3EK7A

Calcium-saturated gcamp2 dimer
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
409
structure length
389
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 128
structure length 389
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ek7A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ek7A01
4KF5A 2A46A 4W75A 2IB6A 1OQPA 4ZBLA 4NWSA 2CT9A 4QJ3B 4DXNA 1EG4A 3LSAA 2H5RA 4W7CA 1QVIY 1M31A 3LK0A 4HREE 3GK1A 4LJDA 2JNFA 5EXBA 1PVAA 3KO0A 2ZRTA 3G9AA 1TIZA 3PN7C 2DD9A 1S5GZ 4W6IA 1XO5A 4AQIA 1LINA 3SVCA 1QX5B 4M2QA 4DKNA 2R2IA 2KFGA 4W6KA 2DOQA 5DU0A 4PE4A 2K2AA 1J7PA 5HZTA 3CTNA 2WHUA 1LKJA 4W6CA 1G7KA 1DT7B 3KEVA 2BCBA 1EMCA 3VRPA 1K94A 2NLNA 3DQKA 3LL8B 1XVJA 1S6ZA 1PSRA 1KQVA 3SSLA 1C07A 1CB1A 5HLVA 1IH0A 5FVIA 3OHMB 3CD9A 2M1UA 1ALVA 4DXQA 3EKHA 1Q4AA 5F6TA 4DIRA 2LLSA 4L1IA 2V4EC 1OZSA 3CS1A 1TRFA 1JC1A 2HPSA 3DQEA 3SVEA 1CDMA 4MZKA 4LJBA 4ZF5A 2M7LA 4Q04A 1EMEA 2JT3A 1SNLA 4AS8A 4ZFSA 3GK2A 4HE4A 1W7UA 3SSHA 2PSRA 1EMAA 1UP5A 1BR1B 5I2QA 1JBZA 2Z6YA 4YGBB 4DUQA 1QV0A 3DVJA 3LVCA 3QRXA 3I19A 1S1EA 4OJ0A 1KFUS 4L13A 3A8RA 2HF5A 2LANA 1KK8B 1MUXA 3O77A 3KF9A 2K61A 2WC8A 2WHSA 4L9MA 4PFEA 4YGCB 2QACA 5T3IA 1OMRA 1WRZA 3JVTC 1R6PA 3PATA 1QXTA 3CLNA 4OVNF 2HPWA 4IL1A 3SG5A 1JUOA 1JBYA 4JC2A 1NCXA 3SVDA 1H8BA 4TZGA 4R6BA 5TNCA 1KCYA 3VRRA 1WDCC 2BL0C 4W6RA 4OY4A 3LCPC 2GV5A 3PIBA 2ZN9A 4GFTA 2GX2A 3DQAA 2KAXA 2RGIA 2BBMA 5J2OA 1A4PA 2CCMA 3EVPA 3I5IB 1BG1A 4XGYA 1N0YA 1PALA 4RYWA 5HZSA 4ORCB 5EXCI 1LVCD 5FYXA 3CBEA 2K7DA 4PPJA 3KPXA 2IE2A 2KOTA 5DRGA 2LVVA 3D10A 2M0RA 2OTGB 4W7AA 2G6YA 2L4HA 1XMZA 3SG4A 5DTYA 1B8CA 2ISDA 2ZO7A 3BUNB 3WLDA 1MR8A 3ADFA 2F3YA 4KAGA 2GX0A 3A8SA 4W6DA 3GJ1A 1YHHA 1SKTA 1UUSA 4XOWA 3MGFA 3NSIA 1SL7A 2EC6B 5DQMA 2QT2A 3AAKA 2K8MB 1NUBA 5G08A 4W6TA 2OGRA 2LMTA 2B3PA 4I2YA 4W6OA 1DGUA 2CTNA 4IK4A 2YE1A 1YUTA 3BXKA 1MOUA 1RK9A 4BY5A 1J7OA 3S05A 3D0YB 3TUYC 2GGZA 1MWNA 1B1GA 4AR7A 4GNKB 5BPJA 2Q91A 4XJKA 2KAVA 2LHIA 1K93D 3EKJA 1Y6WA 1Q73A 2FCEA 2JC2A 1L2OC 4KEXA 2K7OA 2EHBA 4LW5A 1ZGQA 2JU0A 2GW4B 2KI4B 1XFWO 1ZGPA 3AI5A 4AOMA 1J7QA 2M1KB 1KQMC 5HW9A 3WCKA 1GGZA 2HETA 1Z1QA 3DVEA 3IP2A 1NSHA 1SW8A 2P6BB 4ORBB 2A54B 2H5OA 4I5LB 2DDDA 4I5JA 3O2PA 2AAOA 5D69A 5GQQC 1GQMA 4R1EA 3PJ5A 1B47A 3BUWB 1SR6C 2M49B 1M45A 3SV5A 3BXBA 2O29A 2LHLA 3DQ1A 1C4FA 3ST4A 2Y1NA 2H2KA 4ORNA 4GGNA 2HQ8A 4FQOA 2VVHA 1YVLA 3GEXA 3I5GC 1AJ5A 2OS8C 4W76A 1KP5A 2EMDA 4GGFC 3AAJA 4TNCA 1EMKA 2OTEA 2A47A 1OXEA 3DQ4A 2L51A 2DUEA 4M2PA 2M3WA 1PK0D 4PPKA 4HVFA 4LQUA 2QLHA 5I2LA 3OB1B 2KBIA 4W7DA 3OX5A 1DJZA 1ODBA 1QVIZ 2FZUA 1CFDA 1G4YR 4KF5C 1XFVO 1A03A 3CFAA 5FVFA 3SIAA 2ICRA 2F8PA 3WHTB 2LM5A 2QPTA 1KK7Y 4I5NB 4P2YB 2LP3A 3GK4X 1QIVA 2H61C 1KYSA 2AMIA 3I5FC 3M0WA 2KFHA 1YHGA 1ZACA 4MBEA 1EMGA 1XA5A 1NWDA 4QJ4B 3OGOA 2MAZA 3BOWB 1DMOA 4H48A 1UHJA 3I5HC 2F3ZA 1IRJA 3GOFA 1K8UA 3V3DA 1DJXA 2ZN8A 1EMFA 1RMMA 4WRIA 4PPLA 1ZUXA 3BUXB 4PHKA 3TS5B 2A50B 4XJKB 1B7TY 3UFZA 3EVVA 2G3DB 3E5TA 1GFLA 1ALWA 2HQZA 4W77A 3CWGA 2QZ0A 3U0LA 4W6FA 5BTTA 1XQMA 2HQWA 2AWJA 3LF4B 2MLFC 3PALA 2HFCA 1DGVA 2IS9A 1SL9A 5CSIA 1TCFA 4ICBA 3CFHA 2QRFA 2C9JA 1AJ4A 1G33A 1DF0A 2JTZA 5EXUA 1PULA 2Q57A 5AQBB 1PRWA 1RFJA 3RM1A 1S3PA 4W73A 1Z1PA 2JPTA 3BUOB 3ZNIA 4USLA 1F55A 3CGAA 4YI9A 1K2HA 2TN4A 1TN4A 2WISA 3SRYA 4W72A 1QXPA 1A29A 3HCMA 4H47A 1MOVA 1L7ZA 1SMGA 1QYFA 1NPQA 2LMVA 2MHHA 3SG2A 3BX9A 3AKBA 2JNXA 5CSFA 1Y1AA 2M8UA 3NSLA 3VRQA 1SCMC 3BXAA 4NDBA 2JULA 1YTZC 2L50A 1QASA 2Y1MA 1NX3A 2LAPA 2AWLA 4ZINA 3PSRA 4P1QA 1RM9A 2A4JA 1WRLA 5AERA 4JWQA 3DQ5A 5KU1A 1CM4A 2A53B 2DUIA 2LE9B 1B9CA 2I18A 4R6DA 2RH7A 4KF4A 1W7SA 5HZUA 2LV7A 2DUGA 4J8AA 2IOVA 1M39A 2OKWA 4EDOA 5HKYA 4WQ2A 2H8QA 5DY6A 3DQJA 1OXDA 3SJSA 4DKMA 4EMQA 3DQNA 5CSJA 5AEQA 1W7IB 1B9AA 3TZ1A 3CGLA 1X02A 1ZOTB 4MZJA 4YI8A 1SK6D 2EGDA 4RTCA 4W6LA 1SBJA 1UHKA 2YDZA 2JZIA 1YUUA 2K7BA 5D7FA 1Q80A 2DD7A 1YFPA 4N3DA 2JXCA 5BTTB 1BMOA 2JWWA 3ED8A 3D0YA 5HKWA 4ZB1A 1XK4C 2CBLA 3NEZA 1QV1A 1SR6B 1XFXO 1DF0B 2GGMA 3SSKA 5LTQA 3WXAA 1CFPA 1NCYA 2Z1OA 2A56B 3U8PA 4CFQA 3U8AA 3EK8A 2BTJA 2BE6A 2ZNDA 4ZF3A 5DPHA 2F2PA 1Y1XA 1F8HA 1M63B 2MBXA 4Q9XA 3VICA 4C0LA 3AKOA 2B3QA 3WHUB 3DQLA 4DCKA 4HSZA 1HT9A 1KWOC 2P4MA 2VAEA 1CTRA 1CNPA 1BU3A 4DXMA 5JOLA 2L98A 2LLTA 3M22A 2PASA 2E6WA 3LK1A 3CR4X 1V1GA 2KBMA 1SL8A 3SG3A 1VRKA 2DDCA 4W6NA 4Z4MA 1BT6A 1ZUZA 1F70A 1IQ3A 1KSMA 4H3NA 2BE4A 4W7EA 3JTDC 1ZFSA 2HGYA 2BKIB 1QJTA 3EVUA 1RWYA 4EULA 2BKHB 2NZ0A 2I7AA 1UWOA 3IF7A 4OCIA 2M29A 1RJVA 2JXLA 4W6UA 5H88A 3KHEA 3SG6A 4HQ8A 3P8UA 1CM1A 1MYWA 4JPZB 1UURA 1XFUO 1XYDA 4P5OE 2JT0A 4JF9A 2NCPA 1F4QA 1XFYO 3IR8A 5FHVA 1CKKA 4KGFA 3ST0A 1AHRA 1GJYA 1XA9A 1CLMA 1AUIB 1NX1A 1KYRA 2V4EA 4NQGA 3SSVA 2FWQA 4MZLA 4N5XA 3TDUA 2BBNA 4JFGA 2WNDA 1SY9A 1K9UA 2H6VA 2POXA 1YURA 2I2RE 5FVGA 1WLZA 4Q7RA 4KGEA 2HGDA 2DUFA 2YE0A 1BOCA 1S26D 2VZXA 1UHHA 3BOWA 3CZTX 3RWAA 3TMTA 1EH2A 3OSRA 1IGVA 2Z6ZA 3EK7A 2QLIA 1F0BA 2JOJA 3DQMA 3O6BA 4B30A 4A4BA 1Q4CA 1AP4A 2I94A 4DXPA 5B8IB 2MLEC 2LP2A 4W6JA 1K95A 4JEOA 4PHJA 3OP0A 3U0NA 3CFFA 1KSOA 3VHTA 1ZGOA 2HRSA 5ER4X 4H3LA 3EVRA 4ZCUA 2NXQA 2SASA 3DF0A 1JFKA 1B7TZ 4W6HA 2NCOA 2YFPA 1JSAA 4DXOA 2HQKA 3PN7B 1QX2A 2L5XB 1A75A 1W7JB 4MLWA 2K7CA 4N1FA 3FIAA 4J89A 1S6JA 3DQ8A 2AH8A 3VRNA 1J1EA 2Q4UA 1YR5A 2LVKA 3LA1A 3SVBA 2D8NA 1H4BA 2WCBA 3O78A 4EN1A 1S36A 4BY4A 2B1UA 3ZTFA 2LC5A 1SRAA 1B8RA 2L2EA 1OSAA 4W7XA 3AKAA 2F2OA 4XVPA 1YZWA 3RLZA 1KK8C 1IJ5A 2A52B 2OKYA 3MSEB 4JQ0D 3SVSA 3DVKA 1GGXA 4CLNA 2G2SB 3WLCA 1TOPA 2JTTA 1JC0A 4PHMA 5LK4A 4IK8A 1EL4A 1YX8A 3HX4A 2V4EB 2JT8A 4GAOA 3DQFA 3LF3A 1A2XA 1LXFC 1YHIA 2KYFA 2Y0GA 1MXLC 1Y1UA 2LMUA 5DKNA 3E3RA 1IKUA 3H1RA 3SIBA 3DQIA 5DQBA 4PCWA 1D1OA 5HZOA 4LJDC 3NXAA 1NYAA 2KYCA 3SSTA 1YVHA 1SPYA 4Q7UA 1J1DA 4PDZA 3I5IC 4B30B 1GL4A 3ZULA 4ETOA 4M2OA 4H3MA 2O60A 3DQ2A 2V53A 4JRBA 2LVJA 1YJ2A 3JVTB 1TNPA 4KA9A 3VHTB 2OTGC 1UHIA 3ZUJA 1OZOA 2KQYA 2BECA 4QJ5B 3DF0B 5DPIA 3DQ7A 3U0KA 1WDCB 3PLFB 2BL0B 1MF8B 2F33A 2EC6C 4MN0A 2M9GA 1J7RA 2CNPA 5AANA 3IQQA 4W6MA 4GGFA 1A75B 4TZAA 4XYNA 3DQ3A 2WOSA 1YRTB 4HRHA 3SSYA 2PVBA 2QU1A 3ZUFA 5EHUA 1LA0A 4CFRA 3LS3A 1IQ5A 5IBWA 2HCGA 2KGRA 4MEWA 1IJ6A 1CFFA 1WY9A 2KI4C 1ZMZA 1NP8A 1N65A 4OGSA 2O5GA 1Q4EA 5EJUA 1EMBA 1BJFA 3DQOA 2H61A 2KDHA 1J55A 1EMMA 4ANJA 4AQJA 3E5VA 1CDPA 1XSSA 2KHNA 5J3XA 5DTLA 1DJWA 1AK8A 4C0JA 1OMDA 4OHSA 3NT9A 4PE0A 4IZNA 2Y5IA 3DQHA 4KW8A 3NT3A 3TUYB 3H1OA 5CPVA 2H9WA 1DJHA 3WNXB 3SG7A 1NX2A 1R2UA 1GGWA 2KI6D 1NIWA 3PFVA 3FS7A 2LVIA 1L2OB 4GUKA 1TNXA 1YRUB 5HKZA 1SCVA 1OOJA 4WQ3A 2JRFA 2G3OA 1U5IA 4W6PA 3CR5X 4GBAA 1KQMB 3H4SE 3SVRA 1YJFA 1YUSA 2G6XA 4MVFA 1RRXA 2L0PA 4UTSA 2PXWA 2G6EA 4Q9WA 1PVBA 5PALA 1DVIA 1DJYA 2WIQA 3F45A 3CB9A 1Y0VH 5EBJA 1QLSA 1KFXL 1K96A 3EK4A 2AUCA 4W6SA 2M7NA 5AXIA 2PRUA 4YBHB 2BCXA 2LLUA 1QYQA 2WURA 3I5GB 2FCDA 2OS8B 1M46A 1UISA 4W7RA 3W1CA 4LQTA 3KCSA 4DRWA 4PE1A 5DTXA 4UPGA 2ZO6A 3DPZA 1TCOB 4ZCVA 2ZFDA 3DQ9A 2O2BA 5HYDA 3DPWA 1MXEA 2L4IA 1XAEA 4PE7A 3TS5C 4MRYA 5DKQA 1W7TA 4D1EA 1EJ3A 2JADA 5JJGA 1RROA 1QS7A 4W6GA 1FI5A 1EG3A 4XOVA 3C1VA 1FI6A 1DJIA 1IG5A 1LA3A 1V1FA 4W6BA 2LCPA 1S5GY 3TMRA 1KYPA 4L12A 2E30A 3OX6A 3SS0A 3BQ3A 1BF5A 1AVSA 1S6CA 4FTGA 4I5KA 1WRKA 1QLKA 3I5FB 2MRDA 2ZMUA 1F71A 3SSPA 3SVOA 2KI6C 1BODA 2AHAA 3PM8A 2BCAA 3I5HB 4NDDA 3BYAA 2PXSA 5LTPA 3U0MA 3VK1A 3RWTA 4DS7A 5EB6A 2WHTA 5H87A 3ICBA 1QTXA 1FPWA 5DRFA 1UHNA 1K9KA 1CDNA 1B8LA 1QYOA 1QIWA 3K21A 1TNWA 1RMOA 4OQWA 1WLMA 1U5IB 2EMOA 1TNQA 2H5QA 3PJ7A 1FF1A 4CIDA 3BXCA 3SVUA 3E5WA 1OE9B 2G5ZB 1XK4A 5KTGA 1RECA 5KTYA 3CR2A 3VROA 2KGBC 2KAYA 1C7WA 1F54A 2Q6PA 4W6AA 2KQ6A 2OPOA 3DVMA 1HQVA 2COLB 3DD4A 1K9PA 4EDSA 2QLEA 1K90D 5KSZA 1KK7Z 3NEDA 2DUHA 1KFXS 1PSBA 2QLGA 3A4UB 4GESB 2HJOA 3IQOA 1DJGA 4ORAB 2CXJA 1CV7A 1JBAA 1OXFA 1BR4B 2LUXA 5F9GA 4NDCA 3UG0A 3M24A 3DQ6A 3TDZA 1SCMB 4YGEB 1FBVA 4MSPA 1HCJA 2WSNA 4Q7TA 3LVAA 2C9IA 3W1DA 3FWCA 2G2BA 1NCZA 1TTXA 2FOTA 4IK9A 1B4CA 1BLQA 2G9BA 3U8CA 4HQ9A 2A48A 1JF0A 2KNEA 2KFFA 3VGOA 3AI4A 4DXIA 4PHNA 1JC2A 1DTLA 5I8NA 4JGEA 3TDIA 4OKHA 5DTZA 2FL1A 2GW3A 3BUMB 2MA2A 1Q4BA 1NX0A 1OMVA 1Q4DA 4XL5A 3ST2A 1QX7A 4N1GA 2KSPA 4E68A 2K2FA 4YGAA 1EMLA 1H4UA 2AWKA 1BFPA 2ZNEA 1F09A 5BT0A 2VVJA 4IK5A 3O4YA 4KW4A 1YX7A 4A4CA 1CFCA 4P76A 1F4OA 4YGDB 5BQLA 2VADA 4W69A 3ZWHA 2ZMWA 1IWQA 4C0KA 2Y4QA 3DQDA 5H89A 3OB2B 2VVIA 3SVNA 4CPVA 4LJCA 3NF0A 2Z6XA 3DQUA 2MJWB 3LVDA 4IK3A 5HLOA 1H6RA 5K89A 2AWMA 2OJKA 4ZF4A 4KPIA 3OSQA 4HQCA 5DPJA 5ER5A 1CMGA 2H5PA 4BDUA 1JWDA 2IB5A 2PALA 3DPXA 3KCTA 5AFPA 2PMYA 3CD1A 3K1KA 4OV2A 5DPGA 4PALA 5DKRA 2G16B 5CSNA 2QLGB 1KWOB 3FWBA 1JFJA 4J88A 4U8DA 4RYSA 4YRUA 1FW4A 1G8IA 4MRXA 1QATA 2ZKMX 2WCFA 4W7FA 1C7VA 2EMNA 3P28A 2SCPA 4GPLB 2OTBA 3GL4A 2LUCA 1JF2A 5I2OA 3GJ2A 2JQ6A 1QY3A 3PJBA 1MHOA 3JTDB 2WCEA 2ZRSA 3DQCA 2K0JA 4OR9B 4B5YA 4U2VA 4GOBA 2WORA 2WSOA 2O24A 4GF6B 1RMPA 1CMFA 1EXRA 2FJUB 4F0ZB 1CLBA 1CLLA 1HUYA 1KFUL 1MQ1A 3NSOA 1RTP1 1XFZO 3NSKA 3LLEA 2VRGA 4HRGA 4Z4KA 2M97A 4ZIOA 1S6IA 1E8AA 5HBDA 4IK1A 3GB3A 5LTRA 1SYMA 4W74A 1CDLA 3ST3A 1N2DA 2ARLA 2LNKA 5EB7A 4KW9A 5HGEA
