3EKHA

Calcium-saturated gcamp2 t116v/k378w mutant monomer
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
409
structure length
394
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARWMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 137
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ekhA01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ekhA02
4C0JA 2P6BB 4MEWA 1L2OC 2DD9A 2LLSA 3O4YA 1KQMB 4J89A 1QYQA 2KAVA 5HLVA 1CDPA 1W7TA 2WORA 3CLNA 1BMOA 4J88A 4HRHA 2L2EA 4PE7A 2B1UA 1QYFA 3DF0B 4W6MA 5LTRA 2ARLA 3OB2B 1CM4A 2H5RA 2QRFA 4YI8A 1KQMC 1OQPA 3SVRA 3IF7A 4N5XA 2PRUA 3AI4A 2WHUA 1XQMA 4QJ4B 4LQUA 4DKMA 3BYAA 4DXNA 4ZCUA 4DXPA 4I5JA 2LHIA 3BXCA 4M2PA 4L1IA 5HZTA 5B8IB 2KHNA 2VAEA 4GBAA 1RMPA 3DQKA 4MRXA 4ORCB 3M0WA 1Q4CA 1NUBA 2YDZA 1LXFC 1FBVA 4GGFA 3SRYA 3ST0A 4IK1A 1BJFA 2L50A 1MR8A 2NCPA 2JT3A 2LLTA 1CFFA 4GNKB 1XMZA 3LK0A 3P28A 2WHTA 1EL4A 4I5NB 1ZACA 2K7CA 2Z6ZA 2P4MA 4NDCA 1N0YA 4L13A 1K9UA 2M7LA 1OZOA 2OPOA 2LVVA 1EJ3A 2KI4B 3FWCA 2A46A 3TZ1A 3RWTA 5DY6A 4UPGA 3GEXA 1XSSA 3D0YA 4E68A 5ER4X 2LC5A 1KK8B 2F2OA 1K2HA 2KI4C 4W6SA 3SSYA 5F6TA 2MLEC 3LVCA 3H4SE 1XK4A 2K7BA 4MRYA 3DQAA 4DKNA 2PASA 1J7PA 2VVHA 5J3XA 3SVOA 3BX9A 4TZAA 2A4JA 4I2YA 2H5PA 1JBAA 1B9CA 4KPIA 3RM1A 3CWGA 1UUSA 4Q7UA 4ZF5A 1KK8C 4GF6B 3DVJA 5F9GA 3GB3A 1F8HA 2HPWA 4R6BA 3IQQA 4Q7TA 5H87A 1QV1A 2HRSA 3V3DA 3DPZA 4GPLB 2OS8B 1XFVO 2ICRA 2A47A 3SVNA 4KF5C 3CD9A 1YFPA 1PVBA 3LVAA 1Y1UA 4IK8A 2L0PA 1B47A 5EB7A 1D1OA 1QXTA 4XOVA 1XYDA 2G2SB 3E5WA 2DDCA 1PRWA 2OS8C 3DVKA 1RROA 4W7AA 1F4OA 4Z4KA 4W6OA 2Q4UA 1F4QA 3VROA 3DQ8A 2BE4A 5HKZA 2WCFA 1QX5B 2JT8A 1SBJA 5AXIA 3ST2A 2M97A 2KI6D 2WURA 3GOFA 4GOBA 3KHEA 2LP2A 2NXQA 2QLGA 3VHTB 3OSRA 5D7FA 1K95A 3DQFA 1DF0A 4NWSA 1WRZA 2KOTA 1H8BA 4KW8A 4Q9XA 3KEVA 1CM1A 5JOLA 1N65A 3AAKA 1XFWO 3FIAA 2VADA 2ZN9A 1MYWA 4USLA 3E3RA 3E5TA 2G6XA 1JC1A 3SG2A 3SS0A 4KGEA 2EHBA 2PXWA 5BTTA 5DRFA 2FOTA 1BLQA 1YUUA 2Y1NA 4J8AA 2TN4A 1N2DA 3BOWB 2MHHA 5EB6A 2VVIA 2BTJA 5DPIA 4B5YA 4OY4A 3GK4X 4W6FA 1BOCA 3AI5A 2G6EA 2WNDA 3SSVA 4W6JA 5AERA 4ORAB 2ZMUA 5FHVA 1Z1QA 2RH7A 3NEDA 1G4YR 2ZRTA 5DTXA 3DQNA 3DF0A 1CFDA 4DXMA 4PCWA 1PULA 1KK7Z 2KFFA 4PE0A 4ORNA 1M63B 1GQMA 2WIQA 3NSKA 3SVCA 3PN7B 3CR5X 2B3PA 1QLKA 1ALWA 2K0JA 2KFHA 1RMOA 5KSZA 1F0BA 1TNXA 1UISA 2Q6PA 4OR9B 2M49B 1B7TZ 1CLMA 1QX7A 3CGAA 5PALA 3DPXA 2G3OA 1VRKA 4CIDA 4JF9A 4EDSA 4OJ0A 1J1EA 2H61C 2PALA 1S6ZA 4W6KA 5DKNA 4EDOA 2G9BA 1LINA 3U0LA 1CFCA 5DTZA 2HQKA 2LP3A 3I5GC 2I2RE 1S5GY 1QS7A 3VRNA 1F70A 1NWDA 1WDCB 1JWDA 1V1GA 1TNQA 3EVPA 2FWQA 3GK1A 3CB9A 4KF4A 1QY3A 3KO0A 1OSAA 1YX8A 3SG6A 2Y1MA 2F33A 3DD4A 1ZUZA 1WDCC 2MRDA 1IG5A 4YRUA 3SSKA 4OVNF 2K61A 1OMDA 1MXLC 2KGRA 1W7IB 1SCMC 1K96A 5DTYA 1Q80A 4Q04A 3LA1A 5DPHA 4L12A 2C9JA 1NX1A 4XL5A 2LE9B 1TTXA 4GESB 3U0MA 3EK7A 5HZUA 4KF5A 1YHGA 4XVPA 1DJXA 1A4PA 3GJ1A 4JGEA 3HX4A 2DUGA 2HGDA 3SSPA 4W6TA 2WISA 2QLEA 2LANA 4MZJA 1QASA 1ZUXA 4DUQA 2PSRA 3TS5B 4GGNA 5HZSA 2OGRA 1A29A 1QATA 1S6JA 3U8AA 3EVRA 4MZKA 4RTCA 4XJKB 2Z6XA 1NCZA 2V53A 3OGOA 1M45A 3ZUJA 1UWOA 2M8UA 4W7EA 4P1QA 5EHUA 3TS5C 1DT7B 2O2BA 1PSRA 3TMRA 4EULA 2JOJA 4CLNA 3ED8A 1XFXO 2JADA 4PPJA 5DKQA 1MQ1A 2QLIA 2JTZA 4ETOA 4OV2A 1XFUO 1MHOA 5DU0A 1XAEA 2ZO6A 4YGAA 4KAGA 1F09A 1YHIA 3A8SA 3VHTA 1HT9A 4PE1A 2GX2A 4ZCVA 3TUYB 4CFRA 4DXOA 5HLOA 3DQDA 3PFVA 3JTDB 4IK9A 4NQGA 5CSIA 1PVAA 2EMOA 3DQ6A 4EMQA 2HQWA 1AVSA 3TUYC 1RECA 1DVIA 4H48A 2BCAA 1QXPA 1KWOB 3CFHA 4W73A 3M24A 1YRTB 1RJVA 3OB1B 4W7DA 1M31A 1KFXL 3JTDC 3RWAA 2HJOA 4XGYA 2OJKA 3VK1A 1BG1A 4H3NA 3BOWA 3SG7A 3DPWA 4W74A 2L4IA 5ER5A 3OP0A 2ZO7A 1SCVA 4IZNA 3LVDA 2RGIA 3NF0A 2LM5A 3PSRA 4PHJA 1KWOC 1GFLA 2IB6A 2KBMA 1PK0D 4H3LA 1NX2A 1YZWA 1QLSA 1SL7A 3AKAA 1ZGOA 2KBIA 2FL1A 1K9KA 4OQWA 1Y6WA 2AWMA 4IK5A 3SG5A 3DQEA 1B1GA 1QVIY 2EGDA 5LTQA 4MSPA 3TDIA 2CCMA 5H89A 3NEZA 4YI9A 2A50B 3ADFA 1YURA 4DS7A 3VRQA 5HYDA 2I18A 1SL9A 4I5KA 1WRKA 2H61A 1TNPA 1S3PA 1ODBA 2EMNA 4AR7A 1Q4DA 1CV7A 3CBEA 1CMFA 3NT3A 1HQVA 1K8UA 2CNPA 1XA9A 1BODA 2ZMWA 5FVGA 4H47A 1ZGQA 4ZINA 2LHLA 2AHAA 4D1EA 1BU3A 1SYMA 1BFPA 2LMVA 3LCPC 4WQ2A 3H1RA 2BL0B 2AAOA 1UHIA 4MZLA 2HQ8A 1UHJA 4YBHB 1A2XA 1S6IA 5T3IA 1QYOA 4ANJA 1EG4A 2QU1A 1KYRA 2JZIA 3H1OA 3ST3A 2Y5IA 1IRJA 4Z4MA 3U0KA 2BL0C 4MBEA 2KI6C 1M39A 1NX0A 4W6DA 3WHUB 2WSOA 3I19A 4CFQA 4P76A 4OHSA 3SVSA 3ZUFA 1AUIB 2JNXA 2OTBA 2QZ0A 1Q4EA 1TN4A 1NP8A 2Y0GA 3TMTA 1SNLA 2L98A 2JC2A 1EMKA 2HETA 2V4EB 1CDLA 3VGOA 1YR5A 2DUIA 3D10A 2JULA 4F0ZB 1DMOA 1QV0A 1RWYA 3DQUA 1LKJA 1EMCA 4W6UA 3SIBA 3BXAA 1CLLA 3SVUA 4W6AA 1U5IB 2V4EC 4B30B 1Q4AA 2AUCA 1KFXS 1KYSA 1F71A 3GL4A 1DTLA 1SL8A 3RLZA 3WCKA 4XJKA 1CKKA 1MF8B 4PDZA 4HRGA 4BY4A 2MAZA 3BQ3A 1EMBA 2QLHA 1SR6B 5BT0A 3EVVA 1CLBA 1TOPA 1R6PA 3EKHA 3O78A 5G08A 3WXAA 4IL1A 4QJ3B 2ZFDA 1C7VA 3LF4B 1ZMZA 5DTLA 1SR6C 1DJYA 4MN0A 2FCDA 1KSOA 3I5FB 4JFGA 2CBLA 1HCJA 1YHHA 1Y1AA 2G2BA 4U2VA 2POXA 2ZRSA 1J1DA 1JF2A 1BR1B 3SV5A 2LMTA 2JTTA 3S05A 3KCSA 1E8AA 3ZNIA 1JC2A 3I5FC 4MLWA 4JPZB 4OKHA 1NCXA 1UHHA 5TNCA 4HQ9A 2FZUA 3U0NA 1XFYO 5DRGA 1W7JB 3EK4A 4JWQA 1S1EA 2A54B 3DQJA 3PJ7A 5D69A 1W7SA 4LJDC 2BKHB 4U8DA 1YUSA 1DJWA 1MWNA 4JC2A 1MOUA 3PN7C 4GAOA 2LNKA 1FPWA 2YE0A 1H6RA 3DVMA 2QT2A 2IB5A 3D0YB 3WHTB 5HZOA 2KQYA 1EH2A 4PE4A 1G7KA 4LJCA 5FVIA 1AHRA 3SVBA 4YGCB 4AQJA 1BT6A 5KTYA 3ST4A 2VRGA 1JFKA 3W1DA 4ORBB 5I2QA 1J7OA 4TZGA 2VZXA 4N1GA 5CSJA 3UFZA 4W6LA 1GL4A 1UURA 2Q57A 4N3DA 2M1KB 2GW4B 2JRFA 2AMIA 3DQ7A 2LMUA 3MGFA 4EN1A 2KAYA 3NT9A 5H88A 4ZIOA 2HCGA 2M9GA 1LVCD 2BECA 2ZKMX 2Z6YA 1BF5A 3O77A 1SMGA 4W69A 1ZGPA 2M7NA 1UHNA 3DQMA 1YJ2A 2DOQA 2MLFC 5HKWA 3CZTX 2ZNEA 1NCYA 3PJBA 5IBWA 3PJ5A 3IP2A 2GGZA 3AAJA 2H5QA 3M22A 4AQIA 3DQ1A 4C0KA 3CD1A 3DQ9A 1RM9A 4RYWA 5HKYA 1KCYA 2DDDA 4W6IA 1R2UA 1Y1XA 3E5VA 1AJ4A 2YFPA 1YRUB 4P2YB 1NIWA 4Q9WA 3UG0A 3HCMA 3BUMB 2COLB 2HF5A 5BPJA 2GGMA 4IK4A 5CPVA 4M2QA 2QLGB 3I5IB 3DQ2A 2KGBC 1ZOTB 2L4HA 1WLMA 2BCXA 3DQ4A 2GW3A 1DF0B 1LA3A 1TCFA 1Q4BA 1JBZA 2K8MB 1EMGA 1QTXA 3PLFB 3PIBA 4LJBA 4M2OA 1EG3A 1CDMA 2M3WA 4PALA 2NLNA 3BUWB 1V1FA 1SK6D 3K1KA 4HE4A 4W6BA 1YX7A 2MBXA 1M46A 2V4EA 3WLCA 1S36A 2BBNA 3PM8A 4P5OE 3DQIA 2JQ6A 3VRRA 4PFEA 4DXQA 1K94A 3W1CA 1A03A 2LVJA 5K89A 3BXBA 5AFPA 1CB1A 2I94A 5DPJA 1U5IA 2SCPA 3I5HB 4B30A 2GX0A 1S6CA 1J55A 4KA9A 5CSFA 1OMRA 2CXJA 5KTGA 2OTGB 5HGEA 3A4UB 3F45A 4HSZA 1JBYA 2BE6A 4WRIA 1C7WA 3I5HC 3FWBA 4UTSA 2NCOA 2WC8A 5LTPA 2ISDA 2M1UA 2OTGC 2WCBA 2JXCA 1FI5A 4HVFA 1A75B 1X02A 2WCEA 3NXAA 4IK3A 3SSLA 1H4BA 2WHSA 1S5GZ 2O29A 1IGVA 1UHKA 2JNFA 4PHMA 3NSLA 2KDHA 1TRFA 1TIZA 2K2AA 3ZTFA 3SVEA 1MOVA 4W6HA 2PXSA 3EVUA 3PATA 2KYFA 3DQ5A 2KYCA 2K7OA 2AWKA 5DKRA 4LJDA 1K9PA 1XFZO 2D8NA 3OHMB 2ZN8A 1FF1A 5HW9A 2E6WA 4LW5A 1SPYA 1GGWA 1MUXA 1TCOB 3IR8A 2WSNA 4DXIA 2G3DB 2O60A 2EMDA 2H9WA 1Y0VH 4HQCA 3O2PA 3LF3A 2LAPA 3EKJA 1KK7Y 4HREE 1QX2A 3VRPA 1B8CA 1AK8A 4JRBA 2DUEA 5DQBA 2HGYA 5J2OA 2H2KA 3DQOA 3SIAA 2G16B 2BCBA 1XVJA 1LA0A 3CFFA 2DUHA 4KGFA 5EJUA 1NX3A 4XOWA 4FQOA 1CNPA 4JEOA 4ICBA 4GFTA 4W76A 2KAXA 1B7TY 3K21A 1IKUA 5GQQC 1PSBA 3BUNB 2LVKA 4W72A 1SKTA 3C1VA 4W6PA 1NSHA 2BKIB 2DD7A 1PALA 1KQVA 3TDZA 4MVFA 5EXUA 1QIVA 2F8PA 4W75A 1ZFSA 2O24A 5EBJA 3OX5A 4W77A 3G9AA 2K2FA 3SJSA 3CS1A 2A52B 1Q73A 3OSQA 2CT9A 1YTZC 2YE1A 2DUFA 1WY9A 1B9AA 2JU0A 2H6VA 4Q7RA 2KQ6A 3SVDA 5LK4A 4DCKA 1JC0A 1BR4B 2QACA 2OKYA 2NZ0A 1RRXA 1QIWA 1KYPA 2JPTA 3O6BA 1G33A 1MXEA 2IS9A 1OMVA 1XO5A 2AWJA 1WLZA 1J7RA 5DPGA 2M29A 1CDNA 1JUOA 2F3ZA 2HPSA 4L9MA 2KSPA 4JQ0D 3EK8A 4HQ8A 4R1EA 4ZBLA 4W7RA 3CGLA 1K90D 1OZSA 2BBMA 4NDDA 3KPXA 3OX6A 3DQLA 1K93D 1G8IA 1DJHA 3BUXB 5AANA 1KFUL 1JF0A 3PALA 1YUTA 4W6RA 1OXEA 4RYSA 2KNEA 4OGSA 1W7UA 4KEXA 1H4UA 4A4BA 1EMLA 1FI6A 4W7CA 1CTRA 4PPLA 1EXRA 2LV7A 1OXFA 2M0RA 1QVIZ 2PMYA 5I2OA 2FCEA 1OE9B 5EXBA 4FTGA 3QRXA 3AKBA 1J7QA 1DJZA 2MJWB 3DQCA 2LCPA 3LK1A 2E30A 2L51A 1CMGA 4R6DA 4W6NA 2C9IA 1F54A 5JJGA 4XYNA 2QPTA 1XA5A 1IH0A 3KCTA 4QJ5B 4GGFC 4BY5A 2B3QA 1EMAA 2R2IA 4H3MA 1GGXA 2ZNDA 3VICA 4ZFSA 2LVIA 4ZF4A 1RK9A 3CR2A 4AOMA 1SRAA 1A75A 2Z1OA 2A56B 4PHNA 2K7DA 2LLUA 3A8RA 1S26D 3LS3A 3NSIA 2JWWA 5DQMA 4C0LA 4TNCA 4A4CA 1RFJA 2VVJA 1OXDA 3SG4A 3GK2A 3I5GB 5I2LA 5FVFA 4ZF3A 1B8LA 3ZWHA 2EC6B 1DJIA 5CSNA 4W6GA 4KW4A 3CR4X 3WLDA 1QJTA 3CFAA 4N1FA 1OOJA 2SASA 4YGDB 1KSMA 1C4FA 1IJ5A 1JFJA 3MSEB 2IOVA 4KW9A 1SW8A 2Q91A 4I5LB 2KFGA 5BQLA 2H8QA 1XK4C 2JXLA 2LUCA 1AJ5A 2EC6C 1ALVA 4OCIA 1IWQA 1IQ3A 2F2PA 3IQOA 2L5XB 3DQHA 4W7FA 1AP4A 3SSTA 4CPVA 1SCMB 1F55A 1RTP1 5I8NA 3DVEA 3P8UA 1B4CA 1DGVA 2F3YA 4WQ3A 2HFCA 2GV5A 1EMMA 4W6CA 3BUOB 2A48A 3ICBA 2A53B 3NSOA 4PPKA 4PHKA 1GGZA 5HBDA 3LL8B 4ZB1A 1UP5A 5FYXA 5EXCI 5KU1A 4DIRA 2OKWA 1YVHA 2CTNA 2I7AA 1B8RA 3GJ2A 1GJYA 2LUXA 3SSHA 3DQ3A 4NDBA 2IE2A 3ZULA 1C07A 1YJFA 1DJGA 1KFUS 1HUYA 1WRLA 2H5OA 3WNXB 1EMFA 3CTNA 2HQZA 2G5ZB 3TDUA 5AQBB 1IQ5A 3JVTB 2PVBA 4YGBB 1CFPA 1JSAA 1FW4A 2Y4QA 1DGUA 2WOSA 1NYAA 2G6YA 3I5IC 1L7ZA 3U8PA 2JT0A 2AWLA 3AKOA 1IJ6A 3SG3A 2MA2A 1SY9A 3U8CA 1Z1PA 1NPQA 4W7XA 4AS8A 4GUKA 1RMMA 4BDUA 1L2OB 5AEQA 3KF9A 5BTTB 3FS7A 3JVTC 3LSAA 1TNWA 4YGEB 1EMEA 3BXKA 4LQTA 3LLEA 4DRWA 2FJUB 1KP5A 2OTEA 2AH8A 2O5GA 1YVLA
