3EKEA

Crystal structure of ibv x-domain at ph 5.6
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
171
structure length
171
Chain Sequence
ATCEKPKFLEYKTCVGDLTVVIAKALDEFKEFCIVNAANEHMTHGSGVAKAIADFCGLDFVEYCEDYVKKHGPQQRLVTPSFVKGIQCVNNVVGPRHGDNNLHEKLVAAYKNVLVDGVVNYVVPVLSLGIFGVDFKMSIDAMREAFEGCTIRVLLFSLSQEHIDYFDVTCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 3
publication title Crystal structures of the X-domains of a Group-1 and a Group-3 coronavirus reveal that ADP-ribose-binding may not be a conserved property.
pubmed doi rcsb
source organism Avian infectious bronchitis virus (strain beaudette)
molecule tags Hydrolase
total genus 51
structure length 171
sequence length 171
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3ekeA00
4JVVA 3VFQA 2XD7A 2L8RA 2BFQA 4ZY2A 4IQYA 1ZR5A 1ZR3A 4KYBA 4KSIA 2DX6A 3IIDA 3KR4A 3GQOA 2LGRA 5AILA 3GQEA 5DUSA 2FG1A 4ZX8A 4ZYQA 4ZI6A 5CB3A 4GUAA 1VHUA 5FSUA 4J5QA 3KR5A 3EJGA 3PEIA 2AFCA 5HOLA 4K0CA 3ETIA 4J5RA 4ETJA 1LAPA 5D8NA 1LANA 3GPOA 4ABLA 4X2TA 3EWOA 4JGKA 4GVVA 2VRIA 1TY8A 4D86A 4ZY1A 5E3BA 3JZTA 3V45A 3SIJA 2EWBA 5FSVA 4ESSA 4ZX9A 3H8EA 3EJFA 4JLLA 3GPQA 4K3NA 5CBMA 2J9AA 1HJZA 3EW5A 3KZWA 4J5SA 3SIGA 2ACFA 5FSYA 1SPVA 5CMSA 4GVWA 3H8FA 3SIIA 3IIFA 4R76A 3EWRA 5FSXA 4R6TA 3KQZA 2EEEA 5FSZA 3KQXA 1BLLE 5HIHA 1NJRA 4R7MA 2FAVA 3IJ3A 3SIHA 1LCPA 3EKEA 3H8GA 1BPNA 1LAMA 3EWQA 4ETKA 2BFRA 3GPGA 3Q71A 3Q6ZA 4TU0A 2X47A 1GYTA 4ABKA 4UMLA 1BPMA 3JRUA 3EWPA 4JCAA 3T8WA 1YD9A 4ZY0A 4J4ZA 3V2BA 1TXZA 5CB5A 2FXKA
chains in the Genus database with same CATH superfamily
4JVVA 3VFQA 2XD7A 2L8RA 2BFQA 4ZY2A 4IQYA 1ZR5A 1ZR3A 4KYBA 4KSIA 2DX6A 3IIDA 3KR4A 3GQOA 2LGRA 5AILA 3GQEA 2JZEA 5DUSA 2FG1A 4ZX8A 4ZYQA 4ZI6A 5CB3A 4GUAA 1VHUA 2WCTA 5FSUA 4J5QA 3KR5A 3EJGA 3PEIA 2AFCA 5HOLA 4K0CA 3ETIA 4J5RA 4ETJA 1LAPA 5D8NA 1LANA 3GPOA 4ABLA 4X2TA 3EWOA 4JGKA 4GVVA 2VRIA 1TY8A 4D86A 2W2GA 4ZY1A 5E3BA 3JZTA 3V45A 3SIJA 2EWBA 5FSVA 4ESSA 4ZX9A 3H8EA 3EJFA 4JLLA 3GPQA 4K3NA 5CBMA 2J9AA 1HJZA 3EW5A 3KZWA 4J5SA 2JZFA 2ACFA 3SIGA 5FSYA 1SPVA 5CMSA 2JZDA 4GVWA 3H8FA 3SIIA 3IIFA 4R76A 3EWRA 5FSXA 4R6TA 3KQZA 2EEEA 5FSZA 3KQXA 1BLLE 5HIHA 1NJRA 4R7MA 2FAVA 3IJ3A 3SIHA 1LCPA 3EKEA 3H8GA 1BPNA 1LAMA 3EWQA 4ETKA 2BFRA 3GPGA 3Q71A 3Q6ZA 4TU0A 2X47A 1GYTA 4ABKA 4UMLA 2RNKA 1BPMA 3JRUA 3EWPA 4JCAA 3T8WA 1YD9A 4ZY0A 4J4ZA 3V2BA 1TXZA 5CB5A 2KQVA 2FXKA