chains in the Genus database with same CATH superfamily
4KF5A 2A46A 4W75A 2IB6A 3FE8A 1OQPA 4ZBLA 4NWSA 2CT9A 4QJ3B 4DXNA 1EG4A 3LSAA 2H5RA 4W7CA 1QVIY 1M31A 3LK0A 4HREE 3GK1A 4LJDA 2JNFA 5EXBA 1PVAA 3KO0A 2ZRTA 3G9AA 1TIZA 3PN7C 2DD9A 1S5GZ 4W6IA 1XO5A 5FI7A 4AQIA 1LINA 3SVCA 1QX5B 4M2QA 4DKNA 2R2IA 2KFGA 4KYNA 4W6KA 2DOQA 5DU0A 2WCMA 4PE4A 2K2AA 1J7PA 5HZTA 3CTNA 2WHUA 1LKJA 3N7HA 4W6CA 1G7KA 1DT7B 3KEVA 2BCBA 1EMCA 3VRPA 1K94A 2NLNA 3DQKA 3LL8B 1XVJA 1S6ZA 1PSRA 2L2CA 3B87A 1KQVA 3S0BA 3OBVA 3SSLA 1C07A 1CB1A 5HLVA 1IH0A 5FVIA 3OHMB 3CD9A 2M1UA 1ALVA 4DXQA 3EKHA 1Q4AA 5F6TA 4DIRA 2LLSA 4L1IA 2V4EC 1OZSA 3CS1A 1TRFA 1JC1A 2HPSA 4INWA 3DQEA 3SVEA 1CDMA 4MZKA 4LJBA 3Q8IA 4ZF5A 2M7LA 4Q04A 1EMEA 2JT3A 1SNLA 4AS8A 4ZFSA 3GK2A 4HE4A 1W7UA 3SSHA 3L47A 2PSRA 1EMAA 1UP5A 3NHIA 1BR1B 5I2QA 1JBZA 2Z6YA 4YGBB 4DUQA 1QV0A 3DVJA 3LVCA 3QRXA 3I19A 1S1EA 4OJ0A 1KFUS 4L13A 3A8RA 2HF5A 2LANA 1KK8B 1MUXA 3O77A 3KF9A 2K61A 2WC8A 2WHSA 3FE9A 4L9MA 4PFEA 4YGCB 2L5YA 2QACA 5T3IA 1OMRA 1WRZA 3JVTC 3CDNA 1R6PA 3PATA 1QXTA 3CLNA 4OVNF 2HPWA 4IL1A 3SG5A 1JUOA 1ORGA 1JBYA 4JC2A 1NCXA 3SVDA 1H8BA 4TZGA 4R6BA 5TNCA 1KCYA 3VRRA 1WDCC 2BL0C 4W6RA 4OY4A 2H8VA 3LCPC 2GV5A 3PIBA 2ZN9A 4GFTA 1T14A 2GX2A 3DQAA 3R72A 2KAXA 2RGIA 2BBMA 5J2OA 1A4PA 2CCMA 3EVPA 3I5IB 1BG1A 4XGYA 1N0YA 1PALA 4RYWA 5HZSA 4ORCB 5EXCI 1LVCD 5FYXA 3CBEA 2K7DA 1C3ZA 4PPJA 3KPXA 2IE2A 2KOTA 1OOIX 5DRGA 2LVVA 3D10A 2M0RA 2OTGB 4W7AA 2G6YA 2L4HA 1XMZA 3SG4A 5DTYA 1B8CA 2ISDA 2ZO7A 1W9ZA 3BUNB 3IVTA 3WLDA 1MR8A 3ADFA 4JD9A 2F3YA 4KAGA 2GX0A 3A8SA 2WC5A 4W6DA 3GJ1A 1YHHA 1SKTA 1UUSA 4XOWA 3MGFA 3NSIA 1SL7A 2QEOA 2EC6B 5DQMA 2QT2A 3AAKA 2K8MB 1NUBA 5G08A 4W6TA 2OGRA 2LMTA 2B3PA 2GTEA 4I2YA 4W6OA 1DGUA 2CTNA 4IK4A 2YE1A 1YUTA 3BXKA 1MOUA 1RK9A 4BY5A 1TUJA 1J7OA 3S05A 3D0YB 3TUYC 2GGZA 1MWNA 2KPHA 1B1GA 4AR7A 4GNKB 5BPJA 2Q91A 4XJKA 2KAVA 2LHIA 1K93D 3EKJA 1Y6WA 1Q73A 3L4AA 2FCEA 2JC2A 1L2OC 4KEXA 2K7OA 2EHBA 4LW5A 1ZGQA 2JU0A 2GW4B 2KI4B 1XFWO 1ZGPA 3AI5A 4AOMA 1J7QA 2M1KB 1KQMC 4FQTA 5HW9A 3WCKA 1GGZA 2HETA 1Z1QA 3DVEA 3IP2A 1NSHA 1SW8A 2P6BB 4ORBB 2A54B 2H5OA 4I5LB 2DDDA 4I5JA 3O2PA 2AAOA 5D69A 5GQQC 1GQMA 4R1EA 3PJ5A 1B47A 3BUWB 1SR6C 2M49B 1M45A 3SV5A 3BXBA 2O29A 2LHLA 3DQ1A 1C4FA 3ST4A 2Y1NA 2H2KA 4ORNA 4GGNA 2HQ8A 4FQOA 2VVHA 1YVLA 3S0DA 3I5GC 3GEXA 1AJ5A 2OS8C 4W76A 1KP5A 2EMDA 4GGFC 3AAJA 4TNCA 2PYQA 1EMKA 2OTEA 2A47A 1OXEA 3S0AA 3PM2A 3DQ4A 2L51A 2DUEA 4M2PA 1Z2CB 2M3WA 2WCKA 4IJ7A 1PK0D 4PPKA 3K1EA 4HVFA 4LQUA 2QLHA 5I2LA 3OB1B 2KBIA 4W7DA 3OX5A 1DJZA 3V2LA 1ODBA 1QVIZ 2FZUA 1CFDA 1G4YR 4KF5C 1XFVO 1A03A 3CFAA 5FVFA 3SIAA 2ICRA 2F8PA 3WHTB 2LM5A 2QPTA 1KK7Y 3CZ2A 4I5NB 4P2YB 2LP3A 3GK4X 1QIVA 2H61C 1KYSA 2AMIA 3I5FC 3M0WA 2KFHA 1YHGA 1ZACA 4MBEA 1EMGA 1OOFA 1XA5A 1NWDA 4QJ4B 3OGOA 2MAZA 3BOWB 1DMOA 4H48A 1UHJA 3I5HC 2F3ZA 1IRJA 3GOFA 1K8UA 3V3DA 1DJXA 2ZN8A 1EMFA 1RMMA 4WRIA 4PPLA 1ZUXA 3BUXB 4PHKA 3TS5B 2A50B 4XJKB 1B7TY 3UFZA 3EVVA 2G3DB 3E5TA 1GFLA 1ALWA 2HQZA 4W77A 3VB1A 3CWGA 2QZ0A 3U0LA 4W6FA 5BTTA 1XQMA 2HQWA 2AWJA 3LF4B 2MLFC 3PALA 2HFCA 1DGVA 2IS9A 1SL9A 5CSIA 1TCFA 4ICBA 3CFHA 2QRFA 2C9JA 1AJ4A 2QEVA 1G33A 1DF0A 2JTZA 5EXUA 1PULA 2Q57A 5AQBB 3SS3A 1PRWA 1RFJA 3RM1A 1S3PA 4W73A 1Z1PA 2JPTA 3BUOB 3ZNIA 4USLA 1F55A 3CGAA 1SSEB 4YI9A 1K2HA 2TN4A 1TN4A 2WISA 3SRYA 4W72A 1QXPA 2P71A 1A29A 3HCMA 5EL2A 4H47A 1MOVA 1L7ZA 1SMGA 1QYFA 1NPQA 2LMVA 2MHHA 3SG2A 3BX9A 3AKBA 3S0EA 2JNXA 5CSFA 1Y1AA 2M8UA 3NSLA 3VRQA 2K60A 1SCMC 2WCHA 3BXAA 4NDBA 2JULA 1YTZC 2L50A 1QASA 2Y1MA 1NX3A 2LAPA 1DC1A 2AWLA 4ZINA 3PSRA 3B88A 4P1QA 1RM9A 2A4JA 1WRLA 5AERA 4JWQA 1DEKA 3DQ5A 5I94A 1CM4A 5KU1A 2A53B 2DUIA 3BFAA 2LE9B 1B9CA 2I18A 4R6DA 3SS5A 2RH7A 4KF4A 1W7SA 5HZUA 2LV7A 2DUGA 4J8AA 2IOVA 1M39A 2OKWA 4EDOA 5HKYA 4WQ2A 2H8QA 5DY6A 1OOGA 3DQJA 1OXDA 3SJSA 4DKMA 4EMQA 3DQNA 5CSJA 5AEQA 1W7IB 1B9AA 1TWOA 3TZ1A 3CGLA 1X02A 1ZOTB 4MZJA 4YI8A 1SK6D 2EGDA 4RTCA 4W6LA 1SBJA 1UHKA 2YDZA 2JZIA 1YUUA 2K7BA 5D7FA 1Q80A 2DD7A 1YFPA 2YGUA 4N3DA 2JXCA 5BTTB 2P70A 2QEHA 1BMOA 2JWWA 3ED8A 3D0YA 5HKWA 4ZB1A 1XK4C 2CBLA 3NEZA 1QV1A 1SR6B 1XFXO 1DF0B 2GGMA 3SSKA 5LTQA 3WXAA 1CFPA 1NCYA 2Z1OA 2A56B 3CYZA 3U8PA 4CFQA 3U8AA 3EK8A 2BTJA 2BE6A 2ZNDA 4ZF3A 5DPHA 3B86A 2F2PA 1Y1XA 1F8HA 1M63B 2MBXA 4Q9XA 2PQLA 3VICA 4C0LA 3AKOA 2B3QA 3QMEA 3WHUB 3DQLA 4DCKA 4HSZA 1HT9A 1KWOC 2P4MA 2VAEA 1CTRA 1CNPA 1BU3A 4DXMA 5JOLA 2L98A 2LLTA 3M22A 2PASA 2E6WA 3LK1A 3CR4X 2FJYA 1V1GA 2KBMA 1SL8A 3SG3A 1VRKA 2DDCA 4W6NA 4Z4MA 1BT6A 1ZUZA 1F70A 1IQ3A 5DICA 1KSMA 4H3NA 2BE4A 4W7EA 3JTDC 1ZFSA 2HGYA 2BKIB 1QJTA 3EVUA 1RWYA 4EULA 2BKHB 2NZ0A 1OW4A 2I7AA 1UWOA 3IF7A 4OCIA 2M29A 1RJVA 2JXLA 4W6UA 5H88A 5D3OA 3KHEA 3SG6A 4HQ8A 1CM1A 1MYWA 3P8UA 4JPZB 1UURA 1XFUO 1XYDA 4P5OE 2JT0A 4JF9A 2NCPA 1F4QA 1XFYO 3IR8A 5FHVA 1CKKA 4KGFA 2BNXA 3ST0A 1AHRA 1GJYA 1XA9A 1CLMA 1AUIB 1NX1A 3D78A 1KYRA 2V4EA 4NQGA 3SSVA 2FWQA 4F7FA 4MZLA 4N5XA 3TDUA 2BBNA 4JFGA 2WNDA 1QWVA 5FI2A 1SY9A 1K9UA 2H6VA 2POXA 1YURA 2I2RE 5FVGA 1WLZA 4Q7RA 4KGEA 2HGDA 2DUFA 2YE0A 1BOCA 1S26D 2VZXA 1UHHA 3BOWA 3CZTX 3RWAA 3BFBA 3TMTA 1EH2A 3DZTA 3OSRA 1IGVA 2Z6ZA 3EK7A 2QLIA 1F0BA 2JOJA 3DQMA 3CZ0A 3O6BA 4B30A 4A4BA 1Q4CA 1AP4A 2I94A 4DXPA 5B8IB 2MLEC 2LP2A 4W6JA 1K95A 4JEOA 3FE6A 4PHJA 3OP0A 3U0NA 3CFFA 1KSOA 3VHTA 1ZGOA 2HRSA 5ER4X 4H3LA 3EVRA 4ZCUA 2NXQA 2SASA 3PJIA 3DF0A 1JFKA 1B7TZ 4W6HA 2NCOA 2YFPA 1JSAA 4DXOA 2HQKA 3PN7B 1QX2A 2L5XB 1A75A 1W7JB 4MLWA 2K7CA 4N1FA 2KLEA 3FIAA 4J89A 1S6JA 3DQ8A 2AH8A 3VRNA 1J1EA 2Q4UA 1YR5A 2LVKA 3LA1A 3SVBA 2D8NA 1H4BA 2WCBA 3O78A 4EN1A 1S36A 2WCLA 4OZDA 4BY4A 2B1UA 3ZTFA 2LC5A 1SRAA 1B8RA 2L2EA 2ERBA 1OSAA 4W7XA 3AKAA 2F2OA 4XVPA 1YZWA 3RLZA 1KK8C 1IJ5A 2A52B 2OKYA 3MSEB 3R1PA 4JQ0D 3SVSA 3DVKA 1GGXA 4CLNA 2G2SB 3WLCA 5HL1A 1TOPA 2JTTA 1JC0A 4PHMA 5LK4A 4IK8A 1EL4A 1YX8A 3HX4A 2V4EB 2JT8A 4GAOA 3DQFA 3LF3A 1A2XA 1LXFC 1YHIA 2KYFA 2Y0GA 1MXLC 1Y1UA 2LMUA 5DKNA 3E3RA 1IKUA 3DY9A 3SIBA 3H1RA 3DQIA 5DQBA 4PCWA 1D1OA 5HZOA 4LJDC 3NXAA 1NYAA 2QDIA 2KYCA 3SSTA 1YVHA 1SPYA 4Q7UA 1J1DA 4PDZA 3I5IC 4B30B 1GL4A 3ZULA 4ETOA 1LS8A 4M2OA 4H3MA 2O60A 3DQ2A 2V53A 4JRBA 2LVJA 3UNWA 1YJ2A 3JVTB 1TNPA 4KA9A 3VHTB 2OTGC 1UHIA 3ZUJA 1OZOA 2KQYA 2BECA 4QJ5B 3DF0B 5DPIA 3DQ7A 3U0KA 1GM0A 1WDCB 3PLFB 2BL0B 1MF8B 2F33A 2EC6C 4MN0A 2M9GA 1J7RA 2CNPA 5AANA 3IQQA 4W6MA 4GGFA 1A75B 3NGVA 4TZAA 4XYNA 3DQ3A 2WOSA 1YRTB 4HRHA 3SSYA 2PVBA 2QU1A 3ZUFA 5EHUA 1LA0A 4CFRA 3R1VA 3LS3A 1IQ5A 5IBWA 2HCGA 2KGRA 4MEWA 1IJ6A 1CFFA 1WY9A 3OGNA 2KI4C 1ZMZA 1NP8A 1N65A 4OGSA 2O5GA 1Q4EA 5FI6A 5EJUA 1EMBA 1BJFA 3DQOA 2H61A 2KDHA 1J55A 3D74A 2QEBA 1EMMA 4ANJA 4AQJA 3E5VA 1CDPA 1XSSA 3B6XA 1C3YA 2KHNA 5J3XA 5DTLA 1DJWA 1AK8A 4C0JA 1OMDA 4OHSA 3NT9A 4PE0A 4IZNA 2Y5IA 3DQHA 4KW8A 3NT3A 3TUYB 3H1OA 5CPVA 2H9WA 1DJHA 3WNXB 3SG7A 1NX2A 1R2UA 1GGWA 2KI6D 1NIWA 3PFVA 3FS7A 2LVIA 1L2OB 4JKTA 3DYEA 4GUKA 1TNXA 1YRUB 5HKZA 1SCVA 1OOJA 4WQ3A 2JRFA 2G3OA 1U5IA 3CR5X 4W6PA 4GBAA 1KQMB 3H4SE 3SVRA 1YJFA 1YUSA 2G6XA 4MVFA 1RRXA 2L0PA 4UTSA 1TUZA 2PXWA 2G6EA 4Q9WA 1PVBA 5PALA 1DVIA 1DJYA 2WIQA 3F45A 3CB9A 1Y0VH 5EBJA 1QLSA 1KFXL 1K96A 3EK4A 2AUCA 4W6SA 2M7NA 5AXIA 2PRUA 4YBHB 2BCXA 2LLUA 1QYQA 2WURA 3I5GB 1IIOA 2FCDA 2OS8B 1M46A 1UISA 4W7RA 3W1CA 4LQTA 3KCSA 4DRWA 4PE1A 5DTXA 3S0GA 4UPGA 3DPZA 2ZO6A 3O4XA 1TCOB 4ZCVA 2ZFDA 3DQ9A 2O2BA 5HYDA 3DPWA 1MXEA 2L4IA 1XAEA 4PE7A 3TS5C 4MRYA 5DKQA 1W7TA 4D1EA 1EJ3A 2JADA 5JJGA 1RROA 1QS7A 4W6GA 1FI5A 1EG3A 4XOVA 3NHTA 4PT1A 3C1VA 1FI6A 1DJIA 1IG5A 1LA3A 1V1FA 4W6BA 2LCPA 1S5GY 3TMRA 1KYPA 4L12A 2E30A 3OX6A 3R1OA 3DXLA 3SS0A 3BQ3A 1BF5A 1AVSA 2WC6A 1S6CA 4FTGA 4I5KA 1WRKA 1QLKA 3I5FB 2MRDA 2ZMUA 1F71A 3SSPA 3SVOA 2KI6C 1BODA 3CABA 2AHAA 3PM8A 4INXA 2BCAA 3I5HB 4NDDA 3BYAA 1XFRA 2PXSA 5LTPA 3U0MA 3VK1A 3RWTA 1Z4HA 4DS7A 5EB6A 2WHTA 5H87A 3S0FA 3ICBA 1QTXA 1FPWA 5DRFA 1UHNA 1K9KA 1CDNA 1B8LA 1QYOA 1QIWA 3K21A 1TNWA 1RMOA 4OQWA 1WLMA 1U5IB 2EMOA 1TNQA 2H5QA 3PJ7A 1FF1A 4CIDA 3BXCA 3SVUA 3E5WA 1OE9B 2G5ZB 1XK4A 5KTGA 1RECA 5KTYA 3CR2A 3VROA 