;  3PLF B;  4TNC A;  3GL4 A;  1XYD A;  1QIV A;  3CGL A;  1JUO A;  2G9B A;  2LMV A;  4W73 A;  5HGE A;  4KGF A;  2A48 A;  4IK4 A;  1SMG A;  1WY9 A;  1L2O B;  1ZUX A;  2V4E A;  3SG7 A;  4XJK A;  4CFR A;  4HRG A;  4EN1 A;  1UUR A;  1OMV A;  3DQH A;  4RYS A;  2EHB A;  2HQK A;  3DQ9 A;  4L12 A;  2AWJ A;  1ZGQ A;  1NP8 A;  2KAY A;  4IK9 A;  1KK8 B;  4H3M A;  1DF0 A;  1C07 A;  2AHA A;  1IWQ A;  4XOW A;  2FWQ A;  2F3Z A;  2ZNE A;  1TN4 A;  3RWA A;  2F8P A;  4A4C A;  1CFC A;  1MR8 A;  1BOC A;  4ORN A;  4BDU A;  5BTT A;  1J7Q A;  3SVD A;  5EBJ A;  5H87 A;  4GGF A;  1S36 A;  2A47 A;  1NX0 A;  3SSK A;  2KI4 B;  2EMD A;  2DUF A;  1M31 A;  2WHU A;  3GK2 A;  4BY5 A;  2A46 A;  4IK5 A;  2HRS A;  1QY3 A;  1MOV A;  2ZND A;  3EVP A;  4N1G A;  3DF0 A;  1CMF A;  1EMC A;  3H4S E;  4MZL A;  3DPZ A;  1RM9 A;  2LUX A;  4ZBL A;  1J1D A;  2LVV A;  2H9W A;  2G16 B;  4L9M A;  3I5F C;  2AWK A;  4AS8 A;  4GPL B;  4ZIO A;  3CR2 A;  2LUC A;  3AI4 A;  4ETO A;  1OMD A;  2ZMW A;  4KEX A;  2AH8 A;  1EMA A;  1K9P A;  1A4P A;  2DD9 A;  4PE4 A;  2OKY A;  2GW4 B;  4PHJ A;  2M97 A;  3BXC A;  3ST2 A;  2KBI A;  2LP2 A;  1S5G Y;  2L5X B;  1C7V A;  5FVG A;  1HCJ A;  1NX2 A;  1Y1X A;  4MRY A;  1GFL A;  2JQ6 A;  1REC A;  3FIA A;  1B9A A;  3EK7 A;  3CD9 A;  3BUM B;  1EME A;  4W6A A;  1B47 A;  4UPG A;  2BKH B;  4P76 A;  4W6L A;  2V4E B;  4P1Q A;  1NPQ A;  2LE9 B;  1E8A A;  3SVU A;  4L1I A;  1GL4 A;  1NWD A;  2KQY A;  3SG6 A;  4KW8 A;  5HZO A;  2FCE A;  5EXC I;  1MUX A;  3SVC A;  1AVS A;  4ZF5 A;  1Y1U A;  1B7T Y;  1RTP 1;  2Y1N A;  2CT9 A;  1CFD A;  4JGE A;  2DDD A;  2M7L A;  3EVV A;  1PVA A;  2MLE C;  1A29 A;  2NZ0 A;  3CR5 X;  1S26 D;  3SVB A;  1AK8 A;  3SIA A;  1YUU A;  4OJ0 A;  3LVC A;  3ZUL A;  1Z1Q A;  5D69 A;  4BY4 A;  4R6D A;  2AWL A;  2NCO A;  4TZG A;  4W6H A;  3AKO A;  1B8C A;  2HFC A;  1YUT A;  3WHT B;  2C9I A;  3I5G C;  5HKW A;  1IGV A;  2G6X A;  4MSP A;  4NDB A;  1SR6 B;  1OZO A;  3DQE A;  2ZKM X;  3WXA A;  5KTG A;  3AI5 A;  3WCK A;  3KPX A;  3OGO A;  4PE7 A;  2KNE A;  3V3D A;  1NSH A;  2DUH A;  2OKW A;  5EB7 A;  4XL5 A;  2QZ0 A;  3AAK A;  1F70 A;  4E68 A;  2MJW B;  1JC1 A;  2O29 A;  1BOD A;  2WCF A;  1OMR A;  2RGI A;  3IQO A;  1KCY A;  5FYX A;  4PHN A;  4YGD B;  4D1E A;  1DMO A;  3IF7 A;  2BL0 C;  2FL1 A;  2KI6 C;  3OB2 B;  3JTD C;  2CTN A;  1ZGP A;  1YX7 A;  4IL1 A;  4XYN A;  2YE1 A;  3EK8 A;  1S6C A;  2GV5 A;  2ZN9 A;  1IJ5 A;  1JFJ A;  1WLM A;  3KF9 A;  4DCK A;  1HUY A;  1Q73 A;  3DQ2 A;  1A2X A;  2HQ8 A;  2JT3 A;  1KSM A;  1LXF C;  1W7S A;  1N2D A;  1CTR A;  4HSZ A;  1XA5 A;  1K9U A;  3PN7 B;  1TTX A;  2JXC A;  2BBM A;  3BX9 A;  1UHH A;  2M1K B;  4ZB1 A;  1ZAC A;  4W6R A;  3SG4 A;  2KI6 D;  3CLN A;  3DQD A;  5I2O A;  4I5J A;  2I94 A;  2EGD A;  1EMG A;  1UHJ A;  2KOT A;  1XFY O;  2BTJ A;  2ZN8 A;  1KK7 Y;  3O6B A;  5BT0 A;  2K2A A;  2M3W A;  3MGF A;  2A56 B;  4W6P A;  2SCP A;  1RFJ A;  1NCX A;  3LK1 A;  2VVJ A;  5I2Q A;  2QLG B;  2D8N A;  3D10 A;  3ED8 A;  3FWC A;  2GW3 A;  2A54 B;  1CM4 A;  1QV0 A;  3DQ1 A;  2G3O A;  3GB3 A;  1SL9 A;  4DUQ A;  2PSR A;  2A52 B;  4OVN F;  1OE9 B;  1DGV A;  2JT8 A;  3E5W A;  3WLC A;  1QLS A;  1MF8 B;  1XA9 A;  1EML A;  2JC2 A;  1PSB A;  4R1E A;  2QT2 A;  3RWT A;  1D1O A;  3DQL A;  4DXI A;  1JSA A;  3PIB A;  3GK4 X;  2G2B A;  3FWB A;  2BCB A;  3U8A A;  2H61 C;  4DXM A;  1UIS A;  5LTQ A;  4KF4 A;  2JOJ A;  4KA9 A;  3OSQ A;  3HCM A;  4PFE A;  1LVC D;  1QX5 B;  1S1E A;  5EXB A;  4GGN A;  2BE6 A;  2M9G A;  1EXR A;  1U5I A;  5EJU A;  1KWO B;  1K8U A;  5DPJ A;  1OXD A;  3ZUF A;  4W76 A;  3LVA A;  4JQ0 D;  1TNQ A;  2CBL A;  3SG2 A;  1XK4 A;  1F0B A;  2KFG A;  3SVN A;  4FQO A;  2OTG C;  1YJF A;  2NLN A;  2KQ6 A;  2LHL A;  2QLE A;  1ZOT B;  1UHN A;  3SVR A;  2P4M A;  4LW5 A;  1Y6W A;  4PAL A;  4TZA A;  1TNP A;  1QJT A;  5JOL A;  1YHH A;  4OR9 B;  4QJ5 B;  5T3I A;  4JRB A;  2FCD A;  1JBY A;  1RMM A;  1CFF A;  5EB6 A;  1A75 B;  4HQ8 A;  2ZO6 A;  1TIZ A;  2H8Q A;  4WQ2 A;  3VRR A;  4JC2 A;  3I5F B;  3LK0 A;  5K89 A;  2G6E A;  3VRQ A;  3SV5 A;  3EVR A;  4KPI A;  1XFZ O;  1A03 A;  4ZF4 A;  2H6V A;  2LAP A;  2ZMU A;  4YGC B;  2PXS A;  4LJB A;  1K2H A;  1DVI A;  1BF5 A;  2WUR A;  1G33 A;  3W1C A;  4OGS A;  2WCB