chains in the Genus database with same CATH topology
4JVVA 3VFQA 2XD7A 2L8RA 2BFQA 4ZY2A 4IQYA 1ZR5A 1ZR3A 4KYBA 4KSIA 2DX6A 3IIDA 3KR4A 3GQOA 2LGRA 5AILA 3GQEA 5DUSA 2FG1A 4ZX8A 4ZYQA 4ZI6A 5CB3A 4GUAA 1VHUA 5FSUA 4J5QA 3KR5A 3EJGA 3PEIA 2AFCA 5HOLA 4K0CA 3ETIA 4J5RA 4ETJA 1LAPA 5D8NA 1LANA 3GPOA 4ABLA 4X2TA 3EWOA 4JGKA 4GVVA 2VRIA 1TY8A 4D86A 4ZY1A 5E3BA 3JZTA 3V45A 3SIJA 2EWBA 5FSVA 4ESSA 4ZX9A 3H8EA 3EJFA 4JLLA 3GPQA 4K3NA 5CBMA 2J9AA 1HJZA 3EW5A 3KZWA 4J5SA 3SIGA 2ACFA 5FSYA 1SPVA 5CMSA 4GVWA 3H8FA 3SIIA 3IIFA 4R76A 3EWRA 5FSXA 4R6TA 3KQZA 2EEEA 5FSZA 3KQXA 1BLLE 5HIHA 1NJRA 4R7MA 2FAVA 3IJ3A 3SIHA 1LCPA 3EKEA 3H8GA 1BPNA 1LAMA 3EWQA 4ETKA 2BFRA 3GPGA 3Q71A 3Q6ZA 4TU0A 2X47A 1GYTA 4ABKA 4UMLA 1BPMA 3JRUA 3EWPA 4JCAA 3T8WA 1YD9A 4ZY0A 4J4ZA 3V2BA 1TXZA 5CB5A 2FXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JVV A;  3VFQ A;  2XD7 A;  2L8R A;  2BFQ A;  4ZY2 A;  4IQY A;  1ZR5 A;  1ZR3 A;  4KYB A;  4KSI A;  2DX6 A;  3IID A;  3KR4 A;  3GQO A;  2LGR A;  5AIL A;  3GQE A;  5DUS A;  2FG1 A;  4ZX8 A;  4ZYQ A;  4ZI6 A;  5CB3 A;  4GUA A;  1VHU A;  5FSU A;  4J5Q A;  3KR5 A;  3EJG A;  3PEI A;  2AFC A;  5HOL A;  4K0C A;  3ETI A;  4J5R A;  4ETJ A;  1LAP A;  5D8N A;  1LAN A;  3GPO A;  4ABL A;  4X2T A;  3EWO A;  4JGK A;  4GVV A;  2VRI A;  1TY8 A;  4D86 A;  4ZY1 A;  5E3B A;  3JZT A;  3V45 A;  3SIJ A;  2EWB A;  5FSV A;  4ESS A;  4ZX9 A;  3H8E A;  3EJF A;  4JLL A;  3GPQ A;  4K3N A;  5CBM A;  2J9A A;  1HJZ A;  3EW5 A;  3KZW A;  4J5S A;  3SIG A;  2ACF A;  5FSY A;  1SPV A;  5CMS A;  4GVW A;  3H8F A;  3SII A;  3IIF A;  4R76 A;  3EWR A;  5FSX A;  4R6T A;  3KQZ A;  2EEE A;  5FSZ A;  3KQX A;  1BLL E;  5HIH A;  1NJR A;  4R7M A;  2FAV A;  3IJ3 A;  3SIH A;  1LCP A;  3EKE A;  3H8G A;  1BPN A;  1LAM A;  3EWQ A;  4ETK A;  2BFR A;  3GPG A;  3Q71 A;  3Q6Z A;  4TU0 A;  2X47 A;  1GYT A;  4ABK A;  4UML A;  1BPM A;  3JRU A;  3EWP A;  4JCA A;  3T8W A;  1YD9 A;  4ZY0 A;  4J4Z A;  3V2B A;  1TXZ A;  5CB5 A;  2FXK A; 
#chains in the Genus database with same CATH topology