2KGBC 2KAYA 1C7WA 1F54A 2Q6PA 4W6AA 2KQ6A 2OPOA 3DVMA 3L4LA 1HQVA 2COLB 3DD4A 1K9PA 4EDSA 2QLEA 1K90D 5KSZA 1KK7Z 3NEDA 2DUHA 1KFXS 1PSBA 2QLGA 3A4UB 4GESB 2HJOA 3IQOA 1DJGA 2WCJA 2CXJA 4ORAB 3D76A 1CV7A 1JBAA 1OXFA 1BR4B 2LUXA 5F9GA 3EG5B 4NDCA 3UG0A 3M24A 3DQ6A 3TDZA 1SCMB 4YGEB 1FBVA 4MSPA 1HCJA 2WSNA 4Q7TA 3LVAA 2C9IA 3D73A 2JPOA 3W1DA 3FWCA 2G2BA 1NCZA 1TTXA 2FOTA 3D75A 4IK9A 1B4CA 1DELA 1BLQA 2G9BA 3U8CA 3CZ1A 4HQ9A 2A48A 1JF0A 2KNEA 2KFFA 3VGOA 3AI4A 4DXIA 4PHNA 1JC2A 1DQEA 1DTLA 5I8NA 4JGEA 3TDIA 3BFHA 4OKHA 5DTZA 2FL1A 2GW3A 3BUMB 2MA2A 1Q4BA 1NX0A 1OMVA 1Q4DA 4XL5A 3ST2A 1QX7A 4N1GA 2KSPA 4E68A 2K2FA 4YGAA 1EMLA 1H4UA 2AWKA 1BFPA 2ZNEA 1F09A 5BT0A 2VVJA 4IK5A 3O4YA 4KW4A 1YX7A 4A4CA 1CFCA 4P76A 1F4OA 4YGDB 5BQLA 2VADA 4W69A 3ZWHA 2ZMWA 1IWQA 4C0KA 2Y4QA 3DQDA 5H89A 3OB2B 2VVIA 3SVNA 4CPVA 3NF0A 4LJCA 2Z6XA 3DQUA 2MJWB 3LVDA 4IK3A 5HLOA 1H6RA 5K89A 2AWMA 2OJKA 4ZF4A 4KPIA 3OSQA 4HQCA 5DPJA 5ER5A 1CMGA 2H5PA 4BDUA 1JWDA 2IB5A 2PALA 3DPXA 3KCTA 5AFPA 2PMYA 3CD1A 3K1KA 4OV2A 5DPGA 4PALA 5DKRA 2G16B 5CSNA 2QLGB 1KWOB 3FWBA 1JFJA 4J88A 4U8DA 4RYSA 3BJHA 4YRUA 1FW4A 1G8IA 4MRXA 1QATA 2KLDA 2ZKMX 2WCFA 4W7FA 1C7VA 2EMNA 3P28A 2SCPA 4GPLB 3UO9A 2OTBA 3GL4A 2LUCA 1JF2A 5I2OA 3GJ2A 2BAPA 2JQ6A 1QY3A 3PJBA 1MHOA 3D77A 3JTDB 2WCEA 1P28A 2ZRSA 3DQCA 2K0JA 4OR9B 4B5YA 4U2VA 4GOBA 2WORA 3RZSA 2WSOA 2O24A 4GF6B 1RMPA 1CMFA 3B7AA 1EXRA 2FJUB 4F0ZB 1CLBA 1CLLA 1HUYA 1KFUL 1MQ1A 3NSOA 3SS4A 1RTP1 1XFZO 3NSKA 3LLEA 2VRGA 4HRGA 4Z4KA 2M97A 4ZIOA 1S6IA 1E8AA 5HBDA 4IK1A 3GB3A 5LTRA 1SYMA 4W74A 1CDLA 3ST3A 1N2DA 2ARLA 1OOHA 2LNKA 5EB7A 4KW9A 5HGEA
chains in the Genus database with same CATH topology
4KF5A 2A46A 4W75A 2IB6A 1OQPA 4ZBLA 4NWSA 2CT9A 4QJ3B 4DXNA 1EG4A 3LSAA 2H5RA 4W7CA 1QVIY 1M31A 3LK0A 4HREE 3GK1A 4LJDA 2JNFA 5EXBA 1PVAA 3KO0A 2ZRTA 3G9AA 1TIZA 3PN7C 2DD9A 1S5GZ 4W6IA 1XO5A 4AQIA 1LINA 3SVCA 1QX5B 4M2QA 4DKNA 2R2IA 2KFGA 4W6KA 2DOQA 5DU0A 4PE4A 2K2AA 1J7PA 5HZTA 3CTNA 2WHUA 1LKJA 4W6CA 1G7KA 1DT7B 3KEVA 2BCBA 1EMCA 3VRPA 1K94A 2NLNA 3DQKA 3LL8B 1XVJA 1S6ZA 1PSRA 1KQVA 3SSLA 1C07A 1CB1A 5HLVA 1IH0A 5FVIA 3OHMB 3CD9A 2M1UA 1ALVA 4DXQA 3EKHA 1Q4AA 5F6TA 4DIRA 2LLSA 4L1IA 2V4EC 1OZSA 3CS1A 1TRFA 1JC1A 2HPSA 3DQEA 3SVEA 1CDMA 4MZKA 4LJBA 4ZF5A 2M7LA 4Q04A 1EMEA 2JT3A 1SNLA 4AS8A 4ZFSA 3GK2A 4HE4A 1W7UA 3SSHA 2PSRA 1EMAA 1UP5A 1BR1B 5I2QA 1JBZA 2Z6YA 4YGBB 4DUQA 1QV0A 3DVJA 3LVCA 3QRXA 3I19A 1S1EA 4OJ0A 1KFUS 4L13A 3A8RA 2HF5A 2LANA 1KK8B 1MUXA 3O77A 3KF9A 2K61A 2WC8A 2WHSA 4L9MA 4PFEA 4YGCB 2QACA 5T3IA 1OMRA 1WRZA 3JVTC 1R6PA 3PATA 1QXTA 3CLNA 4OVNF 2HPWA 4IL1A 3SG5A 1JUOA 1JBYA 4JC2A 1NCXA 3SVDA 1H8BA 4TZGA 4R6BA 5TNCA 1KCYA 3VRRA 1WDCC 2BL0C 4W6RA 4OY4A 3LCPC 2GV5A 3PIBA 2ZN9A 4GFTA 2GX2A 3DQAA 2KAXA 2RGIA 2BBMA 5J2OA 1A4PA 2CCMA 3EVPA 3I5IB 1BG1A 4XGYA 1N0YA 1PALA 4RYWA 5HZSA 4ORCB 5EXCI 1LVCD 5FYXA 3CBEA 2K7DA 4PPJA 3KPXA 2IE2A 2KOTA 5DRGA 2LVVA 3D10A 2M0RA 2OTGB 4W7AA 2G6YA 2L4HA 1XMZA 3SG4A 5DTYA 1B8CA 2ISDA 2ZO7A 3BUNB 3WLDA 1MR8A 3ADFA 2F3YA 4KAGA 2GX0A 3A8SA 4W6DA 3GJ1A 1YHHA 1SKTA 1UUSA 4XOWA 3MGFA 3NSIA 1SL7A 2EC6B 5DQMA 2QT2A 3AAKA 2K8MB 1NUBA 5G08A 4W6TA 2OGRA 2LMTA 2B3PA 4I2YA 4W6OA 1DGUA 2CTNA 4IK4A 2YE1A 1YUTA 3BXKA 1MOUA 1RK9A 4BY5A 1J7OA 3S05A 3D0YB 3TUYC 2GGZA 1MWNA 1B1GA 4AR7A 4GNKB 5BPJA 2Q91A 4XJKA 2KAVA 2LHIA 1K93D 3EKJA 1Y6WA 1Q73A 2FCEA 2JC2A 1L2OC 4KEXA 2K7OA 2EHBA 4LW5A 1ZGQA 2JU0A 2GW4B 2KI4B 1XFWO 1ZGPA 3AI5A 4AOMA 1J7QA 2M1KB 1KQMC 5HW9A 3WCKA 1GGZA 2HETA 1Z1QA 3DVEA 3IP2A 1NSHA 1SW8A 2P6BB 4ORBB 2A54B 2H5OA 4I5LB 2DDDA 4I5JA 3O2PA 2AAOA 5D69A 5GQQC 1GQMA 4R1EA 3PJ5A 1B47A 3BUWB 1SR6C 2M49B 1M45A 3SV5A 3BXBA 2O29A 2LHLA 3DQ1A 1C4FA 3ST4A 2Y1NA 2H2KA 4ORNA 4GGNA 2HQ8A 4FQOA 2VVHA 1YVLA 3GEXA 3I5GC 1AJ5A 2OS8C 4W76A 1KP5A 2EMDA 4GGFC 3AAJA 4TNCA 1EMKA 2OTEA 2A47A 1OXEA 3DQ4A 2L51A 2DUEA 4M2PA 2M3WA 1PK0D 4PPKA 4HVFA 4LQUA 2QLHA 5I2LA 3OB1B 2KBIA 4W7DA 3OX5A 1DJZA 1ODBA 1QVIZ 2FZUA 1CFDA 1G4YR 4KF5C 1XFVO 1A03A 3CFAA 5FVFA 3SIAA 2ICRA 2F8PA 3WHTB 2LM5A 2QPTA 1KK7Y 4I5NB 4P2YB 2LP3A 3GK4X 1QIVA 2H61C 1KYSA 2AMIA 3I5FC 3M0WA 2KFHA 1YHGA 1ZACA 4MBEA 1EMGA 1XA5A 1NWDA 4QJ4B 3OGOA 2MAZA 3BOWB 1DMOA 4H48A 1UHJA 3I5HC 2F3ZA 1IRJA 3GOFA 1K8UA 3V3DA 1DJXA 2ZN8A 1EMFA 1RMMA 4WRIA 4PPLA 1ZUXA 3BUXB 4PHKA 3TS5B 2A50B 4XJKB 1B7TY 3UFZA 3EVVA 2G3DB 3E5TA 1GFLA 1ALWA 2HQZA 4W77A 3CWGA 2QZ0A 3U0LA 4W6FA 5BTTA 1XQMA 2HQWA 2AWJA 3LF4B 2MLFC 3PALA 2HFCA 1DGVA 2IS9A 1SL9A 5CSIA 1TCFA 4ICBA 3CFHA 2QRFA 2C9JA 1AJ4A 1G33A 1DF0A 2JTZA 5EXUA 1PULA 2Q57A 5AQBB 1PRWA 1RFJA 3RM1A 1S3PA 4W73A 1Z1PA 2JPTA 3BUOB 3ZNIA 4USLA 1F55A 3CGAA 4YI9A 1K2HA 2TN4A 1TN4A 2WISA 3SRYA 4W72A 1QXPA 1A29A 3HCMA 4H47A 1MOVA 1L7ZA 1SMGA 1QYFA 1NPQA 2LMVA 2MHHA 3SG2A 3BX9A 3AKBA 2JNXA 5CSFA 1Y1AA 2M8UA 3NSLA 3VRQA 1SCMC 3BXAA 4NDBA 2JULA 1YTZC 2L50A 1QASA 2Y1MA 1NX3A 2LAPA 2AWLA 4ZINA 3PSRA 4P1QA 1RM9A 2A4JA 1WRLA 5AERA 4JWQA 3DQ5A 5KU1A 1CM4A 2A53B 2DUIA 2LE9B 1B9CA 2I18A 4R6DA 2RH7A 4KF4A 1W7SA 5HZUA 2LV7A 2DUGA 4J8AA 2IOVA 1M39A 2OKWA 4EDOA 5HKYA 4WQ2A 2H8QA 5DY6A 3DQJA 1OXDA 3SJSA 4DKMA 4EMQA 3DQNA 5CSJA 5AEQA 1W7IB 1B9AA 3TZ1A 3CGLA 1X02A 1ZOTB 4MZJA 4YI8A 1SK6D 2EGDA 4RTCA 4W6LA 1SBJA 1UHKA 2YDZA 2JZIA 1YUUA 2K7BA 5D7FA 1Q80A 2DD7A 1YFPA 4N3DA 2JXCA 5BTTB 1BMOA 2JWWA 3ED8A 3D0YA 5HKWA 4ZB1A 1XK4C 2CBLA 3NEZA 1QV1A 1SR6B 1XFXO 1DF0B 2GGMA 3SSKA 5LTQA 3WXAA 1CFPA 1NCYA 2Z1OA 2A56B 3U8PA 4CFQA 3U8AA 3EK8A 2BTJA 2BE6A 2ZNDA 4ZF3A 5DPHA 2F2PA 1Y1XA 1F8HA 1M63B 2MBXA 4Q9XA 3VICA 4C0LA 3AKOA 2B3QA 3WHUB 3DQLA 4DCKA 4HSZA 1HT9A 1KWOC 2P4MA 2VAEA 1CTRA 1CNPA 1BU3A 4DXMA 5JOLA 2L98A 2LLTA 3M22A 2PASA 2E6WA 3LK1A 3CR4X 1V1GA 2KBMA 1SL8A 3SG3A 1VRKA 2DDCA 4W6NA 4Z4MA 1BT6A 1ZUZA 1F70A 1IQ3A 1KSMA 4H3NA 2BE4A 4W7EA 3JTDC 1ZFSA 2HGYA 2BKIB 1QJTA 3EVUA 1RWYA 4EULA 2BKHB 2NZ0A 2I7AA 1UWOA 3IF7A 4OCIA 2M29A 1RJVA 2JXLA 4W6UA 5H88A 3KHEA 3SG6A 4HQ8A 3P8UA 1CM1A 1MYWA 4JPZB 1UURA 1XFUO 1XYDA 4P5OE 2JT0A 4JF9A 2NCPA 1F4QA 1XFYO 3IR8A 5FHVA 1CKKA 4KGFA 3ST0A 1AHRA 1GJYA 1XA9A 1CLMA 1AUIB 1NX1A 1KYRA 2V4EA 4NQGA 3SSVA 2FWQA 4MZLA 4N5XA 3TDUA 2BBNA 4JFGA 2WNDA 1SY9A 1K9UA 2H6VA 2POXA 1YURA 2I2RE 5FVGA 1WLZA 4Q7RA 4KGEA 2HGDA 2DUFA 2YE0A 1BOCA 1S26D 2VZXA 1UHHA 3BOWA 3CZTX 3RWAA 3TMTA 1EH2A 3OSRA 1IGVA 2Z6ZA 3EK7A 2QLIA 1F0BA 2JOJA 3DQMA 3O6BA 4B30A 4A4BA 1Q4CA 1AP4A 2I94A 4DXPA 5B8IB 2MLEC 2LP2A 4W6JA 1K95A 4JEOA 4PHJA 3OP0A 3U0NA 3CFFA 1KSOA 3VHTA 1ZGOA 2HRSA 5ER4X 4H3LA 3EVRA 4ZCUA 2NXQA 2SASA 3DF0A 1JFKA 1B7TZ 4W6HA 2NCOA 2YFPA 1JSAA 4DXOA 2HQKA 3PN7B 1QX2A 2L5XB 1A75A 1W7JB 4MLWA 2K7CA 4N1FA 3FIAA 4J89A 1S6JA 3DQ8A 2AH8A 3VRNA 1J1EA 2Q4UA 1YR5A 2LVKA 3LA1A 3SVBA 2D8NA 1H4BA 2WCBA 3O78A 4EN1A 1S36A 4BY4A 2B1UA 3ZTFA 2LC5A 1SRAA 1B8RA 2L2EA 1OSAA 4W7XA 3AKAA 2F2OA 4XVPA 1YZWA 3RLZA 1KK8C 1IJ5A 2A52B 2OKYA 3MSEB 4JQ0D 3SVSA 3DVKA 1GGXA 4CLNA 2G2SB 3WLCA 1TOPA 2JTTA 1JC0A 4PHMA 5LK4A 4IK8A 1EL4A 1YX8A 3HX4A 2V4EB 2JT8A 4GAOA 3DQFA 3LF3A 1A2XA 1LXFC 1YHIA 2KYFA 2Y0GA 1MXLC 1Y1UA 2LMUA 5DKNA 3E3RA 1IKUA 3H1RA 3SIBA 3DQIA 5DQBA 4PCWA 1D1OA 5HZOA 4LJDC 3NXAA 1NYAA 2KYCA 3SSTA 1YVHA 1SPYA 4Q7UA 1J1DA 4PDZA 3I5IC 4B30B 1GL4A 3ZULA 4ETOA 4M2OA 4H3MA 2O60A 3DQ2A 2V53A 4JRBA 2LVJA 1YJ2A 3JVTB 1TNPA 4KA9A 3VHTB 2OTGC 1UHIA 3ZUJA 1OZOA 2KQYA 2BECA 4QJ5B 3DF0B 5DPIA 3DQ7A 3U0KA 1WDCB 3PLFB 2BL0B 1MF8B 2F33A 2EC6C 4MN0A 2M9GA 1J7RA 2CNPA 5AANA 3IQQA 4W6MA 4GGFA 1A75B 4TZAA 4XYNA 3DQ3A 2WOSA 1YRTB 4HRHA 3SSYA 2PVBA 2QU1A 3ZUFA 5EHUA 1LA0A 4CFRA 3LS3A 1IQ5A 5IBWA 2HCGA 2KGRA 4MEWA 1IJ6A 1CFFA 1WY9A 2KI4C 1ZMZA 1NP8A 1N65A 4OGSA 2O5GA 1Q4EA 5EJUA 1EMBA 1BJFA 3DQOA 2H61A 2KDHA 1J55A 1EMMA 4ANJA 4AQJA 3E5VA 1CDPA 1XSSA 2KHNA 5J3XA 5DTLA 1DJWA 1AK8A 4C0JA 1OMDA 4OHSA 3NT9A 4PE0A 4IZNA 2Y5IA 3DQHA 4KW8A 3NT3A 3TUYB 3H1OA 5CPVA 2H9WA 1DJHA 3WNXB 3SG7A 1NX2A 1R2UA 1GGWA 2KI6D 1NIWA 3PFVA 3FS7A 2LVIA 1L2OB 4GUKA 1TNXA 1YRUB 5HKZA 1SCVA 1OOJA 4WQ3A 2JRFA 2G3OA 1U5IA 4W6PA 3CR5X 4GBAA 1KQMB 3H4SE 3SVRA 1YJFA 1YUSA 2G6XA 4MVFA 1RRXA 2L0PA 4UTSA 2PXWA 2G6EA 4Q9WA 1PVBA 5PALA 1DVIA 1DJYA 2WIQA 3F45A 3CB9A 1Y0VH 5EBJA 1QLSA 1KFXL 1K96A 3EK4A 2AUCA 4W6SA 2M7NA 5AXIA 2PRUA 4YBHB 2BCXA 2LLUA 1QYQA 2WURA 3I5GB 2FCDA 2OS8B 1M46A 1UISA 4W7RA 3W1CA 4LQTA 3KCSA 4DRWA 4PE1A 5DTXA 4UPGA 2ZO6A 3DPZA 1TCOB 4ZCVA 2ZFDA 3DQ9A 2O2BA 5HYDA 3DPWA 1MXEA 2L4IA 1XAEA 4PE7A 3TS5C 4MRYA 5DKQA 1W7TA 4D1EA 1EJ3A 2JADA 5JJGA 1RROA 1QS7A 4W6GA 1FI5A 1EG3A 4XOVA 3C1VA 1FI6A 1DJIA 1IG5A 1LA3A 1V1FA 4W6BA 2LCPA 1S5GY 3TMRA 1KYPA 4L12A 2E30A 3OX6A 3SS0A 3BQ3A 1BF5A 1AVSA 1S6CA 