3EKHA

Calcium-saturated gcamp2 t116v/k378w mutant monomer
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
409
structure length
394
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARWMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 137
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ekhA01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ekhA02
5DKRA 3DPXA 1B8RA 1TNWA 3SS0A 2JADA 2O5GA 2CT9A 1DJHA 1YR5A 4W7RA 3DQ1A 2LUCA 1Q4AA 2AUCA 3WLCA 5J3XA 2G3OA 1WRZA 1QIVA 2AWMA 1SNLA 3I5HC 3DD4A 2KI6D 2YDZA 4EN1A 4DKMA 1GGZA 4TZAA 3KPXA 2LNKA 1DJZA 2LMUA 1SCMB 2LCPA 2HF5A 3BXKA 3LF3A 2B3PA 4NQGA 2LANA 1KYPA 1XK4C 5T3IA 5AEQA 5AANA 1IRJA 1Q73A 1XA9A 1NSHA 1OMVA 1V1FA 3SJSA 1ZUZA 3AKOA 4YGAA 5H89A 1DTLA 1NIWA 1YFPA 2V4EA 2H5PA 5DY6A 2KQYA 1TCOB 2LMVA 4L12A 3OSQA 4AR7A 3LK0A 1JFKA 3SSHA 4DUQA 3SVNA 2JU0A 4BY4A 2HGDA 4W6MA 3OX5A 5I2QA 2LVKA 1UHNA 3U0LA 2LE9B 4J8AA 1JSAA 1EMEA 3U0MA 2WISA 4W7EA 4R6BA 1BR1B 4OQWA 4ORAB 3TDUA 4W6CA 3BXAA 5BT0A 3SG6A 1B9CA 4W6KA 3JTDC 4W6SA 5CSJA 2ZKMX 4GOBA 1TIZA 3BX9A 1RM9A 3DQUA 1YZWA 3CBEA 4IK3A 2LUXA 4W6IA 1PULA 5AERA 1K9KA 3CR4X 2HETA 1UHKA 2HQZA 5EB6A 4H47A 1S6IA 1S5GY 1M46A 1K93D 3DQJA 1XSSA 1CDPA 1OMDA 4C0JA 1EMKA 1OXFA 4W73A 1F71A 2GX2A 2EMDA 1VRKA 1N0YA 1CB1A 3ZWHA 5DPHA 3DQCA 1QJTA 2COLB 2KOTA 1NUBA 4MRYA 1L2OB 2ARLA 1LA0A 2POXA 3CGLA 3ST3A 4DXQA 2GX0A 5LTRA 2EC6B 1CFDA 3CS1A 1EG3A 2WHTA 4W6GA 2KDHA 2ZNDA 2A54B 5KU1A 4KW4A 1JC2A 1QYQA 2QLGB 3I5GB 3PM8A 4RYSA 4ZINA 1F54A 2H2KA 4QJ4B 2H9WA 5HKYA 3I19A 4AOMA 1H4UA 3IQQA 4YI8A 1NCYA 4I5JA 4W69A 4W6TA 3PSRA 1H6RA 3LK1A 4MLWA 1BOCA 3GB3A 3SG7A 1QASA 5BTTB 4M2OA 4JRBA 4ETOA 1QATA 3SVRA 2ISDA 1YX8A 5CSIA 1K9PA 2QRFA 3ZNIA 4IK5A 1SBJA 1MOVA 3I5HB 4YGCB 1XA5A 1F09A 3SIBA 1EMAA 1V1GA 3AKBA 4MN0A 3RM1A 4KW8A 2M0RA 1NX0A 1XFXO 1EJ3A 4W74A 1J1DA 2LMTA 2R2IA 4P76A 2OKYA 2K2AA 2VVHA 2EGDA 2P6BB 1S26D 2Z6YA 4AS8A 3O77A 4U2VA 3BQ3A 2VRGA 1UURA 1F55A 2NZ0A 2DD9A 3SSTA 3DPZA 1KP5A 1SK6D 3VRPA 5DTXA 2H5QA 4HRHA 4ZCVA 1CM1A 5I2OA 1DJIA 2QLGA 2HQKA 4IK4A 2D8NA 2L98A 5HZTA 2HGYA 1CM4A 4C0LA 2B3QA 4Q7UA 5HZUA 1GJYA 3HCMA 1OMRA 4IL1A 3JTDB 1ZGQA 2EMOA 2JXLA 1XO5A 3TDZA 5BTTA 4GESB 1F8HA 2IOVA 4JEOA 5G08A 1JFJA 5F6TA 5JOLA 2K7BA 2JULA 2G16B 1CKKA 2B1UA 2G6EA 3OSRA 1JF0A 1DJGA 1MR8A 4DXMA 1WLMA 1MXEA 1JF2A 2WORA 2M9GA 1R2UA 2KNEA 1NYAA 5GQQC 1EH2A 2KGBC 3IQOA 3O4YA 4H3MA 1SMGA 1CV7A 1C07A 3TZ1A 2HRSA 4IK9A 4USLA 4OHSA 2KFGA 1TRFA 2HPWA 3ICBA 1L7ZA 3LVDA 3BYAA 1H8BA 2QACA 5TNCA 3O6BA 5J2OA 1E8AA 3D10A 1GGXA 3VK1A 1OXDA 3ZULA 1HUYA 2WSNA 1JBAA 1JBZA 2GGZA 4PPJA 1OZSA 4ZBLA 3CR5X 4W6OA 1MXLC 3EK4A 4IK1A 4UTSA 4W7AA 1RTP1 1M63B 3GL4A 2HJOA 4HQCA 2JQ6A 4J89A 1EMLA 2I94A 4PDZA 3VRRA 1SL8A 4YRUA 1K9UA 2H61C 3LS3A 2Y4QA 1KYSA 4DCKA 2LP2A 2GV5A 1BF5A 1WRKA 1S5GZ 4I2YA 2NCPA 1Z1PA 2BCXA 3WHUB 4PHJA 1QY3A 4ZCUA 1DMOA 4DXNA 4A4BA 2ZMWA 1F4OA 4JF9A 4KF5C 2ZMUA 1NP8A 2LLSA 4ZF5A 3W1DA 2F2OA 4J88A 3PJBA 1J7RA 4Q9XA 2VVJA 1PVAA 1S3PA 1KQVA 1AVSA 1F0BA 2WNDA 4NDBA 1TOPA 4MSPA 3CR2A 2JNXA 1W7UA 4AQIA 4GF6B 3LA1A 2C9IA 2BBMA 2IB6A 2FJUB 4YGBB 3D0YB 1QX5B 3KCTA 4ORBB 1RK9A 1CLMA 5I2LA 1MHOA 4PCWA 3CFHA 5CPVA 3M24A 1XYDA 3AI4A 3JVTC 1EMCA 3KHEA 2EHBA 1YHIA 3DQFA 2QPTA 1TNPA 2M7NA 3IR8A 1YUUA 2JT3A 4XL5A 1RECA 3DVJA 2NXQA 2OPOA 3M0WA 1IH0A 2M8UA 4KGFA 1QV1A 5HBDA 2O60A 5HLOA 3U8PA 1JBYA 3EKJA 1HT9A 2I18A 1QLKA 1KK8B 2MLEC 4HRGA 2K7DA 1S1EA 3DF0B 3LVCA 1Q4BA 3KF9A 1SCVA 2BE4A 4HQ9A 3W1CA 3LLEA 4L13A 3CGAA 1KYRA 3CZTX 2JTTA 3CTNA 3SSPA 1QVIZ 1ODBA 1ZFSA 2F33A 1K90D 2C9JA 4W6AA 4PE4A 4OJ0A 1FPWA 4QJ3B 2G6YA 4EMQA 2PRUA 5EBJA 4W6NA 2G2SB 2LVJA 3D0YA 1MQ1A 5PALA 2O24A 1OOJA 1B4CA 2ICRA 1SRAA 2NLNA 2MAZA 5KSZA 2OS8C 3MGFA 1XQMA 1RJVA 4TNCA 1BJFA 2JT8A 2KI6C 3H1OA 1Q80A 1NCZA 4OGSA 2LHIA 2WIQA 3GK1A 3QRXA 1LA3A 4WQ2A 3SVUA 4JPZB 5IBWA 2IB5A 4I5LB 1UWOA 2KFHA 3SVBA 5HKZA 4ZF4A 1KFXS 2L2EA 4DKNA 4KAGA 1K8UA 3PALA 3FWBA 2WHUA 1QIWA 1IGVA 1N65A 3CFAA 2BBNA 3WNXB 1KFXL 3DF0A 5DRGA 4Q7RA 4W6HA 2BE6A 1KFUS 2KI4C 2OTEA 4WQ3A 4MZKA 1KWOC 1IJ6A 3ST2A 3PJ5A 1YRUB 1QYOA 1KFUL 5DTLA 1SYMA 3IP2A 2AWLA 2Q91A 4PE7A 1RFJA 2H5RA 1RMPA 2HCGA 2IE2A 4W7DA 4DXPA 4GNKB 4P5OE 4P2YB 3E5TA 1F70A 1B8LA 4LJDA 3I5IC 3JVTB 2KBIA 1FI5A 1C7WA 2CNPA 4HREE 2M7LA 5DQMA 1OZOA 2A50B 1J7PA 1NWDA 5HZOA 3LF4B 5AXIA 1IJ5A 1UHJA 3PATA 2KQ6A 2JNFA 1LVCD 2E30A 3ADFA 1OQPA 3SSYA 1GGWA 5KTYA 1G4YR 3DQIA 4LJBA 2JT0A 2KFFA 2KYFA 3PLFB 4N1GA 1QTXA 1WDCC 1EMMA 1GFLA 2WOSA 4WRIA 4W6FA 4JC2A 3DQKA 2DUIA 1AUIB 1YTZC 1AHRA 3DQ3A 1B47A 1YJFA 5AQBB 1EMFA 1CTRA 1B7TZ 1CFPA 5EXBA 3PJ7A 2Y1MA 2EMNA 4H48A 4KF5A 4L9MA 5KTGA 3DQ4A 3SG5A 2KSPA 2IS9A 3LCPC 1RRXA 2FCEA 3PN7C 2CBLA 2JPTA 3SVEA 4MRXA 1YVHA 4CIDA 2OKWA 3EVPA 3PIBA 4XOVA 1RROA 3DQLA 3AAJA 2L4HA 3TMTA 3SVOA 1W7TA 1XFUO 5DPGA 3TUYC 1QVIY 4NDCA 1DJWA 3OB2B 2LM5A 1M31A 4KW9A 4ZF3A 1IQ5A 3HX4A 1JC0A 4GGFC 3PFVA 1Q4DA 3K1KA 4YI9A 2WC8A 2OTGC 2DDCA 2V53A 2JXCA 5D7FA 2LHLA 4W76A 2OS8B 1MUXA 1RMOA 3FS7A 3TDIA 2SCPA 3CD9A 1FW4A 1YHGA 1K2HA 4I5KA 1PALA 5K89A 4W6JA 1Y1AA 2K2FA 3K21A 3NF0A 3DQDA 3CD1A 2A47A 2L5XB 4W6BA 1MOUA 4C0KA 1A29A 1J1EA 4OKHA 1XFWO 2ZNEA 4Q7TA 4E68A 1KQMC 1Y1XA 1UP5A 3IF7A 3VROA 1DT7B 5FYXA 1QS7A 2KHNA 2Y0GA 2MJWB 2PASA 1IWQA 1YJ2A 4RYWA 1K95A 2YE1A 1EXRA 3BXCA 2M1KB 2KI4B 2JTZA 3DQEA 1PVBA 3TMRA 4ZFSA 1XK4A 2H6VA 1ZUXA 1KWOB 1DVIA 4JQ0D 1BFPA 2LC5A 1SCMC 1FI6A 4H3LA 5EJUA 3DQNA 1QYFA 3SSKA 5DPIA 4Z4MA 5HLVA 5B8IB 2H5OA 2GW3A 2WSOA 3NT9A 2Q57A 4OY4A 2ZRSA 2AAOA 5JJGA 3AAKA 3DQ5A 4GPLB 1TNXA 1XFZO 3I5IB 2AWKA 1WLZA 1SPYA 1YX7A 2LV7A 2DDDA 1RMMA 3LSAA 2KBMA 1BLQA 3ZUJA 2A56B 1H4BA 3DQ2A 1S6CA 5BQLA 4W7CA 4TZGA 2MLFC 1M45A 1B8CA 4Q04A 3E5VA 1C7VA 1XFVO 2GGMA 4LW5A 2FCDA 4NWSA 1QXTA 2PXWA 3CB9A 3M22A 1KK7Z 4W6LA 1DGUA 5F9GA 1LINA 4W6RA 2HQWA 4GUKA 1B7TY 3EKHA 1YUTA 3PN7B 3KO0A 5DQBA 4FTGA 1KSMA 3BUWB 3RLZA 4ANJA 2LP3A 1Z1QA 1WY9A 1C4FA 5HZSA 1CNPA 1NX1A 3OHMB 1JWDA 3CFFA 2OJKA 2Z1OA 4ORCB 2VAEA 2ZRTA 1JC1A 2OTGB 4FQOA 2WCFA 5I8NA 1DJXA 1R6PA 1YHHA 3KEVA 1AK8A 3ST4A 3RWAA 1SR6C 4F0ZB 4YGDB 2FZUA 1BODA 3WXAA 1CMGA 4I5NB 3LVAA 3NT3A 3P8UA 4DXOA 3A4UB 3SSVA 1CFCA 1EMGA 1FF1A 3WHTB 2F2PA 1N2DA 3NSOA 2KAXA 2CXJA 4A4CA 5DTYA 4EDOA 1KQMB 3BUMB 2JOJA 2QLHA 1AJ4A 2MRDA 4XJKB 1NX3A 1CLBA 5HGEA 3U8AA 1BT6A 4CFQA 2RH7A 1CDNA 3DQAA 4PPKA 2DOQA 1XAEA 1X02A 5BPJA 1MF8B 3DVMA 3DPWA 5DKQA 4W7XA 4JFGA 3EK7A 2DUEA 5EB7A 5EXUA 3DQMA 2AHAA 5EHUA 2YE0A 1G33A 4ICBA 2K8MB 1IG5A 2ZN8A 3SVDA 1DJYA 2GW4B 3GEXA 4IZNA 1D1OA 3G9AA 1GQMA 2ZFDA 3C1VA 4OR9B 3VRQA 4OVNF 1PK0D 2L0PA 1CMFA 3I5FC 1A75B 3GK2A 1XMZA 1JUOA 5CSFA 4MZLA 4M2PA 3TS5C 4IK8A 1W7JB 4BDUA 2HPSA 3DQ8A 4HVFA 1ZGPA 4B5YA 4GGFA 3FIAA 2BL0C 4HSZA 4PE0A 5FVFA 1ZMZA 1PSRA 4QJ5B 1KSOA 1LKJA 2BCAA 2MBXA 2KYCA 3OP0A 3A8RA 1HCJA 4NDDA 1DF0B 1ZACA 3GK4X 1SL9A 2KGRA 4YBHB 4XGYA 2VZXA 1W7SA 4OCIA 5LTPA 2O29A 3FWCA 4U8DA 4GFTA 1OSAA 4ZIOA 3DVKA 3ZTFA 1MWNA 2FL1A 3SVCA 4PE1A 4XJKA 2LLTA 3UG0A 2I2RE 2KAVA 2M1UA 1IQ3A 1HQVA 3DQHA 4EDSA 1ALWA 1KK7Y 2SASA 2PSRA 1J55A 3RWTA 3U0NA 3NEDA 2Q6PA 3WCKA 1SW8A 1WRLA 2H8QA 4DS7A 1XFYO 3F45A 1UISA 3CWGA 2F3YA 2JRFA 4R6DA 1DGVA 2A52B 4KF4A 4LQUA 3A8SA 3BXBA 2LAPA 2WCBA 1KCYA 4PPLA 1EMBA 3BUXB 1YVLA 1J7QA 2K61A 1A75A 4ORNA 4GGNA 4CFRA 4ZB1A 4LQTA 1MYWA 2Y1NA 2WHSA 5DRFA 2OTBA 2G2BA 5LK4A 2NCOA 1A4PA 2ZN9A 1SR6B 3U8CA 2BKHB 2F8PA 3SSLA 2Q4UA 3NSIA 3SG2A 4DRWA 2BCBA 3NXAA 3P28A 1DF0A 2QLIA 1B1GA 2I7AA 1Q4CA 3SV5A 2H61A 2KAYA 3MSEB 1M39A 1CDMA 3SG3A 1UHHA 2G5ZB 5DPJA 4XOWA 3OGOA 1K96A 4W6UA 5EXCI 4UPGA 3ED8A 1FBVA 1AP4A 3O78A 3SVSA 4N3DA 2DD7A 1SKTA 4JWQA 4MVFA 4YGEB 5H87A 1A2XA 3AI5A 4MEWA 3GJ2A 4D1EA 2P4MA 2A53B 1W7IB 2PVBA 4KA9A 3DQ9A 2G6XA 1S6JA 1QLSA 1K94A 1LXFC 3VHTB 2WCEA 2BTJA 1BG1A 1Q4EA 2LVIA 2OGRA 2V4EC 2AWJA 4HE4A 1CFFA 2L50A 3I5FB 1XVJA 5AFPA 2VADA 3TS5B 2E6WA 3VRNA 2M29A 4P1QA 1CDLA 1S6ZA 5FVIA 2JZIA 2BL0B 4W7FA 2PXSA 3BOWB 3DQ6A 4JGEA 5LTQA 3VICA 1IKUA 3BUNB 2A4JA 4KEXA 2LVVA 3OB1B 3O2PA 2A48A 1U5IB 1PSBA 3U0KA 1UUSA 2FOTA 3EVUA 2PALA 4BY5A 2A46A 3DQOA 1PRWA 2QLEA 2CCMA 2AMIA 1Y6WA 2HFCA 2L4IA 2BKIB 1F4QA 4HQ8A 2G9BA 1QX7A 4L1IA 4OV2A 2ZO7A 1QX2A 3EK8A 2MHHA 2M49B 4KPIA 4CPVA 3VGOA 3ZUFA 1YURA 1SL7A 3ST0A 1NCXA 3DVEA 5FHVA 1TTXA 1AJ5A 1A03A 4PHMA 4W72A 1OE9B 4GBAA 3GJ1A 4DXIA 3SIAA 4N1FA 5FVGA 3CLNA 5CSNA 1KK8C 1EL4A 5H88A 4Z4KA 2LLUA 2RGIA 3VHTA 2JWWA 2JC2A 3SG4A 4N5XA 1NPQA 2QT2A 3OX6A 2Z6ZA 1ZGOA 1SY9A 2K0JA 3UFZA 3SRYA 3AKAA 3NEZA 1ZOTB 3S05A 1NX2A 2YFPA 2CTNA 4W75A 4EULA 4B30B 2F3ZA 4W6DA 3NSLA 1Y0VH 5HW9A 3E5WA 1TNQA 1B9AA 2VVIA 1Y1UA 4GAOA 4LJDC 4MBEA 3BOWA 1QXPA 4H3NA 4LJCA 2K7CA 3GOFA 2TN4A 2AH8A 1OXEA 4R1EA 3LL8B 3NSKA 5HYDA 4PFEA 1TN4A 5ER5A 2L51A 2M3WA 1U5IA 1G8IA 1ALVA 4XYNA 5HKWA 1GL4A 2MA2A 2G3DB 4PHKA 2WURA 2ZO6A 1WDCB 5ER4X 5DKNA 1G7KA 1QV0A 5DTZA 4PHNA 2M97A 2FWQA 3V3DA 4M2QA 3DQ7A 2Z6XA 2DUGA 4PALA 1UHIA 1CLLA 4MZJA 2QZ0A 1J7OA 4W77A 3H4SE 4XVPA 1YRTB 1BU3A 3E3RA 1S36A 3EVRA 1YUSA 1RWYA 1BMOA 3BUOB 2PMYA 1EG4A 3KCSA 5D69A 4DIRA 2V4EB 3TUYB 2QU1A 2BECA 3EVVA 1L2OC 2O2BA 2HQ8A 4Q9WA 2K7OA 1BR4B 2Y5IA 2DUFA 4AQJA 3H1RA 2EC6C 5DU0A 4W6PA 4CLNA 4B30A 1TCFA 2DUHA 4KGEA 4RTCA 3WLDA 3I5GC