chains in the Genus database with same CATH superfamily
2WCMA 4C0JA 2P6BB 3S0AA 4MEWA 1L2OC 2DD9A 2LLSA 3O4YA 1KQMB 4J89A 1QYQA 2KAVA 5HLVA 1CDPA 1W7TA 2WORA 3CLNA 1BMOA 4FQTA 4J88A 4HRHA 2L2EA 4PE7A 2B1UA 1QYFA 3DF0B 4W6MA 4PT1A 5LTRA 5I94A 2ARLA 3OB2B 1CM4A 2H5RA 2QRFA 4YI8A 1KQMC 1OQPA 3SVRA 3IF7A 4N5XA 2PRUA 1T14A 3AI4A 2WHUA 1XQMA 4QJ4B 4LQUA 4DKMA 3BYAA 3R1VA 4DXNA 4ZCUA 4DXPA 4I5JA 2LHIA 3BXCA 3V2LA 4M2PA 4L1IA 5HZTA 5B8IB 2KHNA 2VAEA 3CYZA 4GBAA 1RMPA 3R72A 4MRXA 3DQKA 4ORCB 3M0WA 4INXA 2L5YA 1Q4CA 1NUBA 2YDZA 1LXFC 1FBVA 4GGFA 3SRYA 2P70A 3ST0A 4INWA 4IK1A 1BJFA 2L50A 2WCLA 1MR8A 2NCPA 2JT3A 2LLTA 1CFFA 4GNKB 1XMZA 3LK0A 3P28A 2WHTA 1EL4A 4I5NB 3OGNA 1ZACA 2K7CA 2Z6ZA 2P4MA 2PYQA 4NDCA 1N0YA 4L13A 1K9UA 2M7LA 1OZOA 2OPOA 2LVVA 1EJ3A 2KI4B 3FWCA 2A46A 3PJIA 2K60A 3TZ1A 3RWTA 5DY6A 1DC1A 4UPGA 3GEXA 1XSSA 3D0YA 4E68A 5ER4X 2LC5A 3Q8IA 1KK8B 2F2OA 1K2HA 2KI4C 4W6SA 3SSYA 5F6TA 2MLEC 3LVCA 3H4SE 1XK4A 2K7BA 4MRYA 3DQAA 4DKNA 2PASA 1J7PA 2VVHA 5J3XA 3SVOA 3BX9A 4TZAA 2A4JA 4I2YA 2H5PA 1JBAA 1B9CA 4KPIA 3RM1A 3CWGA 1UUSA 3DZTA 4Q7UA 4ZF5A 1KK8C 4GF6B 3DVJA 5F9GA 3GB3A 1F8HA 2HPWA 4R6BA 3IQQA 4Q7TA 5H87A 1QV1A 2HRSA 3V3DA 3DPZA 4GPLB 2OS8B 1XFVO 2ICRA 2A47A 3SVNA 4KF5C 3CD9A 1YFPA 1PVBA 3LVAA 1Y1UA 4IK8A 2L0PA 1B47A 5EB7A 1D1OA 1QXTA 4XOVA 1XYDA 2G2SB 3E5WA 2DDCA 1PRWA 2OS8C 3DVKA 1RROA 4W7AA 1F4OA 4Z4KA 4W6OA 2Q4UA 1F4QA 3VROA 5FI7A 2BAPA 3DQ8A 2BE4A 5HKZA 2WCFA 1QX5B 2JT8A 3D76A 1SBJA 5AXIA 3ST2A 2H8VA 2M97A 2KI6D 2WURA 3GOFA 4GOBA 3KHEA 2LP2A 2NXQA 2QLGA 3VHTB 3OSRA 5D7FA 1K95A 3DQFA 1DF0A 4NWSA 1WRZA 2KOTA 1H8BA 4KW8A 4Q9XA 3KEVA 1CM1A 5JOLA 1N65A 3AAKA 1XFWO 3CDNA 3FIAA 2VADA 2ZN9A 1MYWA 4USLA 3E3RA 2WC6A 3E5TA 3NGVA 2YGUA 2G6XA 1JC1A 3SG2A 3SS0A 4KGEA 3BFHA 2EHBA 2PXWA 5BTTA 5DRFA 2FOTA 1BLQA 3RZSA 1YUUA 2Y1NA 4J8AA 2TN4A 1N2DA 3BOWB 2MHHA 5EB6A 2VVIA 2BTJA 5DPIA 4B5YA 4OY4A 3GK4X 4W6FA 1BOCA 3AI5A 2G6EA 2WNDA 3SSVA 4W6JA 5DICA 5AERA 4ORAB 2ZMUA 3CZ1A 5FHVA 1Z1QA 2RH7A 3NEDA 1G4YR 2WCHA 2ZRTA 5DTXA 3DQNA 3DF0A 1CFDA 4DXMA 4PCWA 1C3YA 1PULA 1KK7Z 2KFFA 4PE0A 4ORNA 1M63B 1GQMA 2WIQA 3NSKA 3SVCA 3PN7B 3CR5X 2B3PA 1DELA 1QLKA 1ALWA 2K0JA 2KFHA 1RMOA 5KSZA 3FE8A 2WCKA 1F0BA 1TNXA 1UISA 2Q6PA 4OR9B 2M49B 1B7TZ 3B88A 1CLMA 2KLDA 1QX7A 3CGAA 3SS5A 5PALA 3DPXA 2G3OA 1VRKA 4CIDA 4JF9A 4EDSA 4OJ0A 1J1EA 2H61C 2PALA 1S6ZA 4W6KA 5DKNA 4EDOA 2G9BA 1LINA 4KYNA 3U0LA 1CFCA 5DTZA 2HQKA 2LP3A 3I5GC 2I2RE 1S5GY 1QS7A 3VRNA 1F70A 1NWDA 1WDCB 1JWDA 1V1GA 1TNQA 3EVPA 2FWQA 3GK1A 3CB9A 4KF4A 1QY3A 3KO0A 1OSAA 1YX8A 3SG6A 2Y1MA 2F33A 3DD4A 3B86A 1ZUZA 1WDCC 2MRDA 1IG5A 4YRUA 3SSKA 4OVNF 2K61A 1OMDA 1MXLC 1ORGA 2KGRA 1W7IB 1SCMC 1K96A 5DTYA 1Q80A 3S0BA 4Q04A 3LA1A 5DPHA 4L12A 2C9JA 1NX1A 4XL5A 2LE9B 1TTXA 4GESB 3U0MA 3EK7A 5HZUA 4KF5A 1YHGA 4XVPA 3D74A 1DJXA 1A4PA 3GJ1A 4JGEA 3HX4A 2HGDA 2DUGA 3SSPA 4W6TA 2WISA 2QLEA 2LANA 4MZJA 1QASA 1ZUXA 4DUQA 2PSRA 3TS5B 4GGNA 5HZSA 2OGRA 1A29A 1QATA 1S6JA 3O4XA 3U8AA 3EVRA 4MZKA 4RTCA 2Z6XA 4XJKB 1NCZA 2V53A 3OGOA 1M45A 3ZUJA 1UWOA 1IIOA 2M8UA 4W7EA 4P1QA 5EHUA 3TS5C 1DT7B 2O2BA 1PSRA 3TMRA 4EULA 2JOJA 4CLNA 3ED8A 1XFXO 2JADA 4PPJA 5DKQA 1MQ1A 2QLIA 2JTZA 4ETOA 1C3ZA 4OV2A 1XFUO 1MHOA 5DU0A 1XAEA 2ZO6A 1DEKA 4YGAA 4KAGA 1F09A 1YHIA 3A8SA 3VHTA 1HT9A 4PE1A 2GX2A 4ZCVA 3TUYB 4CFRA 3R1PA 4DXOA 5HLOA 3DQDA 3PFVA 3JTDB 4IK9A 4NQGA 5CSIA 3D75A 1PVAA 2EMOA 3DQ6A 4EMQA 2HQWA 1AVSA 5FI2A 3TUYC 1RECA 1DVIA 4H48A 2BCAA 1Z4HA 1QXPA 1KWOB 3CFHA 4W73A 3DXLA 3M24A 1YRTB 1RJVA 3OB1B 4W7DA 1M31A 1KFXL 3JTDC 3RWAA 2HJOA 4XGYA 2OJKA 3VK1A 1BG1A 4H3NA 3BOWA 3SG7A 3DPWA 4W74A 3BFAA 2L4IA 5ER5A 3OP0A 2ZO7A 1SCVA 4IZNA 3LVDA 2RGIA 3NF0A 2LM5A 3QMEA 1OOGA 3PSRA 4PHJA 1KWOC 1GFLA 2IB6A 2KBMA 1PK0D 4H3LA 1NX2A 1YZWA 1QLSA 1SL7A 3AKAA 1ZGOA 2KBIA 2FL1A 1K9KA 4OQWA 1Y6WA 4JKTA 2AWMA 4IK5A 3SG5A 3NHIA 3DQEA 1B1GA 1QVIY 2EGDA 5LTQA 4MSPA 3TDIA 2CCMA 5H89A 3NEZA 4YI9A 2A50B 3ADFA 1YURA 4DS7A 3VRQA 5HYDA 2I18A 1SL9A 4I5KA 1WRKA 2H61A 1TNPA 1S3PA 1ODBA 2EMNA 4AR7A 1Q4DA 1CV7A 3CBEA 1CMFA 3NT3A 1HQVA 1K8UA 2CNPA 1XA9A 1BODA 2ZMWA 5FVGA 4H47A 1ZGQA 4ZINA 2LHLA 2AHAA 4D1EA 1BU3A 1SYMA 1BFPA 2LMVA 3LCPC 3H1RA 4WQ2A 2BL0B 2AAOA 3CABA 1UHIA 4MZLA 2HQ8A 1UHJA 3BFBA 4YBHB 1A2XA 2QEBA 1S6IA 5T3IA 1QYOA 4ANJA 1EG4A 2QU1A 1KYRA 2JZIA 3H1OA 3ST3A 3FE9A 2Y5IA 1IRJA 1SSEB 4Z4MA 3U0KA 2BL0C 4MBEA 2KI6C 1M39A 1NX0A 4W6DA 3WHUB 2WSOA 3I19A 4CFQA 4P76A 4OHSA 3SVSA 3ZUFA 1AUIB 2JNXA 2OTBA 2QZ0A 1Q4EA 1TN4A 1NP8A 2Y0GA 3TMTA 1SNLA 2L98A 2JC2A 1EMKA 2HETA 2V4EB 1CDLA 3VGOA 1YR5A 2DUIA 3D10A 2JULA 4F0ZB 1DMOA 1QV0A 1RWYA 3DQUA 1LKJA 1EMCA 4W6UA 3SIBA 3BXAA 1CLLA 3SVUA 4W6AA 1U5IB 2V4EC 4B30B 1Q4AA 2AUCA 1KFXS 1KYSA 1F71A 1XFRA 5FI6A 3L47A 3GL4A 2ERBA 1DTLA 1SL8A 3RLZA 3WCKA 4XJKA 1CKKA 1MF8B 4PDZA 4HRGA 4BY4A 2MAZA 3BQ3A 1EMBA 2QLHA 1SR6B 5BT0A 3EVVA 1CLBA 1TOPA 1R6PA 3EKHA 3O78A 5G08A 3WXAA 4IL1A 4QJ3B 2ZFDA 1C7VA 3LF4B 1ZMZA 5DTLA 1SR6C 1DJYA 4MN0A 2FCDA 1KSOA 3I5FB 4JFGA 2CBLA 1HCJA 1YHHA 1TWOA 1Y1AA 2G2BA 4U2VA 1OOIX 2POXA 2ZRSA 1J1DA 1JF2A 3R1OA 5EL2A 1BR1B 3SV5A 2LMTA 2JTTA 3S05A 3KCSA 1E8AA 3ZNIA 1JC2A 3I5FC 4MLWA 4JPZB 4OKHA 3NHTA 1NCXA 1UHHA 2L2CA 5TNCA 4HQ9A 2FZUA 3U0NA 1XFYO 5DRGA 1W7JB 3EK4A 4JWQA 1S1EA 2A54B 3D78A 3DQJA 3PJ7A 5D69A 1W7SA 2QDIA 4LJDC 2BKHB 4U8DA 1YUSA 1DJWA 1MWNA 4JC2A 1MOUA 3PN7C 4GAOA 2LNKA 3BJHA 1FPWA 2YE0A 1H6RA 3DVMA 1P28A 2QT2A 2IB5A 3D0YB 3WHTB 5HZOA 2KQYA 1EH2A 4PE4A 1G7KA 4LJCA 5FVIA 1AHRA 3SVBA 4YGCB 4AQJA 1BT6A 5KTYA 3ST4A 2VRGA 1JFKA 3W1DA 4ORBB 5I2QA 1J7OA 4TZGA 2VZXA 4N1GA 5CSJA 3UFZA 4W6LA 1GL4A 1UURA 2Q57A 4N3DA 2M1KB 2GW4B 2JRFA 2AMIA 3DQ7A 2LMUA 3MGFA 4EN1A 2KAYA 3NT9A 5H88A 4ZIOA 2HCGA 2M9GA 1LVCD 2BECA 2ZKMX 2Z6YA 1BF5A 3O77A 1SMGA 4W69A 1ZGPA 2M7NA 1UHNA 3DQMA 1YJ2A 2DOQA 2MLFC 4F7FA 3EG5B 5HKWA 3CZTX 2ZNEA 1NCYA 3PJBA 5IBWA 3PJ5A 3IP2A 1OW4A 2GGZA 2WCJA 3AAJA 2H5QA 3M22A 4AQIA 3DQ1A 4C0KA 3CD1A 3DQ9A 1RM9A 4RYWA 3B6XA 5HKYA 1KCYA 2DDDA 4W6IA 1R2UA 1Y1XA 3E5VA 1AJ4A 2YFPA 1YRUB 4P2YB 1NIWA 4Q9WA 3UG0A 3HCMA 3BUMB 2COLB 2HF5A 5BPJA 2GGMA 4IK4A 5CPVA 4M2QA 2QLGB 3I5IB 3DQ2A 2KGBC 1ZOTB 2L4HA 3DY9A 1WLMA 2BCXA 3K1EA 3DQ4A 2GW3A 1DF0B 4OZDA 3S0DA 1LA3A 1TCFA 1Q4BA 1JBZA 2K8MB 1EMGA 1QTXA 3PLFB 3PIBA 4LJBA 1W9ZA 4M2OA 1EG3A 1CDMA 2M3WA 4PALA 3D77A 2NLNA 3BUWB 1V1FA 1SK6D 2PQLA 3K1KA 4HE4A 4W6BA 1YX7A 2MBXA 1M46A 2V4EA 3WLCA 1S36A 2BBNA 3PM8A 4P5OE 3DQIA 2JQ6A 3VRRA 4PFEA 4DXQA 1K94A 3W1CA 3B87A 1A03A 2LVJA 5K89A 3BXBA 5AFPA 1CB1A 2I94A 2P71A 5DPJA 1U5IA 2SCPA 3I5HB 4B30A 2GX0A 1S6CA 1J55A 4KA9A 5CSFA 1OMRA 2CXJA 5KTGA 2OTGB 5HGEA 3A4UB 3F45A 4HSZA 1JBYA 2BE6A 4WRIA 1C7WA 3I5HC 3FWBA 4UTSA 2NCOA 2WC8A 2FJYA 5LTPA 2ISDA 2M1UA 2OTGC 2WCBA 2JXCA 1FI5A 1A75B 1X02A 3OBVA 2WCEA 4HVFA 3NXAA 4IK3A 3SSLA 1H4BA 2WHSA 1S5GZ 2O29A 1IGVA 1UHKA 2JNFA 4PHMA 3NSLA 2KDHA 1TRFA 1TIZA 2K2AA 3ZTFA 3SVEA 1MOVA 4W6HA 2PXSA 3EVUA 3PATA 2KYFA 3DQ5A 2KYCA 5D3OA 2K7OA 2AWKA 5DKRA 4LJDA 1DQEA 1K9PA 1XFZO 2D8NA 3OHMB 2ZN8A 1FF1A 5HW9A 2E6WA 4LW5A 1SPYA 1GGWA 1MUXA 1TCOB 3IR8A 2WSNA 4DXIA 2G3DB 2O60A 2EMDA 2H9WA 1Z2CB 1Y0VH 4HQCA 3O2PA 3LF3A 2LAPA 3EKJA 1KK7Y 4HREE 1QX2A 3VRPA 1B8CA 1AK8A 4JRBA 2DUEA 5DQBA 1OOFA 2HGYA 5J2OA 2H2KA 3DQOA 3SIAA 2G16B 1QWVA 2BCBA 1XVJA 1LA0A 3CFFA 2DUHA 4KGFA 5EJUA 1NX3A 4XOWA 4FQOA 1CNPA 4JEOA 4ICBA 4GFTA 4W76A 2KAXA 2JPOA 1B7TY 3K21A 1IKUA 5GQQC 1PSBA 3BUNB 2LVKA 4W72A 1SKTA 3C1VA 4W6PA 1NSHA 3D73A 2BKIB 2DD7A 1PALA 1KQVA 3TDZA 4MVFA 5EXUA 1QIVA 2F8PA 3FE6A 4W75A 2KLEA 1ZFSA 2O24A 5EBJA 3OX5A 4W77A 3G9AA 2K2FA 3SJSA 3CS1A 2A52B 1Q73A 3OSQA 2CT9A 1YTZC 2YE1A 2DUFA 1WY9A 1B9AA 2JU0A 2H6VA 4Q7RA 2KQ6A 3SVDA 5LK4A 4DCKA 1JC0A 1BR4B 2QACA 2OKYA 2NZ0A 1RRXA 1QIWA 1KYPA 2JPTA 3O6BA 1G33A 1MXEA 2IS9A 1OMVA 1XO5A 2AWJA 3L4AA 1WLZA 1J7RA 5DPGA 2M29A 1TUZA 5HL1A 1CDNA 1JUOA 2F3ZA 2HPSA 4L9MA 2KSPA 4JQ0D 3EK8A 4HQ8A 4R1EA 3SS4A 4ZBLA 4W7RA 3CGLA 1K90D 2QEVA 1OZSA 2BBMA 4NDDA 3KPXA 3OX6A 3DQLA 1K93D 3S0EA 1G8IA 1DJHA 3BUXB 5AANA 1KFUL 1JF0A 