4FTGA 4I5KA 1WRKA 1QLKA 3I5FB 2MRDA 2ZMUA 1F71A 3SSPA 3SVOA 2KI6C 1BODA 2AHAA 3PM8A 2BCAA 3I5HB 4NDDA 3BYAA 2PXSA 5LTPA 3U0MA 3VK1A 3RWTA 4DS7A 5EB6A 2WHTA 5H87A 3ICBA 1QTXA 1FPWA 5DRFA 1UHNA 1K9KA 1CDNA 1B8LA 1QYOA 1QIWA 3K21A 1TNWA 1RMOA 4OQWA 1WLMA 1U5IB 2EMOA 1TNQA 2H5QA 3PJ7A 1FF1A 4CIDA 3BXCA 3SVUA 3E5WA 1OE9B 2G5ZB 1XK4A 5KTGA 1RECA 5KTYA 3CR2A 3VROA 2KGBC 2KAYA 1C7WA 1F54A 2Q6PA 4W6AA 2KQ6A 2OPOA 3DVMA 1HQVA 2COLB 3DD4A 1K9PA 4EDSA 2QLEA 1K90D 5KSZA 1KK7Z 3NEDA 2DUHA 1KFXS 1PSBA 2QLGA 3A4UB 4GESB 2HJOA 3IQOA 1DJGA 4ORAB 2CXJA 1CV7A 1JBAA 1OXFA 1BR4B 2LUXA 5F9GA 4NDCA 3UG0A 3M24A 3DQ6A 3TDZA 1SCMB 4YGEB 1FBVA 4MSPA 1HCJA 2WSNA 4Q7TA 3LVAA 2C9IA 3W1DA 3FWCA 2G2BA 1NCZA 1TTXA 2FOTA 4IK9A 1B4CA 1BLQA 2G9BA 3U8CA 4HQ9A 2A48A 1JF0A 2KNEA 2KFFA 3VGOA 3AI4A 4DXIA 4PHNA 1JC2A 1DTLA 5I8NA 4JGEA 3TDIA 4OKHA 5DTZA 2FL1A 2GW3A 3BUMB 2MA2A 1Q4BA 1NX0A 1OMVA 1Q4DA 4XL5A 3ST2A 1QX7A 4N1GA 2KSPA 4E68A 2K2FA 4YGAA 1EMLA 1H4UA 2AWKA 1BFPA 2ZNEA 1F09A 5BT0A 2VVJA 4IK5A 3O4YA 4KW4A 1YX7A 4A4CA 1CFCA 4P76A 1F4OA 4YGDB 5BQLA 2VADA 4W69A 3ZWHA 2ZMWA 1IWQA 4C0KA 2Y4QA 3DQDA 5H89A 3OB2B 2VVIA 3SVNA 4CPVA 4LJCA 3NF0A 2Z6XA 3DQUA 2MJWB 3LVDA 4IK3A 5HLOA 1H6RA 5K89A 2AWMA 2OJKA 4ZF4A 4KPIA 3OSQA 4HQCA 5DPJA 5ER5A 1CMGA 2H5PA 4BDUA 1JWDA 2IB5A 2PALA 3DPXA 3KCTA 5AFPA 2PMYA 3CD1A 3K1KA 4OV2A 5DPGA 4PALA 5DKRA 2G16B 5CSNA 2QLGB 1KWOB 3FWBA 1JFJA 4J88A 4U8DA 4RYSA 4YRUA 1FW4A 1G8IA 4MRXA 1QATA 2ZKMX 2WCFA 4W7FA 1C7VA 2EMNA 3P28A 2SCPA 4GPLB 2OTBA 3GL4A 2LUCA 1JF2A 5I2OA 3GJ2A 2JQ6A 1QY3A 3PJBA 1MHOA 3JTDB 2WCEA 2ZRSA 3DQCA 2K0JA 4OR9B 4B5YA 4U2VA 4GOBA 2WORA 2WSOA 2O24A 4GF6B 1RMPA 1CMFA 1EXRA 2FJUB 4F0ZB 1CLBA 1CLLA 1HUYA 1KFUL 1MQ1A 3NSOA 1RTP1 1XFZO 3NSKA 3LLEA 2VRGA 4HRGA 4Z4KA 2M97A 4ZIOA 1S6IA 1E8AA 5HBDA 4IK1A 3GB3A 5LTRA 1SYMA 4W74A 1CDLA 3ST3A 1N2DA 2ARLA 2LNKA 5EB7A 4KW9A 5HGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KF5 A;  2A46 A;  4W75 A;  2IB6 A;  1OQP A;  4ZBL A;  4NWS A;  2CT9 A;  4QJ3 B;  4DXN A;  1EG4 A;  3LSA A;  2H5R A;  4W7C A;  1QVI Y;  1M31 A;  3LK0 A;  4HRE E;  3GK1 A;  4LJD A;  2JNF A;  5EXB A;  1PVA A;  3KO0 A;  2ZRT A;  3G9A A;  1TIZ A;  3PN7 C;  2DD9 A;  1S5G Z;  4W6I A;  1XO5 A;  4AQI A;  1LIN A;  3SVC A;  1QX5 B;  4M2Q A;  4DKN A;  2R2I A;  2KFG A;  4W6K A;  2DOQ A;  5DU0 A;  4PE4 A;  2K2A A;  1J7P A;  5HZT A;  3CTN A;  2WHU A;  1LKJ A;  4W6C A;  1G7K A;  1DT7 B;  3KEV A;  2BCB A;  1EMC A;  3VRP A;  1K94 A;  2NLN A;  3DQK A;  3LL8 B;  1XVJ A;  1S6Z A;  1PSR A;  1KQV A;  3SSL A;  1C07 A;  1CB1 A;  5HLV A;  1IH0 A;  5FVI A;  3OHM B;  3CD9 A;  2M1U A;  1ALV A;  4DXQ A;  3EKH A;  1Q4A A;  5F6T A;  4DIR A;  2LLS A;  4L1I A;  2V4E C;  1OZS A;  3CS1 A;  1TRF A;  1JC1 A;  2HPS A;  3DQE A;  3SVE A;  1CDM A;  4MZK A;  4LJB A;  4ZF5 A;  2M7L A;  4Q04 A;  1EME A;  2JT3 A;  1SNL A;  4AS8 A;  4ZFS A;  3GK2 A;  4HE4 A;  1W7U A;  3SSH A;  2PSR A;  1EMA A;  1UP5 A;  1BR1 B;  5I2Q A;  1JBZ A;  2Z6Y A;  4YGB B;  4DUQ A;  1QV0 A;  3DVJ A;  3LVC A;  3QRX A;  3I19 A;  1S1E A;  4OJ0 A;  1KFU S;  4L13 A;  3A8R A;  2HF5 A;  2LAN A;  1KK8 B;  1MUX A;  3O77 A;  3KF9 A;  2K61 A;  2WC8 A;  2WHS A;  4L9M A;  4PFE A;  4YGC B;  2QAC A;  5T3I A;  1OMR A;  1WRZ A;  3JVT C;  1R6P A;  3PAT A;  1QXT A;  3CLN A;  4OVN F;  2HPW A;  4IL1 A;  3SG5 A;  1JUO A;  1JBY A;  4JC2 A;  1NCX A;  3SVD A;  1H8B A;  4TZG A;  4R6B A;  5TNC A;  1KCY A;  3VRR A;  1WDC C;  2BL0 C;  4W6R A;  4OY4 A;  3LCP C;  2GV5 A;  3PIB A;  2ZN9 A;  4GFT A;  2GX2 A;  3DQA A;  2KAX A;  2RGI A;  2BBM A;  5J2O A;  1A4P A;  2CCM A;  3EVP A;  3I5I B;  1BG1 A;  4XGY A;  1N0Y A;  1PAL A;  4RYW A;  5HZS A;  4ORC B;  5EXC I;  1LVC D;  5FYX A;  3CBE A;  2K7D A;  4PPJ A;  3KPX A;  2IE2 A;  2KOT A;  5DRG A;  2LVV A;  3D10 A;  2M0R A;  2OTG B;  4W7A A;  2G6Y A;  2L4H A;  1XMZ A;  3SG4 A;  5DTY A;  1B8C A;  2ISD A;  2ZO7 A;  3BUN B;  3WLD A;  1MR8 A;  3ADF A;  2F3Y A;  4KAG A;  2GX0 A;  3A8S A;  4W6D A;  3GJ1 A;  1YHH A;  1SKT A;  1UUS A;  4XOW A;  3MGF A;  3NSI A;  1SL7 A;  2EC6 B;  5DQM A;  2QT2 A;  3AAK A;  2K8M B;  1NUB A;  5G08 A;  4W6T A;  2OGR A;  2LMT A;  2B3P A;  4I2Y A;  4W6O A;  1DGU A;  2CTN A;  4IK4 A;  2YE1 A;  1YUT A;  3BXK A;  1MOU A;  1RK9 A;  4BY5 A;  1J7O A;  3S05 A;  3D0Y B;  3TUY C;  2GGZ A;  1MWN A;  1B1G A;  4AR7 A;  4GNK B;  5BPJ A;  2Q91 A;  4XJK A;  2KAV A;  2LHI A;  1K93 D;  3EKJ A;  1Y6W A;  1Q73 A;  2FCE A;  2JC2 A;  1L2O C;  4KEX A;  2K7O A;  2EHB A;  4LW5 A;  1ZGQ A;  2JU0 A;  2GW4 B;  2KI4 B;  1XFW O;  1ZGP A;  3AI5 A;  4AOM A;  1J7Q A;  2M1K B;  1KQM C;  5HW9 A;  3WCK A;  1GGZ A;  2HET A;  1Z1Q A;  3DVE A;  3IP2 A;  1NSH A;  1SW8 A;  2P6B B;  4ORB B;  2A54 B;  2H5O A;  4I5L B;  2DDD A;  4I5J A;  3O2P A;  2AAO A;  5D69 A;  5GQQ C;  1GQM A;  4R1E A;  3PJ5 A;  1B47 A;  3BUW B;  1SR6 C;  2M49 B;  1M45 A;  3SV5 A;  3BXB A;  2O29 A;  2LHL A;  3DQ1 A;  1C4F A;  3ST4 A;  2Y1N A;  2H2K A;  4ORN A;  4GGN A;  2HQ8 A;  4FQO A;  2VVH A;  1YVL A;  3GEX A;  3I5G C;  1AJ5 A;  2OS8 C;  4W76 A;  1KP5 A;  2EMD A;  4GGF C;  3AAJ A;  4TNC A;  1EMK A;  2OTE A;  2A47 A;  1OXE A;  3DQ4 A;  2L51 A;  2DUE A;  4M2P A;  2M3W A;  1PK0 D;  4PPK A;  4HVF A;  4LQU A;  2QLH A;  5I2L A;  3OB1 B;  2KBI A;  4W7D A;  3OX5 A;  1DJZ A;  1ODB A;  1QVI Z;  2FZU A;  1CFD A;  1G4Y R;  4KF5 C;  1XFV O;  1A03 A;  3CFA A;  5FVF A;  3SIA A;  2ICR A;  2F8P A;  3WHT B;  2LM5 A;  2QPT A;  1KK7 Y;  4I5N B;  4P2Y B;  2LP3 A;  3GK4 X;  1QIV A;  2H61 C;  1KYS A;  2AMI A;  3I5F C;  3M0W A;  2KFH A;  1YHG A;  1ZAC A;  4MBE A;  1EMG A;  1XA5 A;  1NWD A;  4QJ4 B;  3OGO A;  2MAZ A;  3BOW B;  1DMO A;  4H48 A;  1UHJ A;  3I5H C;  2F3Z A;  1IRJ A;  3GOF A;  1K8U A;  3V3D A;  1DJX A;  2ZN8 A;  1EMF A;  1RMM A;  4WRI A;  4PPL A;  1ZUX A;  3BUX B;  4PHK A;  3TS5 B;  2A50 B;  4XJK B;  1B7T Y;  3UFZ A;  3EVV A;  2G3D B;  3E5T A;  1GFL A;  1ALW A;  2HQZ A;  4W77 A;  3CWG A;  2QZ0 A;  3U0L A;  4W6F A;  5BTT A;  1XQM A;  2HQW A;  2AWJ A;  3LF4 B;  2MLF C;  3PAL A;  2HFC A;  1DGV A;  2IS9 A;  1SL9 A;  5CSI A;  1TCF A;  4ICB A;  3CFH A;  2QRF A;  2C9J A;  1AJ4 A;  1G33 A;  1DF0 A;  2JTZ A;  5EXU A;  1PUL A;  2Q57 A;  5AQB B;  1PRW A;  1RFJ A;  3RM1 A;  1S3P A;  4W73 A;  1Z1P A;  2JPT A;  3BUO B;  3ZNI A;  4USL A;  1F55 A;  3CGA A;  4YI9 A;  1K2H A;  2TN4 A;  1TN4 A;  2WIS A;  3SRY A;  4W72 A;  1QXP A;  1A29 A;  3HCM A;  4H47 A;  1MOV A;  1L7Z A;  1SMG A;  1QYF A;  1NPQ A;  2LMV A;  2MHH A;  3SG2 A;  3BX9 A;  3AKB A;  2JNX A;  5CSF A;  1Y1A A;  2M8U A;  3NSL A;  3VRQ A;  1SCM C;  3BXA A;  4NDB A;  2JUL A;  1YTZ C;  2L50 A;  1QAS A;  2Y1M A;  1NX3 A;  2LAP A;  2AWL A;  4ZIN A;  3PSR A;  4P1Q A;  1RM9 A;  2A4J A;  1WRL A;  5AER A;  4JWQ A;  3DQ5 A;  5KU1 A;  1CM4 A;  2A53 B;  2DUI A;  2LE9 B;  1B9C A;  2I18 A;  4R6D A;  2RH7 A;  4KF4 A;  1W7S A;  5HZU A;  2LV7 A;  2DUG A;  4J8A A;  2IOV A;  1M39 A;  2OKW A;  4EDO A;  5HKY A;  4WQ2 A;  2H8Q A;  5DY6 A;  3DQJ A;  1OXD A;  3SJS A;  4DKM A;  4EMQ A;  3DQN A;  5CSJ A;  5AEQ A;  1W7I B;  1B9A A;  3TZ1 A;  3CGL A;  1X02 A;  1ZOT B;  4MZJ A;  4YI8 A;  1SK6 D;  2EGD A;  4RTC A;  4W6L A;  1SBJ A;  1UHK A;  2YDZ A;  2JZI A;  1YUU A;  2K7B A;  5D7F A;  1Q80 A;  2DD7 A;  1YFP A;  4N3D A;  2JXC A;  5BTT B;  1BMO A;  2JWW A;  3ED8 A;  3D0Y A;  5HKW A;  4ZB1 A;  1XK4 C;  2CBL A;  3NEZ A;  1QV1 A;  1SR6 B;  1XFX O;  1DF0 B;  2GGM A;  3SSK A;  5LTQ A;  3WXA A;  1CFP A;  1NCY A;  2Z1O A;  2A56 B;  3U8P A;  4CFQ A;  3U8A A;  3EK8 A;  2BTJ A;  2BE6 A;  2ZND A;  4ZF3 A;  5DPH A;  2F2P A;  1Y1X A;  1F8H A;  1M63 B;  2MBX A;  4Q9X A;  3VIC A;  4C0L A;  3AKO A;  2B3Q A;  3WHU B;  3DQL A;  4DCK A;  4HSZ A;  1HT9 A;  1KWO C;  2P4M A;  2VAE A;  1CTR A;  1CNP A;  1BU3 A;  4DXM A;  5JOL A;  2L98 A;  2LLT A;  3M22 A;  2PAS A;  2E6W A;  3LK1 A;  3CR4 X;  1V1G A;  2KBM A;  1SL8 A;  3SG3 A;  1VRK A;  2DDC A;  4W6N A;  4Z4M A;  1BT6 A;  1ZUZ A;  1F70 A;  1IQ3 A;  1KSM A;  4H3N A;  2BE4 A;  4W7E A;  3JTD C;  1ZFS A;  2HGY A;  2BKI B;  1QJT A;  3EVU A;  1RWY A;  4EUL A;  2BKH B;  2NZ0 A;  2I7A A;  1UWO A;  3IF7 A;  4OCI A;  2M29 A;  1RJV A;  2JXL A;  4W6U A;  5H88 A;  3KHE A;  3SG6 A;  4HQ8 A;  3P8U A;  1CM1 A;  1MYW A;  4JPZ B;  1UUR A;  1XFU O;  1XYD A;  4P5O E;  2JT0 A;  4JF9 A;  2NCP A;  1F4Q A;  1XFY O;  3IR8 A;  5FHV A;  1CKK A;  4KGF A;  3ST0 A;  1AHR A;  1GJY A;  1XA9 A;  1CLM A;  1AUI B;  1NX1 A;  1KYR A;  2V4E A;  4NQG A;  3SSV A;  2FWQ A;  4MZL A;  4N5X A;  