chains in the Genus database with same CATH superfamily
5DKRA 3DPXA 1B8RA 1TNWA 3SS0A 2JADA 2O5GA 2CT9A 1DJHA 1YR5A 4W7RA 3DQ1A 2LUCA 1Q4AA 3CDNA 2AUCA 3WLCA 5J3XA 2G3OA 1WRZA 1QIVA 2AWMA 1SNLA 3I5HC 3DD4A 2KI6D 2YDZA 4EN1A 4DKMA 1GGZA 4TZAA 5FI7A 3KPXA 2LNKA 1DJZA 2LMUA 1SCMB 2LCPA 2HF5A 3BXKA 3LF3A 1XFRA 3S0AA 2B3PA 4NQGA 2LANA 1KYPA 1XK4C 5T3IA 5AEQA 5AANA 1IRJA 1Q73A 1XA9A 1NSHA 1OMVA 1V1FA 3SJSA 1ZUZA 3AKOA 4YGAA 5H89A 1DTLA 1NIWA 1YFPA 2V4EA 2H5PA 3D73A 5DY6A 2KQYA 1TCOB 2LMVA 4L12A 3OSQA 4AR7A 3LK0A 4INWA 1JFKA 3SSHA 4DUQA 3SVNA 2JU0A 4BY4A 2HGDA 4W6MA 3OX5A 5I2QA 2LVKA 3EG5B 1UHNA 3U0LA 2LE9B 4J8AA 1JSAA 1EMEA 3U0MA 2WISA 4W7EA 4R6BA 1BR1B 4OQWA 4ORAB 3TDUA 4W6CA 3BXAA 5BT0A 3SG6A 1OOFA 1B9CA 4W6KA 3JTDC 4W6SA 5CSJA 2ZKMX 4GOBA 1TIZA 3BX9A 1RM9A 3DQUA 1YZWA 3CBEA 1OOGA 4IK3A 2LUXA 1PULA 4W6IA 3CYZA 5AERA 1K9KA 3CR4X 3FE8A 2HETA 1UHKA 2HQZA 5EB6A 4H47A 1S6IA 1S5GY 1M46A 1K93D 3DQJA 1XSSA 1CDPA 1OMDA 4C0JA 1EMKA 1OXFA 4W73A 1F71A 2GX2A 3CZ1A 2EMDA 1VRKA 1N0YA 1CB1A 3ZWHA 5DPHA 3DQCA 1QJTA 2COLB 2KOTA 1NUBA 4MRYA 2GTEA 1L2OB 2ARLA 1LA0A 2POXA 3CGLA 3ST3A 3OGNA 3QMEA 2GX0A 4DXQA 5LTRA 2EC6B 1CFDA 3CS1A 1EG3A 2WHTA 4W6GA 2KDHA 2ZNDA 2A54B 5KU1A 4KW4A 1JC2A 2WC5A 1QYQA 2QLGB 3I5GB 3PM8A 4RYSA 4ZINA 1F54A 2H2KA 4QJ4B 2H9WA 5HKYA 3I19A 4AOMA 1H4UA 3IQQA 4YI8A 1NCYA 4I5JA 4W69A 4W6TA 3PSRA 1H6RA 3LK1A 4MLWA 1BOCA 3GB3A 3SG7A 1QASA 5BTTB 4M2OA 4JRBA 4ETOA 1QATA 3SVRA 2ISDA 1YX8A 1DQEA 5CSIA 1K9PA 2QRFA 3ZNIA 4IK5A 1SBJA 1MOVA 3I5HB 4YGCB 1XA5A 1F09A 3SIBA 1EMAA 3DYEA 1V1GA 3O4XA 3AKBA 4MN0A 3RM1A 4KW8A 2M0RA 3DY9A 1NX0A 1XFXO 1EJ3A 4W74A 1J1DA 2LMTA 2R2IA 4P76A 2OKYA 2K2AA 2VVHA 2EGDA 2P6BB 1S26D 2PQLA 3SS5A 2Z6YA 3R72A 3FE6A 4AS8A 3FE9A 3O77A 4U2VA 3BQ3A 2VRGA 1UURA 1F55A 2NZ0A 2DD9A 3SSTA 3DPZA 1KP5A 1SK6D 3VRPA 5DTXA 2H5QA 4HRHA 5FI2A 4ZCVA 1CM1A 5I2OA 1DJIA 2QLGA 2HQKA 4IK4A 2D8NA 2L98A 5HZTA 3BJHA 2HGYA 1CM4A 4PT1A 4C0LA 2B3QA 4Q7UA 5HZUA 1GJYA 3HCMA 1C3YA 1OMRA 4IL1A 3JTDB 1ZGQA 2EMOA 2JXLA 1XO5A 3D75A 3TDZA 5BTTA 4GESB 1F8HA 2IOVA 4JEOA 5G08A 1JFJA 5F6TA 5JOLA 2K7BA 2G16B 2JULA 1CKKA 2B1UA 2G6EA 3OSRA 1JF0A 1DJGA 1MR8A 4DXMA 1WLMA 1MXEA 1JF2A 2WORA 2M9GA 1R2UA 2KNEA 1NYAA 5GQQC 1EH2A 2KGBC 3IQOA 3O4YA 4H3MA 1SMGA 1CV7A 1C07A 3TZ1A 2HRSA 1Z4HA 4IK9A 1GM0A 4USLA 4OHSA 2KFGA 1TRFA 2HPWA 3ICBA 1L7ZA 3LVDA 3BYAA 1H8BA 3DZTA 2QACA 5TNCA 3O6BA 5J2OA 1E8AA 3D10A 1GGXA 3VK1A 1OXDA 3ZULA 1HUYA 3D74A 2WSNA 1JBAA 1JBZA 2GGZA 4PPJA 1OZSA 1DC1A 4ZBLA 2H8VA 1SSEB 3CR5X 1MXLC 3EK4A 4W6OA 4IK1A 4JD9A 4UTSA 4W7AA 1RTP1 1M63B 3GL4A 2BAPA 2HJOA 4HQCA 2JQ6A 4J89A 3B7AA 1EMLA 2I94A 2WCKA 4PDZA 3VRRA 1DELA 1SL8A 4YRUA 1OOIX 1K9UA 2H61C 3LS3A 2Y4QA 1KYSA 4DCKA 2LP2A 2GV5A 1BF5A 1WRKA 1S5GZ 4I2YA 2NCPA 1TUZA 1ORGA 1Z1PA 2BCXA 3WHUB 4PHJA 1QY3A 4ZCUA 3NHTA 1DMOA 4DXNA 4A4BA 2ZMWA 1F4OA 4JF9A 3VB1A 4KF5C 2ZMUA 1NP8A 3BFHA 2LLSA 4ZF5A 3W1DA 2F2OA 4J88A 3PJBA 1J7RA 4Q9XA 2VVJA 1PVAA 3DXLA 1S3PA 1KQVA 1AVSA 1F0BA 2WNDA 4NDBA 1TOPA 4MSPA 3B87A 2FJYA 3CR2A 2JNXA 1W7UA 4AQIA 4GF6B 3LA1A 2C9IA 2BBMA 2L5YA 2IB6A 2FJUB 4YGBB 3D0YB 1QX5B 3KCTA 4ORBB 5I94A 1RK9A 1CLMA 5I2LA 1C3ZA 3B88A 1MHOA 4PCWA 3CFHA 5CPVA 3M24A 1XYDA 3AI4A 3JVTC 1EMCA 3UNWA 3KHEA 2EHBA 1YHIA 3DQFA 1TWOA 2QPTA 1TNPA 2M7NA 3IR8A 1YUUA 2JT3A 4XL5A 1RECA 3DVJA 2NXQA 2OPOA 3M0WA 1IH0A 2M8UA 3R1VA 4KGFA 1QV1A 5HBDA 2O60A 5HLOA 5D3OA 3U8PA 1JBYA 3EKJA 1HT9A 2I18A 1QLKA 3UO9A 1KK8B 2MLEC 4HRGA 2K7DA 1S1EA 3DF0B 3LVCA 1Q4BA 3KF9A 1Z2CB 1SCVA 2BE4A 4HQ9A 3W1CA 3D77A 3LLEA 4L13A 3CGAA 1KYRA 3CZTX 2JTTA 3CTNA 3SSPA 1QVIZ 1ODBA 1ZFSA 2F33A 1K90D 2C9JA 3L4LA 4W6AA 4PE4A 4OJ0A 1FPWA 4QJ3B 2G6YA 4EMQA 2PRUA 5EBJA 4W6NA 2G2SB 1LS8A 2LVJA 3D0YA 1MQ1A 5PALA 2O24A 1OOJA 1B4CA 2ICRA 1SRAA 2NLNA 2MAZA 5KSZA 2OS8C 3MGFA 1XQMA 3B6XA 1RJVA 4TNCA 1BJFA 2JT8A 2KI6C 3H1OA 3L4AA 1Q80A 1NCZA 4OGSA 2LHIA 2WIQA 3GK1A 3QRXA 1LA3A 4WQ2A 3SVUA 4JPZB 5IBWA 2IB5A 4I5LB 4IJ7A 1UWOA 2KFHA 3SVBA 5HKZA 4ZF4A 1KFXS 2L2EA 4DKNA 4KAGA 1K8UA 3PALA 3FWBA 2WHUA 1QIWA 1IGVA 1N65A 3CFAA 2BBNA 3WNXB 5HL1A 1KFXL 3CZ2A 3DF0A 5DRGA 4Q7RA 1P28A 4W6HA 2BE6A 1KFUS 4JKTA 2KI4C 2OTEA 4WQ3A 3R1PA 4MZKA 1KWOC 1IJ6A 3ST2A 3PJ5A 1YRUB 1QYOA 2K60A 1KFUL 5DTLA 1SYMA 3IP2A 2AWLA 2Q91A 4PE7A 3RZSA 1RFJA 2H5RA 1RMPA 2HCGA 2IE2A 4W7DA 4DXPA 4GNKB 4P5OE 4P2YB 3E5TA 1F70A 1B8LA 4LJDA 3I5IC 3S0EA 3JVTB 2KBIA 1FI5A 3IVTA 1C7WA 2CNPA 4HREE 2M7LA 5DQMA 1OZOA 2A50B 1J7PA 1NWDA 5HZOA 3LF4B 5AXIA 1IJ5A 1UHJA 3PATA 2KQ6A 2JNFA 1LVCD 2E30A 3ADFA 1OQPA 3SSYA 1GGWA 5KTYA 2JPOA 1G4YR 3DQIA 4LJBA 2JT0A 2KFFA 3K1EA 2KYFA 3PLFB 4N1GA 1QTXA 1WDCC 1EMMA 1GFLA 2WOSA 4WRIA 4W6FA 2DUIA 3DQKA 4JC2A 1AUIB 1YTZC 1AHRA 3DQ3A 1B47A 1YJFA 5AQBB 1EMFA 1CTRA 1B7TZ 1CFPA 5EXBA 3PJ7A 2Y1MA 2EMNA 4H48A 4KF5A 4L9MA 5KTGA 3DQ4A 3SG5A 2KSPA 2IS9A 3LCPC 1RRXA 2FCEA 3PN7C 2CBLA 2JPTA 3SVEA 4MRXA 1YVHA 2QEOA 4CIDA 2OKWA 3S0BA 3EVPA 3PIBA 4XOVA 1RROA 3DQLA 3AAJA 1OOHA 2L4HA 2QEVA 3TMTA 3S0GA 3SVOA 1W7TA 1XFUO 2KLEA 5DPGA 3TUYC 1QVIY 4NDCA 1DJWA 3OB2B 3SS3A 2LM5A 1M31A 4KW9A 4ZF3A 1IQ5A 3HX4A 1JC0A 4GGFC 3PFVA 1Q4DA 3K1KA 4YI9A 2WC8A 2OTGC 2DDCA 2V53A 2JXCA 5D7FA 2LHLA 4W76A 2OS8B 1MUXA 1RMOA 3FS7A 3TDIA 2SCPA 3CD9A 1FW4A 1YHGA 1K2HA 5DICA 4I5KA 1PALA 5K89A 4W6JA 1Y1AA 2K2FA 3K21A 3NF0A 3DQDA 3CD1A 2A47A 2L5XB 4W6BA 1MOUA 4C0KA 1A29A 1J1EA 4OKHA 1XFWO 2ZNEA 2WCMA 4Q7TA 4E68A 1KQMC 1Y1XA 1UP5A 3IF7A 3VROA 3V2LA 1DT7B 5FYXA 1QS7A 2KHNA 2Y0GA 2MJWB 2PASA 1IWQA 1YJ2A 4RYWA 1K95A 2YE1A 1EXRA 3BXCA 2M1KB 2KI4B 2JTZA 3DQEA 1PVBA 3TMRA 4ZFSA 1W9ZA 1XK4A 2H6VA 1ZUXA 1KWOB 1DVIA 4JQ0D 1BFPA 2LC5A 1SCMC 1FI6A 4H3LA 5EJUA 3DQNA 1QYFA 3SSKA 5DPIA 4Z4MA 3Q8IA 3BFAA 5HLVA 5B8IB 2H5OA 2KPHA 2GW3A 2WSOA 3NT9A 1TUJA 3CABA 2Q57A 4OY4A 2ZRSA 2AAOA 5JJGA 3AAKA 3DQ5A 4GPLB 1TNXA 1XFZO 3I5IB 2AWKA 1WLZA 1SPYA 1YX7A 2LV7A 2DDDA 1RMMA 3LSAA 2KBMA 1BLQA 3ZUJA 2A56B 1H4BA 3DQ2A 1S6CA 5BQLA 3NHIA 4W7CA 4TZGA 2MLFC 1M45A 1B8CA 4Q04A 3E5VA 4OZDA 1C7VA 1XFVO 2GGMA 4LW5A 2FCDA 4NWSA 1QXTA 2PXWA 3CB9A 3M22A 1KK7Z 4W6LA 1DGUA 5F9GA 1LINA 4W6RA 3N7HA 2HQWA 2WCJA 4GUKA 1B7TY 3EKHA 1YUTA 3PN7B 3KO0A 2YGUA 5DQBA 4FTGA 1KSMA 3BUWB 2BNXA 3RLZA 4ANJA 2LP3A 1Z1QA 1WY9A 1C4FA 5HZSA 1CNPA 1NX1A 3OHMB 1JWDA 3CFFA 2OJKA 2Z1OA 4ORCB 2VAEA 2ZRTA 1JC1A 2OTGB 4FQOA 2L2CA 2WCFA 5I8NA 1DJXA 1R6PA 1YHHA 3KEVA 1AK8A 3ST4A 3RWAA 1SR6C 4F0ZB 4YGDB 2FZUA 1BODA 3WXAA 1CMGA 4I5NB 3LVAA 3NT3A 3P8UA 4DXOA 3A4UB 3SSVA 1CFCA 1EMGA 1FF1A 3WHTB 2F2PA 1N2DA 3NSOA 2KAXA 2CXJA 4A4CA 5DTYA 4EDOA 1KQMB 5EL2A 3BUMB 2JOJA 2QLHA 1AJ4A 2MRDA 4XJKB 3D78A 1NX3A 1CLBA 5HGEA 3U8AA 4INXA 2P71A 1BT6A 2QEHA 4CFQA 2RH7A 1CDNA 3DQAA 4PPKA 2DOQA 1XAEA 1X02A 5BPJA 1MF8B 3DVMA 3DPWA 1DEKA 5DKQA 4W7XA 4JFGA 3EK7A 2DUEA 5EB7A 5EXUA 3DQMA 2AHAA 5EHUA 4F7FA 2YE0A 1G33A 4ICBA 2K8MB 1IG5A 2ZN8A 3SVDA 1DJYA 2GW4B 3GEXA 4IZNA 1D1OA 3G9AA 1GQMA 2ZFDA 3C1VA 4OR9B 3VRQA 4OVNF 1PK0D 2L0PA 1CMFA 3I5FC 1A75B 3GK2A 1XMZA 3R1OA 1JUOA 5CSFA 4MZLA 4M2PA 3TS5C 4IK8A 1W7JB 4BDUA 2QEBA 2HPSA 3DQ8A 4HVFA 1ZGPA 4B5YA 4GGFA 3FIAA 2BL0C 4HSZA 4PE0A 5FVFA 1ZMZA 2KLDA 1PSRA 4QJ5B 1KSOA 1LKJA 2BCAA 2MBXA 2KYCA 3OP0A 3A8RA 1HCJA 4NDDA 1DF0B 1ZACA 3GK4X 1SL9A 2KGRA 2P70A 4YBHB 4XGYA 2VZXA 1W7SA 4OCIA 2WCLA 5LTPA 2O29A 3FWCA 4U8DA 4GFTA 1OSAA 4ZIOA 3DVKA 3ZTFA 1MWNA 3S0DA 2FL1A 3SVCA 4PE1A 4XJKA 2LLTA 3UG0A 2I2RE 2KAVA 2M1UA 1IQ3A 1HQVA 3DQHA 4EDSA 1ALWA 1KK7Y 2SASA 2PSRA 1J55A 3RWTA 3U0NA 3S0FA 3NEDA 2Q6PA 3WCKA 1SW8A 1WRLA 2H8QA 4DS7A 1XFYO 3F45A 1UISA 3CWGA 2F3YA 2JRFA 4R6DA 1DGVA 2A52B 4KF4A 4LQUA 3A8SA 3BXBA 2LAPA 2WCBA 1KCYA 4PPLA 1EMBA 3BUXB 1YVLA 1J7QA 2K61A 1A75A 4ORNA 4GGNA 4CFRA 3BFBA 4ZB1A 4LQTA 1MYWA 2Y1NA 2WHSA 5DRFA 2OTBA 4KYNA 2G2BA 5LK4A 2NCOA 1A4PA 2ERBA 2ZN9A 1SR6B 3U8CA 2BKHB 2F8PA 3SSLA 2Q4UA 3NSIA 3SG2A 4DRWA 2BCBA 3NXAA 3SS4A 3P28A 1DF0A 2QLIA 1B1GA 2I7AA 1Q4CA 3SV5A 2H61A 2KAYA 3MSEB 1M39A 1CDMA 3SG3A 1UHHA 2G5ZB 3NGVA 5DPJA 4XOWA 3OGOA 1K96A 4W6UA 5EXCI 4UPGA 3ED8A 2WCHA 1FBVA 1AP4A 3O78A 3SVSA 4N3DA 