3PALA 1YUTA 4W6RA 2WC5A 1OXEA 4RYSA 2KNEA 4OGSA 1W7UA 3IVTA 4KEXA 1H4UA 4A4BA 1EMLA 2KPHA 3B7AA 1FI6A 4W7CA 3S0GA 1CTRA 4PPLA 1EXRA 2LV7A 1OXFA 2M0RA 1QVIZ 2PMYA 5I2OA 2FCEA 3VB1A 1OOHA 1OE9B 5EXBA 4FTGA 3QRXA 3S0FA 3AKBA 1J7QA 1DJZA 2MJWB 3DQCA 2LCPA 3LK1A 2E30A 2L51A 3CZ0A 1CMGA 4R6DA 4W6NA 2GTEA 2C9IA 3L4LA 1F54A 5JJGA 4XYNA 2QPTA 1XA5A 1IH0A 3KCTA 4QJ5B 4GGFC 4BY5A 2B3QA 1EMAA 2R2IA 4H3MA 1GGXA 2ZNDA 3VICA 4ZFSA 2LVIA 4ZF4A 3UO9A 1RK9A 3CR2A 4AOMA 1SRAA 1A75A 2Z1OA 2A56B 4PHNA 2K7DA 2LLUA 3A8RA 1S26D 1TUJA 3LS3A 3NSIA 2JWWA 5DQMA 4C0LA 4TNCA 4A4CA 1RFJA 2VVJA 1OXDA 3SG4A 3GK2A 3I5GB 5I2LA 5FVFA 1GM0A 4ZF3A 1B8LA 3ZWHA 2EC6B 1DJIA 5CSNA 4W6GA 4KW4A 3CR4X 3WLDA 1QJTA 3CFAA 2BNXA 4N1FA 1OOJA 2SASA 4YGDB 2QEHA 1KSMA 1C4FA 1IJ5A 1JFJA 3MSEB 2IOVA 4KW9A 1SW8A 2Q91A 4I5LB 2KFGA 5BQLA 2H8QA 1XK4C 2JXLA 2LUCA 1AJ5A 2EC6C 1ALVA 4OCIA 1IWQA 1IQ3A 2F2PA 3IQOA 2L5XB 3DQHA 4W7FA 1AP4A 3SSTA 4CPVA 3CZ2A 3SS3A 1SCMB 1F55A 1RTP1 5I8NA 3DVEA 3P8UA 1B4CA 4JD9A 1DGVA 2F3YA 4WQ3A 2HFCA 2GV5A 1EMMA 4W6CA 3BUOB 2A48A 3ICBA 3UNWA 2A53B 3PM2A 3NSOA 4PPKA 4PHKA 1GGZA 5HBDA 2QEOA 3LL8B 4ZB1A 1UP5A 5FYXA 5EXCI 5KU1A 4DIRA 1LS8A 1YVHA 2OKWA 2CTNA 2I7AA 1B8RA 3GJ2A 1GJYA 2LUXA 3SSHA 3DQ3A 4NDBA 3N7HA 2IE2A 3ZULA 1C07A 1YJFA 3DYEA 1DJGA 1KFUS 1HUYA 1WRLA 2H5OA 3WNXB 1EMFA 3CTNA 2HQZA 2G5ZB 3TDUA 5AQBB 1IQ5A 3JVTB 2PVBA 4YGBB 1CFPA 1JSAA 1FW4A 2Y4QA 4IJ7A 1DGUA 2WOSA 1NYAA 2G6YA 3I5IC 1L7ZA 3U8PA 2JT0A 2AWLA 3AKOA 1IJ6A 3SG3A 2MA2A 1SY9A 3U8CA 1Z1PA 1NPQA 4W7XA 4AS8A 4GUKA 1RMMA 4BDUA 1L2OB 5AEQA 3KF9A 5BTTB 3FS7A 3JVTC 3LSAA 1TNWA 4YGEB 1EMEA 3BXKA 4LQTA 3LLEA 4DRWA 2FJUB 1KP5A 2OTEA 2AH8A 2O5GA 1YVLA
chains in the Genus database with same CATH topology
4C0JA 2P6BB 4MEWA 1L2OC 2DD9A 2LLSA 3O4YA 1KQMB 4J89A 1QYQA 2KAVA 5HLVA 1CDPA 1W7TA 2WORA 3CLNA 1BMOA 4J88A 4HRHA 2L2EA 4PE7A 2B1UA 1QYFA 3DF0B 4W6MA 5LTRA 2ARLA 3OB2B 1CM4A 2H5RA 2QRFA 4YI8A 1KQMC 1OQPA 3SVRA 3IF7A 4N5XA 2PRUA 3AI4A 2WHUA 1XQMA 4QJ4B 4LQUA 4DKMA 3BYAA 4DXNA 4ZCUA 4DXPA 4I5JA 2LHIA 3BXCA 4M2PA 4L1IA 5HZTA 5B8IB 2KHNA 2VAEA 4GBAA 1RMPA 3DQKA 4MRXA 4ORCB 3M0WA 1Q4CA 1NUBA 2YDZA 1LXFC 1FBVA 4GGFA 3SRYA 3ST0A 4IK1A 1BJFA 2L50A 1MR8A 2NCPA 2JT3A 2LLTA 1CFFA 4GNKB 1XMZA 3LK0A 3P28A 2WHTA 1EL4A 4I5NB 1ZACA 2K7CA 2Z6ZA 2P4MA 4NDCA 1N0YA 4L13A 1K9UA 2M7LA 1OZOA 2OPOA 2LVVA 1EJ3A 2KI4B 3FWCA 2A46A 3TZ1A 3RWTA 5DY6A 4UPGA 3GEXA 1XSSA 3D0YA 4E68A 5ER4X 2LC5A 1KK8B 2F2OA 1K2HA 2KI4C 4W6SA 3SSYA 5F6TA 2MLEC 3LVCA 3H4SE 1XK4A 2K7BA 4MRYA 3DQAA 4DKNA 2PASA 1J7PA 2VVHA 5J3XA 3SVOA 3BX9A 4TZAA 2A4JA 4I2YA 2H5PA 1JBAA 1B9CA 4KPIA 3RM1A 3CWGA 1UUSA 4Q7UA 4ZF5A 1KK8C 4GF6B 3DVJA 5F9GA 3GB3A 1F8HA 2HPWA 4R6BA 3IQQA 4Q7TA 5H87A 1QV1A 2HRSA 3V3DA 3DPZA 4GPLB 2OS8B 1XFVO 2ICRA 2A47A 3SVNA 4KF5C 3CD9A 1YFPA 1PVBA 3LVAA 1Y1UA 4IK8A 2L0PA 1B47A 5EB7A 1D1OA 1QXTA 4XOVA 1XYDA 2G2SB 3E5WA 2DDCA 1PRWA 2OS8C 3DVKA 1RROA 4W7AA 1F4OA 4Z4KA 4W6OA 2Q4UA 1F4QA 3VROA 3DQ8A 2BE4A 5HKZA 2WCFA 1QX5B 2JT8A 1SBJA 5AXIA 3ST2A 2M97A 2KI6D 2WURA 3GOFA 4GOBA 3KHEA 2LP2A 2NXQA 2QLGA 3VHTB 3OSRA 5D7FA 1K95A 3DQFA 1DF0A 4NWSA 1WRZA 2KOTA 1H8BA 4KW8A 4Q9XA 3KEVA 1CM1A 5JOLA 1N65A 3AAKA 1XFWO 3FIAA 2VADA 2ZN9A 1MYWA 4USLA 3E3RA 3E5TA 2G6XA 1JC1A 3SG2A 3SS0A 4KGEA 2EHBA 2PXWA 5BTTA 5DRFA 2FOTA 1BLQA 1YUUA 2Y1NA 4J8AA 2TN4A 1N2DA 3BOWB 2MHHA 5EB6A 2VVIA 2BTJA 5DPIA 4B5YA 4OY4A 3GK4X 4W6FA 1BOCA 3AI5A 2G6EA 2WNDA 3SSVA 4W6JA 5AERA 4ORAB 2ZMUA 5FHVA 1Z1QA 2RH7A 3NEDA 1G4YR 2ZRTA 5DTXA 3DQNA 3DF0A 1CFDA 4DXMA 4PCWA 1PULA 1KK7Z 2KFFA 4PE0A 4ORNA 1M63B 1GQMA 2WIQA 3NSKA 3SVCA 3PN7B 3CR5X 2B3PA 1QLKA 1ALWA 2K0JA 2KFHA 1RMOA 5KSZA 1F0BA 1TNXA 1UISA 2Q6PA 4OR9B 2M49B 1B7TZ 1CLMA 1QX7A 3CGAA 5PALA 3DPXA 2G3OA 1VRKA 4CIDA 4JF9A 4EDSA 4OJ0A 1J1EA 2H61C 2PALA 1S6ZA 4W6KA 5DKNA 4EDOA 2G9BA 1LINA 3U0LA 1CFCA 5DTZA 2HQKA 2LP3A 3I5GC 2I2RE 1S5GY 1QS7A 3VRNA 1F70A 1NWDA 1WDCB 1JWDA 1V1GA 1TNQA 3EVPA 2FWQA 3GK1A 3CB9A 4KF4A 1QY3A 3KO0A 1OSAA 1YX8A 3SG6A 2Y1MA 2F33A 3DD4A 1ZUZA 1WDCC 2MRDA 1IG5A 4YRUA 3SSKA 4OVNF 2K61A 1OMDA 1MXLC 2KGRA 1W7IB 1SCMC 1K96A 5DTYA 1Q80A 4Q04A 3LA1A 5DPHA 4L12A 2C9JA 1NX1A 4XL5A 2LE9B 1TTXA 4GESB 3U0MA 3EK7A 5HZUA 4KF5A 1YHGA 4XVPA 1DJXA 1A4PA 3GJ1A 4JGEA 3HX4A 2DUGA 2HGDA 3SSPA 4W6TA 2WISA 2QLEA 2LANA 4MZJA 1QASA 1ZUXA 4DUQA 2PSRA 3TS5B 4GGNA 5HZSA 2OGRA 1A29A 1QATA 1S6JA 3U8AA 3EVRA 4MZKA 4RTCA 4XJKB 2Z6XA 1NCZA 2V53A 3OGOA 1M45A 3ZUJA 1UWOA 2M8UA 4W7EA 4P1QA 5EHUA 3TS5C 1DT7B 2O2BA 1PSRA 3TMRA 4EULA 2JOJA 4CLNA 3ED8A 1XFXO 2JADA 4PPJA 5DKQA 1MQ1A 2QLIA 2JTZA 4ETOA 4OV2A 1XFUO 1MHOA 5DU0A 1XAEA 2ZO6A 4YGAA 4KAGA 1F09A 1YHIA 3A8SA 3VHTA 1HT9A 4PE1A 2GX2A 4ZCVA 3TUYB 4CFRA 4DXOA 5HLOA 3DQDA 3PFVA 3JTDB 4IK9A 4NQGA 5CSIA 1PVAA 2EMOA 3DQ6A 4EMQA 2HQWA 1AVSA 3TUYC 1RECA 1DVIA 4H48A 2BCAA 1QXPA 1KWOB 3CFHA 4W73A 3M24A 1YRTB 1RJVA 3OB1B 4W7DA 1M31A 1KFXL 3JTDC 3RWAA 2HJOA 4XGYA 2OJKA 3VK1A 1BG1A 4H3NA 3BOWA 3SG7A 3DPWA 4W74A 2L4IA 5ER5A 3OP0A 2ZO7A 1SCVA 4IZNA 3LVDA 2RGIA 3NF0A 2LM5A 3PSRA 4PHJA 1KWOC 1GFLA 2IB6A 2KBMA 1PK0D 4H3LA 1NX2A 1YZWA 1QLSA 1SL7A 3AKAA 1ZGOA 2KBIA 2FL1A 1K9KA 4OQWA 1Y6WA 2AWMA 4IK5A 3SG5A 3DQEA 1B1GA 1QVIY 2EGDA 5LTQA 4MSPA 3TDIA 2CCMA 5H89A 3NEZA 4YI9A 2A50B 3ADFA 1YURA 4DS7A 3VRQA 5HYDA 2I18A 1SL9A 4I5KA 1WRKA 2H61A 1TNPA 1S3PA 1ODBA 2EMNA 4AR7A 1Q4DA 1CV7A 3CBEA 1CMFA 3NT3A 1HQVA 1K8UA 2CNPA 1XA9A 1BODA 2ZMWA 5FVGA 4H47A 1ZGQA 4ZINA 2LHLA 2AHAA 4D1EA 1BU3A 1SYMA 1BFPA 2LMVA 3LCPC 4WQ2A 3H1RA 2BL0B 2AAOA 1UHIA 4MZLA 2HQ8A 1UHJA 4YBHB 1A2XA 1S6IA 5T3IA 1QYOA 4ANJA 1EG4A 2QU1A 1KYRA 2JZIA 3H1OA 3ST3A 2Y5IA 1IRJA 4Z4MA 3U0KA 2BL0C 4MBEA 2KI6C 1M39A 1NX0A 4W6DA 3WHUB 2WSOA 3I19A 4CFQA 4P76A 4OHSA 3SVSA 3ZUFA 1AUIB 2JNXA 2OTBA 2QZ0A 1Q4EA 1TN4A 1NP8A 2Y0GA 3TMTA 1SNLA 2L98A 2JC2A 1EMKA 2HETA 2V4EB 1CDLA 3VGOA 1YR5A 2DUIA 3D10A 2JULA 4F0ZB 1DMOA 1QV0A 1RWYA 3DQUA 1LKJA 1EMCA 4W6UA 3SIBA 3BXAA 1CLLA 3SVUA 4W6AA 1U5IB 2V4EC 4B30B 1Q4AA 2AUCA 1KFXS 1KYSA 1F71A 3GL4A 1DTLA 1SL8A 3RLZA 3WCKA 4XJKA 1CKKA 1MF8B 4PDZA 4HRGA 4BY4A 2MAZA 3BQ3A 1EMBA 2QLHA 1SR6B 5BT0A 3EVVA 1CLBA 1TOPA 1R6PA 3EKHA 3O78A 5G08A 3WXAA 4IL1A 4QJ3B 2ZFDA 1C7VA 3LF4B 1ZMZA 5DTLA 1SR6C 1DJYA 4MN0A 2FCDA 1KSOA 3I5FB 4JFGA 2CBLA 1HCJA 1YHHA 1Y1AA 2G2BA 4U2VA 2POXA 2ZRSA 1J1DA 1JF2A 1BR1B 3SV5A 2LMTA 2JTTA 3S05A 3KCSA 1E8AA 3ZNIA 1JC2A 3I5FC 4MLWA 4JPZB 4OKHA 1NCXA 1UHHA 5TNCA 4HQ9A 2FZUA 3U0NA 1XFYO 5DRGA 1W7JB 3EK4A 4JWQA 1S1EA 2A54B 3DQJA 3PJ7A 5D69A 1W7SA 4LJDC 2BKHB 4U8DA 1YUSA 1DJWA 1MWNA 4JC2A 1MOUA 3PN7C 4GAOA 2LNKA 1FPWA 2YE0A 1H6RA 3DVMA 2QT2A 2IB5A 3D0YB 3WHTB 5HZOA 2KQYA 1EH2A 4PE4A 1G7KA 4LJCA 5FVIA 1AHRA 3SVBA 4YGCB 4AQJA 1BT6A 5KTYA 3ST4A 2VRGA 1JFKA 3W1DA 4ORBB 5I2QA 1J7OA 4TZGA 2VZXA 4N1GA 5CSJA 3UFZA 4W6LA 1GL4A 1UURA 2Q57A 4N3DA 2M1KB 2GW4B 2JRFA 2AMIA 3DQ7A 2LMUA 3MGFA 4EN1A 2KAYA 3NT9A 5H88A 4ZIOA 2HCGA 2M9GA 1LVCD 2BECA 2ZKMX 2Z6YA 1BF5A 3O77A 1SMGA 4W69A 1ZGPA 2M7NA 1UHNA 3DQMA 1YJ2A 2DOQA 2MLFC 5HKWA 3CZTX 2ZNEA 1NCYA 3PJBA 5IBWA 3PJ5A 3IP2A 2GGZA 3AAJA 2H5QA 3M22A 4AQIA 3DQ1A 4C0KA 3CD1A 3DQ9A 1RM9A 4RYWA 5HKYA 1KCYA 2DDDA 4W6IA 1R2UA 1Y1XA 3E5VA 1AJ4A 2YFPA 1YRUB 4P2YB 1NIWA 4Q9WA 3UG0A 3HCMA 3BUMB 2COLB 2HF5A 5BPJA 2GGMA 4IK4A 5CPVA 4M2QA 2QLGB 3I5IB 3DQ2A 2KGBC 1ZOTB 2L4HA 1WLMA 2BCXA 3DQ4A 2GW3A 1DF0B 1LA3A 1TCFA 1Q4BA 1JBZA 2K8MB 1EMGA 1QTXA 3PLFB 3PIBA 4LJBA 4M2OA 1EG3A 1CDMA 2M3WA 4PALA 2NLNA 3BUWB 1V1FA 1SK6D 3K1KA 4HE4A 4W6BA 1YX7A 2MBXA 1M46A 2V4EA 3WLCA 1S36A 2BBNA 3PM8A 4P5OE 3DQIA 2JQ6A 3VRRA 4PFEA 4DXQA 1K94A 3W1CA 1A03A 2LVJA 5K89A 3BXBA 5AFPA 1CB1A 2I94A 5DPJA 1U5IA 2SCPA 3I5HB 4B30A 2GX0A 1S6CA 1J55A 4KA9A 5CSFA 1OMRA 2CXJA 5KTGA 2OTGB 5HGEA 3A4UB 3F45A 4HSZA 1JBYA 2BE6A 4WRIA 1C7WA 3I5HC 3FWBA 4UTSA 2NCOA 2WC8A 5LTPA 2ISDA 2M1UA 2OTGC 2WCBA 2JXCA 1FI5A 4HVFA 1A75B 1X02A 2WCEA 3NXAA 4IK3A 3SSLA 1H4BA 2WHSA 1S5GZ 2O29A 1IGVA 1UHKA 2JNFA 4PHMA 3NSLA 2KDHA 1TRFA 1TIZA 2K2AA 3ZTFA 3SVEA 1MOVA 4W6HA 2PXSA 3EVUA 3PATA 2KYFA 3DQ5A 2KYCA 2K7OA 2AWKA 5DKRA 4LJDA 1K9PA 1XFZO 2D8NA 3OHMB 2ZN8A 1FF1A 5HW9A 2E6WA 4LW5A 1SPYA 1GGWA 1MUXA 1TCOB 3IR8A 2WSNA 4DXIA 2G3DB 2O60A 2EMDA 2H9WA 1Y0VH 4HQCA 3O2PA 3LF3A 2LAPA 3EKJA 1KK7Y 4HREE 1QX2A 3VRPA 1B8CA 1AK8A 4JRBA 2DUEA 5DQBA 2HGYA 5J2OA 2H2KA 3DQOA 3SIAA 2G16B 2BCBA 1XVJA 1LA0A 3CFFA 2DUHA 4KGFA 5EJUA 1NX3A 4XOWA 4FQOA 1CNPA 4JEOA 4ICBA 4GFTA 4W76A 2KAXA 1B7TY 3K21A 1IKUA 5GQQC 1PSBA 3BUNB 2LVKA 4W72A 1SKTA 3C1VA 4W6PA 1NSHA 2BKIB 2DD7A 1PALA 1KQVA 3TDZA 4MVFA 5EXUA 1QIVA 2F8PA 4W75A 1ZFSA 2O24A 5EBJA 3OX5A 4W77A 3G9AA 2K2FA 3SJSA 