3TDU A;  2BBN A;  4JFG A;  2WND A;  1SY9 A;  1K9U A;  2H6V A;  2POX A;  1YUR A;  2I2R E;  5FVG A;  1WLZ A;  4Q7R A;  4KGE A;  2HGD A;  2DUF A;  2YE0 A;  1BOC A;  1S26 D;  2VZX A;  1UHH A;  3BOW A;  3CZT X;  3RWA A;  3TMT A;  1EH2 A;  3OSR A;  1IGV A;  2Z6Z A;  3EK7 A;  2QLI A;  1F0B A;  2JOJ A;  3DQM A;  3O6B A;  4B30 A;  4A4B A;  1Q4C A;  1AP4 A;  2I94 A;  4DXP A;  5B8I B;  2MLE C;  2LP2 A;  4W6J A;  1K95 A;  4JEO A;  4PHJ A;  3OP0 A;  3U0N A;  3CFF A;  1KSO A;  3VHT A;  1ZGO A;  2HRS A;  5ER4 X;  4H3L A;  3EVR A;  4ZCU A;  2NXQ A;  2SAS A;  3DF0 A;  1JFK A;  1B7T Z;  4W6H A;  2NCO A;  2YFP A;  1JSA A;  4DXO A;  2HQK A;  3PN7 B;  1QX2 A;  2L5X B;  1A75 A;  1W7J B;  4MLW A;  2K7C A;  4N1F A;  3FIA A;  4J89 A;  1S6J A;  3DQ8 A;  2AH8 A;  3VRN A;  1J1E A;  2Q4U A;  1YR5 A;  2LVK A;  3LA1 A;  3SVB A;  2D8N A;  1H4B A;  2WCB A;  3O78 A;  4EN1 A;  1S36 A;  4BY4 A;  2B1U A;  3ZTF A;  2LC5 A;  1SRA A;  1B8R A;  2L2E A;  1OSA A;  4W7X A;  3AKA A;  2F2O A;  4XVP A;  1YZW A;  3RLZ A;  1KK8 C;  1IJ5 A;  2A52 B;  2OKY A;  3MSE B;  4JQ0 D;  3SVS A;  3DVK A;  1GGX A;  4CLN A;  2G2S B;  3WLC A;  1TOP A;  2JTT A;  1JC0 A;  4PHM A;  5LK4 A;  4IK8 A;  1EL4 A;  1YX8 A;  3HX4 A;  2V4E B;  2JT8 A;  4GAO A;  3DQF A;  3LF3 A;  1A2X A;  1LXF C;  1YHI A;  2KYF A;  2Y0G A;  1MXL C;  1Y1U A;  2LMU A;  5DKN A;  3E3R A;  1IKU A;  3H1R A;  3SIB A;  3DQI A;  5DQB A;  4PCW A;  1D1O A;  5HZO A;  4LJD C;  3NXA A;  1NYA A;  2KYC A;  3SST A;  1YVH A;  1SPY A;  4Q7U A;  1J1D A;  4PDZ A;  3I5I C;  4B30 B;  1GL4 A;  3ZUL A;  4ETO A;  4M2O A;  4H3M A;  2O60 A;  3DQ2 A;  2V53 A;  4JRB A;  2LVJ A;  1YJ2 A;  3JVT B;  1TNP A;  4KA9 A;  3VHT B;  2OTG C;  1UHI A;  3ZUJ A;  1OZO A;  2KQY A;  2BEC A;  4QJ5 B;  3DF0 B;  5DPI A;  3DQ7 A;  3U0K A;  1WDC B;  3PLF B;  2BL0 B;  1MF8 B;  2F33 A;  2EC6 C;  4MN0 A;  2M9G A;  1J7R A;  2CNP A;  5AAN A;  3IQQ A;  4W6M A;  4GGF A;  1A75 B;  4TZA A;  4XYN A;  3DQ3 A;  2WOS A;  1YRT B;  4HRH A;  3SSY A;  2PVB A;  2QU1 A;  3ZUF A;  5EHU A;  1LA0 A;  4CFR A;  3LS3 A;  1IQ5 A;  5IBW A;  2HCG A;  2KGR A;  4MEW A;  1IJ6 A;  1CFF A;  1WY9 A;  2KI4 C;  1ZMZ A;  1NP8 A;  1N65 A;  4OGS A;  2O5G A;  1Q4E A;  5EJU A;  1EMB A;  1BJF A;  3DQO A;  2H61 A;  2KDH A;  1J55 A;  1EMM A;  4ANJ A;  4AQJ A;  3E5V A;  1CDP A;  1XSS A;  2KHN A;  5J3X A;  5DTL A;  1DJW A;  1AK8 A;  4C0J A;  1OMD A;  4OHS A;  3NT9 A;  4PE0 A;  4IZN A;  2Y5I A;  3DQH A;  4KW8 A;  3NT3 A;  3TUY B;  3H1O A;  5CPV A;  2H9W A;  1DJH A;  3WNX B;  3SG7 A;  1NX2 A;  1R2U A;  1GGW A;  2KI6 D;  1NIW A;  3PFV A;  3FS7 A;  2LVI A;  1L2O B;  4GUK A;  1TNX A;  1YRU B;  5HKZ A;  1SCV A;  1OOJ A;  4WQ3 A;  2JRF A;  2G3O A;  1U5I A;  4W6P A;  3CR5 X;  4GBA A;  1KQM B;  3H4S E;  3SVR A;  1YJF A;  1YUS A;  2G6X A;  4MVF A;  1RRX A;  2L0P A;  4UTS A;  2PXW A;  2G6E A;  4Q9W A;  1PVB A;  5PAL A;  1DVI A;  1DJY A;  2WIQ A;  3F45 A;  3CB9 A;  1Y0V H;  5EBJ A;  1QLS A;  1KFX L;  1K96 A;  3EK4 A;  2AUC A;  4W6S A;  2M7N A;  5AXI A;  2PRU A;  4YBH B;  2BCX A;  2LLU A;  1QYQ A;  2WUR A;  3I5G B;  2FCD A;  2OS8 B;  1M46 A;  1UIS A;  4W7R A;  3W1C A;  4LQT A;  3KCS A;  4DRW A;  4PE1 A;  5DTX A;  4UPG A;  2ZO6 A;  3DPZ A;  1TCO B;  4ZCV A;  2ZFD A;  3DQ9 A;  2O2B A;  5HYD A;  3DPW A;  1MXE A;  2L4I A;  1XAE A;  4PE7 A;  3TS5 C;  4MRY A;  5DKQ A;  1W7T A;  4D1E A;  1EJ3 A;  2JAD A;  5JJG A;  1RRO A;  1QS7 A;  4W6G A;  1FI5 A;  1EG3 A;  4XOV A;  3C1V A;  1FI6 A;  1DJI A;  1IG5 A;  1LA3 A;  1V1F A;  4W6B A;  2LCP A;  1S5G Y;  3TMR A;  1KYP A;  4L12 A;  2E30 A;  3OX6 A;  3SS0 A;  3BQ3 A;  1BF5 A;  1AVS A;  1S6C A;  4FTG A;  4I5K A;  1WRK A;  1QLK A;  3I5F B;  2MRD A;  2ZMU A;  1F71 A;  3SSP A;  3SVO A;  2KI6 C;  1BOD A;  2AHA A;  3PM8 A;  2BCA A;  3I5H B;  4NDD A;  3BYA A;  2PXS A;  5LTP A;  3U0M A;  3VK1 A;  3RWT A;  4DS7 A;  5EB6 A;  2WHT A;  5H87 A;  3ICB A;  1QTX A;  1FPW A;  5DRF A;  1UHN A;  1K9K A;  1CDN A;  1B8L A;  1QYO A;  1QIW A;  3K21 A;  1TNW A;  1RMO A;  4OQW A;  1WLM A;  1U5I B;  2EMO A;  1TNQ A;  2H5Q A;  3PJ7 A;  1FF1 A;  4CID A;  3BXC A;  3SVU A;  3E5W A;  1OE9 B;  2G5Z B;  1XK4 A;  5KTG A;  1REC A;  5KTY A;  3CR2 A;  3VRO A;  2KGB C;  2KAY A;  1C7W A;  1F54 A;  2Q6P A;  4W6A A;  2KQ6 A;  2OPO A;  3DVM A;  1HQV A;  2COL B;  3DD4 A;  1K9P A;  4EDS A;  2QLE A;  1K90 D;  5KSZ A;  1KK7 Z;  3NED A;  2DUH A;  1KFX S;  1PSB A;  2QLG A;  3A4U B;  4GES B;  2HJO A;  3IQO A;  1DJG A;  4ORA B;  2CXJ A;  1CV7 A;  1JBA A;  1OXF A;  1BR4 B;  2LUX A;  5F9G A;  4NDC A;  3UG0 A;  3M24 A;  3DQ6 A;  3TDZ A;  1SCM B;  4YGE B;  1FBV A;  4MSP A;  1HCJ A;  2WSN A;  4Q7T A;  3LVA A;  2C9I A;  3W1D A;  3FWC A;  2G2B A;  1NCZ A;  1TTX A;  2FOT A;  4IK9 A;  1B4C A;  1BLQ A;  2G9B A;  3U8C A;  4HQ9 A;  2A48 A;  1JF0 A;  2KNE A;  2KFF A;  3VGO A;  3AI4 A;  4DXI A;  4PHN A;  1JC2 A;  1DTL A;  5I8N A;  4JGE A;  3TDI A;  4OKH A;  5DTZ A;  2FL1 A;  2GW3 A;  3BUM B;  2MA2 A;  1Q4B A;  1NX0 A;  1OMV A;  1Q4D A;  4XL5 A;  3ST2 A;  1QX7 A;  4N1G A;  2KSP A;  4E68 A;  2K2F A;  4YGA A;  1EML A;  1H4U A;  2AWK A;  1BFP A;  2ZNE A;  1F09 A;  5BT0 A;  2VVJ A;  4IK5 A;  3O4Y A;  4KW4 A;  1YX7 A;  4A4C A;  1CFC A;  4P76 A;  1F4O A;  4YGD B;  5BQL A;  2VAD A;  4W69 A;  3ZWH A;  2ZMW A;  1IWQ A;  4C0K A;  2Y4Q A;  3DQD A;  5H89 A;  3OB2 B;  2VVI A;  3SVN A;  4CPV A;  4LJC A;  3NF0 A;  2Z6X A;  3DQU A;  2MJW B;  3LVD A;  4IK3 A;  5HLO A;  1H6R A;  5K89 A;  2AWM A;  2OJK A;  4ZF4 A;  4KPI A;  3OSQ A;  4HQC A;  5DPJ A;  5ER5 A;  1CMG A;  2H5P A;  4BDU A;  1JWD A;  2IB5 A;  2PAL A;  3DPX A;  3KCT A;  5AFP A;  2PMY A;  3CD1 A;  3K1K A;  4OV2 A;  5DPG A;  4PAL A;  5DKR A;  2G16 B;  5CSN A;  2QLG B;  1KWO B;  3FWB A;  1JFJ A;  4J88 A;  4U8D A;  4RYS A;  4YRU A;  1FW4 A;  1G8I A;  4MRX A;  1QAT A;  2ZKM X;  2WCF A;  4W7F A;  1C7V A;  2EMN A;  3P28 A;  2SCP A;  4GPL B;  2OTB A;  3GL4 A;  2LUC A;  1JF2 A;  5I2O A;  3GJ2 A;  2JQ6 A;  1QY3 A;  3PJB A;  1MHO A;  3JTD B;  2WCE A;  2ZRS A;  3DQC A;  2K0J A;  4OR9 B;  4B5Y A;  4U2V A;  4GOB A;  2WOR A;  2WSO A;  2O24 A;  4GF6 B;  1RMP A;  1CMF A;  1EXR A;  2FJU B;  4F0Z B;  1CLB A;  1CLL A;  1HUY A;  1KFU L;  1MQ1 A;  3NSO A;  1RTP 1;  1XFZ O;  3NSK A;  3LLE A;  2VRG A;  4HRG A;  4Z4K A;  2M97 A;  4ZIO A;  1S6I A;  1E8A A;  5HBD A;  4IK1 A;  3GB3 A;  5LTR A;  1SYM A;  4W74 A;  1CDL A;  3ST3 A;  1N2D A;  2ARL A;  2LNK A;  5EB7 A;  4KW9 A;  5HGE A; 
#chains in the Genus database with same CATH topology
 4KF5 A;  2A46 A;  4W75 A;  2IB6 A;  3FE8 A;  1OQP A;  4ZBL A;  4NWS A;  2CT9 A;  4QJ3 B;  4DXN A;  1EG4 A;  3LSA A;  2H5R A;  4W7C A;  1QVI Y;  1M31 A;  3LK0 A;  4HRE E;  3GK1 A;  4LJD A;  2JNF A;  5EXB A;  1PVA A;  3KO0 A;  2ZRT A;  3G9A A;  1TIZ A;  3PN7 C;  2DD9 A;  1S5G Z;  4W6I A;  1XO5 A;  5FI7 A;  4AQI A;  1LIN A;  3SVC A;  1QX5 B;  4M2Q A;  4DKN A;  2R2I A;  2KFG A;  4KYN A;  4W6K A;  2DOQ A;  5DU0 A;  2WCM A;  4PE4 A;  2K2A A;  1J7P A;  5HZT A;  3CTN A;  2WHU A;  1LKJ A;  3N7H A;  4W6C A;  1G7K A;  1DT7 B;  3KEV A;  2BCB A;  1EMC A;  3VRP A;  1K94 A;  2NLN A;  3DQK A;  3LL8 B;  1XVJ A;  1S6Z A;  1PSR A;  2L2C A;  3B87 A;  1KQV A;  3S0B A;  3OBV A;  3SSL A;  1C07 A;  1CB1 A;  5HLV A;  1IH0 A;  5FVI A;  3OHM B;  3CD9 A;  2M1U A;  1ALV A;  4DXQ A;  3EKH A;  1Q4A A;  5F6T A;  4DIR A;  2LLS A;  4L1I A;  2V4E C;  1OZS A;  3CS1 A;  1TRF A;  1JC1 A;  2HPS A;  4INW A;  3DQE A;  3SVE A;  1CDM A;  4MZK A;  4LJB A;  3Q8I A;  4ZF5 A;  2M7L A;  4Q04 A;  1EME A;  2JT3 A;  1SNL A;  4AS8 A;  4ZFS A;  3GK2 A;  4HE4 A;  1W7U A;  3SSH A;  3L47 A;  2PSR A;  1EMA A;  1UP5 A;  3NHI A;  1BR1 B;  5I2Q A;  1JBZ A;  2Z6Y A;  4YGB B;  4DUQ A;  1QV0 A;  3DVJ A;  3LVC A;  3QRX A;  3I19 A;  1S1E A;  4OJ0 A;  1KFU S;  4L13 A;  3A8R A;  2HF5 A;  2LAN A;  1KK8 B;  1MUX A;  3O77 A;  3KF9 A;  2K61 A;  2WC8 A;  2WHS A;  3FE9 A;  4L9M A;  4PFE A;  4YGC B;  2L5Y A;  2QAC A;  5T3I A;  1OMR A;  1WRZ A;  3JVT C;  3CDN A;  1R6P A;  3PAT A;  1QXT A;  3CLN A;  4OVN F;  2HPW A;  4IL1 A;  3SG5 A;  1JUO A;  1ORG A;  1JBY A;  4JC2 A;  1NCX A;  3SVD A;  1H8B A;  4TZG A;  4R6B A;  5TNC A;  1KCY A;  3VRR A;  1WDC C;  2BL0 C;  4W6R A;  4OY4 A;  2H8V A;  3LCP C;  2GV5 A;  3PIB A;  2ZN9 A;  4GFT A;  1T14 A;  2GX2 A;  3DQA A;  3R72 A;  2KAX A;  2RGI A;  2BBM A;  5J2O A;  1A4P A;  2CCM A;  3EVP A;  3I5I B;  1BG1 A;  4XGY A;  1N0Y A;  1PAL A;  4RYW A;  5HZS A;  4ORC B;  5EXC I;  1LVC D;  5FYX A;  3CBE A;  