2DD7A 1SKTA 4JWQA 4MVFA 4YGEB 5H87A 1A2XA 3AI5A 4MEWA 3GJ2A 4D1EA 2P4MA 2A53B 1W7IB 2PVBA 4KA9A 3DQ9A 2G6XA 1S6JA 1QLSA 1K94A 1LXFC 3VHTB 2WCEA 2BTJA 1BG1A 1Q4EA 2LVIA 2OGRA 3L47A 2V4EC 2AWJA 4HE4A 1CFFA 2L50A 3I5FB 1XVJA 5AFPA 2VADA 3TS5B 2E6WA 3VRNA 2M29A 4P1QA 1CDLA 1S6ZA 5FVIA 1T14A 2BL0B 2JZIA 2PXSA 4W7FA 3BOWB 3DQ6A 4JGEA 5LTQA 3VICA 1IKUA 3BUNB 3OBVA 2A4JA 4KEXA 2LVVA 3OB1B 3O2PA 2A48A 1U5IB 1PSBA 3U0KA 1UUSA 2FOTA 3EVUA 2PALA 4BY5A 2A46A 3DQOA 1PRWA 2WC6A 2CCMA 2QLEA 2AMIA 1Y6WA 2HFCA 2L4IA 2BKIB 1F4QA 4HQ8A 2G9BA 1QX7A 4L1IA 4OV2A 2ZO7A 1QX2A 3EK8A 2MHHA 2M49B 4KPIA 4CPVA 3VGOA 3ZUFA 1YURA 1SL7A 3ST0A 1NCXA 3DVEA 5FHVA 1TTXA 1AJ5A 1A03A 4PHMA 4W72A 1OE9B 4GBAA 3GJ1A 4DXIA 3SIAA 3D76A 4N1FA 5FVGA 3CLNA 5CSNA 1KK8C 1EL4A 5H88A 5FI6A 4FQTA 4Z4KA 2LLUA 2RGIA 3VHTA 2JWWA 2JC2A 3SG4A 4N5XA 1NPQA 2QT2A 3OX6A 2Z6ZA 1ZGOA 1SY9A 2K0JA 3UFZA 3SRYA 3AKAA 3NEZA 1ZOTB 3S05A 1NX2A 2YFPA 2CTNA 4W75A 4EULA 4B30B 2F3ZA 4W6DA 3NSLA 1Y0VH 2QDIA 3E5WA 5HW9A 1TNQA 1B9AA 2VVIA 3PM2A 1Y1UA 4GAOA 4LJDC 4MBEA 3BOWA 1QXPA 4H3NA 4LJCA 2K7CA 3GOFA 2TN4A 2AH8A 1OXEA 4R1EA 3LL8B 3NSKA 5HYDA 4PFEA 1TN4A 5ER5A 2L51A 1QWVA 2M3WA 1U5IA 3B86A 1G8IA 1ALVA 4XYNA 5HKWA 1GL4A 2MA2A 2G3DB 4PHKA 2WURA 2ZO6A 1WDCB 5ER4X 5DKNA 1G7KA 1QV0A 5DTZA 4PHNA 2M97A 1IIOA 2FWQA 3V3DA 4M2QA 3DQ7A 2Z6XA 2DUGA 4PALA 1UHIA 3CZ0A 1CLLA 4MZJA 2QZ0A 1J7OA 4W77A 3H4SE 4XVPA 1YRTB 1BU3A 3E3RA 1S36A 3EVRA 1YUSA 1RWYA 1BMOA 3BUOB 2PMYA 3PJIA 1EG4A 3KCSA 5D69A 4DIRA 2V4EB 3TUYB 2QU1A 1OW4A 2BECA 3EVVA 1L2OC 2O2BA 2HQ8A 4Q9WA 2K7OA 1BR4B 2Y5IA 2DUFA 4AQJA 3H1RA 2EC6C 5DU0A 4W6PA 4CLNA 4B30A 2PYQA 1TCFA 2DUHA 4KGEA 4RTCA 3WLDA 3I5GC
chains in the Genus database with same CATH topology
5DKRA 3DPXA 1B8RA 1TNWA 3SS0A 2JADA 2O5GA 2CT9A 1DJHA 1YR5A 4W7RA 3DQ1A 2LUCA 1Q4AA 2AUCA 3WLCA 5J3XA 2G3OA 1WRZA 1QIVA 2AWMA 1SNLA 3I5HC 3DD4A 2KI6D 2YDZA 4EN1A 4DKMA 1GGZA 4TZAA 3KPXA 2LNKA 1DJZA 2LMUA 1SCMB 2LCPA 2HF5A 3BXKA 3LF3A 2B3PA 4NQGA 2LANA 1KYPA 1XK4C 5T3IA 5AEQA 5AANA 1IRJA 1Q73A 1XA9A 1NSHA 1OMVA 1V1FA 3SJSA 1ZUZA 3AKOA 4YGAA 5H89A 1DTLA 1NIWA 1YFPA 2V4EA 2H5PA 5DY6A 2KQYA 1TCOB 2LMVA 4L12A 3OSQA 4AR7A 3LK0A 1JFKA 3SSHA 4DUQA 3SVNA 2JU0A 4BY4A 2HGDA 4W6MA 3OX5A 5I2QA 2LVKA 1UHNA 3U0LA 2LE9B 4J8AA 1JSAA 1EMEA 3U0MA 2WISA 4W7EA 4R6BA 1BR1B 4OQWA 4ORAB 3TDUA 4W6CA 3BXAA 5BT0A 3SG6A 1B9CA 4W6KA 3JTDC 4W6SA 5CSJA 2ZKMX 4GOBA 1TIZA 3BX9A 1RM9A 3DQUA 1YZWA 3CBEA 4IK3A 2LUXA 4W6IA 1PULA 5AERA 1K9KA 3CR4X 2HETA 1UHKA 2HQZA 5EB6A 4H47A 1S6IA 1S5GY 1M46A 1K93D 3DQJA 1XSSA 1CDPA 1OMDA 4C0JA 1EMKA 1OXFA 4W73A 1F71A 2GX2A 2EMDA 1VRKA 1N0YA 1CB1A 3ZWHA 5DPHA 3DQCA 1QJTA 2COLB 2KOTA 1NUBA 4MRYA 1L2OB 2ARLA 1LA0A 2POXA 3CGLA 3ST3A 4DXQA 2GX0A 5LTRA 2EC6B 1CFDA 3CS1A 1EG3A 2WHTA 4W6GA 2KDHA 2ZNDA 2A54B 5KU1A 4KW4A 1JC2A 1QYQA 2QLGB 3I5GB 3PM8A 4RYSA 4ZINA 1F54A 2H2KA 4QJ4B 2H9WA 5HKYA 3I19A 4AOMA 1H4UA 3IQQA 4YI8A 1NCYA 4I5JA 4W69A 4W6TA 3PSRA 1H6RA 3LK1A 4MLWA 1BOCA 3GB3A 3SG7A 1QASA 5BTTB 4M2OA 4JRBA 4ETOA 1QATA 3SVRA 2ISDA 1YX8A 5CSIA 1K9PA 2QRFA 3ZNIA 4IK5A 1SBJA 1MOVA 3I5HB 4YGCB 1XA5A 1F09A 3SIBA 1EMAA 1V1GA 3AKBA 4MN0A 3RM1A 4KW8A 2M0RA 1NX0A 1XFXO 1EJ3A 4W74A 1J1DA 2LMTA 2R2IA 4P76A 2OKYA 2K2AA 2VVHA 2EGDA 2P6BB 1S26D 2Z6YA 4AS8A 3O77A 4U2VA 3BQ3A 2VRGA 1UURA 1F55A 2NZ0A 2DD9A 3SSTA 3DPZA 1KP5A 1SK6D 3VRPA 5DTXA 2H5QA 4HRHA 4ZCVA 1CM1A 5I2OA 1DJIA 2QLGA 2HQKA 4IK4A 2D8NA 2L98A 5HZTA 2HGYA 1CM4A 4C0LA 2B3QA 4Q7UA 5HZUA 1GJYA 3HCMA 1OMRA 4IL1A 3JTDB 1ZGQA 2EMOA 2JXLA 1XO5A 3TDZA 5BTTA 4GESB 1F8HA 2IOVA 4JEOA 5G08A 1JFJA 5F6TA 5JOLA 2K7BA 2JULA 2G16B 1CKKA 2B1UA 2G6EA 3OSRA 1JF0A 1DJGA 1MR8A 4DXMA 1WLMA 1MXEA 1JF2A 2WORA 2M9GA 1R2UA 2KNEA 1NYAA 5GQQC 1EH2A 2KGBC 3IQOA 3O4YA 4H3MA 1SMGA 1CV7A 1C07A 3TZ1A 2HRSA 4IK9A 4USLA 4OHSA 2KFGA 1TRFA 2HPWA 3ICBA 1L7ZA 3LVDA 3BYAA 1H8BA 2QACA 5TNCA 3O6BA 5J2OA 1E8AA 3D10A 1GGXA 3VK1A 1OXDA 3ZULA 1HUYA 2WSNA 1JBAA 1JBZA 2GGZA 4PPJA 1OZSA 4ZBLA 3CR5X 4W6OA 1MXLC 3EK4A 4IK1A 4UTSA 4W7AA 1RTP1 1M63B 3GL4A 2HJOA 4HQCA 2JQ6A 4J89A 1EMLA 2I94A 4PDZA 3VRRA 1SL8A 4YRUA 1K9UA 2H61C 3LS3A 2Y4QA 1KYSA 4DCKA 2LP2A 2GV5A 1BF5A 1WRKA 1S5GZ 4I2YA 2NCPA 1Z1PA 2BCXA 3WHUB 4PHJA 1QY3A 4ZCUA 1DMOA 4DXNA 4A4BA 2ZMWA 1F4OA 4JF9A 4KF5C 2ZMUA 1NP8A 2LLSA 4ZF5A 3W1DA 2F2OA 4J88A 3PJBA 1J7RA 4Q9XA 2VVJA 1PVAA 1S3PA 1KQVA 1AVSA 1F0BA 2WNDA 4NDBA 1TOPA 4MSPA 3CR2A 2JNXA 1W7UA 4AQIA 4GF6B 3LA1A 2C9IA 2BBMA 2IB6A 2FJUB 4YGBB 3D0YB 1QX5B 3KCTA 4ORBB 1RK9A 1CLMA 5I2LA 1MHOA 4PCWA 3CFHA 5CPVA 3M24A 1XYDA 3AI4A 3JVTC 1EMCA 3KHEA 2EHBA 1YHIA 3DQFA 2QPTA 1TNPA 2M7NA 3IR8A 1YUUA 2JT3A 4XL5A 1RECA 3DVJA 2NXQA 2OPOA 3M0WA 1IH0A 2M8UA 4KGFA 1QV1A 5HBDA 2O60A 5HLOA 3U8PA 1JBYA 3EKJA 1HT9A 2I18A 1QLKA 1KK8B 2MLEC 4HRGA 2K7DA 1S1EA 3DF0B 3LVCA 1Q4BA 3KF9A 1SCVA 2BE4A 4HQ9A 3W1CA 3LLEA 4L13A 3CGAA 1KYRA 3CZTX 2JTTA 3CTNA 3SSPA 1QVIZ 1ODBA 1ZFSA 2F33A 1K90D 2C9JA 4W6AA 4PE4A 4OJ0A 1FPWA 4QJ3B 2G6YA 4EMQA 2PRUA 5EBJA 4W6NA 2G2SB 2LVJA 3D0YA 1MQ1A 5PALA 2O24A 1OOJA 1B4CA 2ICRA 1SRAA 2NLNA 2MAZA 5KSZA 2OS8C 3MGFA 1XQMA 1RJVA 4TNCA 1BJFA 2JT8A 2KI6C 3H1OA 1Q80A 1NCZA 4OGSA 2LHIA 2WIQA 3GK1A 3QRXA 1LA3A 4WQ2A 3SVUA 4JPZB 5IBWA 2IB5A 4I5LB 1UWOA 2KFHA 3SVBA 5HKZA 4ZF4A 1KFXS 2L2EA 4DKNA 4KAGA 1K8UA 3PALA 3FWBA 2WHUA 1QIWA 1IGVA 1N65A 3CFAA 2BBNA 3WNXB 1KFXL 3DF0A 5DRGA 4Q7RA 4W6HA 2BE6A 1KFUS 2KI4C 2OTEA 4WQ3A 4MZKA 1KWOC 1IJ6A 3ST2A 3PJ5A 1YRUB 1QYOA 1KFUL 5DTLA 1SYMA 3IP2A 2AWLA 2Q91A 4PE7A 1RFJA 2H5RA 1RMPA 2HCGA 2IE2A 4W7DA 4DXPA 4GNKB 4P5OE 4P2YB 3E5TA 1F70A 1B8LA 4LJDA 3I5IC 3JVTB 2KBIA 1FI5A 1C7WA 2CNPA 4HREE 2M7LA 5DQMA 1OZOA 2A50B 1J7PA 1NWDA 5HZOA 3LF4B 5AXIA 1IJ5A 1UHJA 3PATA 2KQ6A 2JNFA 1LVCD 2E30A 3ADFA 1OQPA 3SSYA 1GGWA 5KTYA 1G4YR 3DQIA 4LJBA 2JT0A 2KFFA 2KYFA 3PLFB 4N1GA 1QTXA 1WDCC 1EMMA 1GFLA 2WOSA 4WRIA 4W6FA 4JC2A 3DQKA 2DUIA 1AUIB 1YTZC 1AHRA 3DQ3A 1B47A 1YJFA 5AQBB 1EMFA 1CTRA 1B7TZ 1CFPA 5EXBA 3PJ7A 2Y1MA 2EMNA 4H48A 4KF5A 4L9MA 5KTGA 3DQ4A 3SG5A 2KSPA 2IS9A 3LCPC 1RRXA 2FCEA 3PN7C 2CBLA 2JPTA 3SVEA 4MRXA 1YVHA 4CIDA 2OKWA 3EVPA 3PIBA 4XOVA 1RROA 3DQLA 3AAJA 2L4HA 3TMTA 3SVOA 1W7TA 1XFUO 5DPGA 3TUYC 1QVIY 4NDCA 1DJWA 3OB2B 2LM5A 1M31A 4KW9A 4ZF3A 1IQ5A 3HX4A 1JC0A 4GGFC 3PFVA 1Q4DA 3K1KA 4YI9A 2WC8A 2OTGC 2DDCA 2V53A 2JXCA 5D7FA 2LHLA 4W76A 2OS8B 1MUXA 1RMOA 3FS7A 3TDIA 2SCPA 3CD9A 1FW4A 1YHGA 1K2HA 4I5KA 1PALA 5K89A 4W6JA 1Y1AA 2K2FA 3K21A 3NF0A 3DQDA 3CD1A 2A47A 2L5XB 4W6BA 1MOUA 4C0KA 1A29A 1J1EA 4OKHA 1XFWO 2ZNEA 4Q7TA 4E68A 1KQMC 1Y1XA 1UP5A 3IF7A 3VROA 1DT7B 5FYXA 1QS7A 2KHNA 2Y0GA 2MJWB 2PASA 1IWQA 1YJ2A 4RYWA 1K95A 2YE1A 1EXRA 3BXCA 2M1KB 2KI4B 2JTZA 3DQEA 1PVBA 3TMRA 4ZFSA 1XK4A 2H6VA 1ZUXA 1KWOB 1DVIA 4JQ0D 1BFPA 2LC5A 1SCMC 1FI6A 4H3LA 5EJUA 3DQNA 1QYFA 3SSKA 5DPIA 4Z4MA 5HLVA 5B8IB 2H5OA 2GW3A 2WSOA 3NT9A 2Q57A 4OY4A 2ZRSA 2AAOA 5JJGA 3AAKA 3DQ5A 4GPLB 1TNXA 1XFZO 3I5IB 2AWKA 1WLZA 1SPYA 1YX7A 2LV7A 2DDDA 1RMMA 3LSAA 2KBMA 1BLQA 3ZUJA 2A56B 1H4BA 3DQ2A 1S6CA 5BQLA 4W7CA 4TZGA 2MLFC 1M45A 1B8CA 4Q04A 3E5VA 1C7VA 1XFVO 2GGMA 4LW5A 2FCDA 4NWSA 1QXTA 2PXWA 3CB9A 3M22A 1KK7Z 4W6LA 1DGUA 5F9GA 1LINA 4W6RA 2HQWA 4GUKA 1B7TY 3EKHA 1YUTA 3PN7B 3KO0A 5DQBA 4FTGA 1KSMA 3BUWB 3RLZA 4ANJA 2LP3A 1Z1QA 1WY9A 1C4FA 5HZSA 1CNPA 1NX1A 3OHMB 1JWDA 3CFFA 2OJKA 2Z1OA 4ORCB 2VAEA 2ZRTA 1JC1A 2OTGB 4FQOA 2WCFA 5I8NA 1DJXA 1R6PA 1YHHA 3KEVA 1AK8A 3ST4A 3RWAA 1SR6C 4F0ZB 4YGDB 2FZUA 1BODA 3WXAA 1CMGA 4I5NB 3LVAA 3NT3A 3P8UA 4DXOA 3A4UB 3SSVA 1CFCA 1EMGA 1FF1A 3WHTB 2F2PA 1N2DA 3NSOA 2KAXA 2CXJA 4A4CA 5DTYA 4EDOA 1KQMB 3BUMB 2JOJA 2QLHA 1AJ4A 2MRDA 4XJKB 1NX3A 1CLBA 5HGEA 3U8AA 1BT6A 4CFQA 2RH7A 1CDNA 3DQAA 4PPKA 2DOQA 1XAEA 1X02A 5BPJA 1MF8B 3DVMA 3DPWA 5DKQA 4W7XA 4JFGA 3EK7A 2DUEA 5EB7A 5EXUA 3DQMA 2AHAA 5EHUA 2YE0A 1G33A 4ICBA 2K8MB 1IG5A 2ZN8A 3SVDA 1DJYA 2GW4B 3GEXA 4IZNA 1D1OA 3G9AA 1GQMA 2ZFDA 3C1VA 4OR9B 3VRQA 4OVNF 1PK0D 2L0PA 1CMFA 3I5FC 1A75B 3GK2A 1XMZA 1JUOA 5CSFA 4MZLA 4M2PA 3TS5C 4IK8A 1W7JB 4BDUA 2HPSA 3DQ8A 4HVFA 1ZGPA 4B5YA 4GGFA 3FIAA 2BL0C 4HSZA 4PE0A 5FVFA 1ZMZA 1PSRA 4QJ5B 1KSOA 1LKJA 2BCAA 2MBXA 2KYCA 3OP0A 3A8RA 1HCJA 4NDDA 1DF0B 1ZACA 3GK4X 1SL9A 2KGRA 4YBHB 4XGYA 2VZXA 1W7SA 4OCIA 5LTPA 2O29A 3FWCA 4U8DA 4GFTA 1OSAA 4ZIOA 3DVKA 3ZTFA 1MWNA 2FL1A 3SVCA 4PE1A 4XJKA 2LLTA 3UG0A 2I2RE 2KAVA 2M1UA 1IQ3A 1HQVA 3DQHA 4EDSA 1ALWA 1KK7Y 2SASA 2PSRA 1J55A 3RWTA 3U0NA 3NEDA 2Q6PA 3WCKA 1SW8A 1WRLA 2H8QA 4DS7A 1XFYO 3F45A 1UISA 3CWGA 2F3YA 2JRFA 4R6DA 1DGVA 2A52B 4KF4A 4LQUA 3A8SA 3BXBA 2LAPA 2WCBA 1KCYA 4PPLA 1EMBA 3BUXB 1YVLA 1J7QA 2K61A 1A75A 