A;  4UTS A;  2F33 A;  4YGB B;  2HF5 A;  5CSF A;  3K1K A;  3ADF A;  1EL4 A;  3EKJ A;  1G8I A;  1W7U A;  2PMY A;  2JT0 A;  4W6M A;  4ZFS A;  1EJ3 A;  4W6N A;  3PJ5 A;  5DPI A;  1MXE A;  1DJY A;  4W75 A;  3SSV A;  1QTX A;  2JUL A;  2WC8 A;  5KSZ A;  4N3D A;  4GUK A;  1KFX S;  4IK3 A;  4U2V A;  3CFA A;  4DS7 A;  3VRN A;  1MYW A;  1U5I B;  1Q4C A;  3CFH A;  4LJD A;  2NCP A;  3I5H C;  3VIC A;  3A8R A;  2G5Z B;  1MQ1 A;  1SCM B;  2LC5 A;  4OHS A;  2GX2 A;  1S5G Z;  1JF2 A;  2IB5 A;  2L51 A;  3BUO B;  2MA2 A;  3SIB A;  5HLV A;  1H4B A;  2FZU A;  2HCG A;  4DXO A;  4Z4M A;  3DPW A;  5HW9 A;  1NCZ A;  1BR1 B;  4W6C A;  1WRK A;  4A4B A;  2KYF A;  3CS1 A;  3VHT B;  2G2S B;  2OJK A;  4W7C A;  5I2L A;  3A4U B;  2EC6 C;  3OB1 B;  2M49 B;  3EK4 A;  2O24 A;  1PVB A;  3H1R A;  4IK8 A;  3PM8 A;  4J89 A;  2KBM A;  1KYP A;  2LMU A;  1PUL A;  2K0J A;  1Q4B A;  1WDC B;  5HKY A;  1NIW A;  3PAL A;  3TDU A;  3WHU B;  1WRL A;  3CBE A;  5CSJ A;  4W7X A;  2MBX A;  2LM5 A;  1B7T Z;  1BJF A;  3JTD B;  2L0P A;  4P5O E;  2LVI A;  2ARL A;  1CNP A;  2M8U A;  4OQW A;  2I7A A;  3TS5 C;  4C0K A;  2CXJ A;  3BQ3 A;  1QVI Y;  1K94 A;  1TCF A;  3ZWH A;  4XGY A;  2WSO A;  3OX5 A;  2NXQ A;  3BUW B;  2IS9 A;  2Y0G A;  3ST3 A;  2M1U A;  1SL8 A;  3HX4 A;  2Q6P A;  1TRF A;  4HQC A;  1OOJ A;  4W6J A;  1TCO B;  1NX1 A;  1PK0 D;  1TNX A;  1KQM C;  4ZCV A;  5DKQ A;  2YFP A;  5HLO A;  5AER A;  4W6D A;  2B1U A;  1NCY A;  3AAJ A;  4JPZ B;  2WHT A;  4LQU A;  1F09 A;  1QX7 A;  4ORA B;  1SCV A;  4AQJ A;  2GX0 A;  1OXF A;  3DQA A;  2K61 A;  2KDH A;  2Y4Q A;  5DQM A;  3U0N A;  1OQP A;  4EDS A;  2ZO7 A;  2DOQ A;  2AWM A;  1S3P A;  3F45 A;  2PXW A;  1RMP A;  1R6P A;  1KFU S;  1QYF A;  3KHE A;  1WRZ A;  1QYO A;  5H88 A;  2JAD A;  1N65 A;  1YRU B;  2QLG A;  2QLH A;  4B5Y A;  3U8C A;  4ZF3 A;  2A4J A;  1PSR A;  1J55 A;  5JJG A;  4Q9X A;  1XVJ A;  5DU0 A;  2LHI A;  2V53 A;  1KSO A;  2HQZ A;  3CTN A;  2LP3 A;  1AUI B;  2K7C A;  1S6I A;  1KK8 C;  1XFW O;  1B4C A;  1ODB A;  1KK7 Z;  4EMQ A;  2PAS A;  3DD4 A;  3M0W A;  2TN4 A;  2OTB A;  4MN0 A;  1RRX A;  3IQQ A;  1NYA A;  3CZT X;  2JNF A;  5DTL A;  4DIR A;  4PPK A;  2OS8 C;  2KI4 C;  3NT3 A;  2K8M B;  3TUY C;  1QX2 A; 
#chains in the Genus database with same CATH topology
 1OXE A;  5EXU A;  2FJU B;  4KAG A;  2ICR A;  4PPL A;  1RWY A;  3LSA A;  3SS4 A;  4NWS A;  1KP5 A;  1YX8 A;  2O5G A;  3UG0 A;  1J7R A;  3OBV A;  4W6I A;  2MLF C;  1CKK A;  2AUC A;  3ST0 A;  3I5I B;  3ICB A;  4PT1 A;  4QJ4 B;  1SPY A;  1QLK A;  1Y1A A;  2ISD A;  2DDC A;  1R2U A;  2ERB A;  2SAS A;  2L2E A;  3NF0 A;  5HBD A;  4L13 A;  1JF0 A;  1AJ4 A;  1V1F A;  1SW8 A;  4CFQ A;  1OOF A;  4KF5 C;  2MHH A;  3BXA A;  4OCI A;  2ZRS A;  4N1F A;  1F55 A;  3DZT A;  1CFP A;  4DXQ A;  1A75 A;  1JBA A;  1CB1 A;  2O2B A;  1PAL A;  3P8U A;  1F8H A;  4Q7R A;  3DXL A;  2LV7 A;  3O4Y A;  1J7O A;  3PSR A;  5HYD A;  4KW9 A;  5AXI A;  3NED A;  2JWW A;  3CYZ A;  1NX3 A;  2I18 A;  1W7J B;  1CDL A;  2K7D A;  5J3X A;  4PHK A;  2WCH A;  2V4E C;  2KGB C;  4KYN A;  3BXK A;  5LTR A;  2LLU A;  2H5O A;  1V1G A;  1LA0 A;  5FVI A;  2VAD A;  3VRP A;  3SRY A;  2KHN A;  3LA1 A;  5EHU A;  1XFX O;  4MZJ A;  1XQM A;  4IZN A;  5AQB B;  3SSH A;  2BEC A;  1H6R A;  3SS5 A;  2JRF A;  2WC5 A;  2YDZ A;  4HQ9 A;  4DKM A;  1YJ2 A;  1UP5 A;  3CB9 A;  4H3L A;  2IE2 A;  1QXP A;  2WHS A;  1DJW A;  3I5H B;  2H5R A;  4AOM A;  4I5K A;  3RM1 A;  1G7K A;  2JNX A;  4I5L B;  2QPT A;  4GGF C;  4W7F A;  4MRX A;  1DJZ A;  4B30 A;  1Q4A A;  5F6T A;  2AAO A;  2G6Y A;  1IG5 A;  4W7D A;  4H3N A;  1QYQ A;  3FE6 A;  1SR6 C;  2HET A;  3DQF A;  2PQL A;  1BMO A;  3S05 A;  4J8A A;  3DQK A;  3NSK A;  3GJ2 A;  2H5Q A;  1B8L A;  2PYQ A;  2EC6 B;  3BUN B;  2KYC A;  1TNW A;  2DUG A;  1WLZ A;  4DXP A;  3I19 A;  2KLD A;  3VHT A;  1YVH A;  1C4F A;  3MSE B;  4QJ3 B;  3C1V A;  1ZMZ A;  2M7N A;  3CD1 A;  5GQQ C;  5AAN A;  2KAV A;  2L4I A;  3TDZ A;  4PPJ A;  3LF3 A;  1FI6 A;  1OSA A;  3DQ3 A;  3TS5 B;  2HJO A;  4YI8 A;  3BYA A;  1XAE A;  4GNK B;  1G4Y R;  3D0Y B;  4W77 A;  2CNP A;  1RK9 A;  1EMB A;  2P70 A;  3OP0 A;  1YTZ C;  4KGE A;  2WIQ A;  2KAX A;  3GEX A;  3LCP C;  1FBV A;  1TOP A;  1QS7 A;  2FOT A;  1MOU A;  3KO0 A;  