2K7D A;  1C3Z A;  4PPJ A;  3KPX A;  2IE2 A;  2KOT A;  1OOI X;  5DRG A;  2LVV A;  3D10 A;  2M0R A;  2OTG B;  4W7A A;  2G6Y A;  2L4H A;  1XMZ A;  3SG4 A;  5DTY A;  1B8C A;  2ISD A;  2ZO7 A;  1W9Z A;  3BUN B;  3IVT A;  3WLD A;  1MR8 A;  3ADF A;  4JD9 A;  2F3Y A;  4KAG A;  2GX0 A;  3A8S A;  2WC5 A;  4W6D A;  3GJ1 A;  1YHH A;  1SKT A;  1UUS A;  4XOW A;  3MGF A;  3NSI A;  1SL7 A;  2QEO A;  2EC6 B;  5DQM A;  2QT2 A;  3AAK A;  2K8M B;  1NUB A;  5G08 A;  4W6T A;  2OGR A;  2LMT A;  2B3P A;  2GTE A;  4I2Y A;  4W6O A;  1DGU A;  2CTN A;  4IK4 A;  2YE1 A;  1YUT A;  3BXK A;  1MOU A;  1RK9 A;  4BY5 A;  1TUJ A;  1J7O A;  3S05 A;  3D0Y B;  3TUY C;  2GGZ A;  1MWN A;  2KPH A;  1B1G A;  4AR7 A;  4GNK B;  5BPJ A;  2Q91 A;  4XJK A;  2KAV A;  2LHI A;  1K93 D;  3EKJ A;  1Y6W A;  1Q73 A;  3L4A A;  2FCE A;  2JC2 A;  1L2O C;  4KEX A;  2K7O A;  2EHB A;  4LW5 A;  1ZGQ A;  2JU0 A;  2GW4 B;  2KI4 B;  1XFW O;  1ZGP A;  3AI5 A;  4AOM A;  1J7Q A;  2M1K B;  1KQM C;  4FQT A;  5HW9 A;  3WCK A;  1GGZ A;  2HET A;  1Z1Q A;  3DVE A;  3IP2 A;  1NSH A;  1SW8 A;  2P6B B;  4ORB B;  2A54 B;  2H5O A;  4I5L B;  2DDD A;  4I5J A;  3O2P A;  2AAO A;  5D69 A;  5GQQ C;  1GQM A;  4R1E A;  3PJ5 A;  1B47 A;  3BUW B;  1SR6 C;  2M49 B;  1M45 A;  3SV5 A;  3BXB A;  2O29 A;  2LHL A;  3DQ1 A;  1C4F A;  3ST4 A;  2Y1N A;  2H2K A;  4ORN A;  4GGN A;  2HQ8 A;  4FQO A;  2VVH A;  1YVL A;  3S0D A;  3I5G C;  3GEX A;  1AJ5 A;  2OS8 C;  4W76 A;  1KP5 A;  2EMD A;  4GGF C;  3AAJ A;  4TNC A;  2PYQ A;  1EMK A;  2OTE A;  2A47 A;  1OXE A;  3S0A A;  3PM2 A;  3DQ4 A;  2L51 A;  2DUE A;  4M2P A;  1Z2C B;  2M3W A;  2WCK A;  4IJ7 A;  1PK0 D;  4PPK A;  3K1E A;  4HVF A;  4LQU A;  2QLH A;  5I2L A;  3OB1 B;  2KBI A;  4W7D A;  3OX5 A;  1DJZ A;  3V2L A;  1ODB A;  1QVI Z;  2FZU A;  1CFD A;  1G4Y R;  4KF5 C;  1XFV O;  1A03 A;  3CFA A;  5FVF A;  3SIA A;  2ICR A;  2F8P A;  3WHT B;  2LM5 A;  2QPT A;  1KK7 Y;  3CZ2 A;  4I5N B;  4P2Y B;  2LP3 A;  3GK4 X;  1QIV A;  2H61 C;  1KYS A;  2AMI A;  3I5F C;  3M0W A;  2KFH A;  1YHG A;  1ZAC A;  4MBE A;  1EMG A;  1OOF A;  1XA5 A;  1NWD A;  4QJ4 B;  3OGO A;  2MAZ A;  3BOW B;  1DMO A;  4H48 A;  1UHJ A;  3I5H C;  2F3Z A;  1IRJ A;  3GOF A;  1K8U A;  3V3D A;  1DJX A;  2ZN8 A;  1EMF A;  1RMM A;  4WRI A;  4PPL A;  1ZUX A;  3BUX B;  4PHK A;  3TS5 B;  2A50 B;  4XJK B;  1B7T Y;  3UFZ A;  3EVV A;  2G3D B;  3E5T A;  1GFL A;  1ALW A;  2HQZ A;  4W77 A;  3VB1 A;  3CWG A;  2QZ0 A;  3U0L A;  4W6F A;  5BTT A;  1XQM A;  2HQW A;  2AWJ A;  3LF4 B;  2MLF C;  3PAL A;  2HFC A;  1DGV A;  2IS9 A;  1SL9 A;  5CSI A;  1TCF A;  4ICB A;  3CFH A;  2QRF A;  2C9J A;  1AJ4 A;  2QEV A;  1G33 A;  1DF0 A;  2JTZ A;  5EXU A;  1PUL A;  2Q57 A;  5AQB B;  3SS3 A;  1PRW A;  1RFJ A;  3RM1 A;  1S3P A;  4W73 A;  1Z1P A;  2JPT A;  3BUO B;  3ZNI A;  4USL A;  1F55 A;  3CGA A;  1SSE B;  4YI9 A;  1K2H A;  2TN4 A;  1TN4 A;  2WIS A;  3SRY A;  4W72 A;  1QXP A;  2P71 A;  1A29 A;  3HCM A;  5EL2 A;  4H47 A;  1MOV A;  1L7Z A;  1SMG A;  1QYF A;  1NPQ A;  2LMV A;  2MHH A;  3SG2 A;  3BX9 A;  3AKB A;  3S0E A;  2JNX A;  5CSF A;  1Y1A A;  2M8U A;  3NSL A;  3VRQ A;  2K60 A;  1SCM C;  2WCH A;  3BXA A;  4NDB A;  2JUL A;  1YTZ C;  2L50 A;  1QAS A;  2Y1M A;  1NX3 A;  2LAP A;  1DC1 A;  2AWL A;  4ZIN A;  3PSR A;  3B88 A;  4P1Q A;  1RM9 A;  2A4J A;  1WRL A;  5AER A;  4JWQ A;  1DEK A;  3DQ5 A;  5I94 A;  1CM4 A;  5KU1 A;  2A53 B;  2DUI A;  3BFA A;  2LE9 B;  1B9C A;  2I18 A;  4R6D A;  3SS5 A;  2RH7 A;  4KF4 A;  1W7S A;  5HZU A;  2LV7 A;  2DUG A;  4J8A A;  2IOV A;  1M39 A;  2OKW A;  4EDO A;  5HKY A;  4WQ2 A;  2H8Q A;  5DY6 A;  1OOG A;  3DQJ A;  1OXD A;  3SJS A;  4DKM A;  4EMQ A;  3DQN A;  5CSJ A;  5AEQ A;  1W7I B;  1B9A A;  1TWO A;  3TZ1 A;  3CGL A;  1X02 A;  1ZOT B;  4MZJ A;  4YI8 A;  1SK6 D;  2EGD A;  4RTC A;  4W6L A;  1SBJ A;  1UHK A;  2YDZ A;  2JZI A;  1YUU A;  2K7B A;  5D7F A;  1Q80 A;  2DD7 A;  1YFP A;  2YGU A;  4N3D A;  2JXC A;  5BTT B;  2P70 A;  2QEH A;  1BMO A;  2JWW A;  3ED8 A;  3D0Y A;  5HKW A;  4ZB1 A;  1XK4 C;  2CBL A;  3NEZ A;  1QV1 A;  1SR6 B;  1XFX O;  1DF0 B;  2GGM A;  3SSK A;  5LTQ A;  3WXA A;  1CFP A;  1NCY A;  2Z1O A;  2A56 B;  3CYZ A;  3U8P A;  4CFQ A;  3U8A A;  3EK8 A;  2BTJ A;  2BE6 A;  2ZND A;  4ZF3 A;  5DPH A;  3B86 A;  2F2P A;  1Y1X A;  1F8H A;  1M63 B;  2MBX A;  4Q9X A;  2PQL A;  3VIC A;  4C0L A;  3AKO A;  2B3Q A;  3QME A;  3WHU B;  3DQL A;  4DCK A;  4HSZ A;  1HT9 A;  1KWO C;  2P4M A;  2VAE A;  1CTR A;  1CNP A;  1BU3 A;  4DXM A;  5JOL A;  2L98 A;  2LLT A;  3M22 A;  2PAS A;  2E6W A;  3LK1 A;  3CR4 X;  2FJY A;  1V1G A;  2KBM A;  1SL8 A;  3SG3 A;  1VRK A;  2DDC A;  4W6N A;  4Z4M A;  1BT6 A;  1ZUZ A;  1F70 A;  1IQ3 A;  5DIC A;  1KSM A;  4H3N A;  2BE4 A;  4W7E A;  3JTD C;  1ZFS A;  2HGY A;  2BKI B;  1QJT A;  3EVU A;  1RWY A;  4EUL A;  2BKH B;  2NZ0 A;  1OW4 A;  2I7A A;  1UWO A;  3IF7 A;  4OCI A;  2M29 A;  1RJV A;  2JXL A;  4W6U A;  5H88 A;  5D3O A;  3KHE A;  3SG6 A;  4HQ8 A;  1CM1 A;  1MYW A;  3P8U A;  4JPZ B;  1UUR A;  1XFU O;  1XYD A;  4P5O E;  2JT0 A;  4JF9 A;  2NCP A;  1F4Q A;  1XFY O;  3IR8 A;  5FHV A;  1CKK A;  4KGF A;  2BNX A;  3ST0 A;  1AHR A;  1GJY A;  1XA9 A;  1CLM A;  1AUI B;  1NX1 A;  3D78 A;  1KYR A;  2V4E A;  4NQG A;  3SSV A;  2FWQ A;  4F7F A;  4MZL A;  4N5X A;  3TDU A;  2BBN A;  4JFG A;  2WND A;  1QWV A;  5FI2 A;  1SY9 A;  1K9U A;  2H6V A;  2POX A;  1YUR A;  2I2R E;  5FVG A;  1WLZ A;  4Q7R A;  4KGE A;  2HGD A;  2DUF A;  2YE0 A;  1BOC A;  1S26 D;  2VZX A;  1UHH A;  3BOW A;  3CZT X;  3RWA A;  3BFB A;  3TMT A;  1EH2 A;  3DZT A;  3OSR A;  1IGV A;  2Z6Z A;  3EK7 A;  2QLI A;  1F0B A;  2JOJ A;  3DQM A;  3CZ0 A;  3O6B A;  4B30 A;  4A4B A;  1Q4C A;  1AP4 A;  2I94 A;  4DXP A;  5B8I B;  2MLE C;  2LP2 A;  4W6J A;  1K95 A;  4JEO A;  3FE6 A;  4PHJ A;  3OP0 A;  3U0N A;  3CFF A;  1KSO A;  3VHT A;  1ZGO A;  2HRS A;  5ER4 X;  4H3L A;  3EVR A;  4ZCU A;  2NXQ A;  2SAS A;  3PJI A;  3DF0 A;  1JFK A;  1B7T Z;  4W6H A;  2NCO A;  2YFP A;  1JSA A;  4DXO A;  2HQK A;  3PN7 B;  1QX2 A;  2L5X B;  1A75 A;  1W7J B;  4MLW A;  2K7C A;  4N1F A;  2KLE A;  3FIA A;  4J89 A;  1S6J A;  3DQ8 A;  2AH8 A;  3VRN A;  1J1E A;  2Q4U A;  1YR5 A;  2LVK A;  3LA1 A;  3SVB A;  2D8N A;  1H4B A;  2WCB A;  3O78 A;  4EN1 A;  1S36 A;  2WCL A;  4OZD A;  4BY4 A;  2B1U A;  3ZTF A;  2LC5 A;  1SRA A;  1B8R A;  2L2E A;  2ERB A;  1OSA A;  4W7X A;  3AKA A;  2F2O A;  4XVP A;  1YZW A;  3RLZ A;  1KK8 C;  1IJ5 A;  2A52 B;  2OKY A;  3MSE B;  3R1P A;  4JQ0 D;  3SVS A;  3DVK A;  1GGX A;  4CLN A;  2G2S B;  3WLC A;  5HL1 A;  1TOP A;  2JTT A;  1JC0 A;  4PHM A;  5LK4 A;  4IK8 A;  1EL4 A;  1YX8 A;  3HX4 A;  2V4E B;  2JT8 A;  4GAO A;  3DQF A;  3LF3 A;  1A2X A;  1LXF C;  1YHI A;  2KYF A;  2Y0G A;  1MXL C;  1Y1U A;  2LMU A;  5DKN A;  3E3R A;  1IKU A;  3DY9 A;  3SIB A;  3H1R A;  3DQI A;  5DQB A;  4PCW A;  1D1O A;  5HZO A;  4LJD C;  3NXA A;  1NYA A;  2QDI A;  2KYC A;  3SST A;  1YVH A;  1SPY A;  4Q7U A;  1J1D A;  4PDZ A;  3I5I C;  4B30 B;  1GL4 A;  3ZUL A;  4ETO A;  1LS8 A;  4M2O A;  4H3M A;  2O60 A;  3DQ2 A;  2V53 A;  4JRB A;  2LVJ A;  3UNW A;  1YJ2 A;  3JVT B;  1TNP A;  4KA9 A;  3VHT B;  2OTG C;  1UHI A;  3ZUJ A;  1OZO A;  2KQY A;  2BEC A;  4QJ5 B;  3DF0 B;  5DPI A;  3DQ7 A;  3U0K A;  1GM0 A;  1WDC B;  3PLF B;  2BL0 B;  1MF8 B;  2F33 A;  2EC6 C;  4MN0 A;  2M9G A;  1J7R A;  2CNP A;  5AAN A;  3IQQ A;  4W6M A;  4GGF A;  1A75 B;  3NGV A;  4TZA A;  4XYN A;  3DQ3 A;  2WOS A;  1YRT B;  4HRH A;  3SSY A;  2PVB A;  2QU1 A;  3ZUF A;  5EHU A;  1LA0 A;  4CFR A;  3R1V A;  3LS3 A;  1IQ5 A;  5IBW A;  2HCG A;  2KGR A;  4MEW A;  1IJ6 A;  1CFF A;  1WY9 A;  3OGN A;  2KI4 C;  1ZMZ A;  1NP8 A;  1N65 A;  4OGS A;  2O5G A;  1Q4E A;  5FI6 A;  5EJU A;  1EMB A;  1BJF A;  3DQO A;  2H61 A;  2KDH A;  1J55 A;  3D74 A;  2QEB A;  1EMM A;  4ANJ A;  4AQJ A;  3E5V A;  1CDP A;  1XSS A;  3B6X A;  1C3Y A;  2KHN A;  5J3X A;  5DTL A;  1DJW A;  1AK8 A;  4C0J A;  1OMD A;  4OHS A;  3NT9 A;  4PE0 A;  4IZN A;  2Y5I A;  3DQH A;  4KW8 A;  3NT3 A;  3TUY B;  3H1O A;  5CPV A;  2H9W A;  1DJH A;  3WNX B;  3SG7 A;  1NX2 A;  1R2U A;  1GGW A;  2KI6 D;  1NIW A;  3PFV A;  3FS7 A;  2LVI A;  1L2O B;  4JKT A;  3DYE A;  4GUK A;  1TNX A;  1YRU B;  5HKZ A;  1SCV A;  1OOJ A;  4WQ3 A;  2JRF A;  2G3O A;  1U5I A;  3CR5 X;  4W6P A;  4GBA A;  1KQM B;  3H4S E;  3SVR A;  1YJF A;  1YUS A;  2G6X A;  4MVF A;  1RRX A;  2L0P A;  4UTS A;  1TUZ A;  2PXW A;  2G6E A;  4Q9W A;  1PVB A;  5PAL A;  1DVI A;  1DJY A;  2WIQ A;  3F45 A;  