4ORNA 4GGNA 4CFRA 4ZB1A 4LQTA 1MYWA 2Y1NA 2WHSA 5DRFA 2OTBA 2G2BA 5LK4A 2NCOA 1A4PA 2ZN9A 1SR6B 3U8CA 2BKHB 2F8PA 3SSLA 2Q4UA 3NSIA 3SG2A 4DRWA 2BCBA 3NXAA 3P28A 1DF0A 2QLIA 1B1GA 2I7AA 1Q4CA 3SV5A 2H61A 2KAYA 3MSEB 1M39A 1CDMA 3SG3A 1UHHA 2G5ZB 5DPJA 4XOWA 3OGOA 1K96A 4W6UA 5EXCI 4UPGA 3ED8A 1FBVA 1AP4A 3O78A 3SVSA 4N3DA 2DD7A 1SKTA 4JWQA 4MVFA 4YGEB 5H87A 1A2XA 3AI5A 4MEWA 3GJ2A 4D1EA 2P4MA 2A53B 1W7IB 2PVBA 4KA9A 3DQ9A 2G6XA 1S6JA 1QLSA 1K94A 1LXFC 3VHTB 2WCEA 2BTJA 1BG1A 1Q4EA 2LVIA 2OGRA 2V4EC 2AWJA 4HE4A 1CFFA 2L50A 3I5FB 1XVJA 5AFPA 2VADA 3TS5B 2E6WA 3VRNA 2M29A 4P1QA 1CDLA 1S6ZA 5FVIA 2JZIA 2BL0B 4W7FA 2PXSA 3BOWB 3DQ6A 4JGEA 5LTQA 3VICA 1IKUA 3BUNB 2A4JA 4KEXA 2LVVA 3OB1B 3O2PA 2A48A 1U5IB 1PSBA 3U0KA 1UUSA 2FOTA 3EVUA 2PALA 4BY5A 2A46A 3DQOA 1PRWA 2QLEA 2CCMA 2AMIA 1Y6WA 2HFCA 2L4IA 2BKIB 1F4QA 4HQ8A 2G9BA 1QX7A 4L1IA 4OV2A 2ZO7A 1QX2A 3EK8A 2MHHA 2M49B 4KPIA 4CPVA 3VGOA 3ZUFA 1YURA 1SL7A 3ST0A 1NCXA 3DVEA 5FHVA 1TTXA 1AJ5A 1A03A 4PHMA 4W72A 1OE9B 4GBAA 3GJ1A 4DXIA 3SIAA 4N1FA 5FVGA 3CLNA 5CSNA 1KK8C 1EL4A 5H88A 4Z4KA 2LLUA 2RGIA 3VHTA 2JWWA 2JC2A 3SG4A 4N5XA 1NPQA 2QT2A 3OX6A 2Z6ZA 1ZGOA 1SY9A 2K0JA 3UFZA 3SRYA 3AKAA 3NEZA 1ZOTB 3S05A 1NX2A 2YFPA 2CTNA 4W75A 4EULA 4B30B 2F3ZA 4W6DA 3NSLA 1Y0VH 5HW9A 3E5WA 1TNQA 1B9AA 2VVIA 1Y1UA 4GAOA 4LJDC 4MBEA 3BOWA 1QXPA 4H3NA 4LJCA 2K7CA 3GOFA 2TN4A 2AH8A 1OXEA 4R1EA 3LL8B 3NSKA 5HYDA 4PFEA 1TN4A 5ER5A 2L51A 2M3WA 1U5IA 1G8IA 1ALVA 4XYNA 5HKWA 1GL4A 2MA2A 2G3DB 4PHKA 2WURA 2ZO6A 1WDCB 5ER4X 5DKNA 1G7KA 1QV0A 5DTZA 4PHNA 2M97A 2FWQA 3V3DA 4M2QA 3DQ7A 2Z6XA 2DUGA 4PALA 1UHIA 1CLLA 4MZJA 2QZ0A 1J7OA 4W77A 3H4SE 4XVPA 1YRTB 1BU3A 3E3RA 1S36A 3EVRA 1YUSA 1RWYA 1BMOA 3BUOB 2PMYA 1EG4A 3KCSA 5D69A 4DIRA 2V4EB 3TUYB 2QU1A 2BECA 3EVVA 1L2OC 2O2BA 2HQ8A 4Q9WA 2K7OA 1BR4B 2Y5IA 2DUFA 4AQJA 3H1RA 2EC6C 5DU0A 4W6PA 4CLNA 4B30A 1TCFA 2DUHA 4KGEA 4RTCA 3WLDA 3I5GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DKR A;  3DPX A;  1B8R A;  1TNW A;  3SS0 A;  2JAD A;  2O5G A;  2CT9 A;  1DJH A;  1YR5 A;  4W7R A;  3DQ1 A;  2LUC A;  1Q4A A;  2AUC A;  3WLC A;  5J3X A;  2G3O A;  1WRZ A;  1QIV A;  2AWM A;  1SNL A;  3I5H C;  3DD4 A;  2KI6 D;  2YDZ A;  4EN1 A;  4DKM A;  1GGZ A;  4TZA A;  3KPX A;  2LNK A;  1DJZ A;  2LMU A;  1SCM B;  2LCP A;  2HF5 A;  3BXK A;  3LF3 A;  2B3P A;  4NQG A;  2LAN A;  1KYP A;  1XK4 C;  5T3I A;  5AEQ A;  5AAN A;  1IRJ A;  1Q73 A;  1XA9 A;  1NSH A;  1OMV A;  1V1F A;  3SJS A;  1ZUZ A;  3AKO A;  4YGA A;  5H89 A;  1DTL A;  1NIW A;  1YFP A;  2V4E A;  2H5P A;  5DY6 A;  2KQY A;  1TCO B;  2LMV A;  4L12 A;  3OSQ A;  4AR7 A;  3LK0 A;  1JFK A;  3SSH A;  4DUQ A;  3SVN A;  2JU0 A;  4BY4 A;  2HGD A;  4W6M A;  3OX5 A;  5I2Q A;  2LVK A;  1UHN A;  3U0L A;  2LE9 B;  4J8A A;  1JSA A;  1EME A;  3U0M A;  2WIS A;  4W7E A;  4R6B A;  1BR1 B;  4OQW A;  4ORA B;  3TDU A;  4W6C A;  3BXA A;  5BT0 A;  3SG6 A;  1B9C A;  4W6K A;  3JTD C;  4W6S A;  5CSJ A;  2ZKM X;  4GOB A;  1TIZ A;  3BX9 A;  1RM9 A;  3DQU A;  1YZW A;  3CBE A;  4IK3 A;  2LUX A;  4W6I A;  1PUL A;  5AER A;  1K9K A;  3CR4 X;  2HET A;  1UHK A;  2HQZ A;  5EB6 A;  4H47 A;  1S6I A;  1S5G Y;  1M46 A;  1K93 D;  3DQJ A;  1XSS A;  1CDP A;  1OMD A;  4C0J A;  1EMK A;  1OXF A;  4W73 A;  1F71 A;  2GX2 A;  2EMD A;  1VRK A;  1N0Y A;  1CB1 A;  3ZWH A;  5DPH A;  3DQC A;  1QJT A;  2COL B;  2KOT A;  1NUB A;  4MRY A;  1L2O B;  2ARL A;  1LA0 A;  2POX A;  3CGL A;  3ST3 A;  4DXQ A;  2GX0 A;  5LTR A;  2EC6 B;  1CFD A;  3CS1 A;  1EG3 A;  2WHT A;  4W6G A;  2KDH A;  2ZND A;  2A54 B;  5KU1 A;  4KW4 A;  1JC2 A;  1QYQ A;  2QLG B;  3I5G B;  3PM8 A;  4RYS A;  4ZIN A;  1F54 A;  2H2K A;  4QJ4 B;  2H9W A;  5HKY A;  3I19 A;  4AOM A;  1H4U A;  3IQQ A;  4YI8 A;  1NCY A;  4I5J A;  4W69 A;  4W6T A;  3PSR A;  1H6R A;  3LK1 A;  4MLW A;  1BOC A;  3GB3 A;  3SG7 A;  1QAS A;  5BTT B;  4M2O A;  4JRB A;  4ETO A;  1QAT A;  3SVR A;  2ISD A;  1YX8 A;  5CSI A;  1K9P A;  2QRF A;  3ZNI A;  4IK5 A;  1SBJ A;  1MOV A;  3I5H B;  4YGC B;  1XA5 A;  1F09 A;  3SIB A;  1EMA A;  1V1G A;  3AKB A;  4MN0 A;  3RM1 A;  4KW8 A;  2M0R A;  1NX0 A;  1XFX O;  1EJ3 A;  4W74 A;  1J1D A;  2LMT A;  2R2I A;  4P76 A;  2OKY A;  2K2A A;  2VVH A;  2EGD A;  2P6B B;  1S26 D;  2Z6Y A;  4AS8 A;  3O77 A;  4U2V A;  3BQ3 A;  2VRG A;  1UUR A;  1F55 A;  2NZ0 A;  2DD9 A;  3SST A;  3DPZ A;  1KP5 A;  1SK6 D;  3VRP A;  5DTX A;  2H5Q A;  4HRH A;  4ZCV A;  1CM1 A;  5I2O A;  1DJI A;  2QLG A;  2HQK A;  4IK4 A;  2D8N A;  2L98 A;  5HZT A;  2HGY A;  1CM4 A;  4C0L A;  2B3Q A;  4Q7U A;  5HZU A;  1GJY A;  3HCM A;  1OMR A;  4IL1 A;  3JTD B;  1ZGQ A;  2EMO A;  2JXL A;  1XO5 A;  3TDZ A;  5BTT A;  4GES B;  1F8H A;  2IOV A;  4JEO A;  5G08 A;  1JFJ A;  5F6T A;  5JOL A;  2K7B A;  2JUL A;  2G16 B;  1CKK A;  2B1U A;  2G6E A;  3OSR A;  1JF0 A;  1DJG A;  1MR8 A;  4DXM A;  1WLM A;  1MXE A;  1JF2 A;  2WOR A;  2M9G A;  1R2U A;  2KNE A;  1NYA A;  5GQQ C;  1EH2 A;  2KGB C;  3IQO A;  3O4Y A;  4H3M A;  1SMG A;  1CV7 A;  1C07 A;  3TZ1 A;  2HRS A;  4IK9 A;  4USL A;  4OHS A;  2KFG A;  1TRF A;  2HPW A;  3ICB A;  1L7Z A;  3LVD A;  3BYA A;  1H8B A;  2QAC A;  5TNC A;  3O6B A;  5J2O A;  1E8A A;  3D10 A;  1GGX A;  3VK1 A;  1OXD A;  3ZUL A;  1HUY A;  2WSN A;  1JBA A;  1JBZ A;  2GGZ A;  4PPJ A;  1OZS A;  4ZBL A;  3CR5 X;  4W6O A;  1MXL C;  3EK4 A;  4IK1 A;  4UTS A;  4W7A A;  1RTP 1;  1M63 B;  3GL4 A;  2HJO A;  4HQC A;  2JQ6 A;  4J89 A;  1EML A;  2I94 A;  4PDZ A;  3VRR A;  1SL8 A;  4YRU A;  1K9U A;  2H61 C;  3LS3 A;  2Y4Q A;  1KYS A;  4DCK A;  2LP2 A;  2GV5 A;  1BF5 A;  1WRK A;  1S5G Z;  4I2Y A;  2NCP A;  1Z1P A;  2BCX A;  3WHU B;  4PHJ A;  1QY3 A;  4ZCU A;  1DMO A;  4DXN A;  4A4B A;  2ZMW A;  1F4O A;  4JF9 A;  4KF5 C;  2ZMU A;  1NP8 A;  2LLS A;  4ZF5 A;  3W1D A;  2F2O A;  4J88 A;  3PJB A;  1J7R A;  4Q9X A;  2VVJ A;  1PVA A;  1S3P A;  1KQV A;  1AVS A;  1F0B A;  2WND A;  4NDB A;  1TOP A;  4MSP A;  3CR2 A;  2JNX A;  1W7U A;  4AQI A;  4GF6 B;  3LA1 A;  2C9I A;  2BBM A;  2IB6 A;  2FJU B;  4YGB B;  3D0Y B;  1QX5 B;  3KCT A;  4ORB B;  1RK9 A;  1CLM A;  5I2L A;  1MHO A;  4PCW A;  3CFH A;  5CPV A;  3M24 A;  1XYD A;  3AI4 A;  3JVT C;  1EMC A;  3KHE A;  2EHB A;  1YHI A;  3DQF A;  2QPT A;  1TNP A;  2M7N A;  3IR8 A;  1YUU A;  2JT3 A;  4XL5 A;  1REC A;  3DVJ A;  2NXQ A;  2OPO A;  3M0W A;  1IH0 A;  2M8U A;  4KGF A;  1QV1 A;  5HBD A;  2O60 A;  5HLO A;  3U8P A;  1JBY A;  3EKJ A;  1HT9 A;  2I18 A;  1QLK A;  1KK8 B;  2MLE C;  4HRG A;  2K7D A;  1S1E A;  3DF0 B;  3LVC A;  1Q4B A;  3KF9 A;  1SCV A;  2BE4 A;  4HQ9 A;  3W1C A;  3LLE A;  4L13 A;  3CGA A;  1KYR A;  3CZT X;  2JTT A;  3CTN A;  3SSP A;  1QVI Z;  1ODB A;  1ZFS A;  2F33 A;  1K90 D;  2C9J A;  4W6A A;  4PE4 A;  4OJ0 A;  1FPW A;  4QJ3 B;  2G6Y A;  4EMQ A;  2PRU A;  5EBJ A;  4W6N A;  2G2S B;  2LVJ A;  3D0Y A;  1MQ1 A;  5PAL A;  2O24 A;  1OOJ A;  1B4C A;  2ICR A;  1SRA A;  2NLN A;  2MAZ A;  5KSZ A;  2OS8 C;  3MGF A;  1XQM A;  1RJV A;  4TNC A;  1BJF A;  2JT8 A;  2KI6 C;  3H1O A;  1Q80 A;  1NCZ A;  4OGS A;  2LHI A;  2WIQ A;  3GK1 A;  3QRX A;  1LA3 A;  4WQ2 A;  3SVU A;  4JPZ B;  5IBW A;  2IB5 A;  4I5L B;  1UWO A;  2KFH A;  3SVB A;  5HKZ A;  4ZF4 A;  1KFX S;  2L2E A;  4DKN A;  4KAG A;  1K8U A;  3PAL A;  3FWB A;  2WHU A;  1QIW A;  1IGV A;  1N65 A;  3CFA A;  2BBN A;  3WNX B;  1KFX L;  3DF0 A;  5DRG A;  4Q7R A;  4W6H A;  2BE6 A;  1KFU S;  2KI4 C;  2OTE A;  4WQ3 A;  4MZK A;  1KWO C;  1IJ6 A;  3ST2 A;  3PJ5 A;  1YRU B;  1QYO A;  1KFU L;  5DTL A;  1SYM A;  3IP2 A;  2AWL A;  2Q91 A;  4PE7 A;  1RFJ A;  2H5R A;  1RMP A;  2HCG A;  2IE2 A;  4W7D A;  4DXP A;  4GNK B;  4P5O E;  4P2Y B;  3E5T A;  1F70 A;  1B8L A;  4LJD A;  3I5I C;  3JVT B;  2KBI A;  1FI5 A;  1C7W A;  2CNP A;  4HRE E;  2M7L A;  5DQM A;  1OZO A;  2A50 B;  1J7P A;  1NWD A;  5HZO A;  3LF4 B;  5AXI A;  1IJ5 A;  1UHJ A;  3PAT A;  2KQ6 A;  2JNF A;  1LVC D;  2E30 A;  3ADF A;  1OQP A;  3SSY A;  1GGW A;  5KTY A;  1G4Y R;  3DQI A;  4LJB A;  2JT0 A;  2KFF A;  2KYF A;  3PLF B;  4N1G A;  1QTX A;  1WDC C;  1EMM A;  1GFL A;  2WOS A;  4WRI A;  4W6F A;  4JC2 A;  3DQK A;  2DUI A;  1AUI B;  1YTZ C;  1AHR A;  3DQ3 A;  1B47 A;  1YJF A;  5AQB B;  1EMF A;  1CTR A;  1B7T Z;  1CFP A;  5EXB A;  3PJ7 A;  2Y1M A;  2EMN A;  4H48 A;  4KF5 A;  4L9M A;  5KTG A;  3DQ4 A;  3SG5 A;  2KSP A;  2IS9 A;  3LCP C;  1RRX A;  2FCE A;  3PN7 C;  2CBL A;  2JPT A;  3SVE A;  4MRX A;  1YVH A;  4CID A;  2OKW A;  3EVP A;  3PIB A;  4XOV A;  1RRO A;  3DQL A;  3AAJ A;  2L4H A;  3TMT A;  3SVO A;  1W7T