2Z6Z A;  3PN7 C;  3SSY A;  3LF4 B;  5B8I B;  2O60 A;  3A8S A;  2GTE A;  2QEV A;  2IB6 A;  4MEW A;  4W74 A;  1BR4 B;  1KQM B;  5FI2 A;  4PDZ A;  1IQ5 A;  3SG3 A;  2L4H A;  1Q80 A;  1GM0 A;  2LMT A;  1BFP A;  3LVD A;  1S6J A;  4H47 A;  5F9G A;  5FVF A;  5J2O A;  5AEQ A;  3D75 A;  4GFT A;  3ST4 A;  1C3Y A;  1SL7 A;  2KSP A;  3PFV A;  2LVK A;  1XO5 A;  4C0L A;  2WCL A;  2GGZ A;  1KYS A;  2VZX A;  4YGE B;  4NQG A;  2WIS A;  2VRG A;  1RRO A;  1SNL A;  1N0Y A;  3IP2 A;  1BT6 A;  4JEO A;  4RTC A;  1CDM A;  1CLL A;  1JWD A;  4MLW A;  4ORC B;  2KGR A;  3DQ4 A;  1F54 A;  1QVI Z;  4B30 B;  1ALW A;  3CGA A;  3DVE A;  2LAN A;  3GOF A;  1UUS A;  3CZ1 A;  1AP4 A;  3SVO A;  2KFH A;  4JD9 A;  2MRD A;  1UHK A;  4GBA A;  5DQB A;  2VAE A;  5BQL A;  3E5T A;  1B8R A;  3SVE A;  2WSN A;  3BFB A;  4P2Y B;  4JF9 A;  2ZRT A;  5BPJ A;  5CSN A;  4R6B A;  2L50 A;  3EKH A;  2LCP A;  4CPV A;  2EMN A;  2JTZ A;  3LS3 A;  1ZFS A;  1CMG A;  3I5G B;  1GGX A;  3DVM A;  2LLT A;  4DXN A;  3CR4 X;  2B3Q A;  5PAL A;  1X02 A;  1KQV A;  3FE8 A;  2QLI A;  3BOW A;  1LA3 A;  2E6W A;  1DEL A;  4W7A A;  1KWO C;  4W7E A;  5HKZ A;  4ANJ A;  1XFV O;  2H61 A;  3DQI A;  3O78 A;  2VVI A;  4PHM A;  5HZU A;  1NUB A;  4M2P A;  2KFF A;  4W6K A;  3B7A A;  2JU0 A;  2C9J A;  2OS8 B;  3NHT A;  1XMZ A;  2BL0 B;  4JFG A;  5TNC A;  3CAB A;  3TUY B;  5DRF A;  3DYE A;  1YVL A;  4MZK A;  2OGR A;  4YI9 A;  3M22 A;  3DQN A;  1EMM A;  4C0J A;  1CDN A;  3DQU A;  4CLN A;  4INX A;  2WCE A;  4W6F A;  1CLB A;  3JVT C;  3AKB A;  3NEZ A;  3SG5 A;  5DPG A;  3R1P A;  2M29 A;  1ALV A;  2JPO A;  4ICB A;  1JBZ A;  1IJ6 A;  4J88 A;  4PCW A;  1LKJ A;  3GJ1 A;  2Q57 A;  5DTZ A;  3SVS A;  1IH0 A;  1BLQ A;  3ZUJ A;  1MXL C;  3DPX A;  5DTY A;  4GAO A;  2PRU A;  1GGW A;  4JWQ A;  4AQI A;  2Y1M A;  5I8N A;  2BE4 A;  2L98 A;  1SY9 A;  3P28 A;  3BXB A;  2L5Y A;  3NSO A;  2BAP A;  1BU3 A;  5KTY A;  4W7R A;  1DJI A;  3ZTF A;  5ER5 A;  3DQ6 A;  2E30 A;  2B3P A;  1QAT A;  2OPO A;  3IR8 A;  4CID A;  3OX6 A;  2Q4U A;  1CLM A;  1YZW A;  2Z6X A;  4FQT A;  5FI7 A;  4GES B;  4XJK B;  1KFX L;  2Z1O A;  2DUI A;  1JFK A;  4FTG A;  1C3Z A;  5LTP A;  4HRH A;  3W1D A;  3S0E A;  1L2O C;  4RYW A;  3BOW B;  1YUR A;  2EMO A;  1DF0 B;  2JXL A;  2LLS A;  3DQ5 A;  3EG5 B;  2H5P A;  1DJG A;  3TZ1 A;  5DTX A;  1M46 A;  2HPW A;  4W6G A;  4YGA A;  4EUL A;  3BUX B;  1SCM C;  3FE9 A;  1XK4 C;  1W7T A;  2WC6 A;  1Z2C B;  5BTT B;  1FF1 A;  1H4U A;  3CDN A;  4W72 A;  2HGD A;  3QME A;  1Z1P A;  1YRT B;  1K96 A;  1J1E A;  3FS7 A;  1FI5 A;  1XFU O;  3DVJ A;  1K9K A;  1GJY A;  1UHI A;  1YHG A;  4AR7 A;  3U0M A;  2JZI A;  4GF6 B;  4W69 A;  1F4O A;  1OZS A;  2MAZ A;  4OKH A;  1UWO A;  1OOG A;  2OTG B;  3DF0 B;  5HZS A;  3GK1 A;  1KYR A;  2RH7 A;  5H89 A;  1M39 A;  3DQC A;  3PAT A;  5DY6 A;  2K7B A;  3D74 A;  4IK1 A;  1WDC C;  5CSI A;  3WLD A;  3ZNI A;  4EDO A;  1FPW A;  3U8P A;  1PRW A;  4NDD A;  4XOV A;  3OSR A;  2KPH A;  1DT7 B;  2BCA A;  3QRX A;  1EH2 A;  4DRW A;  2K7O A;  1B9C A;  5DKN A;  3BFH A;  2HGY A;  1IKU A;  4HVF A;  5HL1 A;  4WRI A;  2YGU A;  2Z6Y A;  1Z4H A;  2YE0 A;  3CFF A;  1CDP A;  2BBN A;  3R1O A;  2F2O A;  3G9A A;  4H48 A;  1MWN A;  3NXA A;  2P6B B;  1F4Q A;  3SS0 A;  3D73 A;  4N5X A;  3LL8 B;  5DPH A;  3UNW A;  2QU1 A;  2JTT A;  4U8D A;  3D0Y A;  1EMK A;  1YUS A;  2LNK A;  1DJX A;  2K2F A;  4I2Y A;  5KU1 A;  3VRO A;  3CWG A;  2I2R E;  4M2O A;  3VGO A;  1EMF A;  3M24 A;  3SST A;  4W6B A;  1ORG A;  1DGU A;  4HRE E;  3TDI A;  3UFZ A;  3E3R A;  3WNX B;  4MVF A;  2LVJ A;  2L2C A;  3PM2 A;  2A53 B;  3DQO A;  2H2K A;  4LJD C;  3PJB A;  1EG3 A;  2VVH A;  2WND A;  2R2I A;  1QV1 A;  2JPT A;  5ER4 X;  1KFU L;  2GGM A;  2HQW A;  3E5V A;  3NSL A;  1XSS A;  1F71 A;  1AJ5 A;  2A50 B;  1H8B A;  3O4X A;  1JC0 A;  3CZ0 A;  4Q04 A;  4NDC A;  3Q8I A;  1FW4 A;  1C7W A;  2DD7 A;  5DKR A;  1LS8 A;  4ZIN A;  3VK1 A;  2OTE A;  3SSP A;  1QXT A;  1RMO A;  2IOV A;  1YHI A;  3PJ7 A;  4MBE A;  1DTL A;  3O77 A;  3NT9 A;  1W7I B;  1EG4 A;  1XFR A;  1J7P A;  1M63 B;  3K21 A;  1BG1 A;  1SRA A;  4Q9W A;  1SKT A;  2WCJ A;  2COL B;  1B1G A;  5IBW A;  3OHM B;  3S0B A;  5FHV A;  3LLE A;  2Y5I A;  3KCT A;  5G08 A;  3EVU A;  4M2Q A;  1Q4E A;  