3CB9 A;  1Y0V H;  5EBJ A;  1QLS A;  1KFX L;  1K96 A;  3EK4 A;  2AUC A;  4W6S A;  2M7N A;  5AXI A;  2PRU A;  4YBH B;  2BCX A;  2LLU A;  1QYQ A;  2WUR A;  3I5G B;  1IIO A;  2FCD A;  2OS8 B;  1M46 A;  1UIS A;  4W7R A;  3W1C A;  4LQT A;  3KCS A;  4DRW A;  4PE1 A;  5DTX A;  3S0G A;  4UPG A;  3DPZ A;  2ZO6 A;  3O4X A;  1TCO B;  4ZCV A;  2ZFD A;  3DQ9 A;  2O2B A;  5HYD A;  3DPW A;  1MXE A;  2L4I A;  1XAE A;  4PE7 A;  3TS5 C;  4MRY A;  5DKQ A;  1W7T A;  4D1E A;  1EJ3 A;  2JAD A;  5JJG A;  1RRO A;  1QS7 A;  4W6G A;  1FI5 A;  1EG3 A;  4XOV A;  3NHT A;  4PT1 A;  3C1V A;  1FI6 A;  1DJI A;  1IG5 A;  1LA3 A;  1V1F A;  4W6B A;  2LCP A;  1S5G Y;  3TMR A;  1KYP A;  4L12 A;  2E30 A;  3OX6 A;  3R1O A;  3DXL A;  3SS0 A;  3BQ3 A;  1BF5 A;  1AVS A;  2WC6 A;  1S6C A;  4FTG A;  4I5K A;  1WRK A;  1QLK A;  3I5F B;  2MRD A;  2ZMU A;  1F71 A;  3SSP A;  3SVO A;  2KI6 C;  1BOD A;  3CAB A;  2AHA A;  3PM8 A;  4INX A;  2BCA A;  3I5H B;  4NDD A;  3BYA A;  1XFR A;  2PXS A;  5LTP A;  3U0M A;  3VK1 A;  3RWT A;  1Z4H A;  4DS7 A;  5EB6 A;  2WHT A;  5H87 A;  3S0F A;  3ICB A;  1QTX A;  1FPW A;  5DRF A;  1UHN A;  1K9K A;  1CDN A;  1B8L A;  1QYO A;  1QIW A;  3K21 A;  1TNW A;  1RMO A;  4OQW A;  1WLM A;  1U5I B;  2EMO A;  1TNQ A;  2H5Q A;  3PJ7 A;  1FF1 A;  4CID A;  3BXC A;  3SVU A;  3E5W A;  1OE9 B;  2G5Z B;  1XK4 A;  5KTG A;  1REC A;  5KTY A;  3CR2 A;  3VRO A;  2KGB C;  2KAY A;  1C7W A;  1F54 A;  2Q6P A;  4W6A A;  2KQ6 A;  2OPO A;  3DVM A;  3L4L A;  1HQV A;  2COL B;  3DD4 A;  1K9P A;  4EDS A;  2QLE A;  1K90 D;  5KSZ A;  1KK7 Z;  3NED A;  2DUH A;  1KFX S;  1PSB A;  2QLG A;  3A4U B;  4GES B;  2HJO A;  3IQO A;  1DJG A;  2WCJ A;  2CXJ A;  4ORA B;  3D76 A;  1CV7 A;  1JBA A;  1OXF A;  1BR4 B;  2LUX A;  5F9G A;  3EG5 B;  4NDC A;  3UG0 A;  3M24 A;  3DQ6 A;  3TDZ A;  1SCM B;  4YGE B;  1FBV A;  4MSP A;  1HCJ A;  2WSN A;  4Q7T A;  3LVA A;  2C9I A;  3D73 A;  2JPO A;  3W1D A;  3FWC A;  2G2B A;  1NCZ A;  1TTX A;  2FOT A;  3D75 A;  4IK9 A;  1B4C A;  1DEL A;  1BLQ A;  2G9B A;  3U8C A;  3CZ1 A;  4HQ9 A;  2A48 A;  1JF0 A;  2KNE A;  2KFF A;  3VGO A;  3AI4 A;  4DXI A;  4PHN A;  1JC2 A;  1DQE A;  1DTL A;  5I8N A;  4JGE A;  3TDI A;  3BFH A;  4OKH A;  5DTZ A;  2FL1 A;  2GW3 A;  3BUM B;  2MA2 A;  1Q4B A;  1NX0 A;  1OMV A;  1Q4D A;  4XL5 A;  3ST2 A;  1QX7 A;  4N1G A;  2KSP A;  4E68 A;  2K2F A;  4YGA A;  1EML A;  1H4U A;  2AWK A;  1BFP A;  2ZNE A;  1F09 A;  5BT0 A;  2VVJ A;  4IK5 A;  3O4Y A;  4KW4 A;  1YX7 A;  4A4C A;  1CFC A;  4P76 A;  1F4O A;  4YGD B;  5BQL A;  2VAD A;  4W69 A;  3ZWH A;  2ZMW A;  1IWQ A;  4C0K A;  2Y4Q A;  3DQD A;  5H89 A;  3OB2 B;  2VVI A;  3SVN A;  4CPV A;  3NF0 A;  4LJC A;  2Z6X A;  3DQU A;  2MJW B;  3LVD A;  4IK3 A;  5HLO A;  1H6R A;  5K89 A;  2AWM A;  2OJK A;  4ZF4 A;  4KPI A;  3OSQ A;  4HQC A;  5DPJ A;  5ER5 A;  1CMG A;  2H5P A;  4BDU A;  1JWD A;  2IB5 A;  2PAL A;  3DPX A;  3KCT A;  5AFP A;  2PMY A;  3CD1 A;  3K1K A;  4OV2 A;  5DPG A;  4PAL A;  5DKR A;  2G16 B;  5CSN A;  2QLG B;  1KWO B;  3FWB A;  1JFJ A;  4J88 A;  4U8D A;  4RYS A;  3BJH A;  4YRU A;  1FW4 A;  1G8I A;  4MRX A;  1QAT A;  2KLD A;  2ZKM X;  2WCF A;  4W7F A;  1C7V A;  2EMN A;  3P28 A;  2SCP A;  4GPL B;  3UO9 A;  2OTB A;  3GL4 A;  2LUC A;  1JF2 A;  5I2O A;  3GJ2 A;  2BAP A;  2JQ6 A;  1QY3 A;  3PJB A;  1MHO A;  3D77 A;  3JTD B;  2WCE A;  1P28 A;  2ZRS A;  3DQC A;  2K0J A;  4OR9 B;  4B5Y A;  4U2V A;  4GOB A;  2WOR A;  3RZS A;  2WSO A;  2O24 A;  4GF6 B;  1RMP A;  1CMF A;  3B7A A;  1EXR A;  2FJU B;  4F0Z B;  1CLB A;  1CLL A;  1HUY A;  1KFU L;  1MQ1 A;  3NSO A;  3SS4 A;  1RTP 1;  1XFZ O;  3NSK A;  3LLE A;  2VRG A;  4HRG A;  4Z4K A;  2M97 A;  4ZIO A;  1S6I A;  1E8A A;  5HBD A;  4IK1 A;  3GB3 A;  5LTR A;  1SYM A;  4W74 A;  1CDL A;  3ST3 A;  1N2D A;  2ARL A;  1OOH A;  2LNK A;  5EB7 A;  4KW9 A;  5HGE A; 
#chains in the Genus database with same CATH homology
 4KF5 A;  2A46 A;  4W75 A;  2IB6 A;  1OQP A;  4ZBL A;  4NWS A;  2CT9 A;  4QJ3 B;  4DXN A;  1EG4 A;  3LSA A;  2H5R A;  4W7C A;  1QVI Y;  1M31 A;  3LK0 A;  4HRE E;  3GK1 A;  4LJD A;  2JNF A;  5EXB A;  1PVA A;  3KO0 A;  2ZRT A;  3G9A A;  1TIZ A;  3PN7 C;  2DD9 A;  1S5G Z;  4W6I A;  1XO5 A;  4AQI A;  1LIN A;  3SVC A;  1QX5 B;  4M2Q A;  4DKN A;  2R2I A;  2KFG A;  4W6K A;  2DOQ A;  5DU0 A;  4PE4 A;  2K2A A;  1J7P A;  5HZT A;  3CTN A;  2WHU A;  1LKJ A;  4W6C A;  1G7K A;  1DT7 B;  3KEV A;  2BCB A;  1EMC A;  3VRP A;  1K94 A;  2NLN A;  3DQK A;  3LL8 B;  1XVJ A;  1S6Z A;  1PSR A;  1KQV A;  3SSL A;  1C07 A;  1CB1 A;  5HLV A;  1IH0 A;  5FVI A;  3OHM B;  3CD9 A;  2M1U A;  1ALV A;  4DXQ A;  3EKH A;  1Q4A A;  5F6T A;  4DIR A;  2LLS A;  4L1I A;  2V4E C;  1OZS A;  3CS1 A;  1TRF A;  1JC1 A;  2HPS A;  3DQE A;  3SVE A;  1CDM A;  4MZK A;  4LJB A;  4ZF5 A;  2M7L A;  4Q04 A;  1EME A;  2JT3 A;  1SNL A;  4AS8 A;  4ZFS A;  3GK2 A;  4HE4 A;  1W7U A;  3SSH A;  2PSR A;  1EMA A;  1UP5 A;  1BR1 B;  5I2Q A;  1JBZ A;  2Z6Y A;  4YGB B;  4DUQ A;  1QV0 A;  3DVJ A;  3LVC A;  3QRX A;  3I19 A;  1S1E A;  4OJ0 A;  1KFU S;  4L13 A;  3A8R A;  2HF5 A;  2LAN A;  1KK8 B;  1MUX A;  3O77 A;  3KF9 A;  2K61 A;  2WC8 A;  2WHS A;  4L9M A;  4PFE A;  4YGC B;  2QAC A;  5T3I A;  1OMR A;  1WRZ A;  3JVT C;  1R6P A;  3PAT A;  1QXT A;  3CLN A;  4OVN F;  2HPW A;  4IL1 A;  3SG5 A;  1JUO A;  1JBY A;  4JC2 A;  1NCX A;  3SVD A;  1H8B A;  4TZG A;  4R6B A;  5TNC A;  1KCY A;  3VRR A;  1WDC C;  2BL0 C;  4W6R A;  4OY4 A;  3LCP C;  2GV5 A;  3PIB A;  2ZN9 A;  4GFT A;  2GX2 A;  3DQA A;  2KAX A;  2RGI A;  2BBM A;  5J2O A;  1A4P A;  2CCM A;  3EVP A;  3I5I B;  1BG1 A;  4XGY A;  1N0Y A;  1PAL A;  4RYW A;  5HZS A;  4ORC B;  5EXC I;  1LVC D;  5FYX A;  3CBE A;  2K7D A;  4PPJ A;  3KPX A;  2IE2 A;  2KOT A;  5DRG A;  2LVV A;  3D10 A;  2M0R A;  2OTG B;  4W7A A;  2G6Y A;  2L4H A;  1XMZ A;  3SG4 A;  5DTY A;  1B8C A;  2ISD A;  2ZO7 A;  3BUN B;  3WLD A;  1MR8 A;  3ADF A;  2F3Y A;  4KAG A;  2GX0 A;  3A8S A;  4W6D A;  3GJ1 A;  1YHH A;  1SKT A;  1UUS A;  4XOW A;  3MGF A;  3NSI A;  1SL7 A;  2EC6 B;  5DQM A;  2QT2 A;  3AAK A;  2K8M B;  1NUB A;  5G08 A;  4W6T A;  2OGR A;  2LMT A;  2B3P A;  4I2Y A;  4W6O A;  1DGU A;  2CTN A;  4IK4 A;  2YE1 A;  1YUT A;  3BXK A;  1MOU A;  1RK9 A;  4BY5 A;  1J7O A;  3S05 A;  3D0Y B;  3TUY C;  2GGZ A;  1MWN A;  1B1G A;  4AR7 A;  4GNK B;  5BPJ A;  2Q91 A;  4XJK A;  2KAV A;  2LHI A;  1K93 D;  3EKJ A;  1Y6W A;  1Q73 A;  2FCE A;  2JC2 A;  1L2O C;  4KEX A;  2K7O A;  2EHB A;  4LW5 A;  1ZGQ A;  2JU0 A;  2GW4 B;  2KI4 B;  1XFW O;  1ZGP A;  3AI5 A;  4AOM A;  1J7Q A;  2M1K B;  1KQM C;  5HW9 A;  3WCK A;  1GGZ A;  2HET A;  1Z1Q A;  3DVE A;  3IP2 A;  1NSH A;  1SW8 A;  2P6B B;  4ORB B;  2A54 B;  2H5O A;  4I5L B;  2DDD A;  4I5J A;  3O2P A;  2AAO A;  5D69 A;  5GQQ C;  1GQM A;  4R1E A;  3PJ5 A;  1B47 A;  3BUW B;  1SR6 C;  2M49 B;  1M45 A;  3SV5 A;  3BXB A;  2O29 A;  2LHL A;  3DQ1 A;  1C4F A;  3ST4 A;  2Y1N A;  2H2K A;  4ORN A;  4GGN A;  2HQ8 A;  4FQO A;  2VVH A;  1YVL A;  3GEX A;  3I5G C;  1AJ5 A;  2OS8 C;  4W76 A;  1KP5 A;  2EMD A;  4GGF C;  3AAJ A;  4TNC A;  1EMK A;  2OTE A;  2A47 A;  1OXE A;  3DQ4 A;  2L51 A;  2DUE A;  4M2P A;  2M3W A;  1PK0 D;  4PPK A;  4HVF A;  4LQU A;  2QLH A;  5I2L A;  3OB1 B;  2KBI A;  4W7D A;  3OX5 A;  1DJZ A;  1ODB A;  1QVI Z;  2FZU A;  1CFD A;  1G4Y R;  4KF5 C;  1XFV O;  1A03 A;  3CFA A;  5FVF A;  3SIA A;  2ICR A;  2F8P A;  3WHT B;  2LM5 A;  2QPT A;  1KK7 Y;  4I5N B;  4P2Y B;  2LP3 A;  3GK4 X;  1QIV A;  2H61 C;  1KYS A;  2AMI A;  3I5F C;  3M0W A;  2KFH A;  1YHG A;  1ZAC A;  4MBE A;  1EMG A;  1XA5 A;  1NWD A;  4QJ4 B;  3OGO A;  2MAZ A;  3BOW B;  1DMO A;  4H48 A;  1UHJ A;  3I5H C;  2F3Z A;  1IRJ A;  3GOF A;  1K8U A;  3V3D A;  1DJX A;  2ZN8 A;  1EMF A;  1RMM A;  4WRI A;  4PPL A;  1ZUX A;  3BUX B;  4PHK A;  3TS5 B;  2A50 B;  4XJK B;  1B7T Y;  3UFZ A;  3EVV A;  2G3D B;  3E5T A;  1GFL A;  1ALW A;  2HQZ A;  4W77 A;  3CWG A;  2QZ0 A;  3U0L A;  4W6F A;  5BTT A;  1XQM A;  2HQW A;  2AWJ A;  3LF4 B;  2MLF C;  3PAL A;  2HFC A;  1DGV A;  2IS9 A;  1SL9 A;  5CSI A;  1TCF A;  4ICB A;  3CFH A;  2QRF A;  2C9J A;  1AJ4 A;  1G33 A;  1DF0 A;  2JTZ A;  5EXU A;  1PUL A;  2Q57 A;  5AQB B;  1PRW A;  1RFJ A;  3RM1 A;  1S3P A;  4W73 A;  1Z1P A;  2JPT A;  3BUO B;  3ZNI A;  4USL A;  1F55 A;  3CGA A;  4YI9 A;  1K2H A;  2TN4 A;  1TN4 A;  2WIS A;  3SRY A;  4W72 A;  1QXP A;  1A29 A;  3HCM A;  4H47 A;  1MOV A;  1L7Z A;  1SMG A;  1QYF A;  1NPQ A;  2LMV A;  2MHH A;  3SG2 A;  3BX9 A;  3AKB A;  2JNX