A;  1XFU O;  5DPG A;  3TUY C;  1QVI Y;  4NDC A;  1DJW A;  3OB2 B;  2LM5 A;  1M31 A;  4KW9 A;  4ZF3 A;  1IQ5 A;  3HX4 A;  1JC0 A;  4GGF C;  3PFV A;  1Q4D A;  3K1K A;  4YI9 A;  2WC8 A;  2OTG C;  2DDC A;  2V53 A;  2JXC A;  5D7F A;  2LHL A;  4W76 A;  2OS8 B;  1MUX A;  1RMO A;  3FS7 A;  3TDI A;  2SCP A;  3CD9 A;  1FW4 A;  1YHG A;  1K2H A;  4I5K A;  1PAL A;  5K89 A;  4W6J A;  1Y1A A;  2K2F A;  3K21 A;  3NF0 A;  3DQD A;  3CD1 A;  2A47 A;  2L5X B;  4W6B A;  1MOU A;  4C0K A;  1A29 A;  1J1E A;  4OKH A;  1XFW O;  2ZNE A;  4Q7T A;  4E68 A;  1KQM C;  1Y1X A;  1UP5 A;  3IF7 A;  3VRO A;  1DT7 B;  5FYX A;  1QS7 A;  2KHN A;  2Y0G A;  2MJW B;  2PAS A;  1IWQ A;  1YJ2 A;  4RYW A;  1K95 A;  2YE1 A;  1EXR A;  3BXC A;  2M1K B;  2KI4 B;  2JTZ A;  3DQE A;  1PVB A;  3TMR A;  4ZFS A;  1XK4 A;  2H6V A;  1ZUX A;  1KWO B;  1DVI A;  4JQ0 D;  1BFP A;  2LC5 A;  1SCM C;  1FI6 A;  4H3L A;  5EJU A;  3DQN A;  1QYF A;  3SSK A;  5DPI A;  4Z4M A;  5HLV A;  5B8I B;  2H5O A;  2GW3 A;  2WSO A;  3NT9 A;  2Q57 A;  4OY4 A;  2ZRS A;  2AAO A;  5JJG A;  3AAK A;  3DQ5 A;  4GPL B;  1TNX A;  1XFZ O;  3I5I B;  2AWK A;  1WLZ A;  1SPY A;  1YX7 A;  2LV7 A;  2DDD A;  1RMM A;  3LSA A;  2KBM A;  1BLQ A;  3ZUJ A;  2A56 B;  1H4B A;  3DQ2 A;  1S6C A;  5BQL A;  4W7C A;  4TZG A;  2MLF C;  1M45 A;  1B8C A;  4Q04 A;  3E5V A;  1C7V A;  1XFV O;  2GGM A;  4LW5 A;  2FCD A;  4NWS A;  1QXT A;  2PXW A;  3CB9 A;  3M22 A;  1KK7 Z;  4W6L A;  1DGU A;  5F9G A;  1LIN A;  4W6R A;  2HQW A;  4GUK A;  1B7T Y;  3EKH A;  1YUT A;  3PN7 B;  3KO0 A;  5DQB A;  4FTG A;  1KSM A;  3BUW B;  3RLZ A;  4ANJ A;  2LP3 A;  1Z1Q A;  1WY9 A;  1C4F A;  5HZS A;  1CNP A;  1NX1 A;  3OHM B;  1JWD A;  3CFF A;  2OJK A;  2Z1O A;  4ORC B;  2VAE A;  2ZRT A;  1JC1 A;  2OTG B;  4FQO A;  2WCF A;  5I8N A;  1DJX A;  1R6P A;  1YHH A;  3KEV A;  1AK8 A;  3ST4 A;  3RWA A;  1SR6 C;  4F0Z B;  4YGD B;  2FZU A;  1BOD A;  3WXA A;  1CMG A;  4I5N B;  3LVA A;  3NT3 A;  3P8U A;  4DXO A;  3A4U B;  3SSV A;  1CFC A;  1EMG A;  1FF1 A;  3WHT B;  2F2P A;  1N2D A;  3NSO A;  2KAX A;  2CXJ A;  4A4C A;  5DTY A;  4EDO A;  1KQM B;  3BUM B;  2JOJ A;  2QLH A;  1AJ4 A;  2MRD A;  4XJK B;  1NX3 A;  1CLB A;  5HGE A;  3U8A A;  1BT6 A;  4CFQ A;  2RH7 A;  1CDN A;  3DQA A;  4PPK A;  2DOQ A;  1XAE A;  1X02 A;  5BPJ A;  1MF8 B;  3DVM A;  3DPW A;  5DKQ A;  4W7X A;  4JFG A;  3EK7 A;  2DUE A;  5EB7 A;  5EXU A;  3DQM A;  2AHA A;  5EHU A;  2YE0 A;  1G33 A;  4ICB A;  2K8M B;  1IG5 A;  2ZN8 A;  3SVD A;  1DJY A;  2GW4 B;  3GEX A;  4IZN A;  1D1O A;  3G9A A;  1GQM A;  2ZFD A;  3C1V A;  4OR9 B;  3VRQ A;  4OVN F;  1PK0 D;  2L0P A;  1CMF A;  3I5F C;  1A75 B;  3GK2 A;  1XMZ A;  1JUO A;  5CSF A;  4MZL A;  4M2P A;  3TS5 C;  4IK8 A;  1W7J B;  4BDU A;  2HPS A;  3DQ8 A;  4HVF A;  1ZGP A;  4B5Y A;  4GGF A;  3FIA A;  2BL0 C;  4HSZ A;  4PE0 A;  5FVF A;  1ZMZ A;  1PSR A;  4QJ5 B;  1KSO A;  1LKJ A;  2BCA A;  2MBX A;  2KYC A;  3OP0 A;  3A8R A;  1HCJ A;  4NDD A;  1DF0 B;  1ZAC A;  3GK4 X;  1SL9 A;  2KGR A;  4YBH B;  4XGY A;  2VZX A;  1W7S A;  4OCI A;  5LTP A;  2O29 A;  3FWC A;  4U8D A;  4GFT A;  1OSA A;  4ZIO A;  3DVK A;  3ZTF A;  1MWN A;  2FL1 A;  3SVC A;  4PE1 A;  4XJK A;  2LLT A;  3UG0 A;  2I2R E;  2KAV A;  2M1U A;  1IQ3 A;  1HQV A;  3DQH A;  4EDS A;  1ALW A;  1KK7 Y;  2SAS A;  2PSR A;  1J55 A;  3RWT A;  3U0N A;  3NED A;  2Q6P A;  3WCK A;  1SW8 A;  1WRL A;  2H8Q A;  4DS7 A;  1XFY O;  3F45 A;  1UIS A;  3CWG A;  2F3Y A;  2JRF A;  4R6D A;  1DGV A;  2A52 B;  4KF4 A;  4LQU A;  3A8S A;  3BXB A;  2LAP A;  2WCB A;  1KCY A;  4PPL A;  1EMB A;  3BUX B;  1YVL A;  1J7Q A;  2K61 A;  1A75 A;  4ORN A;  4GGN A;  4CFR A;  4ZB1 A;  4LQT A;  1MYW A;  2Y1N A;  2WHS A;  5DRF A;  2OTB A;  2G2B A;  5LK4 A;  2NCO A;  1A4P A;  2ZN9 A;  1SR6 B;  3U8C A;  2BKH B;  2F8P A;  3SSL A;  2Q4U A;  3NSI A;  3SG2 A;  4DRW A;  2BCB A;  3NXA A;  3P28 A;  1DF0 A;  2QLI A;  1B1G A;  2I7A A;  1Q4C A;  3SV5 A;  2H61 A;  2KAY A;  3MSE B;  1M39 A;  1CDM A;  3SG3 A;  1UHH A;  2G5Z B;  5DPJ A;  4XOW A;  3OGO A;  1K96 A;  4W6U A;  5EXC I;  4UPG A;  3ED8 A;  1FBV A;  1AP4 A;  3O78 A;  3SVS A;  4N3D A;  2DD7 A;  1SKT A;  4JWQ A;  4MVF A;  4YGE B;  5H87 A;  1A2X A;  3AI5 A;  4MEW A;  3GJ2 A;  4D1E A;  2P4M A;  2A53 B;  1W7I B;  2PVB A;  4KA9 A;  3DQ9 A;  2G6X A;  1S6J A;  1QLS A;  1K94 A;  1LXF C;  3VHT B;  2WCE A;  2BTJ A;  1BG1 A;  1Q4E A;  2LVI A;  2OGR A;  2V4E C;  2AWJ A;  4HE4 A;  1CFF A;  2L50 A;  3I5F B;  1XVJ A;  5AFP A;  2VAD A;  3TS5 B;  2E6W A;  3VRN A;  2M29 A;  4P1Q A;  1CDL A;  1S6Z A;  5FVI A;  2JZI A;  2BL0 B;  4W7F A;  2PXS A;  3BOW B;  3DQ6 A;  4JGE A;  5LTQ A;  3VIC A;  1IKU A;  3BUN B;  2A4J A;  4KEX A;  2LVV A;  3OB1 B;  3O2P A;  2A48 A;  1U5I B;  1PSB A;  3U0K A;  1UUS A;  2FOT A;  3EVU A;  2PAL A;  4BY5 A;  2A46 A;  3DQO A;  1PRW A;  2QLE A;  2CCM A;  2AMI A;  1Y6W A;  2HFC A;  2L4I A;  2BKI B;  1F4Q A;  4HQ8 A;  2G9B A;  1QX7 A;  4L1I A;  4OV2 A;  2ZO7 A;  1QX2 A;  3EK8 A;  2MHH A;  2M49 B;  4KPI A;  4CPV A;  3VGO A;  3ZUF A;  1YUR A;  1SL7 A;  3ST0 A;  1NCX A;  3DVE A;  5FHV A;  1TTX A;  1AJ5 A;  1A03 A;  4PHM A;  4W72 A;  1OE9 B;  4GBA A;  3GJ1 A;  4DXI A;  3SIA A;  4N1F A;  5FVG A;  3CLN A;  5CSN A;  1KK8 C;  1EL4 A;  5H88 A;  4Z4K A;  2LLU A;  2RGI A;  3VHT A;  2JWW A;  2JC2 A;  3SG4 A;  4N5X A;  1NPQ A;  2QT2 A;  3OX6 A;  2Z6Z A;  1ZGO A;  1SY9 A;  2K0J A;  3UFZ A;  3SRY A;  3AKA A;  3NEZ A;  1ZOT B;  3S05 A;  1NX2 A;  2YFP A;  2CTN A;  4W75 A;  4EUL A;  4B30 B;  2F3Z A;  4W6D A;  3NSL A;  1Y0V H;  5HW9 A;  3E5W A;  1TNQ A;  1B9A A;  2VVI A;  1Y1U A;  4GAO A;  4LJD C;  4MBE A;  3BOW A;  1QXP A;  4H3N A;  4LJC A;  2K7C A;  3GOF A;  2TN4 A;  2AH8 A;  1OXE A;  4R1E A;  3LL8 B;  3NSK A;  5HYD A;  4PFE A;  1TN4 A;  5ER5 A;  2L51 A;  2M3W A;  1U5I A;  1G8I A;  1ALV A;  4XYN A;  5HKW A;  1GL4 A;  2MA2 A;  2G3D B;  4PHK A;  2WUR A;  2ZO6 A;  1WDC B;  5ER4 X;  5DKN A;  1G7K A;  1QV0 A;  5DTZ A;  4PHN A;  2M97 A;  2FWQ A;  3V3D A;  4M2Q A;  3DQ7 A;  2Z6X A;  2DUG A;  4PAL A;  1UHI A;  1CLL A;  4MZJ A;  2QZ0 A;  1J7O A;  4W77 A;  3H4S E;  4XVP A;  1YRT B;  1BU3 A;  3E3R A;  1S36 A;  3EVR A;  1YUS A;  1RWY A;  1BMO A;  3BUO B;  2PMY A;  1EG4 A;  3KCS A;  5D69 A;  4DIR A;  2V4E B;  3TUY B;  2QU1 A;  2BEC A;  3EVV A;  1L2O C;  2O2B A;  2HQ8 A;  4Q9W A;  2K7O A;  1BR4 B;  2Y5I A;  2DUF A;  4AQJ A;  3H1R A;  2EC6 C;  5DU0 A;  4W6P A;  4CLN A;  4B30 A;  1TCF A;  2DUH A;  4KGE A;  4RTC A;  3WLD A;  3I5G C; 
#chains in the Genus database with same CATH topology
 5DKR A;  3DPX A;  1B8R A;  1TNW A;  3SS0 A;  2JAD A;  2O5G A;  2CT9 A;  1DJH A;  1YR5 A;  4W7R A;  3DQ1 A;  2LUC A;  1Q4A A;  3CDN A;  2AUC A;  3WLC A;  5J3X A;  2G3O A;  1WRZ A;  1QIV A;  2AWM A;  1SNL A;  3I5H C;  3DD4 A;  2KI6 D;  2YDZ A;  4EN1 A;  4DKM A;  1GGZ A;  4TZA A;  5FI7 A;  3KPX A;  2LNK A;  1DJZ A;  2LMU A;  1SCM B;  2LCP A;  2HF5 A;  3BXK A;  3LF3 A;  1XFR A;  3S0A A;  2B3P A;  4NQG A;  2LAN A;  1KYP A;  1XK4 C;  5T3I A;  5AEQ A;  5AAN A;  1IRJ A;  1Q73 A;  1XA9 A;  1NSH A;  1OMV A;  1V1F A;  3SJS A;  1ZUZ A;  3AKO A;  4YGA A;  5H89 A;  1DTL A;  1NIW A;  1YFP A;  2V4E A;  2H5P A;  3D73 A;  5DY6 A;  2KQY A;  1TCO B;  2LMV A;  4L12 A;  3OSQ A;  4AR7 A;  3LK0 A;  4INW A;  1JFK A;  3SSH A;  4DUQ A;  3SVN A;  2JU0 A;  4BY4 A;  2HGD A;  4W6M A;  3OX5 A;  5I2Q A;  2LVK A;  3EG5 B;  1UHN A;  3U0L A;  2LE9 B;  4J8A A;  1JSA A;  1EME A;  3U0M A;  2WIS A;  4W7E A;  4R6B A;  1BR1 B;  4OQW A;  4ORA B;  3TDU A;  4W6C A;  3BXA A;  5BT0 A;  3SG6 A;  1OOF A;  1B9C A;  4W6K A;  3JTD C;  4W6S A;  5CSJ A;  2ZKM X;  4GOB A;  1TIZ A;  3BX9 A;  1RM9 A;  3DQU A;  1YZW A;  3CBE A;  1OOG A;  4IK3 A;  2LUX A;  1PUL A;  4W6I A;  3CYZ A;  5AER A;  1K9K A;  3CR4 X;  3FE8 A;  2HET A;  1UHK A;  2HQZ A;  5EB6 A;  4H47 A;  1S6I A;  1S5G Y;  1M46 A;  1K93 D;  3DQJ A;  1XSS A;  1CDP A;  1OMD A;  4C0J A;  1EMK A;  1OXF A;  4W73 A;  1F71 A;  2GX2 A;  3CZ1 A;  2EMD A;  1VRK A;  1N0Y A;  1CB1 A;  3ZWH A;  5DPH A;  3DQC A;  1QJT A;  2COL B;  2KOT A;  1NUB A;  4MRY A;  2GTE A;  1L2O B;  2ARL A;  1LA0 A;  2POX A;  3CGL A;  3ST3 A;  3OGN A;  3QME A;  2GX0 A;  4DXQ A;  5LTR A;  2EC6 B;  1CFD A;  3CS1 A;  1EG3 A;  2WHT A;  4W6G A;  2KDH A;  2ZND A;  2A54 B;  5KU1 A;  4KW4 A;  1JC2 A;  2WC5 A;  1QYQ A;  2QLG B;  3I5G B;  3PM8 A;  4RYS A;  4ZIN A;  1F54 A;  2H2K A;  4QJ4 B;  2H9W A;  5HKY A;  3I19 A;  4AOM A;  1H4U A;  3IQQ A;  4YI8 A;  1NCY A;  4I5J A;  4W69 A;  4W6T