3DQJ A;  3SJS A;  1JC2 A;  1M45 A;  3H1O A;  1VRK A;  5LK4 A;  5I94 A;  4DKN A;  3SS3 A;  3S0A A;  2AMI A;  4OY4 A;  1SK6 D;  2Q91 A;  2PAL A;  4W6T A;  3SSL A;  1GQM A;  1SBJ A;  3DQ7 A;  3TMT A;  2ZFD A;  4Q7U A;  5EL2 A;  2DUE A;  1ZGO A;  1QIW A;  3L4A A;  1DC1 A;  4ZCU A;  1GGZ A;  4HE4 A;  2F2P A;  1SYM A;  3L4L A;  4LQT A;  2QAC A;  5AFP A;  1HT9 A;  5D3O A;  1IQ3 A;  5D7F A;  2G3D B;  4KW4 A;  4ORB B;  1AHR A;  2QEH A;  3O2P A;  1QAS A;  4I5N B;  3NSI A;  3I5I C;  2M0R A;  4LJC A;  5DRG A;  4F0Z B;  1IRJ A;  3DVK A;  3OGN A;  4OV2 A;  3U0L A;  3JVT B;  4PE0 A;  2CCM A;  5HZT A;  2F3Y A;  3KEV A;  4Z4K A;  3VB1 A;  4PE1 A;  1ZUZ A;  1K95 A;  2PVB A;  1LIN A;  2WOR A;  3TMR A;  3U0K A;  1MHO A;  1K93 D;  1Q4D A;  4YRU A;  4W6U A;  1DJH A;  2WOS A;  3RLZ A;  4Q7T A;  4XVP A;  2BCX A;  4WQ3 A;  4GOB A;  2BKI B;  1RJV A;  4W6O A;  2POX A;  4USL A;  5CPV A;  4KF5 A;  1K90 D;  1YR5 A;  3DQM A;  1Y0V H;  4W6S A;  3AKA A;  1CM1 A;  1YFP A;  3KCS A;  4INW A;  3DQ8 A;  4YBH B;  1L7Z A;  1S6Z A;  1HQV A;  1CV7 A;  2QRF A;  2HPS A;  3PLF B;  4TNC A;  3GL4 A;  1XYD A;  1QIV A;  3CGL A;  1JUO A;  2G9B A;  2LMV A;  4W73 A;  5HGE A;  4KGF A;  2A48 A;  4IK4 A;  1SMG A;  1WY9 A;  1L2O B;  3D76 A;  1ZUX A;  2V4E A;  3SG7 A;  4XJK A;  4CFR A;  1OOI X;  4HRG A;  4EN1 A;  1UUR A;  1OMV A;  3DQH A;  4RYS A;  2EHB A;  2HQK A;  3DQ9 A;  4L12 A;  2AWJ A;  1ZGQ A;  1NP8 A;  2KAY A;  4IK9 A;  1KK8 B;  4H3M A;  1DF0 A;  1C07 A;  2AHA A;  1IWQ A;  4XOW A;  2FWQ A;  2F3Z A;  3N7H A;  2ZNE A;  1TN4 A;  3RWA A;  2F8P A;  4A4C A;  3S0F A;  1CFC A;  1MR8 A;  1BOC A;  4ORN A;  4BDU A;  5BTT A;  1J7Q A;  3SVD A;  3B86 A;  5EBJ A;  5H87 A;  4GGF A;  1S36 A;  2A47 A;  1NX0 A;  3SSK A;  2KI4 B;  2EMD A;  2DUF A;  3S0G A;  1M31 A;  2WHU A;  3GK2 A;  4BY5 A;  2A46 A;  4IK5 A;  2HRS A;  1QY3 A;  1MOV A;  3B87 A;  2ZND A;  3PJI A;  4IJ7 A;  3EVP A;  4N1G A;  3DF0 A;  1CMF A;  1EMC A;  1T14 A;  3H4S E;  4MZL A;  3DPZ A;  1RM9 A;  2LUX A;  4ZBL A;  1J1D A;  2LVV A;  2H9W A;  1QWV A;  2G16 B;  4L9M A;  3I5F C;  2AWK A;  4AS8 A;  4GPL B;  4ZIO A;  3CR2 A;  2LUC A;  3AI4 A;  4ETO A;  1OMD A;  2ZMW A;  4KEX A;  2AH8 A;  1EMA A;  1K9P A;  2OKY A;  1A4P A;  4PE4 A;  2DD9 A;  2GW4 B;  4PHJ A;  2M97 A;  3BXC A;  3ST2 A;  2KBI A;  5FI6 A;  2LP2 A;  1S5G Y;  3BJH A;  1SSE B;  2L5X B;  3CZ2 A;  1C7V A;  5FVG A;  1HCJ A;  1NX2 A;  1P28 A;  1Y1X A;  4MRY A;  1GFL A;  2JQ6 A;  1REC A;  3FIA A;  1B9A A;  3EK7 A;  3CD9 A;  3BUM B;  1EME A;  4W6A A;  1TUJ A;  1W9Z A;  1B47 A;  5DIC A;  3K1E A;  4UPG A;  2BKH B;  4P76 A;  4W6L A;  2V4E B;  4P1Q A;  1NPQ A;  2LE9 B;  1E8A A;  3SVU A;  4L1I A;  1GL4 A;  1NWD A;  2KQY A;  3SG6 A;  4KW8 A;  5HZO A;  2FCE A;  5EXC I;  1MUX A;  3SVC A;  1AVS A;  4ZF5 A;  1Y1U A;  1B7T Y;  1RTP 1;  2Y1N A;  2CT9 A;  1CFD A;  3R1V A;  4JGE A;  2DDD A;  2M7L A;  3EVV A;  1PVA A;  2MLE C;  1A29 A;  2NZ0 A;  3CR5 X;  1S26 D;  3SVB A;  1AK8 A;  3SIA A;  1YUU A;  4OJ0 A;  3LVC A;  3ZUL A;  1Z1Q A;  5D69 A;  4BY4 A;  4R6D A;  3D78 A;  2NCO A;  2AWL A;  4TZG A;  4W6H A;  3AKO A;  1B8C A;  2HFC A;  1YUT A;  1IIO A;  3WHT B;  2C9I A;  3I5G C;  5HKW A;  1IGV A;  2G6X A;  4MSP A;  4NDB A;  1SR6 B;  1OZO A;  3DQE A;  2ZKM X;  3WXA A;  5KTG A;  3AI5 A;  3WCK A;  3KPX A;  3OGO A;  4PE7 A;  2KNE A;  3V3D A;  1NSH A;  2DUH A;  2OKW A;  5EB7 A;  4XL5 A;  2QZ0 A;  3AAK A;  1F70 A;  4E68 A;  2MJW B;  1JC1 A;  2O29 A;  1BOD A;  2WCF A;  1OMR A;  2RGI A;  3IQO A;  1KCY A;  5FYX A;  4PHN A;  4YGD B;  4D1E A;  1DMO A;  3IF7 A;  2BL0 C;  2FL1 A;  2KI6 C;  3OB2 B;  3JTD C;  2CTN A;  1ZGP A;  3L47 A;  3RZS A;  1YX7 A;  4IL1 A;  4XYN A;  2YE1 A;  3EK8 A;  1S6C A;  2GV5 A;  2ZN9 A;  1IJ5 A;  1JFJ A;  1WLM A;  3KF9 A;  4DCK A;  1HUY A;  1Q73 A;  3DQ2 A;  3BFA A;  1A2X A;  2HQ8 A;  2JT3 A;  1KSM A;  1LXF C;  1W7S A;  1N2D A;  1CTR A;  4HSZ A;  1XA5 A;  1K9U A;  3PN7 B;  1TTX A;  2JXC A;  2BBM A;  3BX9 A;  1UHH A;  2M1K B;  4ZB1 A;  1ZAC A;  4W6R A;  3SG4 A;  2KI6 D;  3CLN A;  3DQD A;  5I2O A;  4I5J A;  2I94 A;  2EGD A;  1EMG A;  1UHJ A;  2KOT A;  1DQE A;  1XFY O;  2BTJ A;  2ZN8 A;  4F7F A;  1KK7 Y;  3O6B A;  5BT0 A;  2K2A A;  2M3W A;  3MGF A;  2A56 