3CS1A 2A52B 1Q73A 3OSQA 2CT9A 1YTZC 2YE1A 2DUFA 1WY9A 1B9AA 2JU0A 2H6VA 4Q7RA 2KQ6A 3SVDA 5LK4A 4DCKA 1JC0A 1BR4B 2QACA 2OKYA 2NZ0A 1RRXA 1QIWA 1KYPA 2JPTA 3O6BA 1G33A 1MXEA 2IS9A 1OMVA 1XO5A 2AWJA 1WLZA 1J7RA 5DPGA 2M29A 1CDNA 1JUOA 2F3ZA 2HPSA 4L9MA 2KSPA 4JQ0D 3EK8A 4HQ8A 4R1EA 4ZBLA 4W7RA 3CGLA 1K90D 1OZSA 2BBMA 4NDDA 3KPXA 3OX6A 3DQLA 1K93D 1G8IA 1DJHA 3BUXB 5AANA 1KFUL 1JF0A 3PALA 1YUTA 4W6RA 1OXEA 4RYSA 2KNEA 4OGSA 1W7UA 4KEXA 1H4UA 4A4BA 1EMLA 1FI6A 4W7CA 1CTRA 4PPLA 1EXRA 2LV7A 1OXFA 2M0RA 1QVIZ 2PMYA 5I2OA 2FCEA 1OE9B 5EXBA 4FTGA 3QRXA 3AKBA 1J7QA 1DJZA 2MJWB 3DQCA 2LCPA 3LK1A 2E30A 2L51A 1CMGA 4R6DA 4W6NA 2C9IA 1F54A 5JJGA 4XYNA 2QPTA 1XA5A 1IH0A 3KCTA 4QJ5B 4GGFC 4BY5A 2B3QA 1EMAA 2R2IA 4H3MA 1GGXA 2ZNDA 3VICA 4ZFSA 2LVIA 4ZF4A 1RK9A 3CR2A 4AOMA 1SRAA 1A75A 2Z1OA 2A56B 4PHNA 2K7DA 2LLUA 3A8RA 1S26D 3LS3A 3NSIA 2JWWA 5DQMA 4C0LA 4TNCA 4A4CA 1RFJA 2VVJA 1OXDA 3SG4A 3GK2A 3I5GB 5I2LA 5FVFA 4ZF3A 1B8LA 3ZWHA 2EC6B 1DJIA 5CSNA 4W6GA 4KW4A 3CR4X 3WLDA 1QJTA 3CFAA 4N1FA 1OOJA 2SASA 4YGDB 1KSMA 1C4FA 1IJ5A 1JFJA 3MSEB 2IOVA 4KW9A 1SW8A 2Q91A 4I5LB 2KFGA 5BQLA 2H8QA 1XK4C 2JXLA 2LUCA 1AJ5A 2EC6C 1ALVA 4OCIA 1IWQA 1IQ3A 2F2PA 3IQOA 2L5XB 3DQHA 4W7FA 1AP4A 3SSTA 4CPVA 1SCMB 1F55A 1RTP1 5I8NA 3DVEA 3P8UA 1B4CA 1DGVA 2F3YA 4WQ3A 2HFCA 2GV5A 1EMMA 4W6CA 3BUOB 2A48A 3ICBA 2A53B 3NSOA 4PPKA 4PHKA 1GGZA 5HBDA 3LL8B 4ZB1A 1UP5A 5FYXA 5EXCI 5KU1A 4DIRA 2OKWA 1YVHA 2CTNA 2I7AA 1B8RA 3GJ2A 1GJYA 2LUXA 3SSHA 3DQ3A 4NDBA 2IE2A 3ZULA 1C07A 1YJFA 1DJGA 1KFUS 1HUYA 1WRLA 2H5OA 3WNXB 1EMFA 3CTNA 2HQZA 2G5ZB 3TDUA 5AQBB 1IQ5A 3JVTB 2PVBA 4YGBB 1CFPA 1JSAA 1FW4A 2Y4QA 1DGUA 2WOSA 1NYAA 2G6YA 3I5IC 1L7ZA 3U8PA 2JT0A 2AWLA 3AKOA 1IJ6A 3SG3A 2MA2A 1SY9A 3U8CA 1Z1PA 1NPQA 4W7XA 4AS8A 4GUKA 1RMMA 4BDUA 1L2OB 5AEQA 3KF9A 5BTTB 3FS7A 3JVTC 3LSAA 1TNWA 4YGEB 1EMEA 3BXKA 4LQTA 3LLEA 4DRWA 2FJUB 1KP5A 2OTEA 2AH8A 2O5GA 1YVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0J A;  2P6B B;  4MEW A;  1L2O C;  2DD9 A;  2LLS A;  3O4Y A;  1KQM B;  4J89 A;  1QYQ A;  2KAV A;  5HLV A;  1CDP A;  1W7T A;  2WOR A;  3CLN A;  1BMO A;  4J88 A;  4HRH A;  2L2E A;  4PE7 A;  2B1U A;  1QYF A;  3DF0 B;  4W6M A;  5LTR A;  2ARL A;  3OB2 B;  1CM4 A;  2H5R A;  2QRF A;  4YI8 A;  1KQM C;  1OQP A;  3SVR A;  3IF7 A;  4N5X A;  2PRU A;  3AI4 A;  2WHU A;  1XQM A;  4QJ4 B;  4LQU A;  4DKM A;  3BYA A;  4DXN A;  4ZCU A;  4DXP A;  4I5J A;  2LHI A;  3BXC A;  4M2P A;  4L1I A;  5HZT A;  5B8I B;  2KHN A;  2VAE A;  4GBA A;  1RMP A;  3DQK A;  4MRX A;  4ORC B;  3M0W A;  1Q4C A;  1NUB A;  2YDZ A;  1LXF C;  1FBV A;  4GGF A;  3SRY A;  3ST0 A;  4IK1 A;  1BJF A;  2L50 A;  1MR8 A;  2NCP A;  2JT3 A;  2LLT A;  1CFF A;  4GNK B;  1XMZ A;  3LK0 A;  3P28 A;  2WHT A;  1EL4 A;  4I5N B;  1ZAC A;  2K7C A;  2Z6Z A;  2P4M A;  4NDC A;  1N0Y A;  4L13 A;  1K9U A;  2M7L A;  1OZO A;  2OPO A;  2LVV A;  1EJ3 A;  2KI4 B;  3FWC A;  2A46 A;  3TZ1 A;  3RWT A;  5DY6 A;  4UPG A;  3GEX A;  1XSS A;  3D0Y A;  4E68 A;  5ER4 X;  2LC5 A;  1KK8 B;  2F2O A;  1K2H A;  2KI4 C;  4W6S A;  3SSY A;  5F6T A;  2MLE C;  3LVC A;  3H4S E;  1XK4 A;  2K7B A;  4MRY A;  3DQA A;  4DKN A;  2PAS A;  1J7P A;  2VVH A;  5J3X A;  3SVO A;  3BX9 A;  4TZA A;  2A4J A;  4I2Y A;  2H5P A;  1JBA A;  1B9C A;  4KPI A;  3RM1 A;  3CWG A;  1UUS A;  4Q7U A;  4ZF5 A;  1KK8 C;  4GF6 B;  3DVJ A;  5F9G A;  3GB3 A;  1F8H A;  2HPW A;  4R6B A;  3IQQ A;  4Q7T A;  5H87 A;  1QV1 A;  2HRS A;  3V3D A;  3DPZ A;  4GPL B;  2OS8 B;  1XFV O;  2ICR A;  2A47 A;  3SVN A;  4KF5 C;  3CD9 A;  1YFP A;  1PVB A;  3LVA A;  1Y1U A;  4IK8 A;  2L0P A;  1B47 A;  5EB7 A;  1D1O A;  1QXT A;  4XOV A;  1XYD A;  2G2S B;  3E5W A;  2DDC A;  1PRW A;  2OS8 C;  3DVK A;  1RRO A;  4W7A A;  1F4O A;  4Z4K A;  4W6O A;  2Q4U A;  1F4Q A;  3VRO A;  3DQ8 A;  2BE4 A;  5HKZ A;  2WCF A;  1QX5 B;  2JT8 A;  1SBJ A;  5AXI A;  3ST2 A;  2M97 A;  2KI6 D;  2WUR A;  3GOF A;  4GOB A;  3KHE A;  2LP2 A;  2NXQ A;  2QLG A;  3VHT B;  3OSR A;  5D7F A;  1K95 A;  3DQF A;  1DF0 A;  4NWS A;  1WRZ A;  2KOT A;  1H8B A;  4KW8 A;  4Q9X A;  3KEV A;  1CM1 A;  5JOL A;  1N65 A;  3AAK A;  1XFW O;  3FIA A;  2VAD A;  2ZN9 A;  1MYW A;  4USL A;  3E3R A;  3E5T A;  2G6X A;  1JC1 A;  3SG2 A;  3SS0 A;  4KGE A;  2EHB A;  2PXW A;  5BTT A;  5DRF A;  2FOT A;  1BLQ A;  1YUU A;  2Y1N A;  4J8A A;  2TN4 A;  1N2D A;  3BOW B;  2MHH A;  5EB6 A;  2VVI A;  2BTJ A;  5DPI A;  4B5Y A;  4OY4 A;  3GK4 X;  4W6F A;  1BOC A;  3AI5 A;  2G6E A;  2WND A;  3SSV A;  4W6J A;  5AER A;  4ORA B;  2ZMU A;  5FHV A;  1Z1Q A;  2RH7 A;  3NED A;  1G4Y R;  2ZRT A;  5DTX A;  3DQN A;  3DF0 A;  1CFD A;  4DXM A;  4PCW A;  1PUL A;  1KK7 Z;  2KFF A;  4PE0 A;  4ORN A;  1M63 B;  1GQM A;  2WIQ A;  3NSK A;  3SVC A;  3PN7 B;  3CR5 X;  2B3P A;  1QLK A;  1ALW A;  2K0J A;  2KFH A;  1RMO A;  5KSZ A;  1F0B A;  1TNX A;  1UIS A;  2Q6P A;  4OR9 B;  2M49 B;  1B7T Z;  1CLM A;  1QX7 A;  3CGA A;  5PAL A;  3DPX A;  2G3O A;  1VRK A;  4CID A;  4JF9 A;  4EDS A;  4OJ0 A;  1J1E A;  2H61 C;  2PAL A;  1S6Z A;  4W6K A;  5DKN A;  4EDO A;  2G9B A;  1LIN A;  3U0L A;  1CFC A;  5DTZ A;  2HQK A;  2LP3 A;  3I5G C;  2I2R E;  1S5G Y;  1QS7 A;  3VRN A;  1F70 A;  1NWD A;  1WDC B;  1JWD A;  1V1G A;  1TNQ A;  3EVP A;  2FWQ A;  3GK1 A;  3CB9 A;  4KF4 A;  1QY3 A;  3KO0 A;  1OSA A;  1YX8 A;  3SG6 A;  2Y1M A;  2F33 A;  3DD4 A;  1ZUZ A;  1WDC C;  2MRD A;  1IG5 A;  4YRU A;  3SSK A;  4OVN F;  2K61 A;  1OMD A;  1MXL C;  2KGR A;  1W7I B;  1SCM C;  1K96 A;  5DTY A;  1Q80 A;  4Q04 A;  3LA1 A;  5DPH A;  4L12 A;  2C9J A;  1NX1 A;  4XL5 A;  2LE9 B;  1TTX A;  4GES B;  3U0M A;  3EK7 A;  5HZU A;  4KF5 A;  1YHG A;  4XVP A;  1DJX A;  1A4P A;  3GJ1 A;  4JGE A;  3HX4 A;  2DUG A;  2HGD A;  3SSP A;  4W6T A;  2WIS A;  2QLE A;  2LAN A;  4MZJ A;  1QAS A;  1ZUX A;  4DUQ A;  2PSR A;  3TS5 B;  4GGN A;  5HZS A;  2OGR A;  1A29 A;  1QAT A;  1S6J A;  3U8A A;  3EVR A;  4MZK A;  4RTC A;  4XJK B;  2Z6X A;  1NCZ A;  2V53 A;  3OGO A;  1M45 A;  3ZUJ A;  1UWO A;  2M8U A;  4W7E A;  4P1Q A;  5EHU A;  3TS5 C;  1DT7 B;  2O2B A;  1PSR A;  3TMR A;  4EUL A;  2JOJ A;  4CLN A;  3ED8 A;  1XFX O;  2JAD A;  4PPJ A;  5DKQ A;  1MQ1 A;  2QLI A;  2JTZ A;  4ETO A;  4OV2 A;  1XFU O;  1MHO A;  5DU0 A;  1XAE A;  2ZO6 A;  4YGA A;  4KAG A;  1F09 A;  1YHI A;  3A8S A;  3VHT A;  1HT9 A;  4PE1 A;  2GX2 A;  4ZCV A;  3TUY B;  4CFR A;  4DXO A;  5HLO A;  3DQD A;  3PFV A;  3JTD B;  4IK9 A;  4NQG A;  5CSI A;  1PVA A;  2EMO A;  3DQ6 A;  4EMQ A;  2HQW A;  1AVS A;  3TUY C;  1REC A;  1DVI A;  4H48 A;  2BCA A;  1QXP A;  1KWO B;  3CFH A;  4W73 A;  3M24 A;  1YRT B;  1RJV A;  3OB1 B;  4W7D A;  1M31 A;  1KFX L;  3JTD C;  3RWA A;  2HJO A;  4XGY A;  2OJK A;  3VK1 A;  1BG1 A;  4H3N A;  3BOW A;  3SG7 A;  3DPW A;  4W74 A;  2L4I A;  5ER5 A;  3OP0 A;  2ZO7 A;  1SCV A;  4IZN A;  3LVD A;  2RGI A;  3NF0 A;  2LM5 A;  3PSR A;  4PHJ A;  1KWO C;  1GFL A;  2IB6 A;  2KBM A;  1PK0 D;  4H3L A;  1NX2 A;  1YZW A;  1QLS A;  1SL7 A;  3AKA A;  1ZGO A;  2KBI A;  2FL1 A;  1K9K A;  4OQW A;  1Y6W A;  2AWM A;  4IK5 A;  3SG5 A;  3DQE A;  1B1G A;  1QVI Y;  2EGD A;  5LTQ A;  4MSP A;  3TDI A;  2CCM A;  5H89 A;  3NEZ A;  4YI9 A;  2A50 B;  3ADF A;  1YUR A;  4DS7 A;  3VRQ A;  5HYD A;  2I18 A;  1SL9 A;  4I5K A;  1WRK A;  2H61 A;  1TNP A;  1S3P A;  1ODB A;  2EMN A;  4AR7 A;  1Q4D A;  1CV7 A;  3CBE A;  1CMF A;  3NT3 A;  1HQV A;  1K8U A;  2CNP A;  1XA9 A;  1BOD A;  2ZMW A;  5FVG A;  4H47 A;  1ZGQ A;  4ZIN A;  2LHL A;  2AHA A;  4D1E A;  1BU3 A;  1SYM A;  1BFP A;  2LMV A;  3LCP C;  4WQ2 A;  3H1R A;  2BL0 B;  2AAO A;  1UHI A;  4MZL A;  2HQ8 A;  1UHJ A;  4YBH B;  1A2X A;  1S6I A;  5T3I A;  1QYO A;  4ANJ A;  1EG4 A;  2QU1 A;  1KYR A;  2JZI A;  3H1O A;  3ST3 A;  2Y5I A;  1IRJ A;  4Z4M A;  3U0K A;  2BL0 C;  4MBE A;  2KI6 C;  1M39 A;  1NX0 A;  4W6D A;  3WHU B;  2WSO A;  3I19 A;  4CFQ A;  4P76 A;  4OHS A;  3SVS A;  3ZUF A;  1AUI B;  2JNX A;  2OTB A;  2QZ0 A;  1Q4E A;  1TN4 A;  1NP8 A;  2Y0G A;  3TMT A;  1SNL A;  2L98 A;  2JC2 A;  1EMK A;  2HET A;  2V4E B;  1CDL A;  3VGO A;  1YR5 A;  2DUI A;  3D10 A;  2JUL A;  4F0Z B;  1DMO A;  1QV0 A;  1RWY A;  3DQU A;  1LKJ A;  1EMC A;  4W6U A;  3SIB A;  3BXA A;  1CLL A;  3SVU A;  4W6A A;  1U5I B;  2V4E C;  4B30 B;  1Q4A A;  2AUC A;  1KFX S;  1KYS A;  1F71 A;  3GL4 A;  1DTL A;  1SL8 A;  3RLZ A;  3WCK A;  4XJK A;  1CKK A;  1MF8 B;  4PDZ A;  4HRG A;  4BY4 A;  2MAZ A;  3BQ3 A;  1EMB A;  2QLH A;  1SR6 B;  5BT0 A;  3EVV A;  1CLB A;  1TOP A;  1R6P A;  3EKH A;  3O78 A;  5G08 A;  3WXA A;  