A;  3PSR A;  1H6R A;  3LK1 A;  4MLW A;  1BOC A;  3GB3 A;  3SG7 A;  1QAS A;  5BTT B;  4M2O A;  4JRB A;  4ETO A;  1QAT A;  3SVR A;  2ISD A;  1YX8 A;  1DQE A;  5CSI A;  1K9P A;  2QRF A;  3ZNI A;  4IK5 A;  1SBJ A;  1MOV A;  3I5H B;  4YGC B;  1XA5 A;  1F09 A;  3SIB A;  1EMA A;  3DYE A;  1V1G A;  3O4X A;  3AKB A;  4MN0 A;  3RM1 A;  4KW8 A;  2M0R A;  3DY9 A;  1NX0 A;  1XFX O;  1EJ3 A;  4W74 A;  1J1D A;  2LMT A;  2R2I A;  4P76 A;  2OKY A;  2K2A A;  2VVH A;  2EGD A;  2P6B B;  1S26 D;  2PQL A;  3SS5 A;  2Z6Y A;  3R72 A;  3FE6 A;  4AS8 A;  3FE9 A;  3O77 A;  4U2V A;  3BQ3 A;  2VRG A;  1UUR A;  1F55 A;  2NZ0 A;  2DD9 A;  3SST A;  3DPZ A;  1KP5 A;  1SK6 D;  3VRP A;  5DTX A;  2H5Q A;  4HRH A;  5FI2 A;  4ZCV A;  1CM1 A;  5I2O A;  1DJI A;  2QLG A;  2HQK A;  4IK4 A;  2D8N A;  2L98 A;  5HZT A;  3BJH A;  2HGY A;  1CM4 A;  4PT1 A;  4C0L A;  2B3Q A;  4Q7U A;  5HZU A;  1GJY A;  3HCM A;  1C3Y A;  1OMR A;  4IL1 A;  3JTD B;  1ZGQ A;  2EMO A;  2JXL A;  1XO5 A;  3D75 A;  3TDZ A;  5BTT A;  4GES B;  1F8H A;  2IOV A;  4JEO A;  5G08 A;  1JFJ A;  5F6T A;  5JOL A;  2K7B A;  2G16 B;  2JUL A;  1CKK A;  2B1U A;  2G6E A;  3OSR A;  1JF0 A;  1DJG A;  1MR8 A;  4DXM A;  1WLM A;  1MXE A;  1JF2 A;  2WOR A;  2M9G A;  1R2U A;  2KNE A;  1NYA A;  5GQQ C;  1EH2 A;  2KGB C;  3IQO A;  3O4Y A;  4H3M A;  1SMG A;  1CV7 A;  1C07 A;  3TZ1 A;  2HRS A;  1Z4H A;  4IK9 A;  1GM0 A;  4USL A;  4OHS A;  2KFG A;  1TRF A;  2HPW A;  3ICB A;  1L7Z A;  3LVD A;  3BYA A;  1H8B A;  3DZT A;  2QAC A;  5TNC A;  3O6B A;  5J2O A;  1E8A A;  3D10 A;  1GGX A;  3VK1 A;  1OXD A;  3ZUL A;  1HUY A;  3D74 A;  2WSN A;  1JBA A;  1JBZ A;  2GGZ A;  4PPJ A;  1OZS A;  1DC1 A;  4ZBL A;  2H8V A;  1SSE B;  3CR5 X;  1MXL C;  3EK4 A;  4W6O A;  4IK1 A;  4JD9 A;  4UTS A;  4W7A A;  1RTP 1;  1M63 B;  3GL4 A;  2BAP A;  2HJO A;  4HQC A;  2JQ6 A;  4J89 A;  3B7A A;  1EML A;  2I94 A;  2WCK A;  4PDZ A;  3VRR A;  1DEL A;  1SL8 A;  4YRU A;  1OOI X;  1K9U A;  2H61 C;  3LS3 A;  2Y4Q A;  1KYS A;  4DCK A;  2LP2 A;  2GV5 A;  1BF5 A;  1WRK A;  1S5G Z;  4I2Y A;  2NCP A;  1TUZ A;  1ORG A;  1Z1P A;  2BCX A;  3WHU B;  4PHJ A;  1QY3 A;  4ZCU A;  3NHT A;  1DMO A;  4DXN A;  4A4B A;  2ZMW A;  1F4O A;  4JF9 A;  3VB1 A;  4KF5 C;  2ZMU A;  1NP8 A;  3BFH A;  2LLS A;  4ZF5 A;  3W1D A;  2F2O A;  4J88 A;  3PJB A;  1J7R A;  4Q9X A;  2VVJ A;  1PVA A;  3DXL A;  1S3P A;  1KQV A;  1AVS A;  1F0B A;  2WND A;  4NDB A;  1TOP A;  4MSP A;  3B87 A;  2FJY A;  3CR2 A;  2JNX A;  1W7U A;  4AQI A;  4GF6 B;  3LA1 A;  2C9I A;  2BBM A;  2L5Y A;  2IB6 A;  2FJU B;  4YGB B;  3D0Y B;  1QX5 B;  3KCT A;  4ORB B;  5I94 A;  1RK9 A;  1CLM A;  5I2L A;  1C3Z A;  3B88 A;  1MHO A;  4PCW A;  3CFH A;  5CPV A;  3M24 A;  1XYD A;  3AI4 A;  3JVT C;  1EMC A;  3UNW A;  3KHE A;  2EHB A;  1YHI A;  3DQF A;  1TWO A;  2QPT A;  1TNP A;  2M7N A;  3IR8 A;  1YUU A;  2JT3 A;  4XL5 A;  1REC A;  3DVJ A;  2NXQ A;  2OPO A;  3M0W A;  1IH0 A;  2M8U A;  3R1V A;  4KGF A;  1QV1 A;  5HBD A;  2O60 A;  5HLO A;  5D3O A;  3U8P A;  1JBY A;  3EKJ A;  1HT9 A;  2I18 A;  1QLK A;  3UO9 A;  1KK8 B;  2MLE C;  4HRG A;  2K7D A;  1S1E A;  3DF0 B;  3LVC A;  1Q4B A;  3KF9 A;  1Z2C B;  1SCV A;  2BE4 A;  4HQ9 A;  3W1C A;  3D77 A;  3LLE A;  4L13 A;  3CGA A;  1KYR A;  3CZT X;  2JTT A;  3CTN A;  3SSP A;  1QVI Z;  1ODB A;  1ZFS A;  2F33 A;  1K90 D;  2C9J A;  3L4L A;  4W6A A;  4PE4 A;  4OJ0 A;  1FPW A;  4QJ3 B;  2G6Y A;  4EMQ A;  2PRU A;  5EBJ A;  4W6N A;  2G2S B;  1LS8 A;  2LVJ A;  3D0Y A;  1MQ1 A;  5PAL A;  2O24 A;  1OOJ A;  1B4C A;  2ICR A;  1SRA A;  2NLN A;  2MAZ A;  5KSZ A;  2OS8 C;  3MGF A;  1XQM A;  3B6X A;  1RJV A;  4TNC A;  1BJF A;  2JT8 A;  2KI6 C;  3H1O A;  3L4A A;  1Q80 A;  1NCZ A;  4OGS A;  2LHI A;  2WIQ A;  3GK1 A;  3QRX A;  1LA3 A;  4WQ2 A;  3SVU A;  4JPZ B;  5IBW A;  2IB5 A;  4I5L B;  4IJ7 A;  1UWO A;  2KFH A;  3SVB A;  5HKZ A;  4ZF4 A;  1KFX S;  2L2E A;  4DKN A;  4KAG A;  1K8U A;  3PAL A;  3FWB A;  2WHU A;  1QIW A;  1IGV A;  1N65 A;  3CFA A;  2BBN A;  3WNX B;  5HL1 A;  1KFX L;  3CZ2 A;  3DF0 A;  5DRG A;  4Q7R A;  1P28 A;  4W6H A;  2BE6 A;  1KFU S;  4JKT A;  2KI4 C;  2OTE A;  4WQ3 A;  3R1P A;  4MZK A;  1KWO C;  1IJ6 A;  3ST2 A;  3PJ5 A;  1YRU B;  1QYO A;  2K60 A;  1KFU L;  5DTL A;  1SYM A;  3IP2 A;  2AWL A;  2Q91 A;  4PE7 A;  3RZS A;  1RFJ A;  2H5R A;  1RMP A;  2HCG A;  2IE2 A;  4W7D A;  4DXP A;  4GNK B;  4P5O E;  4P2Y B;  3E5T A;  1F70 A;  1B8L A;  4LJD A;  3I5I C;  3S0E A;  3JVT B;  2KBI A;  1FI5 A;  3IVT A;  1C7W A;  2CNP A;  4HRE E;  2M7L A;  5DQM A;  1OZO A;  2A50 B;  1J7P A;  1NWD A;  5HZO A;  3LF4 B;  5AXI A;  1IJ5 A;  1UHJ A;  3PAT A;  2KQ6 A;  2JNF A;  1LVC D;  2E30 A;  3ADF A;  1OQP A;  3SSY A;  1GGW A;  5KTY A;  2JPO A;  1G4Y R;  3DQI A;  4LJB A;  2JT0 A;  2KFF A;  3K1E A;  2KYF A;  3PLF B;  4N1G A;  1QTX A;  1WDC C;  1EMM A;  1GFL A;  2WOS A;  4WRI A;  4W6F A;  2DUI A;  3DQK A;  4JC2 A;  1AUI B;  1YTZ C;  1AHR A;  3DQ3 A;  1B47 A;  1YJF A;  5AQB B;  1EMF A;  1CTR A;  1B7T Z;  1CFP A;  5EXB A;  3PJ7 A;  2Y1M A;  2EMN A;  4H48 A;  4KF5 A;  4L9M A;  5KTG A;  3DQ4 A;  3SG5 A;  2KSP A;  2IS9 A;  3LCP C;  1RRX A;  2FCE A;  3PN7 C;  2CBL A;  2JPT A;  3SVE A;  4MRX A;  1YVH A;  2QEO A;  4CID A;  2OKW A;  3S0B A;  3EVP A;  3PIB A;  4XOV A;  1RRO A;  3DQL A;  3AAJ A;  1OOH A;  2L4H A;  2QEV A;  3TMT A;  3S0G A;  3SVO A;  1W7T A;  1XFU O;  2KLE A;  5DPG A;  3TUY C;  1QVI Y;  4NDC A;  1DJW A;  3OB2 B;  3SS3 A;  2LM5 A;  1M31 A;  4KW9 A;  4ZF3 A;  1IQ5 A;  3HX4 A;  1JC0 A;  4GGF C;  3PFV A;  1Q4D A;  3K1K A;  4YI9 A;  2WC8 A;  2OTG C;  2DDC A;  2V53 A;  2JXC A;  5D7F A;  2LHL A;  4W76 A;  2OS8 B;  1MUX A;  1RMO A;  3FS7 A;  3TDI A;  2SCP A;  3CD9 A;  1FW4 A;  1YHG A;  1K2H A;  5DIC A;  4I5K A;  1PAL A;  5K89 A;  4W6J A;  1Y1A A;  2K2F A;  3K21 A;  3NF0 A;  3DQD A;  3CD1 A;  2A47 A;  2L5X B;  4W6B A;  1MOU A;  4C0K A;  1A29 A;  1J1E A;  4OKH A;  1XFW O;  2ZNE A;  2WCM A;  4Q7T A;  4E68 A;  1KQM C;  1Y1X A;  1UP5 A;  3IF7 A;  3VRO A;  3V2L A;  1DT7 B;  5FYX A;  1QS7 A;  2KHN A;  2Y0G A;  2MJW B;  2PAS A;  1IWQ A;  1YJ2 A;  4RYW A;  1K95 A;  2YE1 A;  1EXR A;  3BXC A;  2M1K B;  2KI4 B;  2JTZ A;  3DQE A;  1PVB A;  3TMR A;  4ZFS A;  1W9Z A;  1XK4 A;  2H6V A;  1ZUX A;  1KWO B;  1DVI A;  4JQ0 D;  1BFP A;  2LC5 A;  1SCM C;  1FI6 A;  4H3L A;  5EJU A;  3DQN A;  1QYF A;  3SSK A;  5DPI A;  4Z4M A;  3Q8I A;  3BFA A;  5HLV A;  5B8I B;  2H5O A;  2KPH A;  2GW3 A;  2WSO A;  3NT9 A;  1TUJ A;  3CAB A;  2Q57 A;  4OY4 A;  2ZRS A;  2AAO A;  5JJG A;  3AAK A;  3DQ5 A;  4GPL B;  1TNX A;  1XFZ O;  3I5I B;  2AWK A;  1WLZ A;  1SPY A;  1YX7 A;  2LV7 A;  2DDD A;  1RMM A;  3LSA A;  2KBM A;  1BLQ A;  3ZUJ A;  2A56 B;  1H4B A;  3DQ2 A;  1S6C A;  5BQL A;  3NHI A;  4W7C A;  4TZG A;  2MLF C;  1M45 A;  1B8C A;  4Q04 A;  3E5V A;  4OZD A;  1C7V A;  1XFV O;  2GGM A;  4LW5 A;  2FCD A;  4NWS A;  1QXT A;  2PXW A;  3CB9 A;  3M22 A;  1KK7 Z;  4W6L A;  1DGU A;  5F9G A;  1LIN A;  4W6R A;  3N7H A;  2HQW A;  2WCJ A;  4GUK A;  1B7T Y;  3EKH A;  1YUT A;  3PN7 B;  3KO0 A;  2YGU A;  5DQB A;  4FTG A;  1KSM A;  3BUW B;  2BNX A;  3RLZ A;  4ANJ A;  2LP3 A;  1Z1Q A;  1WY9 A;  1C4F A;  5HZS A;  1CNP A;  1NX1 A;  3OHM B;  1JWD A;  3CFF A;  2OJK A;  2Z1O A;  4ORC B;  2VAE A;  2ZRT A;  1JC1 A;  2OTG B;  4FQO A;  2L2C A;  2WCF A;  5I8N A;  1DJX A;  1R6P A;  1YHH A;  3KEV A;  1AK8 A;  3ST4 A;  3RWA A;  1SR6 C;  4F0Z B;  4YGD B;  2FZU A;  1BOD A;  3WXA A;  1CMG A;  4I5N B;  3LVA A;  3NT3 A;  3P8U A;  4DXO A;  3A4U B;  3SSV A;  1CFC A;  1EMG A;  1FF1 A;  3WHT B;  2F2P A;  1N2D A;  3NSO A;  2KAX A;  2CXJ A;  4A4C A;  5DTY A;  4EDO A;  1KQM B;  5EL2 A;  3BUM B;  2JOJ A;  2QLH A;  1AJ4 A;  2MRD A;  4XJK B;  3D78 A;  1NX3 A;  1CLB A;  5HGE A;  3U8A A;  4INX A;  2P71 A;  1BT6 A;  2QEH A;  4CFQ A;  2RH7 A;  1CDN A;  3DQA A;  4PPK A;  2DOQ A;  1XAE A;  1X02 A;  5BPJ A;  1MF8 B;  3DVM A;  3DPW A;  1DEK A;  5DKQ A;  4W7X A;  4JFG A;  3EK7 A;  2DUE A;  5EB7 A;  5EXU A;  3DQM A;  2AHA A;  5EHU A;  4F7F A;  2YE0 A;  1G33 A;  4ICB A;  2K8M B;  1IG5 A;  2ZN8 A;  3SVD A;  1DJY A;  2GW4 B;  3GEX A;  4IZN A;  1D1O A;  3G9A A;  1GQM A;  2ZFD A;  3C1V A;  4OR9 B;  3VRQ A;  4OVN F;  1PK0 D;  2L0P A;  1CMF A;  3I5F C;  1A75 B;  3GK2 A;  1XMZ A;  3R1O A;  1JUO A;  5CSF A;  4MZL A;  4M2P A;  3TS5 C;  4IK8 A;  1W7J B;  4BDU A;  2QEB A;  2HPS A;  3DQ8 A;  4HVF A;  1ZGP A;  4B5Y A;  4GGF A;  3FIA A;  2BL0 C;  4HSZ A;  4PE0 A;  5FVF A;  1ZMZ A;  2KLD A;  1PSR A;  