B;  4W6P A;  2SCP A;  1RFJ A;  1NCX A;  3LK1 A;  3UO9 A;  2VVJ A;  5I2Q A;  2QLG B;  2D8N A;  3D10 A;  2BNX A;  3ED8 A;  3FWC A;  2GW3 A;  2A54 B;  1CM4 A;  1QV0 A;  3DQ1 A;  2G3O A;  3GB3 A;  1SL9 A;  4DUQ A;  2PSR A;  2A52 B;  4OVN F;  1OE9 B;  1DGV A;  2JT8 A;  3E5W A;  3WLC A;  1QLS A;  1MF8 B;  1XA9 A;  3NGV A;  1EML A;  2JC2 A;  1PSB A;  2K60 A;  4R1E A;  2QT2 A;  3RWT A;  1D1O A;  3DQL A;  4DXI A;  1JSA A;  3PIB A;  3GK4 X;  2G2B A;  3FWB A;  2BCB A;  3DY9 A;  3U8A A;  2H61 C;  4DXM A;  1UIS A;  3D77 A;  5LTQ A;  4KF4 A;  2JOJ A;  4KA9 A;  3OSQ A;  3HCM A;  4PFE A;  1LVC D;  1QX5 B;  1S1E A;  5EXB A;  4GGN A;  2BE6 A;  2M9G A;  1EXR A;  1U5I A;  5EJU A;  1KWO B;  1K8U A;  5DPJ A;  1OXD A;  3ZUF A;  4W76 A;  3LVA A;  4JQ0 D;  1TNQ A;  2CBL A;  3SG2 A;  1XK4 A;  1F0B A;  2KFG A;  3SVN A;  4FQO A;  2OTG C;  1YJF A;  2NLN A;  2KQ6 A;  2LHL A;  2QLE A;  1ZOT B;  1UHN A;  3SVR A;  2P4M A;  4LW5 A;  1Y6W A;  4PAL A;  4OZD A;  4TZA A;  1TNP A;  1QJT A;  5JOL A;  1YHH A;  1TWO A;  4OR9 B;  4QJ5 B;  5T3I A;  4JRB A;  2FCD A;  2FJY A;  1JBY A;  1RMM A;  1CFF A;  5EB6 A;  1A75 B;  4HQ8 A;  2ZO6 A;  1TIZ A;  2H8Q A;  4WQ2 A;  3VRR A;  4JC2 A;  3I5F B;  3LK0 A;  5K89 A;  2G6E A;  3V2L A;  3VRQ A;  3NHI A;  3SV5 A;  3EVR A;  4KPI A;  1XFZ O;  1A03 A;  4ZF4 A;  2H6V A;  2LAP A;  2ZMU A;  4YGC B;  2PXS A;  4LJB A;  1K2H A;  1DVI A;  1BF5 A;  2WUR A;  1TUZ A;  1G33 A;  3W1C A;  4OGS A;  2WCB A;  4UTS A;  2F33 A;  4YGB B;  2QEB A;  2HF5 A;  5CSF A;  3K1K A;  3ADF A;  1EL4 A;  3EKJ A;  1G8I A;  1W7U A;  2PMY A;  2JT0 A;  4W6M A;  4ZFS A;  2H8V A;  1EJ3 A;  4W6N A;  3PJ5 A;  5DPI A;  1MXE A;  1DJY A;  3IVT A;  4W75 A;  3SSV A;  1QTX A;  2JUL A;  2WC8 A;  5KSZ A;  4N3D A;  4GUK A;  1KFX S;  4IK3 A;  4U2V A;  3CFA A;  4DS7 A;  3VRN A;  1MYW A;  1U5I B;  1Q4C A;  3CFH A;  4LJD A;  2NCP A;  3I5H C;  3VIC A;  3A8R A;  2G5Z B;  1MQ1 A;  1SCM B;  2LC5 A;  4OHS A;  2GX2 A;  1S5G Z;  1JF2 A;  2IB5 A;  2L51 A;  3BUO B;  2MA2 A;  3SIB A;  5HLV A;  1H4B A;  2FZU A;  2HCG A;  4DXO A;  4Z4M A;  3DPW A;  5HW9 A;  1NCZ A;  1BR1 B;  4W6C A;  1WRK A;  4A4B A;  1DEK A;  2KYF A;  3CS1 A;  3VHT B;  2G2S B;  2OJK A;  4W7C A;  5I2L A;  3A4U B;  2EC6 C;  3OB1 B;  2M49 B;  3EK4 A;  2O24 A;  1PVB A;  3H1R A;  4IK8 A;  3PM8 A;  4J89 A;  2KBM A;  1KYP A;  2LMU A;  1PUL A;  2K0J A;  1Q4B A;  1WDC B;  5HKY A;  1NIW A;  3PAL A;  3TDU A;  3WHU B;  1WRL A;  3CBE A;  1OW4 A;  5CSJ A;  4W7X A;  2MBX A;  2LM5 A;  1B7T Z;  1BJF A;  3JTD B;  2L0P A;  4P5O E;  2LVI A;  2ARL A;  1CNP A;  2M8U A;  4OQW A;  2I7A A;  2KLE A;  3TS5 C;  4C0K A;  2CXJ A;  3BQ3 A;  1QVI Y;  1K94 A;  1TCF A;  3ZWH A;  4XGY A;  2WSO A;  3OX5 A;  2NXQ A;  2P71 A;  3BUW B;  2IS9 A;  2Y0G A;  3ST3 A;  2M1U A;  1SL8 A;  3HX4 A;  2Q6P A;  1TRF A;  4HQC A;  1OOJ A;  4W6J A;  1TCO B;  1NX1 A;  1PK0 D;  1TNX A;  1KQM C;  4ZCV A;  5DKQ A;  2YFP A;  5HLO A;  5AER A;  4W6D A;  2B1U A;  1NCY A;  1OOH A;  3B88 A;  3AAJ A;  4JPZ B;  2WHT A;  4LQU A;  1F09 A;  1QX7 A;  4ORA B;  3R72 A;  1SCV A;  4AQJ A;  2GX0 A;  1OXF A;  3DQA A;  2K61 A;  2KDH A;  2Y4Q A;  5DQM A;  3U0N A;  4JKT A;  1OQP A;  4EDS A;  2ZO7 A;  2DOQ A;  2AWM A;  1S3P A;  3F45 A;  2PXW A;  1RMP A;  1R6P A;  1KFU S;  1QYF A;  3KHE A;  1WRZ A;  1QYO A;  2WCK A;  5H88 A;  2JAD A;  1N65 A;  1YRU B;  2QLG A;  2QLH A;  4B5Y A;  3U8C A;  4ZF3 A;  2A4J A;  1PSR A;  2QEO A;  1J55 A;  5JJG A;  2WCM A;  4Q9X A;  1XVJ A;  5DU0 A;  2LHI A;  2V53 A;  1KSO A;  2HQZ A;  3CTN A;  2LP3 A;  1AUI B;  2K7C A;  1S6I A;  1KK8 C;  1XFW O;  1B4C A;  1ODB A;  1KK7 Z;  4EMQ A;  2PAS A;  3B6X A;  3DD4 A;  3M0W A;  2OTB A;  2TN4 A;  4MN0 A;  1RRX A;  2QDI A;  3IQQ A;  1NYA A;  3CZT X;  2JNF A;  5DTL A;  4DIR A;  4PPK A;  2OS8 C;  2KI4 C;  3NT3 A;  2K8M B;  3S0D A;  3TUY C;  1QX2 A; 
#chains in the Genus database with same CATH homology