4IL1 A;  4QJ3 B;  2ZFD A;  1C7V A;  3LF4 B;  1ZMZ A;  5DTL A;  1SR6 C;  1DJY A;  4MN0 A;  2FCD A;  1KSO A;  3I5F B;  4JFG A;  2CBL A;  1HCJ A;  1YHH A;  1Y1A A;  2G2B A;  4U2V A;  2POX A;  2ZRS A;  1J1D A;  1JF2 A;  1BR1 B;  3SV5 A;  2LMT A;  2JTT A;  3S05 A;  3KCS A;  1E8A A;  3ZNI A;  1JC2 A;  3I5F C;  4MLW A;  4JPZ B;  4OKH A;  1NCX A;  1UHH A;  5TNC A;  4HQ9 A;  2FZU A;  3U0N A;  1XFY O;  5DRG A;  1W7J B;  3EK4 A;  4JWQ A;  1S1E A;  2A54 B;  3DQJ A;  3PJ7 A;  5D69 A;  1W7S A;  4LJD C;  2BKH B;  4U8D A;  1YUS A;  1DJW A;  1MWN A;  4JC2 A;  1MOU A;  3PN7 C;  4GAO A;  2LNK A;  1FPW A;  2YE0 A;  1H6R A;  3DVM A;  2QT2 A;  2IB5 A;  3D0Y B;  3WHT B;  5HZO A;  2KQY A;  1EH2 A;  4PE4 A;  1G7K A;  4LJC A;  5FVI A;  1AHR A;  3SVB A;  4YGC B;  4AQJ A;  1BT6 A;  5KTY A;  3ST4 A;  2VRG A;  1JFK A;  3W1D A;  4ORB B;  5I2Q A;  1J7O A;  4TZG A;  2VZX A;  4N1G A;  5CSJ A;  3UFZ A;  4W6L A;  1GL4 A;  1UUR A;  2Q57 A;  4N3D A;  2M1K B;  2GW4 B;  2JRF A;  2AMI A;  3DQ7 A;  2LMU A;  3MGF A;  4EN1 A;  2KAY A;  3NT9 A;  5H88 A;  4ZIO A;  2HCG A;  2M9G A;  1LVC D;  2BEC A;  2ZKM X;  2Z6Y A;  1BF5 A;  3O77 A;  1SMG A;  4W69 A;  1ZGP A;  2M7N A;  1UHN A;  3DQM A;  1YJ2 A;  2DOQ A;  2MLF C;  5HKW A;  3CZT X;  2ZNE A;  1NCY A;  3PJB A;  5IBW A;  3PJ5 A;  3IP2 A;  2GGZ A;  3AAJ A;  2H5Q A;  3M22 A;  4AQI A;  3DQ1 A;  4C0K A;  3CD1 A;  3DQ9 A;  1RM9 A;  4RYW A;  5HKY A;  1KCY A;  2DDD A;  4W6I A;  1R2U A;  1Y1X A;  3E5V A;  1AJ4 A;  2YFP A;  1YRU B;  4P2Y B;  1NIW A;  4Q9W A;  3UG0 A;  3HCM A;  3BUM B;  2COL B;  2HF5 A;  5BPJ A;  2GGM A;  4IK4 A;  5CPV A;  4M2Q A;  2QLG B;  3I5I B;  3DQ2 A;  2KGB C;  1ZOT B;  2L4H A;  1WLM A;  2BCX A;  3DQ4 A;  2GW3 A;  1DF0 B;  1LA3 A;  1TCF A;  1Q4B A;  1JBZ A;  2K8M B;  1EMG A;  1QTX A;  3PLF B;  3PIB A;  4LJB A;  4M2O A;  1EG3 A;  1CDM A;  2M3W A;  4PAL A;  2NLN A;  3BUW B;  1V1F A;  1SK6 D;  3K1K A;  4HE4 A;  4W6B A;  1YX7 A;  2MBX A;  1M46 A;  2V4E A;  3WLC A;  1S36 A;  2BBN A;  3PM8 A;  4P5O E;  3DQI A;  2JQ6 A;  3VRR A;  4PFE A;  4DXQ A;  1K94 A;  3W1C A;  1A03 A;  2LVJ A;  5K89 A;  3BXB A;  5AFP A;  1CB1 A;  2I94 A;  5DPJ A;  1U5I A;  2SCP A;  3I5H B;  4B30 A;  2GX0 A;  1S6C A;  1J55 A;  4KA9 A;  5CSF A;  1OMR A;  2CXJ A;  5KTG A;  2OTG B;  5HGE A;  3A4U B;  3F45 A;  4HSZ A;  1JBY A;  2BE6 A;  4WRI A;  1C7W A;  3I5H C;  3FWB A;  4UTS A;  2NCO A;  2WC8 A;  5LTP A;  2ISD A;  2M1U A;  2OTG C;  2WCB A;  2JXC A;  1FI5 A;  4HVF A;  1A75 B;  1X02 A;  2WCE A;  3NXA A;  4IK3 A;  3SSL A;  1H4B A;  2WHS A;  1S5G Z;  2O29 A;  1IGV A;  1UHK A;  2JNF A;  4PHM A;  3NSL A;  2KDH A;  1TRF A;  1TIZ A;  2K2A A;  3ZTF A;  3SVE A;  1MOV A;  4W6H A;  2PXS A;  3EVU A;  3PAT A;  2KYF A;  3DQ5 A;  2KYC A;  2K7O A;  2AWK A;  5DKR A;  4LJD A;  1K9P A;  1XFZ O;  2D8N A;  3OHM B;  2ZN8 A;  1FF1 A;  5HW9 A;  2E6W A;  4LW5 A;  1SPY A;  1GGW A;  1MUX A;  1TCO B;  3IR8 A;  2WSN A;  4DXI A;  2G3D B;  2O60 A;  2EMD A;  2H9W A;  1Y0V H;  4HQC A;  3O2P A;  3LF3 A;  2LAP A;  3EKJ A;  1KK7 Y;  4HRE E;  1QX2 A;  3VRP A;  1B8C A;  1AK8 A;  4JRB A;  2DUE A;  5DQB A;  2HGY A;  5J2O A;  2H2K A;  3DQO A;  3SIA A;  2G16 B;  2BCB A;  1XVJ A;  1LA0 A;  3CFF A;  2DUH A;  4KGF A;  5EJU A;  1NX3 A;  4XOW A;  4FQO A;  1CNP A;  4JEO A;  4ICB A;  4GFT A;  4W76 A;  2KAX A;  1B7T Y;  3K21 A;  1IKU A;  5GQQ C;  1PSB A;  3BUN B;  2LVK A;  4W72 A;  1SKT A;  3C1V A;  4W6P A;  1NSH A;  2BKI B;  2DD7 A;  1PAL A;  1KQV A;  3TDZ A;  4MVF A;  5EXU A;  1QIV A;  2F8P A;  4W75 A;  1ZFS A;  2O24 A;  5EBJ A;  3OX5 A;  4W77 A;  3G9A A;  2K2F A;  3SJS A;  3CS1 A;  2A52 B;  1Q73 A;  3OSQ A;  2CT9 A;  1YTZ C;  2YE1 A;  2DUF A;  1WY9 A;  1B9A A;  2JU0 A;  2H6V A;  4Q7R A;  2KQ6 A;  3SVD A;  5LK4 A;  4DCK A;  1JC0 A;  1BR4 B;  2QAC A;  2OKY A;  2NZ0 A;  1RRX A;  1QIW A;  1KYP A;  2JPT A;  3O6B A;  1G33 A;  1MXE A;  2IS9 A;  1OMV A;  1XO5 A;  2AWJ A;  1WLZ A;  1J7R A;  5DPG A;  2M29 A;  1CDN A;  1JUO A;  2F3Z A;  2HPS A;  4L9M A;  2KSP A;  4JQ0 D;  3EK8 A;  4HQ8 A;  4R1E A;  4ZBL A;  4W7R A;  3CGL A;  1K90 D;  1OZS A;  2BBM A;  4NDD A;  3KPX A;  3OX6 A;  3DQL A;  1K93 D;  1G8I A;  1DJH A;  3BUX B;  5AAN A;  1KFU L;  1JF0 A;  3PAL A;  1YUT A;  4W6R A;  1OXE A;  4RYS A;  2KNE A;  4OGS A;  1W7U A;  4KEX A;  1H4U A;  4A4B A;  1EML A;  1FI6 A;  4W7C A;  1CTR A;  4PPL A;  1EXR A;  2LV7 A;  1OXF A;  2M0R A;  1QVI Z;  2PMY A;  5I2O A;  2FCE A;  1OE9 B;  5EXB A;  4FTG A;  3QRX A;  3AKB A;  1J7Q A;  1DJZ A;  2MJW B;  3DQC A;  2LCP A;  3LK1 A;  2E30 A;  2L51 A;  1CMG A;  4R6D A;  4W6N A;  2C9I A;  1F54 A;  5JJG A;  4XYN A;  2QPT A;  1XA5 A;  1IH0 A;  3KCT A;  4QJ5 B;  4GGF C;  4BY5 A;  2B3Q A;  1EMA A;  2R2I A;  4H3M A;  1GGX A;  2ZND A;  3VIC A;  4ZFS A;  2LVI A;  4ZF4 A;  1RK9 A;  3CR2 A;  4AOM A;  1SRA A;  1A75 A;  2Z1O A;  2A56 B;  4PHN A;  2K7D A;  2LLU A;  3A8R A;  1S26 D;  3LS3 A;  3NSI A;  2JWW A;  5DQM A;  4C0L A;  4TNC A;  4A4C A;  1RFJ A;  2VVJ A;  1OXD A;  3SG4 A;  3GK2 A;  3I5G B;  5I2L A;  5FVF A;  4ZF3 A;  1B8L A;  3ZWH A;  2EC6 B;  1DJI A;  5CSN A;  4W6G A;  4KW4 A;  3CR4 X;  3WLD A;  1QJT A;  3CFA A;  4N1F A;  1OOJ A;  2SAS A;  4YGD B;  1KSM A;  1C4F A;  1IJ5 A;  1JFJ A;  3MSE B;  2IOV A;  4KW9 A;  1SW8 A;  2Q91 A;  4I5L B;  2KFG A;  5BQL A;  2H8Q A;  1XK4 C;  2JXL A;  2LUC A;  1AJ5 A;  2EC6 C;  1ALV A;  4OCI A;  1IWQ A;  1IQ3 A;  2F2P A;  3IQO A;  2L5X B;  3DQH A;  4W7F A;  1AP4 A;  3SST A;  4CPV A;  1SCM B;  1F55 A;  1RTP 1;  5I8N A;  3DVE A;  3P8U A;  1B4C A;  1DGV A;  2F3Y A;  4WQ3 A;  2HFC A;  2GV5 A;  1EMM A;  4W6C A;  3BUO B;  2A48 A;  3ICB A;  2A53 B;  3NSO A;  4PPK A;  4PHK A;  1GGZ A;  5HBD A;  3LL8 B;  4ZB1 A;  1UP5 A;  5FYX A;  5EXC I;  5KU1 A;  4DIR A;  2OKW A;  1YVH A;  2CTN A;  2I7A A;  1B8R A;  3GJ2 A;  1GJY A;  2LUX A;  3SSH A;  3DQ3 A;  4NDB A;  2IE2 A;  3ZUL A;  1C07 A;  1YJF A;  1DJG A;  1KFU S;  1HUY A;  1WRL A;  2H5O A;  3WNX B;  1EMF A;  3CTN A;  2HQZ A;  2G5Z B;  3TDU A;  5AQB B;  1IQ5 A;  3JVT B;  2PVB A;  4YGB B;  1CFP A;  1JSA A;  1FW4 A;  2Y4Q A;  1DGU A;  2WOS A;  1NYA A;  2G6Y A;  3I5I C;  1L7Z A;  3U8P A;  2JT0 A;  2AWL A;  3AKO A;  1IJ6 A;  3SG3 A;  2MA2 A;  1SY9 A;  3U8C A;  1Z1P A;  1NPQ A;  4W7X A;  4AS8 A;  4GUK A;  1RMM A;  4BDU A;  1L2O B;  5AEQ A;  3KF9 A;  5BTT B;  3FS7 A;  3JVT C;  3LSA A;  1TNW A;  4YGE B;  1EME A;  3BXK A;  4LQT A;  3LLE A;  4DRW A;  2FJU B;  1KP5 A;  2OTE A;  2AH8 A;  2O5G A;  1YVL A; 
#chains in the Genus database with same CATH topology
 2WCM A;  4C0J A;  2P6B B;  3S0A A;  4MEW A;  1L2O C;  2DD9 A;  2LLS A;  3O4Y A;  1KQM B;  4J89 A;  1QYQ A;  2KAV A;  5HLV A;  1CDP A;  1W7T A;  2WOR A;  3CLN A;  1BMO A;  4FQT A;  4J88 A;  4HRH A;  2L2E A;  4PE7 A;  2B1U A;  1QYF A;  3DF0 B;  4W6M A;  4PT1 A;  5LTR A;  5I94 A;  2ARL A;  3OB2 B;  1CM4 A;  2H5R A;  2QRF A;  4YI8 A;  1KQM C;  1OQP A;  3SVR A;  3IF7 A;  4N5X A;  2PRU A;  1T14 A;  3AI4 A;  2WHU A;  1XQM A;  4QJ4 B;  4LQU A;  4DKM A;  3BYA A;  3R1V A;  4DXN A;  4ZCU A;  4DXP A;  4I5J A;  2LHI A;  3BXC A;  3V2L A;  4M2P A;  4L1I A;  5HZT A;  5B8I B;  2KHN A;  2VAE A;  3CYZ A;  4GBA A;  1RMP A;  3R72 A;  4MRX A;  3DQK A;  4ORC B;  3M0W A;  4INX A;  2L5Y A;  1Q4C A;  1NUB A;  2YDZ A;  1LXF C;  1FBV A;  4GGF A;  3SRY A;  2P70 A;  3ST0 A;  4INW A;  4IK1 A;  1BJF A;  2L50 A;  2WCL A;  1MR8 A;  2NCP A;  2JT3 A;  2LLT A;  1CFF A;  4GNK B;  1XMZ A;  3LK0 A;  3P28 A;  2WHT A;  1EL4 A;  4I5N B;  3OGN A;  1ZAC A;  2K7C A;  2Z6Z A;  2P4M A;  2PYQ A;  4NDC A;  1N0Y A;  4L13 A;  1K9U A;  2M7L A;  1OZO A;  2OPO A;  2LVV A;  1EJ3 A;  2KI4 B;  3FWC A;  2A46 A;  3PJI A;  2K60 A;  3TZ1 A;  3RWT A;  5DY6 A;  1DC1 A;  4UPG A;  3GEX A;  1XSS A;  3D0Y A;  4E68 A;  5ER4 X;  2LC5 A;  3Q8I A;  1KK8 B;  2F2O A;  1K2H A;  2KI4 C;  4W6S A;  3SSY A;  5F6T A;  2MLE C;  3LVC A;  3H4S E;  1XK4 A;  2K7B A;  4MRY A;  3DQA A;  4DKN A;  2PAS A;  1J7P A;  2VVH A;  5J3X A;  3SVO A;  3BX9 A;  4TZA A;  2A4J A;  4I2Y A;  2H5P A;  1JBA A;  1B9C A;  4KPI A;  3RM1 A;  3CWG A;  1UUS A;  3DZT A;  4Q7U A;  4ZF5 A;  1KK8 C;  4GF6 B;  3DVJ A;  5F9G A;  3GB3 A;  1F8H A;  2HPW A;  4R6B A;  3IQQ A;  4Q7T A;  5H87 A;  1QV1 A;  2HRS A;  3V3D A;  3DPZ A;  4GPL B;  2OS8 B;  1XFV O;  2ICR A;  2A47 A;  3SVN A;  4KF5 C;  3CD9 A;  1YFP A;  1PVB A;  3LVA A;  1Y1U A;  4IK8 A;  2L0P A;  1B47 A;  5EB7 A;  1D1O A;  1QXT A;  4XOV A;  1XYD A;  2G2S B;  3E5W A;  2DDC A;  1PRW A;  2OS8 C;  3DVK