4QJ5 B;  1KSO A;  1LKJ A;  2BCA A;  2MBX A;  2KYC A;  3OP0 A;  3A8R A;  1HCJ A;  4NDD A;  1DF0 B;  1ZAC A;  3GK4 X;  1SL9 A;  2KGR A;  2P70 A;  4YBH B;  4XGY A;  2VZX A;  1W7S A;  4OCI A;  2WCL A;  5LTP A;  2O29 A;  3FWC A;  4U8D A;  4GFT A;  1OSA A;  4ZIO A;  3DVK A;  3ZTF A;  1MWN A;  3S0D A;  2FL1 A;  3SVC A;  4PE1 A;  4XJK A;  2LLT A;  3UG0 A;  2I2R E;  2KAV A;  2M1U A;  1IQ3 A;  1HQV A;  3DQH A;  4EDS A;  1ALW A;  1KK7 Y;  2SAS A;  2PSR A;  1J55 A;  3RWT A;  3U0N A;  3S0F A;  3NED A;  2Q6P A;  3WCK A;  1SW8 A;  1WRL A;  2H8Q A;  4DS7 A;  1XFY O;  3F45 A;  1UIS A;  3CWG A;  2F3Y A;  2JRF A;  4R6D A;  1DGV A;  2A52 B;  4KF4 A;  4LQU A;  3A8S A;  3BXB A;  2LAP A;  2WCB A;  1KCY A;  4PPL A;  1EMB A;  3BUX B;  1YVL A;  1J7Q A;  2K61 A;  1A75 A;  4ORN A;  4GGN A;  4CFR A;  3BFB A;  4ZB1 A;  4LQT A;  1MYW A;  2Y1N A;  2WHS A;  5DRF A;  2OTB A;  4KYN A;  2G2B A;  5LK4 A;  2NCO A;  1A4P A;  2ERB A;  2ZN9 A;  1SR6 B;  3U8C A;  2BKH B;  2F8P A;  3SSL A;  2Q4U A;  3NSI A;  3SG2 A;  4DRW A;  2BCB A;  3NXA A;  3SS4 A;  3P28 A;  1DF0 A;  2QLI A;  1B1G A;  2I7A A;  1Q4C A;  3SV5 A;  2H61 A;  2KAY A;  3MSE B;  1M39 A;  1CDM A;  3SG3 A;  1UHH A;  2G5Z B;  3NGV A;  5DPJ A;  4XOW A;  3OGO A;  1K96 A;  4W6U A;  5EXC I;  4UPG A;  3ED8 A;  2WCH A;  1FBV A;  1AP4 A;  3O78 A;  3SVS A;  4N3D A;  2DD7 A;  1SKT A;  4JWQ A;  4MVF A;  4YGE B;  5H87 A;  1A2X A;  3AI5 A;  4MEW A;  3GJ2 A;  4D1E A;  2P4M A;  2A53 B;  1W7I B;  2PVB A;  4KA9 A;  3DQ9 A;  2G6X A;  1S6J A;  1QLS A;  1K94 A;  1LXF C;  3VHT B;  2WCE A;  2BTJ A;  1BG1 A;  1Q4E A;  2LVI A;  2OGR A;  3L47 A;  2V4E C;  2AWJ A;  4HE4 A;  1CFF A;  2L50 A;  3I5F B;  1XVJ A;  5AFP A;  2VAD A;  3TS5 B;  2E6W A;  3VRN A;  2M29 A;  4P1Q A;  1CDL A;  1S6Z A;  5FVI A;  1T14 A;  2BL0 B;  2JZI A;  2PXS A;  4W7F A;  3BOW B;  3DQ6 A;  4JGE A;  5LTQ A;  3VIC A;  1IKU A;  3BUN B;  3OBV A;  2A4J A;  4KEX A;  2LVV A;  3OB1 B;  3O2P A;  2A48 A;  1U5I B;  1PSB A;  3U0K A;  1UUS A;  2FOT A;  3EVU A;  2PAL A;  4BY5 A;  2A46 A;  3DQO A;  1PRW A;  2WC6 A;  2CCM A;  2QLE A;  2AMI A;  1Y6W A;  2HFC A;  2L4I A;  2BKI B;  1F4Q A;  4HQ8 A;  2G9B A;  1QX7 A;  4L1I A;  4OV2 A;  2ZO7 A;  1QX2 A;  3EK8 A;  2MHH A;  2M49 B;  4KPI A;  4CPV A;  3VGO A;  3ZUF A;  1YUR A;  1SL7 A;  3ST0 A;  1NCX A;  3DVE A;  5FHV A;  1TTX A;  1AJ5 A;  1A03 A;  4PHM A;  4W72 A;  1OE9 B;  4GBA A;  3GJ1 A;  4DXI A;  3SIA A;  3D76 A;  4N1F A;  5FVG A;  3CLN A;  5CSN A;  1KK8 C;  1EL4 A;  5H88 A;  5FI6 A;  4FQT A;  4Z4K A;  2LLU A;  2RGI A;  3VHT A;  2JWW A;  2JC2 A;  3SG4 A;  4N5X A;  1NPQ A;  2QT2 A;  3OX6 A;  2Z6Z A;  1ZGO A;  1SY9 A;  2K0J A;  3UFZ A;  3SRY A;  3AKA A;  3NEZ A;  1ZOT B;  3S05 A;  1NX2 A;  2YFP A;  2CTN A;  4W75 A;  4EUL A;  4B30 B;  2F3Z A;  4W6D A;  3NSL A;  1Y0V H;  2QDI A;  3E5W A;  5HW9 A;  1TNQ A;  1B9A A;  2VVI A;  3PM2 A;  1Y1U A;  4GAO A;  4LJD C;  4MBE A;  3BOW A;  1QXP A;  4H3N A;  4LJC A;  2K7C A;  3GOF A;  2TN4 A;  2AH8 A;  1OXE A;  4R1E A;  3LL8 B;  3NSK A;  5HYD A;  4PFE A;  1TN4 A;  5ER5 A;  2L51 A;  1QWV A;  2M3W A;  1U5I A;  3B86 A;  1G8I A;  1ALV A;  4XYN A;  5HKW A;  1GL4 A;  2MA2 A;  2G3D B;  4PHK A;  2WUR A;  2ZO6 A;  1WDC B;  5ER4 X;  5DKN A;  1G7K A;  1QV0 A;  5DTZ A;  4PHN A;  2M97 A;  1IIO A;  2FWQ A;  3V3D A;  4M2Q A;  3DQ7 A;  2Z6X A;  2DUG A;  4PAL A;  1UHI A;  3CZ0 A;  1CLL A;  4MZJ A;  2QZ0 A;  1J7O A;  4W77 A;  3H4S E;  4XVP A;  1YRT B;  1BU3 A;  3E3R A;  1S36 A;  3EVR A;  1YUS A;  1RWY A;  1BMO A;  3BUO B;  2PMY A;  3PJI A;  1EG4 A;  3KCS A;  5D69 A;  4DIR A;  2V4E B;  3TUY B;  2QU1 A;  1OW4 A;  2BEC A;  3EVV A;  1L2O C;  2O2B A;  2HQ8 A;  4Q9W A;  2K7O A;  1BR4 B;  2Y5I A;  2DUF A;  4AQJ A;  3H1R A;  2EC6 C;  5DU0 A;  4W6P A;  4CLN A;  4B30 A;  2PYQ A;  1TCF A;  2DUH A;  4KGE A;  4RTC A;  3WLD A;  3I5G C; 
#chains in the Genus database with same CATH homology
 5DKR A;  3DPX A;  1B8R A;  1TNW A;  3SS0 A;  2JAD A;  2O5G A;  2CT9 A;  1DJH A;  1YR5 A;  4W7R A;  3DQ1 A;  2LUC A;  1Q4A A;  2AUC A;  3WLC A;  5J3X A;  2G3O A;  1WRZ A;  1QIV A;  2AWM A;  1SNL A;  3I5H C;  3DD4 A;  2KI6 D;  2YDZ A;  4EN1 A;  4DKM A;  1GGZ A;  4TZA A;  3KPX A;  2LNK A;  1DJZ A;  2LMU A;  1SCM B;  2LCP A;  2HF5 A;  3BXK A;  3LF3 A;  2B3P A;  4NQG A;  2LAN A;  1KYP A;  1XK4 C;  5T3I A;  5AEQ A;  5AAN A;  1IRJ A;  1Q73 A;  1XA9 A;  1NSH A;  1OMV A;  1V1F A;  3SJS A;  1ZUZ A;  3AKO A;  4YGA A;  5H89 A;  1DTL A;  1NIW A;  1YFP A;  2V4E A;  2H5P A;  5DY6 A;  2KQY A;  1TCO B;  2LMV A;  4L12 A;  3OSQ A;  4AR7 A;  3LK0 A;  1JFK A;  3SSH A;  4DUQ A;  3SVN A;  2JU0 A;  4BY4 A;  2HGD A;  4W6M A;  3OX5 A;  5I2Q A;  2LVK A;  1UHN A;  3U0L A;  2LE9 B;  4J8A A;  1JSA A;  1EME A;  3U0M A;  2WIS A;  4W7E A;  4R6B A;  1BR1 B;  4OQW A;  4ORA B;  3TDU A;  4W6C A;  3BXA A;  5BT0 A;  3SG6 A;  1B9C A;  4W6K A;  3JTD C;  4W6S A;  5CSJ A;  2ZKM X;  4GOB A;  1TIZ A;  3BX9 A;  1RM9 A;  3DQU A;  1YZW A;  3CBE A;  4IK3 A;  2LUX A;  4W6I A;  1PUL A;  5AER A;  1K9K A;  3CR4 X;  2HET A;  1UHK A;  2HQZ A;  5EB6 A;  4H47 A;  1S6I A;  1S5G Y;  1M46 A;  1K93 D;  3DQJ A;  1XSS A;  1CDP A;  1OMD A;  4C0J A;  1EMK A;  1OXF A;  4W73 A;  1F71 A;  2GX2 A;  2EMD A;  1VRK A;  1N0Y A;  1CB1 A;  3ZWH A;  5DPH A;  3DQC A;  1QJT A;  2COL B;  2KOT A;  1NUB A;  4MRY A;  1L2O B;  2ARL A;  1LA0 A;  2POX A;  3CGL A;  3ST3 A;  4DXQ A;  2GX0 A;  5LTR A;  2EC6 B;  1CFD A;  3CS1 A;  1EG3 A;  2WHT A;  4W6G A;  2KDH A;  2ZND A;  2A54 B;  5KU1 A;  4KW4 A;  1JC2 A;  1QYQ A;  2QLG B;  3I5G B;  3PM8 A;  4RYS A;  4ZIN A;  1F54 A;  2H2K A;  4QJ4 B;  2H9W A;  5HKY A;  3I19 A;  4AOM A;  1H4U A;  3IQQ A;  4YI8 A;  1NCY A;  4I5J A;  4W69 A;  4W6T A;  3PSR A;  1H6R A;  3LK1 A;  4MLW A;  1BOC A;  3GB3 A;  3SG7 A;  1QAS A;  5BTT B;  4M2O A;  4JRB A;  4ETO A;  1QAT A;  3SVR A;  2ISD A;  1YX8 A;  5CSI A;  1K9P A;  2QRF A;  3ZNI A;  4IK5 A;  1SBJ A;  1MOV A;  3I5H B;  4YGC B;  1XA5 A;  1F09 A;  3SIB A;  1EMA A;  1V1G A;  3AKB A;  4MN0 A;  3RM1 A;  4KW8 A;  2M0R A;  1NX0 A;  1XFX O;  1EJ3 A;  4W74 A;  1J1D A;  2LMT A;  2R2I A;  4P76 A;  2OKY A;  2K2A A;  2VVH A;  2EGD A;  2P6B B;  1S26 D;  2Z6Y A;  4AS8 A;  3O77 A;  4U2V A;  3BQ3 A;  2VRG A;  1UUR A;  1F55 A;  2NZ0 A;  2DD9 A;  3SST A;  3DPZ A;  1KP5 A;  1SK6 D;  3VRP A;  5DTX A;  2H5Q A;  4HRH A;  4ZCV A;  1CM1 A;  5I2O A;  1DJI A;  2QLG A;  2HQK A;  4IK4 A;  2D8N A;  2L98 A;  5HZT A;  2HGY A;  1CM4 A;  4C0L A;  2B3Q A;  4Q7U A;  5HZU A;  1GJY A;  3HCM A;  1OMR A;  4IL1 A;  3JTD B;  1ZGQ A;  2EMO A;  2JXL A;  1XO5 A;  3TDZ A;  5BTT A;  4GES B;  1F8H A;  2IOV A;  4JEO A;  5G08 A;  1JFJ A;  5F6T A;  5JOL A;  2K7B A;  2JUL A;  2G16 B;  1CKK A;  2B1U A;  2G6E A;  3OSR A;  1JF0 A;  1DJG A;  1MR8 A;  4DXM A;  1WLM A;  1MXE A;  1JF2 A;  2WOR A;  2M9G A;  1R2U A;  2KNE A;  1NYA A;  5GQQ C;  1EH2 A;  2KGB C;  3IQO A;  3O4Y A;  4H3M A;  1SMG A;  1CV7 A;  1C07 A;  3TZ1 A;  2HRS A;  4IK9 A;  4USL A;  4OHS A;  2KFG A;  1TRF A;  2HPW A;  3ICB A;  1L7Z A;  3LVD A;  3BYA A;  1H8B A;  2QAC A;  5TNC A;  3O6B A;  5J2O A;  1E8A A;  3D10 A;  1GGX A;  3VK1 A;  1OXD A;  3ZUL A;  1HUY A;  2WSN A;  1JBA A;  1JBZ A;  2GGZ A;  4PPJ A;  1OZS A;  4ZBL A;  3CR5 X;  4W6O A;  1MXL C;  3EK4 A;  4IK1 A;  4UTS A;  4W7A A;  1RTP 1;  1M63 B;  3GL4 A;  2HJO A;  4HQC A;  2JQ6 A;  4J89 A;  1EML A;  2I94 A;  4PDZ A;  3VRR A;  1SL8 A;  4YRU A;  1K9U A;  2H61 C;  3LS3 A;  2Y4Q A;  1KYS A;  4DCK A;  2LP2 A;  2GV5 A;  1BF5 A;  1WRK A;  1S5G Z;  4I2Y A;  2NCP A;  1Z1P A;  2BCX A;  3WHU B;  4PHJ A;  1QY3 A;  4ZCU A;  1DMO A;  4DXN A;  4A4B A;  2ZMW A;  1F4O A;  4JF9 A;  4KF5 C;  2ZMU A;  1NP8 A;  2LLS A;  4ZF5 A;  3W1D A;  2F2O A;  4J88 A;  3PJB A;  1J7R A;  4Q9X A;  2VVJ A;  1PVA A;  1S3P A;  1KQV A;  1AVS A;  1F0B A;  2WND A;  4NDB A;  1TOP A;  4MSP A;  3CR2 A;  2JNX A;  1W7U A;  4AQI A;  4GF6 B;  3LA1 A;  2C9I A;  2BBM A;  2IB6 A;  2FJU B;  4YGB B;  3D0Y B;  1QX5 B;  3KCT A;  4ORB B;  1RK9 A;  1CLM A;  5I2L A;  1MHO A;  4PCW A;  3CFH A;  5CPV A;  3M24 A;  1XYD A;  3AI4 A;  3JVT C;  1EMC A;  3KHE A;  2EHB A;  1YHI A;  3DQF A;  2QPT A;  1TNP A;  2M7N A;  3IR8 A;  1YUU A;  2JT3 A;  4XL5 A;  1REC A;  3DVJ A;  2NXQ A;  2OPO A;  3M0W A;  1IH0 A;  2M8U A;  4KGF A;  1QV1 A;  5HBD A;  2O60 A;  5HLO A;  3U8P A;  1JBY A;  3EKJ A;  1HT9 A;  2I18 A;  1QLK A;  1KK8 B;  2MLE C;  4HRG A;  2K7D A;  1S1E A;  3DF0 B;  3LVC A;  1Q4B A;  3KF9 A;  1SCV A;  2BE4 A;  4HQ9 A;  