 4JVV A;  3VFQ A;  2XD7 A;  2L8R A;  2BFQ A;  4ZY2 A;  4IQY A;  1ZR5 A;  1ZR3 A;  4KYB A;  4KSI A;  2DX6 A;  3IID A;  3KR4 A;  3GQO A;  2LGR A;  5AIL A;  3GQE A;  2JZE A;  5DUS A;  2FG1 A;  4ZX8 A;  4ZYQ A;  4ZI6 A;  5CB3 A;  4GUA A;  1VHU A;  2WCT A;  5FSU A;  4J5Q A;  3KR5 A;  3EJG A;  3PEI A;  2AFC A;  5HOL A;  4K0C A;  3ETI A;  4J5R A;  4ETJ A;  1LAP A;  5D8N A;  1LAN A;  3GPO A;  4ABL A;  4X2T A;  3EWO A;  4JGK A;  4GVV A;  2VRI A;  1TY8 A;  4D86 A;  2W2G A;  4ZY1 A;  5E3B A;  3JZT A;  3V45 A;  3SIJ A;  2EWB A;  5FSV A;  4ESS A;  4ZX9 A;  3H8E A;  3EJF A;  4JLL A;  3GPQ A;  4K3N A;  5CBM A;  2J9A A;  1HJZ A;  3EW5 A;  3KZW A;  4J5S A;  2JZF A;  2ACF A;  3SIG A;  5FSY A;  1SPV A;  5CMS A;  2JZD A;  4GVW A;  3H8F A;  3SII A;  3IIF A;  4R76 A;  3EWR A;  5FSX A;  4R6T A;  3KQZ A;  2EEE A;  5FSZ A;  3KQX A;  1BLL E;  5HIH A;  1NJR A;  4R7M A;  2FAV A;  3IJ3 A;  3SIH A;  1LCP A;  3EKE A;  3H8G A;  1BPN A;  1LAM A;  3EWQ A;  4ETK A;  2BFR A;  3GPG A;  3Q71 A;  3Q6Z A;  4TU0 A;  2X47 A;  1GYT A;  4ABK A;  4UML A;  2RNK A;  1BPM A;  3JRU A;  3EWP A;  4JCA A;  3T8W A;  1YD9 A;  4ZY0 A;  4J4Z A;  3V2B A;  1TXZ A;  5CB5 A;  2KQV A;  2FXK A; 
#chains in the Genus database with same CATH homology
 4JVV A;  3VFQ A;  2XD7 A;  2L8R A;  2BFQ A;  4ZY2 A;  4IQY A;  1ZR5 A;  1ZR3 A;  4KYB A;  4KSI A;  2DX6 A;  3IID A;  3KR4 A;  3GQO A;  2LGR A;  5AIL A;  3GQE A;  5DUS A;  2FG1 A;  4ZX8 A;  4ZYQ A;  4ZI6 A;  5CB3 A;  4GUA A;  1VHU A;  5FSU A;  4J5Q A;  3KR5 A;  3EJG A;  3PEI A;  2AFC A;  5HOL A;  4K0C A;  3ETI A;  4J5R A;  4ETJ A;  1LAP A;  5D8N A;  1LAN A;  3GPO A;  4ABL A;  4X2T A;  3EWO A;  4JGK A;  4GVV A;  2VRI A;  1TY8 A;  4D86 A;  4ZY1 A;  5E3B A;  3JZT A;  3V45 A;  3SIJ A;  2EWB A;  5FSV A;  4ESS A;  4ZX9 A;  3H8E A;  3EJF A;  4JLL A;  3GPQ A;  4K3N A;  5CBM A;  2J9A A;  1HJZ A;  3EW5 A;  3KZW A;  4J5S A;  3SIG A;  2ACF A;  5FSY A;  1SPV A;  5CMS A;  4GVW A;  3H8F A;  3SII A;  3IIF A;  4R76 A;  3EWR A;  5FSX A;  4R6T A;  3KQZ A;  2EEE A;  5FSZ A;  3KQX A;  1BLL E;  5HIH A;  1NJR A;  4R7M A;  2FAV A;  3IJ3 A;  3SIH A;  1LCP A;  3EKE A;  3H8G A;  1BPN A;  1LAM A;  3EWQ A;  4ETK A;  2BFR A;  3GPG A;  3Q71 A;  3Q6Z A;  4TU0 A;  2X47 A;  1GYT A;  4ABK A;  4UML A;  1BPM A;  3JRU A;  3EWP A;  4JCA A;  3T8W A;  1YD9 A;  4ZY0 A;  4J4Z A;  3V2B A;  1TXZ A;  5CB5 A;  2FXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...