A;  1RRO A;  4W7A A;  1F4O A;  4Z4K A;  4W6O A;  2Q4U A;  1F4Q A;  3VRO A;  5FI7 A;  2BAP A;  3DQ8 A;  2BE4 A;  5HKZ A;  2WCF A;  1QX5 B;  2JT8 A;  3D76 A;  1SBJ A;  5AXI A;  3ST2 A;  2H8V A;  2M97 A;  2KI6 D;  2WUR A;  3GOF A;  4GOB A;  3KHE A;  2LP2 A;  2NXQ A;  2QLG A;  3VHT B;  3OSR A;  5D7F A;  1K95 A;  3DQF A;  1DF0 A;  4NWS A;  1WRZ A;  2KOT A;  1H8B A;  4KW8 A;  4Q9X A;  3KEV A;  1CM1 A;  5JOL A;  1N65 A;  3AAK A;  1XFW O;  3CDN A;  3FIA A;  2VAD A;  2ZN9 A;  1MYW A;  4USL A;  3E3R A;  2WC6 A;  3E5T A;  3NGV A;  2YGU A;  2G6X A;  1JC1 A;  3SG2 A;  3SS0 A;  4KGE A;  3BFH A;  2EHB A;  2PXW A;  5BTT A;  5DRF A;  2FOT A;  1BLQ A;  3RZS A;  1YUU A;  2Y1N A;  4J8A A;  2TN4 A;  1N2D A;  3BOW B;  2MHH A;  5EB6 A;  2VVI A;  2BTJ A;  5DPI A;  4B5Y A;  4OY4 A;  3GK4 X;  4W6F A;  1BOC A;  3AI5 A;  2G6E A;  2WND A;  3SSV A;  4W6J A;  5DIC A;  5AER A;  4ORA B;  2ZMU A;  3CZ1 A;  5FHV A;  1Z1Q A;  2RH7 A;  3NED A;  1G4Y R;  2WCH A;  2ZRT A;  5DTX A;  3DQN A;  3DF0 A;  1CFD A;  4DXM A;  4PCW A;  1C3Y A;  1PUL A;  1KK7 Z;  2KFF A;  4PE0 A;  4ORN A;  1M63 B;  1GQM A;  2WIQ A;  3NSK A;  3SVC A;  3PN7 B;  3CR5 X;  2B3P A;  1DEL A;  1QLK A;  1ALW A;  2K0J A;  2KFH A;  1RMO A;  5KSZ A;  3FE8 A;  2WCK A;  1F0B A;  1TNX A;  1UIS A;  2Q6P A;  4OR9 B;  2M49 B;  1B7T Z;  3B88 A;  1CLM A;  2KLD A;  1QX7 A;  3CGA A;  3SS5 A;  5PAL A;  3DPX A;  2G3O A;  1VRK A;  4CID A;  4JF9 A;  4EDS A;  4OJ0 A;  1J1E A;  2H61 C;  2PAL A;  1S6Z A;  4W6K A;  5DKN A;  4EDO A;  2G9B A;  1LIN A;  4KYN A;  3U0L A;  1CFC A;  5DTZ A;  2HQK A;  2LP3 A;  3I5G C;  2I2R E;  1S5G Y;  1QS7 A;  3VRN A;  1F70 A;  1NWD A;  1WDC B;  1JWD A;  1V1G A;  1TNQ A;  3EVP A;  2FWQ A;  3GK1 A;  3CB9 A;  4KF4 A;  1QY3 A;  3KO0 A;  1OSA A;  1YX8 A;  3SG6 A;  2Y1M A;  2F33 A;  3DD4 A;  3B86 A;  1ZUZ A;  1WDC C;  2MRD A;  1IG5 A;  4YRU A;  3SSK A;  4OVN F;  2K61 A;  1OMD A;  1MXL C;  1ORG A;  2KGR A;  1W7I B;  1SCM C;  1K96 A;  5DTY A;  1Q80 A;  3S0B A;  4Q04 A;  3LA1 A;  5DPH A;  4L12 A;  2C9J A;  1NX1 A;  4XL5 A;  2LE9 B;  1TTX A;  4GES B;  3U0M A;  3EK7 A;  5HZU A;  4KF5 A;  1YHG A;  4XVP A;  3D74 A;  1DJX A;  1A4P A;  3GJ1 A;  4JGE A;  3HX4 A;  2HGD A;  2DUG A;  3SSP A;  4W6T A;  2WIS A;  2QLE A;  2LAN A;  4MZJ A;  1QAS A;  1ZUX A;  4DUQ A;  2PSR A;  3TS5 B;  4GGN A;  5HZS A;  2OGR A;  1A29 A;  1QAT A;  1S6J A;  3O4X A;  3U8A A;  3EVR A;  4MZK A;  4RTC A;  2Z6X A;  4XJK B;  1NCZ A;  2V53 A;  3OGO A;  1M45 A;  3ZUJ A;  1UWO A;  1IIO A;  2M8U A;  4W7E A;  4P1Q A;  5EHU A;  3TS5 C;  1DT7 B;  2O2B A;  1PSR A;  3TMR A;  4EUL A;  2JOJ A;  4CLN A;  3ED8 A;  1XFX O;  2JAD A;  4PPJ A;  5DKQ A;  1MQ1 A;  2QLI A;  2JTZ A;  4ETO A;  1C3Z A;  4OV2 A;  1XFU O;  1MHO A;  5DU0 A;  1XAE A;  2ZO6 A;  1DEK A;  4YGA A;  4KAG A;  1F09 A;  1YHI A;  3A8S A;  3VHT A;  1HT9 A;  4PE1 A;  2GX2 A;  4ZCV A;  3TUY B;  4CFR A;  3R1P A;  4DXO A;  5HLO A;  3DQD A;  3PFV A;  3JTD B;  4IK9 A;  4NQG A;  5CSI A;  3D75 A;  1PVA A;  2EMO A;  3DQ6 A;  4EMQ A;  2HQW A;  1AVS A;  5FI2 A;  3TUY C;  1REC A;  1DVI A;  4H48 A;  2BCA A;  1Z4H A;  1QXP A;  1KWO B;  3CFH A;  4W73 A;  3DXL A;  3M24 A;  1YRT B;  1RJV A;  3OB1 B;  4W7D A;  1M31 A;  1KFX L;  3JTD C;  3RWA A;  2HJO A;  4XGY A;  2OJK A;  3VK1 A;  1BG1 A;  4H3N A;  3BOW A;  3SG7 A;  3DPW A;  4W74 A;  3BFA A;  2L4I A;  5ER5 A;  3OP0 A;  2ZO7 A;  1SCV A;  4IZN A;  3LVD A;  2RGI A;  3NF0 A;  2LM5 A;  3QME A;  1OOG A;  3PSR A;  4PHJ A;  1KWO C;  1GFL A;  2IB6 A;  2KBM A;  1PK0 D;  4H3L A;  1NX2 A;  1YZW A;  1QLS A;  1SL7 A;  3AKA A;  1ZGO A;  2KBI A;  2FL1 A;  1K9K A;  4OQW A;  1Y6W A;  4JKT A;  2AWM A;  4IK5 A;  3SG5 A;  3NHI A;  3DQE A;  1B1G A;  1QVI Y;  2EGD A;  5LTQ A;  4MSP A;  3TDI A;  2CCM A;  5H89 A;  3NEZ A;  4YI9 A;  2A50 B;  3ADF A;  1YUR A;  4DS7 A;  3VRQ A;  5HYD A;  2I18 A;  1SL9 A;  4I5K A;  1WRK A;  2H61 A;  1TNP A;  1S3P A;  1ODB A;  2EMN A;  4AR7 A;  1Q4D A;  1CV7 A;  3CBE A;  1CMF A;  3NT3 A;  1HQV A;  1K8U A;  2CNP A;  1XA9 A;  1BOD A;  2ZMW A;  5FVG A;  4H47 A;  1ZGQ A;  4ZIN A;  2LHL A;  2AHA A;  4D1E A;  1BU3 A;  1SYM A;  1BFP A;  2LMV A;  3LCP C;  3H1R A;  4WQ2 A;  2BL0 B;  2AAO A;  3CAB A;  1UHI A;  4MZL A;  2HQ8 A;  1UHJ A;  3BFB A;  4YBH B;  1A2X A;  2QEB A;  1S6I A;  5T3I A;  1QYO A;  4ANJ A;  1EG4 A;  2QU1 A;  1KYR A;  2JZI A;  3H1O A;  3ST3 A;  3FE9 A;  2Y5I A;  1IRJ A;  1SSE B;  4Z4M A;  3U0K A;  2BL0 C;  4MBE A;  2KI6 C;  1M39 A;  1NX0 A;  4W6D A;  3WHU B;  2WSO A;  3I19 A;  4CFQ A;  4P76 A;  4OHS A;  3SVS A;  3ZUF A;  1AUI B;  2JNX A;  2OTB A;  2QZ0 A;  1Q4E A;  1TN4 A;  1NP8 A;  2Y0G A;  3TMT A;  1SNL A;  2L98 A;  2JC2 A;  1EMK A;  2HET A;  2V4E B;  1CDL A;  3VGO A;  1YR5 A;  2DUI A;  3D10 A;  2JUL A;  4F0Z B;  1DMO A;  1QV0 A;  1RWY A;  3DQU A;  1LKJ A;  1EMC A;  4W6U A;  3SIB A;  3BXA A;  1CLL A;  3SVU A;  4W6A A;  1U5I B;  2V4E C;  4B30 B;  1Q4A A;  2AUC A;  1KFX S;  1KYS A;  1F71 A;  1XFR A;  5FI6 A;  3L47 A;  3GL4 A;  2ERB A;  1DTL A;  1SL8 A;  3RLZ A;  3WCK A;  4XJK A;  1CKK A;  1MF8 B;  4PDZ A;  4HRG A;  4BY4 A;  2MAZ A;  3BQ3 A;  1EMB A;  2QLH A;  1SR6 B;  5BT0 A;  3EVV A;  1CLB A;  1TOP A;  1R6P A;  3EKH A;  3O78 A;  5G08 A;  3WXA A;  4IL1 A;  4QJ3 B;  2ZFD A;  1C7V A;  3LF4 B;  1ZMZ A;  5DTL A;  1SR6 C;  1DJY A;  4MN0 A;  2FCD A;  1KSO A;  3I5F B;  4JFG A;  2CBL A;  1HCJ A;  1YHH A;  1TWO A;  1Y1A A;  2G2B A;  4U2V A;  1OOI X;  2POX A;  2ZRS A;  1J1D A;  1JF2 A;  3R1O A;  5EL2 A;  1BR1 B;  3SV5 A;  2LMT A;  2JTT A;  3S05 A;  3KCS A;  1E8A A;  3ZNI A;  1JC2 A;  3I5F C;  4MLW A;  4JPZ B;  4OKH A;  3NHT A;  1NCX A;  1UHH A;  2L2C A;  5TNC A;  4HQ9 A;  2FZU A;  3U0N A;  1XFY O;  5DRG A;  1W7J B;  3EK4 A;  4JWQ A;  1S1E A;  2A54 B;  3D78 A;  3DQJ A;  3PJ7 A;  5D69 A;  1W7S A;  2QDI A;  4LJD C;  2BKH B;  4U8D A;  1YUS A;  1DJW A;  1MWN A;  4JC2 A;  1MOU A;  3PN7 C;  4GAO A;  2LNK A;  3BJH A;  1FPW A;  2YE0 A;  1H6R A;  3DVM A;  1P28 A;  2QT2 A;  2IB5 A;  3D0Y B;  3WHT B;  5HZO A;  2KQY A;  1EH2 A;  4PE4 A;  1G7K A;  4LJC A;  5FVI A;  1AHR A;  3SVB A;  4YGC B;  4AQJ A;  1BT6 A;  5KTY A;  3ST4 A;  2VRG A;  1JFK A;  3W1D A;  4ORB B;  5I2Q A;  1J7O A;  4TZG A;  2VZX A;  4N1G A;  5CSJ A;  3UFZ A;  4W6L A;  1GL4 A;  1UUR A;  2Q57 A;  4N3D A;  2M1K B;  2GW4 B;  2JRF A;  2AMI A;  3DQ7 A;  2LMU A;  3MGF A;  4EN1 A;  2KAY A;  3NT9 A;  5H88 A;  4ZIO A;  2HCG A;  2M9G A;  1LVC D;  2BEC A;  2ZKM X;  2Z6Y A;  1BF5 A;  3O77 A;  1SMG A;  4W69 A;  1ZGP A;  2M7N A;  1UHN A;  3DQM A;  1YJ2 A;  2DOQ A;  2MLF C;  4F7F A;  3EG5 B;  5HKW A;  3CZT X;  2ZNE A;  1NCY A;  3PJB A;  5IBW A;  3PJ5 A;  3IP2 A;  1OW4 A;  2GGZ A;  2WCJ A;  3AAJ A;  2H5Q A;  3M22 A;  4AQI A;  3DQ1 A;  4C0K A;  3CD1 A;  3DQ9 A;  1RM9 A;  4RYW A;  3B6X A;  5HKY A;  1KCY A;  2DDD A;  4W6I A;  1R2U A;  1Y1X A;  3E5V A;  1AJ4 A;  2YFP A;  1YRU B;  4P2Y B;  1NIW A;  4Q9W A;  3UG0 A;  3HCM A;  3BUM B;  2COL B;  2HF5 A;  5BPJ A;  2GGM A;  4IK4 A;  5CPV A;  4M2Q A;  2QLG B;  3I5I B;  3DQ2 A;  2KGB C;  1ZOT B;  2L4H A;  3DY9 A;  1WLM A;  2BCX A;  3K1E A;  3DQ4 A;  2GW3 A;  1DF0 B;  4OZD A;  3S0D A;  1LA3 A;  1TCF A;  1Q4B A;  1JBZ A;  2K8M B;  1EMG A;  1QTX A;  3PLF B;  3PIB A;  4LJB A;  1W9Z A;  4M2O A;  1EG3 A;  1CDM A;  2M3W A;  4PAL A;  3D77 A;  2NLN A;  3BUW B;  1V1F A;  1SK6 D;  2PQL A;  3K1K A;  4HE4 A;  4W6B A;  1YX7 A;  2MBX A;  1M46 A;  2V4E A;  3WLC A;  1S36 A;  2BBN A;  3PM8 A;  4P5O E;  3DQI A;  2JQ6 A;  3VRR A;  4PFE A;  4DXQ A;  1K94 A;  3W1C A;  3B87 A;  1A03 A;  2LVJ A;  5K89 A;  3BXB A;  5AFP A;  1CB1 A;  2I94 A;  2P71 A;  5DPJ A;  1U5I A;  2SCP A;  3I5H B;  4B30 A;  2GX0 A;  1S6C A;  1J55 A;  4KA9 A;  5CSF A;  1OMR A;  2CXJ A;  5KTG A;  2OTG B;  5HGE A;  3A4U B;  3F45 A;  4HSZ A;  1JBY A;  2BE6 A;  4WRI A;  1C7W A;  3I5H C;  3FWB A;  4UTS A;  2NCO A;  2WC8 A;  2FJY A;  5LTP A;  2ISD A;  2M1U A;  2OTG C;  2WCB A;  2JXC A;  1FI5 A;  1A75 B;  1X02 A;  3OBV A;  2WCE A;  4HVF A;  3NXA A;  4IK3 A;  3SSL A;  1H4B A;  2WHS A;  1S5G Z;  2O29 A;  1IGV A;  1UHK A;  2JNF A;  4PHM A;  3NSL A;  2KDH A;  1TRF A;  1TIZ A;  2K2A A;  3ZTF A;  3SVE A;  1MOV A;  4W6H A;  2PXS A;  3EVU A;  3PAT A;  2KYF A;  3DQ5 A;  2KYC A;  5D3O A;  2K7O A;  2AWK A;  5DKR A;  4LJD A;  1DQE A;  1K9P A;  1XFZ O;  2D8N A;  3OHM B;  2ZN8 A;  1FF1 A;  5HW9 A;  2E6W A;  4LW5 A;  1SPY A;  1GGW A;  1MUX A;  1TCO B;  3IR8 A;  2WSN A;  4DXI A;  2G3D B;  2O60 A;  2EMD A;  2H9W A;  