3W1C A;  3LLE A;  4L13 A;  3CGA A;  1KYR A;  3CZT X;  2JTT A;  3CTN A;  3SSP A;  1QVI Z;  1ODB A;  1ZFS A;  2F33 A;  1K90 D;  2C9J A;  4W6A A;  4PE4 A;  4OJ0 A;  1FPW A;  4QJ3 B;  2G6Y A;  4EMQ A;  2PRU A;  5EBJ A;  4W6N A;  2G2S B;  2LVJ A;  3D0Y A;  1MQ1 A;  5PAL A;  2O24 A;  1OOJ A;  1B4C A;  2ICR A;  1SRA A;  2NLN A;  2MAZ A;  5KSZ A;  2OS8 C;  3MGF A;  1XQM A;  1RJV A;  4TNC A;  1BJF A;  2JT8 A;  2KI6 C;  3H1O A;  1Q80 A;  1NCZ A;  4OGS A;  2LHI A;  2WIQ A;  3GK1 A;  3QRX A;  1LA3 A;  4WQ2 A;  3SVU A;  4JPZ B;  5IBW A;  2IB5 A;  4I5L B;  1UWO A;  2KFH A;  3SVB A;  5HKZ A;  4ZF4 A;  1KFX S;  2L2E A;  4DKN A;  4KAG A;  1K8U A;  3PAL A;  3FWB A;  2WHU A;  1QIW A;  1IGV A;  1N65 A;  3CFA A;  2BBN A;  3WNX B;  1KFX L;  3DF0 A;  5DRG A;  4Q7R A;  4W6H A;  2BE6 A;  1KFU S;  2KI4 C;  2OTE A;  4WQ3 A;  4MZK A;  1KWO C;  1IJ6 A;  3ST2 A;  3PJ5 A;  1YRU B;  1QYO A;  1KFU L;  5DTL A;  1SYM A;  3IP2 A;  2AWL A;  2Q91 A;  4PE7 A;  1RFJ A;  2H5R A;  1RMP A;  2HCG A;  2IE2 A;  4W7D A;  4DXP A;  4GNK B;  4P5O E;  4P2Y B;  3E5T A;  1F70 A;  1B8L A;  4LJD A;  3I5I C;  3JVT B;  2KBI A;  1FI5 A;  1C7W A;  2CNP A;  4HRE E;  2M7L A;  5DQM A;  1OZO A;  2A50 B;  1J7P A;  1NWD A;  5HZO A;  3LF4 B;  5AXI A;  1IJ5 A;  1UHJ A;  3PAT A;  2KQ6 A;  2JNF A;  1LVC D;  2E30 A;  3ADF A;  1OQP A;  3SSY A;  1GGW A;  5KTY A;  1G4Y R;  3DQI A;  4LJB A;  2JT0 A;  2KFF A;  2KYF A;  3PLF B;  4N1G A;  1QTX A;  1WDC C;  1EMM A;  1GFL A;  2WOS A;  4WRI A;  4W6F A;  4JC2 A;  3DQK A;  2DUI A;  1AUI B;  1YTZ C;  1AHR A;  3DQ3 A;  1B47 A;  1YJF A;  5AQB B;  1EMF A;  1CTR A;  1B7T Z;  1CFP A;  5EXB A;  3PJ7 A;  2Y1M A;  2EMN A;  4H48 A;  4KF5 A;  4L9M A;  5KTG A;  3DQ4 A;  3SG5 A;  2KSP A;  2IS9 A;  3LCP C;  1RRX A;  2FCE A;  3PN7 C;  2CBL A;  2JPT A;  3SVE A;  4MRX A;  1YVH A;  4CID A;  2OKW A;  3EVP A;  3PIB A;  4XOV A;  1RRO A;  3DQL A;  3AAJ A;  2L4H A;  3TMT A;  3SVO A;  1W7T A;  1XFU O;  5DPG A;  3TUY C;  1QVI Y;  4NDC A;  1DJW A;  3OB2 B;  2LM5 A;  1M31 A;  4KW9 A;  4ZF3 A;  1IQ5 A;  3HX4 A;  1JC0 A;  4GGF C;  3PFV A;  1Q4D A;  3K1K A;  4YI9 A;  2WC8 A;  2OTG C;  2DDC A;  2V53 A;  2JXC A;  5D7F A;  2LHL A;  4W76 A;  2OS8 B;  1MUX A;  1RMO A;  3FS7 A;  3TDI A;  2SCP A;  3CD9 A;  1FW4 A;  1YHG A;  1K2H A;  4I5K A;  1PAL A;  5K89 A;  4W6J A;  1Y1A A;  2K2F A;  3K21 A;  3NF0 A;  3DQD A;  3CD1 A;  2A47 A;  2L5X B;  4W6B A;  1MOU A;  4C0K A;  1A29 A;  1J1E A;  4OKH A;  1XFW O;  2ZNE A;  4Q7T A;  4E68 A;  1KQM C;  1Y1X A;  1UP5 A;  3IF7 A;  3VRO A;  1DT7 B;  5FYX A;  1QS7 A;  2KHN A;  2Y0G A;  2MJW B;  2PAS A;  1IWQ A;  1YJ2 A;  4RYW A;  1K95 A;  2YE1 A;  1EXR A;  3BXC A;  2M1K B;  2KI4 B;  2JTZ A;  3DQE A;  1PVB A;  3TMR A;  4ZFS A;  1XK4 A;  2H6V A;  1ZUX A;  1KWO B;  1DVI A;  4JQ0 D;  1BFP A;  2LC5 A;  1SCM C;  1FI6 A;  4H3L A;  5EJU A;  3DQN A;  1QYF A;  3SSK A;  5DPI A;  4Z4M A;  5HLV A;  5B8I B;  2H5O A;  2GW3 A;  2WSO A;  3NT9 A;  2Q57 A;  4OY4 A;  2ZRS A;  2AAO A;  5JJG A;  3AAK A;  3DQ5 A;  4GPL B;  1TNX A;  1XFZ O;  3I5I B;  2AWK A;  1WLZ A;  1SPY A;  1YX7 A;  2LV7 A;  2DDD A;  1RMM A;  3LSA A;  2KBM A;  1BLQ A;  3ZUJ A;  2A56 B;  1H4B A;  3DQ2 A;  1S6C A;  5BQL A;  4W7C A;  4TZG A;  2MLF C;  1M45 A;  1B8C A;  4Q04 A;  3E5V A;  1C7V A;  1XFV O;  2GGM A;  4LW5 A;  2FCD A;  4NWS A;  1QXT A;  2PXW A;  3CB9 A;  3M22 A;  1KK7 Z;  4W6L A;  1DGU A;  5F9G A;  1LIN A;  4W6R A;  2HQW A;  4GUK A;  1B7T Y;  3EKH A;  1YUT A;  3PN7 B;  3KO0 A;  5DQB A;  4FTG A;  1KSM A;  3BUW B;  3RLZ A;  4ANJ A;  2LP3 A;  1Z1Q A;  1WY9 A;  1C4F A;  5HZS A;  1CNP A;  1NX1 A;  3OHM B;  1JWD A;  3CFF A;  2OJK A;  2Z1O A;  4ORC B;  2VAE A;  2ZRT A;  1JC1 A;  2OTG B;  4FQO A;  2WCF A;  5I8N A;  1DJX A;  1R6P A;  1YHH A;  3KEV A;  1AK8 A;  3ST4 A;  3RWA A;  1SR6 C;  4F0Z B;  4YGD B;  2FZU A;  1BOD A;  3WXA A;  1CMG A;  4I5N B;  3LVA A;  3NT3 A;  3P8U A;  4DXO A;  3A4U B;  3SSV A;  1CFC A;  1EMG A;  1FF1 A;  3WHT B;  2F2P A;  1N2D A;  3NSO A;  2KAX A;  2CXJ A;  4A4C A;  5DTY A;  4EDO A;  1KQM B;  3BUM B;  2JOJ A;  2QLH A;  1AJ4 A;  2MRD A;  4XJK B;  1NX3 A;  1CLB A;  5HGE A;  3U8A A;  1BT6 A;  4CFQ A;  2RH7 A;  1CDN A;  3DQA A;  4PPK A;  2DOQ A;  1XAE A;  1X02 A;  5BPJ A;  1MF8 B;  3DVM A;  3DPW A;  5DKQ A;  4W7X A;  4JFG A;  3EK7 A;  2DUE A;  5EB7 A;  5EXU A;  3DQM A;  2AHA A;  5EHU A;  2YE0 A;  1G33 A;  4ICB A;  2K8M B;  1IG5 A;  2ZN8 A;  3SVD A;  1DJY A;  2GW4 B;  3GEX A;  4IZN A;  1D1O A;  3G9A A;  1GQM A;  2ZFD A;  3C1V A;  4OR9 B;  3VRQ A;  4OVN F;  1PK0 D;  2L0P A;  1CMF A;  3I5F C;  1A75 B;  3GK2 A;  1XMZ A;  1JUO A;  5CSF A;  4MZL A;  4M2P A;  3TS5 C;  4IK8 A;  1W7J B;  4BDU A;  2HPS A;  3DQ8 A;  4HVF A;  1ZGP A;  4B5Y A;  4GGF A;  3FIA A;  2BL0 C;  4HSZ A;  4PE0 A;  5FVF A;  1ZMZ A;  1PSR A;  4QJ5 B;  1KSO A;  1LKJ A;  2BCA A;  2MBX A;  2KYC A;  3OP0 A;  3A8R A;  1HCJ A;  4NDD A;  1DF0 B;  1ZAC A;  3GK4 X;  1SL9 A;  2KGR A;  4YBH B;  4XGY A;  2VZX A;  1W7S A;  4OCI A;  5LTP A;  2O29 A;  3FWC A;  4U8D A;  4GFT A;  1OSA A;  4ZIO A;  3DVK A;  3ZTF A;  1MWN A;  2FL1 A;  3SVC A;  4PE1 A;  4XJK A;  2LLT A;  3UG0 A;  2I2R E;  2KAV A;  2M1U A;  1IQ3 A;  1HQV A;  3DQH A;  4EDS A;  1ALW A;  1KK7 Y;  2SAS A;  2PSR A;  1J55 A;  3RWT A;  3U0N A;  3NED A;  2Q6P A;  3WCK A;  1SW8 A;  1WRL A;  2H8Q A;  4DS7 A;  1XFY O;  3F45 A;  1UIS A;  3CWG A;  2F3Y A;  2JRF A;  4R6D A;  1DGV A;  2A52 B;  4KF4 A;  4LQU A;  3A8S A;  3BXB A;  2LAP A;  2WCB A;  1KCY A;  4PPL A;  1EMB A;  3BUX B;  1YVL A;  1J7Q A;  2K61 A;  1A75 A;  4ORN A;  4GGN A;  4CFR A;  4ZB1 A;  4LQT A;  1MYW A;  2Y1N A;  2WHS A;  5DRF A;  2OTB A;  2G2B A;  5LK4 A;  2NCO A;  1A4P A;  2ZN9 A;  1SR6 B;  3U8C A;  2BKH B;  2F8P A;  3SSL A;  2Q4U A;  3NSI A;  3SG2 A;  4DRW A;  2BCB A;  3NXA A;  3P28 A;  1DF0 A;  2QLI A;  1B1G A;  2I7A A;  1Q4C A;  3SV5 A;  2H61 A;  2KAY A;  3MSE B;  1M39 A;  1CDM A;  3SG3 A;  1UHH A;  2G5Z B;  5DPJ A;  4XOW A;  3OGO A;  1K96 A;  4W6U A;  5EXC I;  4UPG A;  3ED8 A;  1FBV A;  1AP4 A;  3O78 A;  3SVS A;  4N3D A;  2DD7 A;  1SKT A;  4JWQ A;  4MVF A;  4YGE B;  5H87 A;  1A2X A;  3AI5 A;  4MEW A;  3GJ2 A;  4D1E A;  2P4M A;  2A53 B;  1W7I B;  2PVB A;  4KA9 A;  3DQ9 A;  2G6X A;  1S6J A;  1QLS A;  1K94 A;  1LXF C;  3VHT B;  2WCE A;  2BTJ A;  1BG1 A;  1Q4E A;  2LVI A;  2OGR A;  2V4E C;  2AWJ A;  4HE4 A;  1CFF A;  2L50 A;  3I5F B;  1XVJ A;  5AFP A;  2VAD A;  3TS5 B;  2E6W A;  3VRN A;  2M29 A;  4P1Q A;  1CDL A;  1S6Z A;  5FVI A;  2JZI A;  2BL0 B;  4W7F A;  2PXS A;  3BOW B;  3DQ6 A;  4JGE A;  5LTQ A;  3VIC A;  1IKU A;  3BUN B;  2A4J A;  4KEX A;  2LVV A;  3OB1 B;  3O2P A;  2A48 A;  1U5I B;  1PSB A;  3U0K A;  1UUS A;  2FOT A;  3EVU A;  2PAL A;  4BY5 A;  2A46 A;  3DQO A;  1PRW A;  2QLE A;  2CCM A;  2AMI A;  1Y6W A;  2HFC A;  2L4I A;  2BKI B;  1F4Q A;  4HQ8 A;  2G9B A;  1QX7 A;  4L1I A;  4OV2 A;  2ZO7 A;  1QX2 A;  3EK8 A;  2MHH A;  2M49 B;  4KPI A;  4CPV A;  3VGO A;  3ZUF A;  1YUR A;  1SL7 A;  3ST0 A;  1NCX A;  3DVE A;  5FHV A;  1TTX A;  1AJ5 A;  1A03 A;  4PHM A;  4W72 A;  1OE9 B;  4GBA A;  3GJ1 A;  4DXI A;  3SIA A;  4N1F A;  5FVG A;  3CLN A;  5CSN A;  1KK8 C;  1EL4 A;  5H88 A;  4Z4K A;  2LLU A;  2RGI A;  3VHT A;  2JWW A;  2JC2 A;  3SG4 A;  4N5X A;  1NPQ A;  2QT2 A;  3OX6 A;  2Z6Z A;  1ZGO A;  1SY9 A;  2K0J A;  3UFZ A;  3SRY A;  3AKA A;  3NEZ A;  1ZOT B;  3S05 A;  1NX2 A;  2YFP A;  2CTN A;  4W75 A;  4EUL A;  4B30 B;  2F3Z A;  4W6D A;  3NSL A;  1Y0V H;  5HW9 A;  3E5W A;  1TNQ A;  1B9A A;  2VVI A;  1Y1U A;  4GAO A;  4LJD C;  4MBE A;  3BOW A;  1QXP A;  4H3N A;  4LJC A;  2K7C A;  3GOF A;  2TN4 A;  2AH8 A;  1OXE A;  4R1E A;  3LL8 B;  3NSK A;  5HYD A;  4PFE A;  1TN4 A;  5ER5 A;  2L51 A;  2M3W A;  1U5I A;  1G8I A;  1ALV A;  4XYN A;  5HKW A;  1GL4 A;  2MA2 A;  2G3D B;  4PHK A;  2WUR A;  2ZO6 A;  1WDC B;  5ER4 X;  5DKN A;  1G7K A;  1QV0 A;  5DTZ A;  4PHN A;  2M97 A;  2FWQ A;  3V3D A;  4M2Q A;  3DQ7 A;  2Z6X A;  2DUG A;  4PAL A;  1UHI A;  1CLL A;  4MZJ A;  2QZ0 A;  1J7O A;  4W77 A;  3H4S E;  4XVP A;  1YRT B;  1BU3 A;  3E3R A;  1S36 A;  3EVR A;  1YUS A;  1RWY A;  1BMO A;  3BUO B;  2PMY A;  1EG4 A;  3KCS A;  5D69 A;  4DIR A;  2V4E B;  3TUY B;  2QU1 A;  2BEC A;  3EVV A;  1L2O C;  2O2B A;  2HQ8 A;  4Q9W A;  2K7O A;  1BR4 B;  2Y5I A;  2DUF A;  4AQJ A;  3H1R A;  2EC6 C;  5DU0 A;  4W6P A;  4CLN A;  4B30 A;  1TCF A;  2DUH A;  4KGE A;  4RTC A;  3WLD A;  3I5G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...