A;  5CSF A;  1Y1A A;  2M8U A;  3NSL A;  3VRQ A;  1SCM C;  3BXA A;  4NDB A;  2JUL A;  1YTZ C;  2L50 A;  1QAS A;  2Y1M A;  1NX3 A;  2LAP A;  2AWL A;  4ZIN A;  3PSR A;  4P1Q A;  1RM9 A;  2A4J A;  1WRL A;  5AER A;  4JWQ A;  3DQ5 A;  5KU1 A;  1CM4 A;  2A53 B;  2DUI A;  2LE9 B;  1B9C A;  2I18 A;  4R6D A;  2RH7 A;  4KF4 A;  1W7S A;  5HZU A;  2LV7 A;  2DUG A;  4J8A A;  2IOV A;  1M39 A;  2OKW A;  4EDO A;  5HKY A;  4WQ2 A;  2H8Q A;  5DY6 A;  3DQJ A;  1OXD A;  3SJS A;  4DKM A;  4EMQ A;  3DQN A;  5CSJ A;  5AEQ A;  1W7I B;  1B9A A;  3TZ1 A;  3CGL A;  1X02 A;  1ZOT B;  4MZJ A;  4YI8 A;  1SK6 D;  2EGD A;  4RTC A;  4W6L A;  1SBJ A;  1UHK A;  2YDZ A;  2JZI A;  1YUU A;  2K7B A;  5D7F A;  1Q80 A;  2DD7 A;  1YFP A;  4N3D A;  2JXC A;  5BTT B;  1BMO A;  2JWW A;  3ED8 A;  3D0Y A;  5HKW A;  4ZB1 A;  1XK4 C;  2CBL A;  3NEZ A;  1QV1 A;  1SR6 B;  1XFX O;  1DF0 B;  2GGM A;  3SSK A;  5LTQ A;  3WXA A;  1CFP A;  1NCY A;  2Z1O A;  2A56 B;  3U8P A;  4CFQ A;  3U8A A;  3EK8 A;  2BTJ A;  2BE6 A;  2ZND A;  4ZF3 A;  5DPH A;  2F2P A;  1Y1X A;  1F8H A;  1M63 B;  2MBX A;  4Q9X A;  3VIC A;  4C0L A;  3AKO A;  2B3Q A;  3WHU B;  3DQL A;  4DCK A;  4HSZ A;  1HT9 A;  1KWO C;  2P4M A;  2VAE A;  1CTR A;  1CNP A;  1BU3 A;  4DXM A;  5JOL A;  2L98 A;  2LLT A;  3M22 A;  2PAS A;  2E6W A;  3LK1 A;  3CR4 X;  1V1G A;  2KBM A;  1SL8 A;  3SG3 A;  1VRK A;  2DDC A;  4W6N A;  4Z4M A;  1BT6 A;  1ZUZ A;  1F70 A;  1IQ3 A;  1KSM A;  4H3N A;  2BE4 A;  4W7E A;  3JTD C;  1ZFS A;  2HGY A;  2BKI B;  1QJT A;  3EVU A;  1RWY A;  4EUL A;  2BKH B;  2NZ0 A;  2I7A A;  1UWO A;  3IF7 A;  4OCI A;  2M29 A;  1RJV A;  2JXL A;  4W6U A;  5H88 A;  3KHE A;  3SG6 A;  4HQ8 A;  3P8U A;  1CM1 A;  1MYW A;  4JPZ B;  1UUR A;  1XFU O;  1XYD A;  4P5O E;  2JT0 A;  4JF9 A;  2NCP A;  1F4Q A;  1XFY O;  3IR8 A;  5FHV A;  1CKK A;  4KGF A;  3ST0 A;  1AHR A;  1GJY A;  1XA9 A;  1CLM A;  1AUI B;  1NX1 A;  1KYR A;  2V4E A;  4NQG A;  3SSV A;  2FWQ A;  4MZL A;  4N5X A;  3TDU A;  2BBN A;  4JFG A;  2WND A;  1SY9 A;  1K9U A;  2H6V A;  2POX A;  1YUR A;  2I2R E;  5FVG A;  1WLZ A;  4Q7R A;  4KGE A;  2HGD A;  2DUF A;  2YE0 A;  1BOC A;  1S26 D;  2VZX A;  1UHH A;  3BOW A;  3CZT X;  3RWA A;  3TMT A;  1EH2 A;  3OSR A;  1IGV A;  2Z6Z A;  3EK7 A;  2QLI A;  1F0B A;  2JOJ A;  3DQM A;  3O6B A;  4B30 A;  4A4B A;  1Q4C A;  1AP4 A;  2I94 A;  4DXP A;  5B8I B;  2MLE C;  2LP2 A;  4W6J A;  1K95 A;  4JEO A;  4PHJ A;  3OP0 A;  3U0N A;  3CFF A;  1KSO A;  3VHT A;  1ZGO A;  2HRS A;  5ER4 X;  4H3L A;  3EVR A;  4ZCU A;  2NXQ A;  2SAS A;  3DF0 A;  1JFK A;  1B7T Z;  4W6H A;  2NCO A;  2YFP A;  1JSA A;  4DXO A;  2HQK A;  3PN7 B;  1QX2 A;  2L5X B;  1A75 A;  1W7J B;  4MLW A;  2K7C A;  4N1F A;  3FIA A;  4J89 A;  1S6J A;  3DQ8 A;  2AH8 A;  3VRN A;  1J1E A;  2Q4U A;  1YR5 A;  2LVK A;  3LA1 A;  3SVB A;  2D8N A;  1H4B A;  2WCB A;  3O78 A;  4EN1 A;  1S36 A;  4BY4 A;  2B1U A;  3ZTF A;  2LC5 A;  1SRA A;  1B8R A;  2L2E A;  1OSA A;  4W7X A;  3AKA A;  2F2O A;  4XVP A;  1YZW A;  3RLZ A;  1KK8 C;  1IJ5 A;  2A52 B;  2OKY A;  3MSE B;  4JQ0 D;  3SVS A;  3DVK A;  1GGX A;  4CLN A;  2G2S B;  3WLC A;  1TOP A;  2JTT A;  1JC0 A;  4PHM A;  5LK4 A;  4IK8 A;  1EL4 A;  1YX8 A;  3HX4 A;  2V4E B;  2JT8 A;  4GAO A;  3DQF A;  3LF3 A;  1A2X A;  1LXF C;  1YHI A;  2KYF A;  2Y0G A;  1MXL C;  1Y1U A;  2LMU A;  5DKN A;  3E3R A;  1IKU A;  3H1R A;  3SIB A;  3DQI A;  5DQB A;  4PCW A;  1D1O A;  5HZO A;  4LJD C;  3NXA A;  1NYA A;  2KYC A;  3SST A;  1YVH A;  1SPY A;  4Q7U A;  1J1D A;  4PDZ A;  3I5I C;  4B30 B;  1GL4 A;  3ZUL A;  4ETO A;  4M2O A;  4H3M A;  2O60 A;  3DQ2 A;  2V53 A;  4JRB A;  2LVJ A;  1YJ2 A;  3JVT B;  1TNP A;  4KA9 A;  3VHT B;  2OTG C;  1UHI A;  3ZUJ A;  1OZO A;  2KQY A;  2BEC A;  4QJ5 B;  3DF0 B;  5DPI A;  3DQ7 A;  3U0K A;  1WDC B;  3PLF B;  2BL0 B;  1MF8 B;  2F33 A;  2EC6 C;  4MN0 A;  2M9G A;  1J7R A;  2CNP A;  5AAN A;  3IQQ A;  4W6M A;  4GGF A;  1A75 B;  4TZA A;  4XYN A;  3DQ3 A;  2WOS A;  1YRT B;  4HRH A;  3SSY A;  2PVB A;  2QU1 A;  3ZUF A;  5EHU A;  1LA0 A;  4CFR A;  3LS3 A;  1IQ5 A;  5IBW A;  2HCG A;  2KGR A;  4MEW A;  1IJ6 A;  1CFF A;  1WY9 A;  2KI4 C;  1ZMZ A;  1NP8 A;  1N65 A;  4OGS A;  2O5G A;  1Q4E A;  5EJU A;  1EMB A;  1BJF A;  3DQO A;  2H61 A;  2KDH A;  1J55 A;  1EMM A;  4ANJ A;  4AQJ A;  3E5V A;  1CDP A;  1XSS A;  2KHN A;  5J3X A;  5DTL A;  1DJW A;  1AK8 A;  4C0J A;  1OMD A;  4OHS A;  3NT9 A;  4PE0 A;  4IZN A;  2Y5I A;  3DQH A;  4KW8 A;  3NT3 A;  3TUY B;  3H1O A;  5CPV A;  2H9W A;  1DJH A;  3WNX B;  3SG7 A;  1NX2 A;  1R2U A;  1GGW A;  2KI6 D;  1NIW A;  3PFV A;  3FS7 A;  2LVI A;  1L2O B;  4GUK A;  1TNX A;  1YRU B;  5HKZ A;  1SCV A;  1OOJ A;  4WQ3 A;  2JRF A;  2G3O A;  1U5I A;  4W6P A;  3CR5 X;  4GBA A;  1KQM B;  3H4S E;  3SVR A;  1YJF A;  1YUS A;  2G6X A;  4MVF A;  1RRX A;  2L0P A;  4UTS A;  2PXW A;  2G6E A;  4Q9W A;  1PVB A;  5PAL A;  1DVI A;  1DJY A;  2WIQ A;  3F45 A;  3CB9 A;  1Y0V H;  5EBJ A;  1QLS A;  1KFX L;  1K96 A;  3EK4 A;  2AUC A;  4W6S A;  2M7N A;  5AXI A;  2PRU A;  4YBH B;  2BCX A;  2LLU A;  1QYQ A;  2WUR A;  3I5G B;  2FCD A;  2OS8 B;  1M46 A;  1UIS A;  4W7R A;  3W1C A;  4LQT A;  3KCS A;  4DRW A;  4PE1 A;  5DTX A;  4UPG A;  2ZO6 A;  3DPZ A;  1TCO B;  4ZCV A;  2ZFD A;  3DQ9 A;  2O2B A;  5HYD A;  3DPW A;  1MXE A;  2L4I A;  1XAE A;  4PE7 A;  3TS5 C;  4MRY A;  5DKQ A;  1W7T A;  4D1E A;  1EJ3 A;  2JAD A;  5JJG A;  1RRO A;  1QS7 A;  4W6G A;  1FI5 A;  1EG3 A;  4XOV A;  3C1V A;  1FI6 A;  1DJI A;  1IG5 A;  1LA3 A;  1V1F A;  4W6B A;  2LCP A;  1S5G Y;  3TMR A;  1KYP A;  4L12 A;  2E30 A;  3OX6 A;  3SS0 A;  3BQ3 A;  1BF5 A;  1AVS A;  1S6C A;  4FTG A;  4I5K A;  1WRK A;  1QLK A;  3I5F B;  2MRD A;  2ZMU A;  1F71 A;  3SSP A;  3SVO A;  2KI6 C;  1BOD A;  2AHA A;  3PM8 A;  2BCA A;  3I5H B;  4NDD A;  3BYA A;  2PXS A;  5LTP A;  3U0M A;  3VK1 A;  3RWT A;  4DS7 A;  5EB6 A;  2WHT A;  5H87 A;  3ICB A;  1QTX A;  1FPW A;  5DRF A;  1UHN A;  1K9K A;  1CDN A;  1B8L A;  1QYO A;  1QIW A;  3K21 A;  1TNW A;  1RMO A;  4OQW A;  1WLM A;  1U5I B;  2EMO A;  1TNQ A;  2H5Q A;  3PJ7 A;  1FF1 A;  4CID A;  3BXC A;  3SVU A;  3E5W A;  1OE9 B;  2G5Z B;  1XK4 A;  5KTG A;  1REC A;  5KTY A;  3CR2 A;  3VRO A;  2KGB C;  2KAY A;  1C7W A;  1F54 A;  2Q6P A;  4W6A A;  2KQ6 A;  2OPO A;  3DVM A;  1HQV A;  2COL B;  3DD4 A;  1K9P A;  4EDS A;  2QLE A;  1K90 D;  5KSZ A;  1KK7 Z;  3NED A;  2DUH A;  1KFX S;  1PSB A;  2QLG A;  3A4U B;  4GES B;  2HJO A;  3IQO A;  1DJG A;  4ORA B;  2CXJ A;  1CV7 A;  1JBA A;  1OXF A;  1BR4 B;  2LUX A;  5F9G A;  4NDC A;  3UG0 A;  3M24 A;  3DQ6 A;  3TDZ A;  1SCM B;  4YGE B;  1FBV A;  4MSP A;  1HCJ A;  2WSN A;  4Q7T A;  3LVA A;  2C9I A;  3W1D A;  3FWC A;  2G2B A;  1NCZ A;  1TTX A;  2FOT A;  4IK9 A;  1B4C A;  1BLQ A;  2G9B A;  3U8C A;  4HQ9 A;  2A48 A;  1JF0 A;  2KNE A;  2KFF A;  3VGO A;  3AI4 A;  4DXI A;  4PHN A;  1JC2 A;  1DTL A;  5I8N A;  4JGE A;  3TDI A;  4OKH A;  5DTZ A;  2FL1 A;  2GW3 A;  3BUM B;  2MA2 A;  1Q4B A;  1NX0 A;  1OMV A;  1Q4D A;  4XL5 A;  3ST2 A;  1QX7 A;  4N1G A;  2KSP A;  4E68 A;  2K2F A;  4YGA A;  1EML A;  1H4U A;  2AWK A;  1BFP A;  2ZNE A;  1F09 A;  5BT0 A;  2VVJ A;  4IK5 A;  3O4Y A;  4KW4 A;  1YX7 A;  4A4C A;  1CFC A;  4P76 A;  1F4O A;  4YGD B;  5BQL A;  2VAD A;  4W69 A;  3ZWH A;  2ZMW A;  1IWQ A;  4C0K A;  2Y4Q A;  3DQD A;  5H89 A;  3OB2 B;  2VVI A;  3SVN A;  4CPV A;  4LJC A;  3NF0 A;  2Z6X A;  3DQU A;  2MJW B;  3LVD A;  4IK3 A;  5HLO A;  1H6R A;  5K89 A;  2AWM A;  2OJK A;  4ZF4 A;  4KPI A;  3OSQ A;  4HQC A;  5DPJ A;  5ER5 A;  1CMG A;  2H5P A;  4BDU A;  1JWD A;  2IB5 A;  2PAL A;  3DPX A;  3KCT A;  5AFP A;  2PMY A;  3CD1 A;  3K1K A;  4OV2 A;  5DPG A;  4PAL A;  5DKR A;  2G16 B;  5CSN A;  2QLG B;  1KWO B;  3FWB A;  1JFJ A;  4J88 A;  4U8D A;  4RYS A;  4YRU A;  1FW4 A;  1G8I A;  4MRX A;  1QAT A;  2ZKM X;  2WCF A;  4W7F A;  1C7V A;  2EMN A;  3P28 A;  2SCP A;  4GPL B;  2OTB A;  3GL4 A;  2LUC A;  1JF2 A;  5I2O A;  3GJ2 A;  2JQ6 A;  1QY3 A;  3PJB A;  1MHO A;  3JTD B;  2WCE A;  2ZRS A;  3DQC A;  2K0J A;  4OR9 B;  4B5Y A;  4U2V A;  4GOB A;  2WOR A;  2WSO A;  2O24 A;  4GF6 B;  1RMP A;  1CMF A;  1EXR A;  2FJU B;  4F0Z B;  1CLB A;  1CLL A;  1HUY A;  1KFU L;  1MQ1 A;  3NSO A;  1RTP 1;  1XFZ O;  3NSK A;  3LLE A;  2VRG A;  4HRG A;  4Z4K A;  2M97 A;  4ZIO A;  1S6I A;  1E8A A;  5HBD A;  4IK1 A;  3GB3 A;  5LTR A;  1SYM A;  4W74 A;  1CDL A;  3ST3 A;  1N2D A;  2ARL A;  2LNK A;  5EB7 A;  4KW9 A;  5HGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...