1Z2C B;  1Y0V H;  4HQC A;  3O2P A;  3LF3 A;  2LAP A;  3EKJ A;  1KK7 Y;  4HRE E;  1QX2 A;  3VRP A;  1B8C A;  1AK8 A;  4JRB A;  2DUE A;  5DQB A;  1OOF A;  2HGY A;  5J2O A;  2H2K A;  3DQO A;  3SIA A;  2G16 B;  1QWV A;  2BCB A;  1XVJ A;  1LA0 A;  3CFF A;  2DUH A;  4KGF A;  5EJU A;  1NX3 A;  4XOW A;  4FQO A;  1CNP A;  4JEO A;  4ICB A;  4GFT A;  4W76 A;  2KAX A;  2JPO A;  1B7T Y;  3K21 A;  1IKU A;  5GQQ C;  1PSB A;  3BUN B;  2LVK A;  4W72 A;  1SKT A;  3C1V A;  4W6P A;  1NSH A;  3D73 A;  2BKI B;  2DD7 A;  1PAL A;  1KQV A;  3TDZ A;  4MVF A;  5EXU A;  1QIV A;  2F8P A;  3FE6 A;  4W75 A;  2KLE A;  1ZFS A;  2O24 A;  5EBJ A;  3OX5 A;  4W77 A;  3G9A A;  2K2F A;  3SJS A;  3CS1 A;  2A52 B;  1Q73 A;  3OSQ A;  2CT9 A;  1YTZ C;  2YE1 A;  2DUF A;  1WY9 A;  1B9A A;  2JU0 A;  2H6V A;  4Q7R A;  2KQ6 A;  3SVD A;  5LK4 A;  4DCK A;  1JC0 A;  1BR4 B;  2QAC A;  2OKY A;  2NZ0 A;  1RRX A;  1QIW A;  1KYP A;  2JPT A;  3O6B A;  1G33 A;  1MXE A;  2IS9 A;  1OMV A;  1XO5 A;  2AWJ A;  3L4A A;  1WLZ A;  1J7R A;  5DPG A;  2M29 A;  1TUZ A;  5HL1 A;  1CDN A;  1JUO A;  2F3Z A;  2HPS A;  4L9M A;  2KSP A;  4JQ0 D;  3EK8 A;  4HQ8 A;  4R1E A;  3SS4 A;  4ZBL A;  4W7R A;  3CGL A;  1K90 D;  2QEV A;  1OZS A;  2BBM A;  4NDD A;  3KPX A;  3OX6 A;  3DQL A;  1K93 D;  3S0E A;  1G8I A;  1DJH A;  3BUX B;  5AAN A;  1KFU L;  1JF0 A;  3PAL A;  1YUT A;  4W6R A;  2WC5 A;  1OXE A;  4RYS A;  2KNE A;  4OGS A;  1W7U A;  3IVT A;  4KEX A;  1H4U A;  4A4B A;  1EML A;  2KPH A;  3B7A A;  1FI6 A;  4W7C A;  3S0G A;  1CTR A;  4PPL A;  1EXR A;  2LV7 A;  1OXF A;  2M0R A;  1QVI Z;  2PMY A;  5I2O A;  2FCE A;  3VB1 A;  1OOH A;  1OE9 B;  5EXB A;  4FTG A;  3QRX A;  3S0F A;  3AKB A;  1J7Q A;  1DJZ A;  2MJW B;  3DQC A;  2LCP A;  3LK1 A;  2E30 A;  2L51 A;  3CZ0 A;  1CMG A;  4R6D A;  4W6N A;  2GTE A;  2C9I A;  3L4L A;  1F54 A;  5JJG A;  4XYN A;  2QPT A;  1XA5 A;  1IH0 A;  3KCT A;  4QJ5 B;  4GGF C;  4BY5 A;  2B3Q A;  1EMA A;  2R2I A;  4H3M A;  1GGX A;  2ZND A;  3VIC A;  4ZFS A;  2LVI A;  4ZF4 A;  3UO9 A;  1RK9 A;  3CR2 A;  4AOM A;  1SRA A;  1A75 A;  2Z1O A;  2A56 B;  4PHN A;  2K7D A;  2LLU A;  3A8R A;  1S26 D;  1TUJ A;  3LS3 A;  3NSI A;  2JWW A;  5DQM A;  4C0L A;  4TNC A;  4A4C A;  1RFJ A;  2VVJ A;  1OXD A;  3SG4 A;  3GK2 A;  3I5G B;  5I2L A;  5FVF A;  1GM0 A;  4ZF3 A;  1B8L A;  3ZWH A;  2EC6 B;  1DJI A;  5CSN A;  4W6G A;  4KW4 A;  3CR4 X;  3WLD A;  1QJT A;  3CFA A;  2BNX A;  4N1F A;  1OOJ A;  2SAS A;  4YGD B;  2QEH A;  1KSM A;  1C4F A;  1IJ5 A;  1JFJ A;  3MSE B;  2IOV A;  4KW9 A;  1SW8 A;  2Q91 A;  4I5L B;  2KFG A;  5BQL A;  2H8Q A;  1XK4 C;  2JXL A;  2LUC A;  1AJ5 A;  2EC6 C;  1ALV A;  4OCI A;  1IWQ A;  1IQ3 A;  2F2P A;  3IQO A;  2L5X B;  3DQH A;  4W7F A;  1AP4 A;  3SST A;  4CPV A;  3CZ2 A;  3SS3 A;  1SCM B;  1F55 A;  1RTP 1;  5I8N A;  3DVE A;  3P8U A;  1B4C A;  4JD9 A;  1DGV A;  2F3Y A;  4WQ3 A;  2HFC A;  2GV5 A;  1EMM A;  4W6C A;  3BUO B;  2A48 A;  3ICB A;  3UNW A;  2A53 B;  3PM2 A;  3NSO A;  4PPK A;  4PHK A;  1GGZ A;  5HBD A;  2QEO A;  3LL8 B;  4ZB1 A;  1UP5 A;  5FYX A;  5EXC I;  5KU1 A;  4DIR A;  1LS8 A;  1YVH A;  2OKW A;  2CTN A;  2I7A A;  1B8R A;  3GJ2 A;  1GJY A;  2LUX A;  3SSH A;  3DQ3 A;  4NDB A;  3N7H A;  2IE2 A;  3ZUL A;  1C07 A;  1YJF A;  3DYE A;  1DJG A;  1KFU S;  1HUY A;  1WRL A;  2H5O A;  3WNX B;  1EMF A;  3CTN A;  2HQZ A;  2G5Z B;  3TDU A;  5AQB B;  1IQ5 A;  3JVT B;  2PVB A;  4YGB B;  1CFP A;  1JSA A;  1FW4 A;  2Y4Q A;  4IJ7 A;  1DGU A;  2WOS A;  1NYA A;  2G6Y A;  3I5I C;  1L7Z A;  3U8P A;  2JT0 A;  2AWL A;  3AKO A;  1IJ6 A;  3SG3 A;  2MA2 A;  1SY9 A;  3U8C A;  1Z1P A;  1NPQ A;  4W7X A;  4AS8 A;  4GUK A;  1RMM A;  4BDU A;  1L2O B;  5AEQ A;  3KF9 A;  5BTT B;  3FS7 A;  3JVT C;  3LSA A;  1TNW A;  4YGE B;  1EME A;  3BXK A;  4LQT A;  3LLE A;  4DRW A;  2FJU B;  1KP5 A;  2OTE A;  2AH8 A;  2O5G A;  1YVL A; 
#chains in the Genus database with same CATH homology
 4C0J A;  2P6B B;  4MEW A;  1L2O C;  2DD9 A;  2LLS A;  3O4Y A;  1KQM B;  4J89 A;  1QYQ A;  2KAV A;  5HLV A;  1CDP A;  1W7T A;  2WOR A;  3CLN A;  1BMO A;  4J88 A;  4HRH A;  2L2E A;  4PE7 A;  2B1U A;  1QYF A;  3DF0 B;  4W6M A;  5LTR A;  2ARL A;  3OB2 B;  1CM4 A;  2H5R A;  2QRF A;  4YI8 A;  1KQM C;  1OQP A;  3SVR A;  3IF7 A;  4N5X A;  2PRU A;  3AI4 A;  2WHU A;  1XQM A;  4QJ4 B;  4LQU A;  4DKM A;  3BYA A;  4DXN A;  4ZCU A;  4DXP A;  4I5J A;  2LHI A;  3BXC A;  4M2P A;  4L1I A;  5HZT A;  5B8I B;  2KHN A;  2VAE A;  4GBA A;  1RMP A;  3DQK A;  4MRX A;  4ORC B;  3M0W A;  1Q4C A;  1NUB A;  2YDZ A;  1LXF C;  1FBV A;  4GGF A;  3SRY A;  3ST0 A;  4IK1 A;  1BJF A;  2L50 A;  1MR8 A;  2NCP A;  2JT3 A;  2LLT A;  1CFF A;  4GNK B;  1XMZ A;  3LK0 A;  3P28 A;  2WHT A;  1EL4 A;  4I5N B;  1ZAC A;  2K7C A;  2Z6Z A;  2P4M A;  4NDC A;  1N0Y A;  4L13 A;  1K9U A;  2M7L A;  1OZO A;  2OPO A;  2LVV A;  1EJ3 A;  2KI4 B;  3FWC A;  2A46 A;  3TZ1 A;  3RWT A;  5DY6 A;  4UPG A;  3GEX A;  1XSS A;  3D0Y A;  4E68 A;  5ER4 X;  2LC5 A;  1KK8 B;  2F2O A;  1K2H A;  2KI4 C;  4W6S A;  3SSY A;  5F6T A;  2MLE C;  3LVC A;  3H4S E;  1XK4 A;  2K7B A;  4MRY A;  3DQA A;  4DKN A;  2PAS A;  1J7P A;  2VVH A;  5J3X A;  3SVO A;  3BX9 A;  4TZA A;  2A4J A;  4I2Y A;  2H5P A;  1JBA A;  1B9C A;  4KPI A;  3RM1 A;  3CWG A;  1UUS A;  4Q7U A;  4ZF5 A;  1KK8 C;  4GF6 B;  3DVJ A;  5F9G A;  3GB3 A;  1F8H A;  2HPW A;  4R6B A;  3IQQ A;  4Q7T A;  5H87 A;  1QV1 A;  2HRS A;  3V3D A;  3DPZ A;  4GPL B;  2OS8 B;  1XFV O;  2ICR A;  2A47 A;  3SVN A;  4KF5 C;  3CD9 A;  1YFP A;  1PVB A;  3LVA A;  1Y1U A;  4IK8 A;  2L0P A;  1B47 A;  5EB7 A;  1D1O A;  1QXT A;  4XOV A;  1XYD A;  2G2S B;  3E5W A;  2DDC A;  1PRW A;  2OS8 C;  3DVK A;  1RRO A;  4W7A A;  1F4O A;  4Z4K A;  4W6O A;  2Q4U A;  1F4Q A;  3VRO A;  3DQ8 A;  2BE4 A;  5HKZ A;  2WCF A;  1QX5 B;  2JT8 A;  1SBJ A;  5AXI A;  3ST2 A;  2M97 A;  2KI6 D;  2WUR A;  3GOF A;  4GOB A;  3KHE A;  2LP2 A;  2NXQ A;  2QLG A;  3VHT B;  3OSR A;  5D7F A;  1K95 A;  3DQF A;  1DF0 A;  4NWS A;  1WRZ A;  2KOT A;  1H8B A;  4KW8 A;  4Q9X A;  3KEV A;  1CM1 A;  5JOL A;  1N65 A;  3AAK A;  1XFW O;  3FIA A;  2VAD A;  2ZN9 A;  1MYW A;  4USL A;  3E3R A;  3E5T A;  2G6X A;  1JC1 A;  3SG2 A;  3SS0 A;  4KGE A;  2EHB A;  2PXW A;  5BTT A;  5DRF A;  2FOT A;  1BLQ A;  1YUU A;  2Y1N A;  4J8A A;  2TN4 A;  1N2D A;  3BOW B;  2MHH A;  5EB6 A;  2VVI A;  2BTJ A;  5DPI A;  4B5Y A;  4OY4 A;  3GK4 X;  4W6F A;  1BOC A;  3AI5 A;  2G6E A;  2WND A;  3SSV A;  4W6J A;  5AER A;  4ORA B;  2ZMU A;  5FHV A;  1Z1Q A;  2RH7 A;  3NED A;  1G4Y R;  2ZRT A;  5DTX A;  3DQN A;  3DF0 A;  1CFD A;  4DXM A;  4PCW A;  1PUL A;  1KK7 Z;  2KFF A;  4PE0 A;  4ORN A;  1M63 B;  1GQM A;  2WIQ A;  3NSK A;  3SVC A;  3PN7 B;  3CR5 X;  2B3P A;  1QLK A;  1ALW A;  2K0J A;  2KFH A;  1RMO A;  5KSZ A;  1F0B A;  1TNX A;  1UIS A;  2Q6P A;  4OR9 B;  2M49 B;  1B7T Z;  1CLM A;  1QX7 A;  3CGA A;  5PAL A;  3DPX A;  2G3O A;  1VRK A;  4CID A;  4JF9 A;  4EDS A;  4OJ0 A;  1J1E A;  2H61 C;  2PAL A;  1S6Z A;  4W6K A;  5DKN A;  4EDO A;  2G9B A;  1LIN A;  3U0L A;  1CFC A;  5DTZ A;  2HQK A;  2LP3 A;  3I5G C;  2I2R E;  1S5G Y;  1QS7 A;  3VRN A;  1F70 A;  1NWD A;  1WDC B;  1JWD A;  1V1G A;  1TNQ A;  3EVP A;  2FWQ A;  3GK1 A;  3CB9 A;  4KF4 A;  1QY3 A;  3KO0 A;  1OSA A;  1YX8 A;  3SG6 A;  2Y1M A;  2F33 A;  3DD4 A;  1ZUZ A;  1WDC C;  2MRD A;  1IG5 A;  4YRU A;  3SSK A;  4OVN F;  2K61 A;  1OMD A;  1MXL C;  2KGR A;  1W7I B;  1SCM C;  1K96 A;  5DTY A;  1Q80 A;  4Q04 A;  3LA1 A;  5DPH A;  4L12 A;  2C9J A;  1NX1 A;  4XL5 A;  2LE9 B;  1TTX A;  4GES B;  3U0M A;  3EK7 A;  5HZU A;  4KF5 A;  1YHG A;  4XVP A;  1DJX A;  1A4P A;  3GJ1 A;  4JGE A;  3HX4 A;  2DUG A;  2HGD A;  3SSP A;  4W6T A;  2WIS A;  2QLE A;  2LAN A;  4MZJ A;  1QAS A;  1ZUX A;  4DUQ A;  2PSR A;  3TS5 B;  4GGN A;  5HZS A;  2OGR A;  1A29 A;  1QAT A;  1S6J A;  3U8A A;  3EVR A;  4MZK A;  4RTC A;  4XJK B;  2Z6X A;  1NCZ A;  2V53 A;  3OGO A;  1M45 A;  3ZUJ A;  1UWO A;  2M8U A;  4W7E A;  4P1Q A;  5EHU A;  3TS5 C;  1DT7 B;  2O2B A;  1PSR A;  3TMR A;  4EUL A;  2JOJ A;  4CLN A;  3ED8 A;  1XFX O;  2JAD A;  4PPJ A;  5DKQ A;  1MQ1 A;  2QLI A;  2JTZ A;  4ETO A;  4OV2 A;  1XFU O;  1MHO A;  5DU0 A;  1XAE A;  2ZO6 A;  4YGA A;  4KAG A;  1F09 A;  1YHI A;  3A8S A;  3VHT A;  1HT9 A;  4PE1 A;  2GX2 A;  4ZCV A;  3TUY B;  4CFR A;  4DXO A;  5HLO A;  3DQD A;  3PFV A;  3JTD B;  4IK9 A;  4NQG A;  5CSI A;  1PVA A;  2EMO A;  3DQ6 A;  4EMQ A;  2HQW A;  1AVS A;  3TUY C;  1REC A;  1DVI A;  4H48 A;  2BCA A;  1QXP A;  1KWO B;  