 1OXE A;  5EXU A;  2FJU B;  4KAG A;  2ICR A;  4PPL A;  1RWY A;  3LSA A;  4NWS A;  1KP5 A;  1YX8 A;  2O5G A;  3UG0 A;  1J7R A;  4W6I A;  2MLF C;  1CKK A;  2AUC A;  3ST0 A;  3I5I B;  3ICB A;  4QJ4 B;  1SPY A;  1QLK A;  1Y1A A;  2ISD A;  2DDC A;  1R2U A;  2SAS A;  2L2E A;  3NF0 A;  5HBD A;  4L13 A;  1JF0 A;  1AJ4 A;  1V1F A;  1SW8 A;  4CFQ A;  4KF5 C;  2MHH A;  3BXA A;  4OCI A;  2ZRS A;  4N1F A;  1F55 A;  1CFP A;  4DXQ A;  1A75 A;  1JBA A;  1CB1 A;  2O2B A;  1PAL A;  3P8U A;  1F8H A;  4Q7R A;  2LV7 A;  3O4Y A;  1J7O A;  3PSR A;  5HYD A;  4KW9 A;  5AXI A;  3NED A;  2JWW A;  1NX3 A;  2I18 A;  1W7J B;  1CDL A;  2K7D A;  5J3X A;  4PHK A;  2V4E C;  2KGB C;  3BXK A;  5LTR A;  2LLU A;  2H5O A;  1V1G A;  1LA0 A;  5FVI A;  2VAD A;  3VRP A;  3SRY A;  2KHN A;  3LA1 A;  5EHU A;  1XFX O;  4MZJ A;  1XQM A;  4IZN A;  5AQB B;  3SSH A;  2BEC A;  1H6R A;  2JRF A;  2YDZ A;  4HQ9 A;  4DKM A;  1YJ2 A;  1UP5 A;  3CB9 A;  4H3L A;  2IE2 A;  1QXP A;  2WHS A;  1DJW A;  3I5H B;  2H5R A;  4AOM A;  4I5K A;  3RM1 A;  1G7K A;  2JNX A;  4I5L B;  2QPT A;  4GGF C;  4W7F A;  4MRX A;  1DJZ A;  4B30 A;  1Q4A A;  5F6T A;  2AAO A;  2G6Y A;  1IG5 A;  4W7D A;  4H3N A;  1QYQ A;  1SR6 C;  2HET A;  3DQF A;  1BMO A;  3S05 A;  4J8A A;  3DQK A;  3NSK A;  3GJ2 A;  2H5Q A;  1B8L A;  2EC6 B;  3BUN B;  2KYC A;  1TNW A;  2DUG A;  1WLZ A;  4DXP A;  3I19 A;  3VHT A;  1YVH A;  1C4F A;  3MSE B;  4QJ3 B;  3C1V A;  1ZMZ A;  2M7N A;  3CD1 A;  5GQQ C;  5AAN A;  2KAV A;  2L4I A;  3TDZ A;  4PPJ A;  3LF3 A;  1FI6 A;  1OSA A;  3DQ3 A;  3TS5 B;  2HJO A;  4YI8 A;  3BYA A;  1XAE A;  4GNK B;  1G4Y R;  3D0Y B;  4W77 A;  2CNP A;  1RK9 A;  1EMB A;  3OP0 A;  1YTZ C;  4KGE A;  2WIQ A;  2KAX A;  3GEX A;  3LCP C;  1FBV A;  1TOP A;  1QS7 A;  2FOT A;  1MOU A;  3KO0 A;  2Z6Z A;  3PN7 C;  3SSY A;  3LF4 B;  5B8I B;  2O60 A;  3A8S A;  2IB6 A;  4MEW A;  4W74 A;  1BR4 B;  1KQM B;  4PDZ A;  1IQ5 A;  3SG3 A;  2L4H A;  1Q80 A;  2LMT A;  1BFP A;  3LVD A;  1S6J A;  4H47 A;  5F9G A;  5FVF A;  5J2O A;  5AEQ A;  4GFT A;  3ST4 A;  1SL7 A;  2KSP A;  3PFV A;  2LVK A;  1XO5 A;  4C0L A;  2GGZ A;  1KYS A;  2VZX A;  4YGE B;  4NQG A;  2WIS A;  2VRG A;  1RRO A;  1SNL A;  1N0Y A;  3IP2 A;  1BT6 A;  4JEO A;  4RTC A;  1CDM A;  1CLL A;  1JWD A;  4MLW A;  4ORC B;  2KGR A;  3DQ4 A;  1F54 A;  1QVI Z;  4B30 B;  1ALW A;  3CGA A;  3DVE A;  2LAN A;  3GOF A;  1UUS A;  1AP4 A;  3SVO A;  2KFH A;  2MRD A;  1UHK A;  4GBA A;  5DQB A;  2VAE A;  5BQL A;  3E5T A;  1B8R A;  3SVE A;  2WSN A;  4P2Y B;  4JF9 A;  2ZRT A;  5BPJ A;  5CSN A;  4R6B A;  2L50 A;  3EKH A;  2LCP A;  4CPV A;  2EMN A;  2JTZ A;  3LS3 A;  1ZFS A;  1CMG A;  3I5G B;  1GGX A;  3DVM A;  2LLT A;  4DXN A;  3CR4 X;  2B3Q A;  5PAL A;  1X02 A;  1KQV A;  2QLI A;  3BOW A;  1LA3 A;  2E6W A;  4W7A A;  1KWO C;  4W7E A;  5HKZ A;  4ANJ A;  1XFV O;  2H61 A;  3DQI A;  3O78 A;  2VVI A;  4PHM A;  5HZU A;  1NUB A;  4M2P A;  2KFF A;  4W6K A;  2JU0 A;  2C9J A;  2OS8 B;  1XMZ A;  2BL0 B;  4JFG A;  5TNC A;  3TUY B;  5DRF A;  1YVL A;  4MZK A;  2OGR A;  4YI9 A;  3M22 A;  3DQN A;  1EMM A;  4C0J A;  1CDN A;  3DQU A;  4CLN A;  2WCE A;  4W6F A;  1CLB A;  3JVT C;  3AKB A;  3NEZ A;  3SG5 A;  5DPG A;  2M29 A;  1ALV A;  4ICB A;  1JBZ A;  1IJ6 A;  4J88 A;  4PCW A;  1LKJ A;  3GJ1 A;  2Q57 A;  5DTZ A;  3SVS A;  1IH0 A;  1BLQ A;  3ZUJ A;  1MXL C;  3DPX A;  5DTY A;  4GAO A;  2PRU A;  1GGW A;  4JWQ A;  4AQI A;  2Y1M A;  5I8N A;  2BE4 A;  2L98 A;  1SY9 A;  3P28 A;  3BXB A;  3NSO A;  5KTY A;  1BU3 A;  4W7R A;  1DJI A;  3ZTF A;  5ER5 A;  3DQ6 A;  2E30 A;  2B3P A;  1QAT A;  2OPO A;  3IR8 A;  4CID A;  3OX6 A;  2Q4U A;  1CLM A;  1YZW A;  2Z6X A;  4GES B;  4XJK B;  1KFX L;  2Z1O A;  2DUI A;  1JFK A;  4FTG A;  5LTP A;  4HRH A;  3W1D A;  1L2O C;  4RYW A;  3BOW B;  1YUR A;  2EMO A;  1DF0 B;  2JXL A;  2LLS A;  3DQ5 A;  2H5P A;  1DJG A;  3TZ1 A;  5DTX A;  1M46 A;  2HPW A;  4W6G A;  4YGA A;  4EUL A;  3BUX B;  1SCM C;  1XK4 C;  1W7T A;  5BTT B;  1FF1 A;  1H4U A;  4W72 A;  2HGD A;  1Z1P A;  1YRT B;  1K96 A;  1J1E A;  3FS7 A;  1FI5 A;  1XFU O;  3DVJ A;  1K9K A;  1GJY A;  1UHI A;  1YHG A;  4AR7 A;  3U0M A;  2JZI A;  4GF6 B;  4W69 A;  1F4O A;  1OZS A;  2MAZ A;  4OKH A;  1UWO A;  2OTG B;  3DF0 B;  5HZS A;  3GK1 A;  1KYR A;  2RH7 A;  5H89 A;  1M39 A;  3DQC A;  3PAT A;  5DY6 A;  2K7B A;  4IK1 A;  1WDC C;  5CSI A;  3WLD A;  3ZNI A;  4EDO A;  1FPW A;  3U8P A;  1PRW A;  4NDD A;  4XOV A;  3OSR A;  1DT7 B;  2BCA A;  3QRX A;  1EH2 A;  4DRW A;  2K7O A;  1B9C A;  5DKN A;  2HGY A;  1IKU A;  4HVF A;  4WRI A;  2Z6Y A;  2YE0 A;  3CFF A;  1CDP A;  2BBN A;  2F2O A;  3G9A A;  4H48 A;  1MWN A;  3NXA A;  2P6B B;  1F4Q A;  3SS0 A;  4N5X A;  3LL8 B;  5DPH A;  2QU1 A;  2JTT A;  4U8D A;  3D0Y A;  1EMK A;  1YUS A;  2LNK A;  1DJX A;  2K2F A;  4I2Y A;  5KU1 A;  3VRO A;  3CWG A;  2I2R E;  4M2O A;  3VGO A;  1EMF A;  3M24 A;  3SST A;  4W6B A;  1DGU A;  4HRE E;  3TDI A;  3UFZ A;  3E3R A;  3WNX B;  4MVF A;  2LVJ A;  2A53 B;  3DQO A;  2H2K A;  4LJD C;  3PJB A;  1EG3 A;  2VVH A;  2WND A;  2R2I A;  1QV1 A;  2JPT A;  5ER4 X;  1KFU L;  2GGM A;  2HQW A;  3E5V A;  3NSL A;  1XSS A;  1F71 A;  1AJ5 A;  2A50 B;  1H8B A;  1JC0 A;  4Q04 A;  4NDC A;  1FW4 A;  1C7W A;  2DD7 A;  5DKR A;  4ZIN A;  3VK1 A;  2OTE A;  3SSP A;  1QXT A;  1RMO A;  2IOV A;  1YHI A;  3PJ7 A;  4MBE A;  1DTL A;  3O77 A;  3NT9 A;  1W7I B;  1EG4 A;  1J7P A;  1M63 B;  3K21 A;  1BG1 A;  1SRA A;  4Q9W A;  1SKT A;  2COL B;  1B1G A;  5IBW A;  3OHM B;  5FHV A;  3LLE A;  2Y5I A;  3KCT A;  5G08 A;  3EVU A;  4M2Q A;  1Q4E A;  3DQJ A;  3SJS A;  1JC2 A;  1M45 A;  3H1O A;  1VRK A;  5LK4 A;  4DKN A;  2AMI A;  4OY4 A;  1SK6 D;  2Q91 A;  2PAL A;  4W6T A;  3SSL A;  1GQM A;  1SBJ A;  3DQ7 A;  3TMT A;  2ZFD A;  4Q7U A;  2DUE A;  1ZGO A;  1QIW A;  4ZCU A;  1GGZ A;  4HE4 A;  2F2P A;  1SYM A;  4LQT A;  2QAC A;  5AFP A;  1HT9 A;  1IQ3 A;  5D7F A;  2G3D B;  4KW4 A;  4ORB B;  1AHR A;  3O2P A;  1QAS A;  4I5N B;  3NSI A;  3I5I C;  2M0R A;  4LJC A;  5DRG A;  4F0Z B;  1IRJ A;  3DVK A;  4OV2 A;  3U0L A;  3JVT B;  4PE0 A;  2CCM A;  5HZT A;  2F3Y A;  3KEV A;  4Z4K A;  4PE1 A;  1ZUZ A;  1K95 A;  2PVB A;  1LIN A;  2WOR A;  3TMR A;  3U0K A;  1MHO A;  1K93 D;  1Q4D A;  4YRU A;  4W6U A;  1DJH A;  2WOS A;  3RLZ A;  4Q7T A;  4XVP A;  2BCX A;  4WQ3 A;  4GOB A;  2BKI B;  1RJV A;  4W6O A;  2POX A;  4USL A;  5CPV A;  4KF5 A;  1K90 D;  1YR5 A;  3DQM A;  1Y0V H;  4W6S A;  3AKA A;  1CM1 A;  1YFP A;  3KCS A;  3DQ8 A;  4YBH B;  1L7Z A;  1S6Z A;  1HQV A;  1CV7 A;  2QRF A;  2HPS A;  3PLF B;  4TNC A;  3GL4 A;  1XYD A;  1QIV A;  3CGL A;  1JUO A;  2G9B A;  2LMV A;  4W73 A;  5HGE A;  4KGF A;  2A48 A;  4IK4 A;  1SMG A;  1WY9 A;  1L2O B;  1ZUX A;  2V4E A;  3SG7 A;  4XJK A;  4CFR A;  4HRG A;  4EN1 A;  1UUR A;  1OMV A;  3DQH A;  4RYS A;  2EHB A;  2HQK A;  3DQ9 A;  4L12 A;  2AWJ A;  1ZGQ A;  1NP8 A;  2KAY A;  4IK9 A;  1KK8 B;  4H3M A;  1DF0 A;  1C07 A;  2AHA A;  1IWQ A;  4XOW A;  2FWQ A;  2F3Z A;  2ZNE A;  1TN4 A;  3RWA A;  2F8P A;  4A4C A;  1CFC A;  1MR8 A;  1BOC A;  4ORN A;  4BDU A;  5BTT A;  1J7Q A;  3SVD A;  5EBJ A;  5H87 A;  4GGF A;  1S36 A;  2A47 A;  1NX0 A;  3SSK A;  2KI4 B;  2EMD A;  2DUF A;  1M31 A;  2WHU A;  3GK2 A;  4BY5 A;  2A46 A;  4IK5 A;  2HRS A;  1QY3 A;  1MOV A;  2ZND A;  3EVP A;  4N1G A;  3DF0 A;  1CMF A;  1EMC A;  3H4S E;  4MZL A;  3DPZ A;  1RM9 A;  2LUX A;  4ZBL A;  1J1D A;  2LVV A;  2H9W A;  2G16 B;  4L9M A;  3I5F C;  2AWK A;  4AS8 A;  4GPL B;  4ZIO A;  3CR2 A;  2LUC A;  3AI4 A;  4ETO A;  1OMD A;  2ZMW A;  4KEX A;  2AH8 A;  1EMA A;  1K9P A;  1A4P A;  2DD9 A;  4PE4 A;  2OKY A;  2GW4 B;  4PHJ A;  2M97 A;  3BXC A;  3ST2 A;  2KBI A;  2LP2 A;  1S5G Y;  2L5X B;  1C7V A;  5FVG A;  1HCJ A;  1NX2 A;  1Y1X A;  4MRY A;  1GFL A;  2JQ6 A;  1REC A;  3FIA A;  1B9A A;  3EK7 A;  3CD9 A;  3BUM B;  1EME A;  4W6A A;  1B47 A;  4UPG A;  2BKH B;  4P76 A;  4W6L A;  2V4E B;  4P1Q A;  1NPQ A;  2LE9 B;  1E8A A;  3SVU A;  4L1I A;  1GL4 A;  1NWD A;  2KQY A;  3SG6 A;  4KW8 A;  5HZO A;  2FCE A;  5EXC I;  1MUX A;  3SVC A;  1AVS A;  4ZF5 A;  1Y1U A;  1B7T Y;  1RTP 1;  2Y1N A;  2CT9 A;  1CFD A;  4JGE A;  2DDD A;  2M7L A;  3EVV A;  1PVA A;  2MLE C;  1A29 A;  2NZ0 A;  3CR5 X;  1S26 D;  3SVB A;  1AK8 A;  3SIA A;  1YUU A;  4OJ0 A;  3LVC A;  3ZUL A;  1Z1Q A;  5D69 A;  4BY4 A;  4R6D A;  2AWL A;  2NCO A;  4TZG A;  4W6H A;  3AKO A;  1B8C A;  2HFC A;  1YUT A;  3WHT B;  2C9I A;  3I5G C;  5HKW A;  1IGV A;  2G6X A;  4MSP A;  4NDB A;  1SR6 B;  1OZO A;  3DQE A;  2ZKM X;  3WXA A;  5KTG A;  3AI5 A;  3WCK A;  3KPX A;  3OGO A;  4PE7 A;  2KNE A;  3V3D A;  1NSH A;  2DUH A;  2OKW A;  5EB7 A;  4XL5 A;  2QZ0 A;  3AAK A;  1F70 A;  4E68 A;  2MJW B;  1JC1 A;  2O29 A;  1BOD A;  2WCF A;  1OMR A;  2RGI A;  3IQO A;  1KCY A;  5FYX A;  4PHN A;  4YGD B;  4D1E A;  1DMO A;  3IF7 A;  