3CFH A;  4W73 A;  3M24 A;  1YRT B;  1RJV A;  3OB1 B;  4W7D A;  1M31 A;  1KFX L;  3JTD C;  3RWA A;  2HJO A;  4XGY A;  2OJK A;  3VK1 A;  1BG1 A;  4H3N A;  3BOW A;  3SG7 A;  3DPW A;  4W74 A;  2L4I A;  5ER5 A;  3OP0 A;  2ZO7 A;  1SCV A;  4IZN A;  3LVD A;  2RGI A;  3NF0 A;  2LM5 A;  3PSR A;  4PHJ A;  1KWO C;  1GFL A;  2IB6 A;  2KBM A;  1PK0 D;  4H3L A;  1NX2 A;  1YZW A;  1QLS A;  1SL7 A;  3AKA A;  1ZGO A;  2KBI A;  2FL1 A;  1K9K A;  4OQW A;  1Y6W A;  2AWM A;  4IK5 A;  3SG5 A;  3DQE A;  1B1G A;  1QVI Y;  2EGD A;  5LTQ A;  4MSP A;  3TDI A;  2CCM A;  5H89 A;  3NEZ A;  4YI9 A;  2A50 B;  3ADF A;  1YUR A;  4DS7 A;  3VRQ A;  5HYD A;  2I18 A;  1SL9 A;  4I5K A;  1WRK A;  2H61 A;  1TNP A;  1S3P A;  1ODB A;  2EMN A;  4AR7 A;  1Q4D A;  1CV7 A;  3CBE A;  1CMF A;  3NT3 A;  1HQV A;  1K8U A;  2CNP A;  1XA9 A;  1BOD A;  2ZMW A;  5FVG A;  4H47 A;  1ZGQ A;  4ZIN A;  2LHL A;  2AHA A;  4D1E A;  1BU3 A;  1SYM A;  1BFP A;  2LMV A;  3LCP C;  4WQ2 A;  3H1R A;  2BL0 B;  2AAO A;  1UHI A;  4MZL A;  2HQ8 A;  1UHJ A;  4YBH B;  1A2X A;  1S6I A;  5T3I A;  1QYO A;  4ANJ A;  1EG4 A;  2QU1 A;  1KYR A;  2JZI A;  3H1O A;  3ST3 A;  2Y5I A;  1IRJ A;  4Z4M A;  3U0K A;  2BL0 C;  4MBE A;  2KI6 C;  1M39 A;  1NX0 A;  4W6D A;  3WHU B;  2WSO A;  3I19 A;  4CFQ A;  4P76 A;  4OHS A;  3SVS A;  3ZUF A;  1AUI B;  2JNX A;  2OTB A;  2QZ0 A;  1Q4E A;  1TN4 A;  1NP8 A;  2Y0G A;  3TMT A;  1SNL A;  2L98 A;  2JC2 A;  1EMK A;  2HET A;  2V4E B;  1CDL A;  3VGO A;  1YR5 A;  2DUI A;  3D10 A;  2JUL A;  4F0Z B;  1DMO A;  1QV0 A;  1RWY A;  3DQU A;  1LKJ A;  1EMC A;  4W6U A;  3SIB A;  3BXA A;  1CLL A;  3SVU A;  4W6A A;  1U5I B;  2V4E C;  4B30 B;  1Q4A A;  2AUC A;  1KFX S;  1KYS A;  1F71 A;  3GL4 A;  1DTL A;  1SL8 A;  3RLZ A;  3WCK A;  4XJK A;  1CKK A;  1MF8 B;  4PDZ A;  4HRG A;  4BY4 A;  2MAZ A;  3BQ3 A;  1EMB A;  2QLH A;  1SR6 B;  5BT0 A;  3EVV A;  1CLB A;  1TOP A;  1R6P A;  3EKH A;  3O78 A;  5G08 A;  3WXA A;  4IL1 A;  4QJ3 B;  2ZFD A;  1C7V A;  3LF4 B;  1ZMZ A;  5DTL A;  1SR6 C;  1DJY A;  4MN0 A;  2FCD A;  1KSO A;  3I5F B;  4JFG A;  2CBL A;  1HCJ A;  1YHH A;  1Y1A A;  2G2B A;  4U2V A;  2POX A;  2ZRS A;  1J1D A;  1JF2 A;  1BR1 B;  3SV5 A;  2LMT A;  2JTT A;  3S05 A;  3KCS A;  1E8A A;  3ZNI A;  1JC2 A;  3I5F C;  4MLW A;  4JPZ B;  4OKH A;  1NCX A;  1UHH A;  5TNC A;  4HQ9 A;  2FZU A;  3U0N A;  1XFY O;  5DRG A;  1W7J B;  3EK4 A;  4JWQ A;  1S1E A;  2A54 B;  3DQJ A;  3PJ7 A;  5D69 A;  1W7S A;  4LJD C;  2BKH B;  4U8D A;  1YUS A;  1DJW A;  1MWN A;  4JC2 A;  1MOU A;  3PN7 C;  4GAO A;  2LNK A;  1FPW A;  2YE0 A;  1H6R A;  3DVM A;  2QT2 A;  2IB5 A;  3D0Y B;  3WHT B;  5HZO A;  2KQY A;  1EH2 A;  4PE4 A;  1G7K A;  4LJC A;  5FVI A;  1AHR A;  3SVB A;  4YGC B;  4AQJ A;  1BT6 A;  5KTY A;  3ST4 A;  2VRG A;  1JFK A;  3W1D A;  4ORB B;  5I2Q A;  1J7O A;  4TZG A;  2VZX A;  4N1G A;  5CSJ A;  3UFZ A;  4W6L A;  1GL4 A;  1UUR A;  2Q57 A;  4N3D A;  2M1K B;  2GW4 B;  2JRF A;  2AMI A;  3DQ7 A;  2LMU A;  3MGF A;  4EN1 A;  2KAY A;  3NT9 A;  5H88 A;  4ZIO A;  2HCG A;  2M9G A;  1LVC D;  2BEC A;  2ZKM X;  2Z6Y A;  1BF5 A;  3O77 A;  1SMG A;  4W69 A;  1ZGP A;  2M7N A;  1UHN A;  3DQM A;  1YJ2 A;  2DOQ A;  2MLF C;  5HKW A;  3CZT X;  2ZNE A;  1NCY A;  3PJB A;  5IBW A;  3PJ5 A;  3IP2 A;  2GGZ A;  3AAJ A;  2H5Q A;  3M22 A;  4AQI A;  3DQ1 A;  4C0K A;  3CD1 A;  3DQ9 A;  1RM9 A;  4RYW A;  5HKY A;  1KCY A;  2DDD A;  4W6I A;  1R2U A;  1Y1X A;  3E5V A;  1AJ4 A;  2YFP A;  1YRU B;  4P2Y B;  1NIW A;  4Q9W A;  3UG0 A;  3HCM A;  3BUM B;  2COL B;  2HF5 A;  5BPJ A;  2GGM A;  4IK4 A;  5CPV A;  4M2Q A;  2QLG B;  3I5I B;  3DQ2 A;  2KGB C;  1ZOT B;  2L4H A;  1WLM A;  2BCX A;  3DQ4 A;  2GW3 A;  1DF0 B;  1LA3 A;  1TCF A;  1Q4B A;  1JBZ A;  2K8M B;  1EMG A;  1QTX A;  3PLF B;  3PIB A;  4LJB A;  4M2O A;  1EG3 A;  1CDM A;  2M3W A;  4PAL A;  2NLN A;  3BUW B;  1V1F A;  1SK6 D;  3K1K A;  4HE4 A;  4W6B A;  1YX7 A;  2MBX A;  1M46 A;  2V4E A;  3WLC A;  1S36 A;  2BBN A;  3PM8 A;  4P5O E;  3DQI A;  2JQ6 A;  3VRR A;  4PFE A;  4DXQ A;  1K94 A;  3W1C A;  1A03 A;  2LVJ A;  5K89 A;  3BXB A;  5AFP A;  1CB1 A;  2I94 A;  5DPJ A;  1U5I A;  2SCP A;  3I5H B;  4B30 A;  2GX0 A;  1S6C A;  1J55 A;  4KA9 A;  5CSF A;  1OMR A;  2CXJ A;  5KTG A;  2OTG B;  5HGE A;  3A4U B;  3F45 A;  4HSZ A;  1JBY A;  2BE6 A;  4WRI A;  1C7W A;  3I5H C;  3FWB A;  4UTS A;  2NCO A;  2WC8 A;  5LTP A;  2ISD A;  2M1U A;  2OTG C;  2WCB A;  2JXC A;  1FI5 A;  4HVF A;  1A75 B;  1X02 A;  2WCE A;  3NXA A;  4IK3 A;  3SSL A;  1H4B A;  2WHS A;  1S5G Z;  2O29 A;  1IGV A;  1UHK A;  2JNF A;  4PHM A;  3NSL A;  2KDH A;  1TRF A;  1TIZ A;  2K2A A;  3ZTF A;  3SVE A;  1MOV A;  4W6H A;  2PXS A;  3EVU A;  3PAT A;  2KYF A;  3DQ5 A;  2KYC A;  2K7O A;  2AWK A;  5DKR A;  4LJD A;  1K9P A;  1XFZ O;  2D8N A;  3OHM B;  2ZN8 A;  1FF1 A;  5HW9 A;  2E6W A;  4LW5 A;  1SPY A;  1GGW A;  1MUX A;  1TCO B;  3IR8 A;  2WSN A;  4DXI A;  2G3D B;  2O60 A;  2EMD A;  2H9W A;  1Y0V H;  4HQC A;  3O2P A;  3LF3 A;  2LAP A;  3EKJ A;  1KK7 Y;  4HRE E;  1QX2 A;  3VRP A;  1B8C A;  1AK8 A;  4JRB A;  2DUE A;  5DQB A;  2HGY A;  5J2O A;  2H2K A;  3DQO A;  3SIA A;  2G16 B;  2BCB A;  1XVJ A;  1LA0 A;  3CFF A;  2DUH A;  4KGF A;  5EJU A;  1NX3 A;  4XOW A;  4FQO A;  1CNP A;  4JEO A;  4ICB A;  4GFT A;  4W76 A;  2KAX A;  1B7T Y;  3K21 A;  1IKU A;  5GQQ C;  1PSB A;  3BUN B;  2LVK A;  4W72 A;  1SKT A;  3C1V A;  4W6P A;  1NSH A;  2BKI B;  2DD7 A;  1PAL A;  1KQV A;  3TDZ A;  4MVF A;  5EXU A;  1QIV A;  2F8P A;  4W75 A;  1ZFS A;  2O24 A;  5EBJ A;  3OX5 A;  4W77 A;  3G9A A;  2K2F A;  3SJS A;  3CS1 A;  2A52 B;  1Q73 A;  3OSQ A;  2CT9 A;  1YTZ C;  2YE1 A;  2DUF A;  1WY9 A;  1B9A A;  2JU0 A;  2H6V A;  4Q7R A;  2KQ6 A;  3SVD A;  5LK4 A;  4DCK A;  1JC0 A;  1BR4 B;  2QAC A;  2OKY A;  2NZ0 A;  1RRX A;  1QIW A;  1KYP A;  2JPT A;  3O6B A;  1G33 A;  1MXE A;  2IS9 A;  1OMV A;  1XO5 A;  2AWJ A;  1WLZ A;  1J7R A;  5DPG A;  2M29 A;  1CDN A;  1JUO A;  2F3Z A;  2HPS A;  4L9M A;  2KSP A;  4JQ0 D;  3EK8 A;  4HQ8 A;  4R1E A;  4ZBL A;  4W7R A;  3CGL A;  1K90 D;  1OZS A;  2BBM A;  4NDD A;  3KPX A;  3OX6 A;  3DQL A;  1K93 D;  1G8I A;  1DJH A;  3BUX B;  5AAN A;  1KFU L;  1JF0 A;  3PAL A;  1YUT A;  4W6R A;  1OXE A;  4RYS A;  2KNE A;  4OGS A;  1W7U A;  4KEX A;  1H4U A;  4A4B A;  1EML A;  1FI6 A;  4W7C A;  1CTR A;  4PPL A;  1EXR A;  2LV7 A;  1OXF A;  2M0R A;  1QVI Z;  2PMY A;  5I2O A;  2FCE A;  1OE9 B;  5EXB A;  4FTG A;  3QRX A;  3AKB A;  1J7Q A;  1DJZ A;  2MJW B;  3DQC A;  2LCP A;  3LK1 A;  2E30 A;  2L51 A;  1CMG A;  4R6D A;  4W6N A;  2C9I A;  1F54 A;  5JJG A;  4XYN A;  2QPT A;  1XA5 A;  1IH0 A;  3KCT A;  4QJ5 B;  4GGF C;  4BY5 A;  2B3Q A;  1EMA A;  2R2I A;  4H3M A;  1GGX A;  2ZND A;  3VIC A;  4ZFS A;  2LVI A;  4ZF4 A;  1RK9 A;  3CR2 A;  4AOM A;  1SRA A;  1A75 A;  2Z1O A;  2A56 B;  4PHN A;  2K7D A;  2LLU A;  3A8R A;  1S26 D;  3LS3 A;  3NSI A;  2JWW A;  5DQM A;  4C0L A;  4TNC A;  4A4C A;  1RFJ A;  2VVJ A;  1OXD A;  3SG4 A;  3GK2 A;  3I5G B;  5I2L A;  5FVF A;  4ZF3 A;  1B8L A;  3ZWH A;  2EC6 B;  1DJI A;  5CSN A;  4W6G A;  4KW4 A;  3CR4 X;  3WLD A;  1QJT A;  3CFA A;  4N1F A;  1OOJ A;  2SAS A;  4YGD B;  1KSM A;  1C4F A;  1IJ5 A;  1JFJ A;  3MSE B;  2IOV A;  4KW9 A;  1SW8 A;  2Q91 A;  4I5L B;  2KFG A;  5BQL A;  2H8Q A;  1XK4 C;  2JXL A;  2LUC A;  1AJ5 A;  2EC6 C;  1ALV A;  4OCI A;  1IWQ A;  1IQ3 A;  2F2P A;  3IQO A;  2L5X B;  3DQH A;  4W7F A;  1AP4 A;  3SST A;  4CPV A;  1SCM B;  1F55 A;  1RTP 1;  5I8N A;  3DVE A;  3P8U A;  1B4C A;  1DGV A;  2F3Y A;  4WQ3 A;  2HFC A;  2GV5 A;  1EMM A;  4W6C A;  3BUO B;  2A48 A;  3ICB A;  2A53 B;  3NSO A;  4PPK A;  4PHK A;  1GGZ A;  5HBD A;  3LL8 B;  4ZB1 A;  1UP5 A;  5FYX A;  5EXC I;  5KU1 A;  4DIR A;  2OKW A;  1YVH A;  2CTN A;  2I7A A;  1B8R A;  3GJ2 A;  1GJY A;  2LUX A;  3SSH A;  3DQ3 A;  4NDB A;  2IE2 A;  3ZUL A;  1C07 A;  1YJF A;  1DJG A;  1KFU S;  1HUY A;  1WRL A;  2H5O A;  3WNX B;  1EMF A;  3CTN A;  2HQZ A;  2G5Z B;  3TDU A;  5AQB B;  1IQ5 A;  3JVT B;  2PVB A;  4YGB B;  1CFP A;  1JSA A;  1FW4 A;  2Y4Q A;  1DGU A;  2WOS A;  1NYA A;  2G6Y A;  3I5I C;  1L7Z A;  3U8P A;  2JT0 A;  2AWL A;  3AKO A;  1IJ6 A;  3SG3 A;  2MA2 A;  1SY9 A;  3U8C A;  1Z1P A;  1NPQ A;  4W7X A;  4AS8 A;  4GUK A;  1RMM A;  4BDU A;  1L2O B;  5AEQ A;  3KF9 A;  5BTT B;  3FS7 A;  3JVT C;  3LSA A;  1TNW A;  4YGE B;  1EME A;  3BXK A;  4LQT A;  3LLE A;  4DRW A;  2FJU B;  1KP5 A;  2OTE A;  2AH8 A;  2O5G A;  1YVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...