2BL0 C;  2FL1 A;  2KI6 C;  3OB2 B;  3JTD C;  2CTN A;  1ZGP A;  1YX7 A;  4IL1 A;  4XYN A;  2YE1 A;  3EK8 A;  1S6C A;  2GV5 A;  2ZN9 A;  1IJ5 A;  1JFJ A;  1WLM A;  3KF9 A;  4DCK A;  1HUY A;  1Q73 A;  3DQ2 A;  1A2X A;  2HQ8 A;  2JT3 A;  1KSM A;  1LXF C;  1W7S A;  1N2D A;  1CTR A;  4HSZ A;  1XA5 A;  1K9U A;  3PN7 B;  1TTX A;  2JXC A;  2BBM A;  3BX9 A;  1UHH A;  2M1K B;  4ZB1 A;  1ZAC A;  4W6R A;  3SG4 A;  2KI6 D;  3CLN A;  3DQD A;  5I2O A;  4I5J A;  2I94 A;  2EGD A;  1EMG A;  1UHJ A;  2KOT A;  1XFY O;  2BTJ A;  2ZN8 A;  1KK7 Y;  3O6B A;  5BT0 A;  2K2A A;  2M3W A;  3MGF A;  2A56 B;  4W6P A;  2SCP A;  1RFJ A;  1NCX A;  3LK1 A;  2VVJ A;  5I2Q A;  2QLG B;  2D8N A;  3D10 A;  3ED8 A;  3FWC A;  2GW3 A;  2A54 B;  1CM4 A;  1QV0 A;  3DQ1 A;  2G3O A;  3GB3 A;  1SL9 A;  4DUQ A;  2PSR A;  2A52 B;  4OVN F;  1OE9 B;  1DGV A;  2JT8 A;  3E5W A;  3WLC A;  1QLS A;  1MF8 B;  1XA9 A;  1EML A;  2JC2 A;  1PSB A;  4R1E A;  2QT2 A;  3RWT A;  1D1O A;  3DQL A;  4DXI A;  1JSA A;  3PIB A;  3GK4 X;  2G2B A;  3FWB A;  2BCB A;  3U8A A;  2H61 C;  4DXM A;  1UIS A;  5LTQ A;  4KF4 A;  2JOJ A;  4KA9 A;  3OSQ A;  3HCM A;  4PFE A;  1LVC D;  1QX5 B;  1S1E A;  5EXB A;  4GGN A;  2BE6 A;  2M9G A;  1EXR A;  1U5I A;  5EJU A;  1KWO B;  1K8U A;  5DPJ A;  1OXD A;  3ZUF A;  4W76 A;  3LVA A;  4JQ0 D;  1TNQ A;  2CBL A;  3SG2 A;  1XK4 A;  1F0B A;  2KFG A;  3SVN A;  4FQO A;  2OTG C;  1YJF A;  2NLN A;  2KQ6 A;  2LHL A;  2QLE A;  1ZOT B;  1UHN A;  3SVR A;  2P4M A;  4LW5 A;  1Y6W A;  4PAL A;  4TZA A;  1TNP A;  1QJT A;  5JOL A;  1YHH A;  4OR9 B;  4QJ5 B;  5T3I A;  4JRB A;  2FCD A;  1JBY A;  1RMM A;  1CFF A;  5EB6 A;  1A75 B;  4HQ8 A;  2ZO6 A;  1TIZ A;  2H8Q A;  4WQ2 A;  3VRR A;  4JC2 A;  3I5F B;  3LK0 A;  5K89 A;  2G6E A;  3VRQ A;  3SV5 A;  3EVR A;  4KPI A;  1XFZ O;  1A03 A;  4ZF4 A;  2H6V A;  2LAP A;  2ZMU A;  4YGC B;  2PXS A;  4LJB A;  1K2H A;  1DVI A;  1BF5 A;  2WUR A;  1G33 A;  3W1C A;  4OGS A;  2WCB A;  4UTS A;  2F33 A;  4YGB B;  2HF5 A;  5CSF A;  3K1K A;  3ADF A;  1EL4 A;  3EKJ A;  1G8I A;  1W7U A;  2PMY A;  2JT0 A;  4W6M A;  4ZFS A;  1EJ3 A;  4W6N A;  3PJ5 A;  5DPI A;  1MXE A;  1DJY A;  4W75 A;  3SSV A;  1QTX A;  2JUL A;  2WC8 A;  5KSZ A;  4N3D A;  4GUK A;  1KFX S;  4IK3 A;  4U2V A;  3CFA A;  4DS7 A;  3VRN A;  1MYW A;  1U5I B;  1Q4C A;  3CFH A;  4LJD A;  2NCP A;  3I5H C;  3VIC A;  3A8R A;  2G5Z B;  1MQ1 A;  1SCM B;  2LC5 A;  4OHS A;  2GX2 A;  1S5G Z;  1JF2 A;  2IB5 A;  2L51 A;  3BUO B;  2MA2 A;  3SIB A;  5HLV A;  1H4B A;  2FZU A;  2HCG A;  4DXO A;  4Z4M A;  3DPW A;  5HW9 A;  1NCZ A;  1BR1 B;  4W6C A;  1WRK A;  4A4B A;  2KYF A;  3CS1 A;  3VHT B;  2G2S B;  2OJK A;  4W7C A;  5I2L A;  3A4U B;  2EC6 C;  3OB1 B;  2M49 B;  3EK4 A;  2O24 A;  1PVB A;  3H1R A;  4IK8 A;  3PM8 A;  4J89 A;  2KBM A;  1KYP A;  2LMU A;  1PUL A;  2K0J A;  1Q4B A;  1WDC B;  5HKY A;  1NIW A;  3PAL A;  3TDU A;  3WHU B;  1WRL A;  3CBE A;  5CSJ A;  4W7X A;  2MBX A;  2LM5 A;  1B7T Z;  1BJF A;  3JTD B;  2L0P A;  4P5O E;  2LVI A;  2ARL A;  1CNP A;  2M8U A;  4OQW A;  2I7A A;  3TS5 C;  4C0K A;  2CXJ A;  3BQ3 A;  1QVI Y;  1K94 A;  1TCF A;  3ZWH A;  4XGY A;  2WSO A;  3OX5 A;  2NXQ A;  3BUW B;  2IS9 A;  2Y0G A;  3ST3 A;  2M1U A;  1SL8 A;  3HX4 A;  2Q6P A;  1TRF A;  4HQC A;  1OOJ A;  4W6J A;  1TCO B;  1NX1 A;  1PK0 D;  1TNX A;  1KQM C;  4ZCV A;  5DKQ A;  2YFP A;  5HLO A;  5AER A;  4W6D A;  2B1U A;  1NCY A;  3AAJ A;  4JPZ B;  2WHT A;  4LQU A;  1F09 A;  1QX7 A;  4ORA B;  1SCV A;  4AQJ A;  2GX0 A;  1OXF A;  3DQA A;  2K61 A;  2KDH A;  2Y4Q A;  5DQM A;  3U0N A;  1OQP A;  4EDS A;  2ZO7 A;  2DOQ A;  2AWM A;  1S3P A;  3F45 A;  2PXW A;  1RMP A;  1R6P A;  1KFU S;  1QYF A;  3KHE A;  1WRZ A;  1QYO A;  5H88 A;  2JAD A;  1N65 A;  1YRU B;  2QLG A;  2QLH A;  4B5Y A;  3U8C A;  4ZF3 A;  2A4J A;  1PSR A;  1J55 A;  5JJG A;  4Q9X A;  1XVJ A;  5DU0 A;  2LHI A;  2V53 A;  1KSO A;  2HQZ A;  3CTN A;  2LP3 A;  1AUI B;  2K7C A;  1S6I A;  1KK8 C;  1XFW O;  1B4C A;  1ODB A;  1KK7 Z;  4EMQ A;  2PAS A;  3DD4 A;  3M0W A;  2TN4 A;  2OTB A;  4MN0 A;  1RRX A;  3IQQ A;  1NYA A;  3CZT X;  2JNF A;  5DTL A;  4DIR A;  4PPK A;  2OS8 C;  2KI4 C;  3NT3 A;  2K8M B;  3TUY C;  1QX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...