3EKHA

Calcium-saturated gcamp2 t116v/k378w mutant monomer
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
409
structure length
394
Chain Sequence
b'SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLEFVTAAGITLVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARWMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Crystal Structures of the GCaMP Calcium Sensor Reveal the Mechanism of Fluorescence Signal Change and Aid Rational Design
pubmed doi rcsb
source organism Artificial gene
molecule tags Fluorescent protein
total genus 137
structure length 394
sequence length 409
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3ekhA01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3ekhA02
4OHSA 1DMOA 1KK8B 1OQPA 4W6AA 1GGWA 3FWCA 1F55A 1FW4A 5F9GA 4YGCB 5I2LA 2LP3A 3SRYA 4TNCA 1NUBA 1YHIA 1KP5A 1XA9A 1AJ4A 4ZB1A 1C7VA 3CR2A 1B7TZ 1DJHA 1G7KA 4W7DA 1Q73A 3EK8A 2I2RE 3LA1A 5EXUA 1F54A 2HQWA 1YUTA 2WCEA 1ZGQA 2QLIA 4MN0A 5DKQA 2K61A 2FCEA 3LS3A 3GK1A 4J89A 5ER5A 4JWQA 3D0YB 1XSSA 2MRDA 2HGYA 3PJBA 1V1FA 3GOFA 3E5TA 2BECA 4W6OA 5DRGA 1RK9A 2KAYA 5DPIA 3BUXB 2C9IA 4ZF4A 4I5JA 2MBXA 1Q4AA 1A75B 2QT2A 3I5HB 5TNCA 1S6CA 2G3DB 4B30B 1YJ2A 1J1EA 3SJSA 4W6RA 3DQ6A 1QYOA 4W6UA 4PCWA 5IBWA 4RYWA 4PHMA 5DPJA 4TZGA 3OB1B 2WSOA 3EKHA 2LVVA 4W6HA 4XJKA 4GOBA 2L50A 2QLHA 2DDCA 5EB6A 3CD1A 4R1EA 4IL1A 4W6MA 2PRUA 2HQKA 4TZAA 3VRQA 4C0LA 5HZUA 3D10A 1XQMA 1ALWA 1W7UA 5DPHA 3P28A 3SG3A 1KSMA 2MAZA 1UHKA 2H9WA 1TNXA 2ISDA 4W7XA 2BE4A 3H1OA 3NT9A 2ZMWA 4OVNF 4KA9A 1SMGA 1YJFA 4M2OA 4H47A 2PASA 2KSPA 1TNPA 4W69A 1ZGPA 2I18A 4CFRA 2WISA 1NP8A 1EMGA 2M3WA 4W6IA 3SSHA 2AMIA 2VVJA 4JQ0D 4JF9A 1CMFA 4R6BA 1K94A 1F0BA 1M31A 1PALA 1X02A 2HQ8A 3IQOA 1B47A 4N1GA 5DY6A 2ZN8A 1FF1A 2OJKA 1N65A 1LINA 4W75A 1IQ5A 3KCTA 1MYWA 1SCMB 5JOLA 2IS9A 2GX2A 1CLMA 2WCFA 3IP2A 1B8LA 4EN1A 3TS5C 1IWQA 5BTTB 2Z6YA 2O5GA 5B8IB 4WQ2A 3SVDA 5LTQA 3DQNA 4LQUA 1U5IA 1UWOA 2H2KA 1JWDA 2WHSA 2IE2A 4UPGA 3KF9A 2LV7A 4MZKA 3DQAA 1KK7Y 1BR4B 1K2HA 4OCIA 5DU0A 1QS7A 3PJ5A 3I5HC 5HKYA 3CFHA 3I5GC 3CD9A 3CGAA 3OX5A 2WIQA 2RGIA 3SS0A 1UURA 3JTDC 4JRBA 2JC2A 2LLSA 1QVIZ 3HX4A 2G16B 2NCPA 2A52B 3BXCA 1FI6A 3DPZA 3LK1A 1H4BA 4HREE 1WRKA 3I19A 3AKAA 3TMRA 3BX9A 3TZ1A 3SVOA 2OPOA 2L4HA 2L2EA 1DF0B 4FTGA 4PE4A 4DXMA 1FI5A 1HQVA 4P1QA 2F2PA 1EMCA 2COLB 3GL4A 1SNLA 2BKHB 3FWBA 1NPQA 1KQMC 1L2OC 3PN7B 1SRAA 1YHHA 4EMQA 1QXPA 1SK6D 1TCFA 2LHIA 2FOTA 3DVKA 3LCPC 1SL8A 3DF0B 4YGAA 2YE0A 4HQ9A 1QXTA 3LF4B 2VZXA 4C0JA 1B8RA 4JGEA 2VAEA 2LVIA 2DD9A 4USLA 3U8CA 3GK2A 4GGFA 4GGFC 2PMYA 1SCMC 3DQHA 2A48A 2TN4A 1ZOTB 3CR4X 3MGFA 1XA5A 1Y6WA 1XFXO 4YRUA 1AK8A 2F8PA 2JT8A 2LAPA 1EMFA 1LXFC 5FVGA 3DVJA 4IK4A 5FHVA 1AHRA 4NQGA 1KFUS 3AAKA 1QV0A 4KW8A 3WHTB 3SVCA 2ICRA 3RWAA 2KYCA 2H61A 1JC1A 1CM1A 4GAOA 2PVBA 1KQVA 3GEXA 1Q80A 5DTXA 3TMTA 3DQUA 4DXIA 4LJBA 4W6KA 1LVCD 5HKZA 2JULA 4OGSA 1OSAA 1S5GY 1CLLA 2DUFA 2G2BA 2KNEA 2A4JA 4OJ0A 2CNPA 3DD4A 1WRLA 4MZJA 3PSRA 3EK7A 5EB7A 1S6ZA 3PFVA 2H5RA 1W7JB 3EVVA 1SL9A 5AFPA 5HYDA 3DQ5A 4PPJA 4ORBB 4KW9A 2FCDA 3V3DA 2Y1NA 1RMPA 3SG4A 4GFTA 3NSIA 2G6XA 1H4UA 1KYPA 3LK0A 5EXCI 2LMVA 3DQ8A 4PDZA 2QPTA 3LVAA 1BR1B 2AWJA 4YGEB 2HPWA 1Y1XA 4XJKB 4DUQA 3SIBA 3SVUA 1C7WA 1YX8A 4DRWA 1CDNA 1Y1AA 2IB5A 3F45A 1BU3A 4DKNA 1QASA 3NXAA 1S1EA 2M1KB 1CMGA 3NEDA 1GQMA 4W6FA 2BCAA 4WRIA 3ADFA 1MR8A 2F2OA 1E8AA 4XYNA 1JBZA 1DJGA 4GPLB 3DQIA 2L51A 2JNFA 2I94A 1JFJA 1AJ5A 4QJ5B 4XOWA 1PVBA 3LLEA 2EMDA 2WHTA 2L98A 3SVRA 2P6BB 2QZ0A 4GUKA 2CBLA 1QX7A 3PM8A 2PALA 2Y0GA 1BOCA 1XFVO 3BQ3A 3IQQA 2BBNA 4YBHB 4HRHA 2OGRA 4Q9WA 2ZKMX 2ZO6A 3EKJA 1NX1A 2L5XB 1MUXA 2JRFA 2JT3A 5KTGA 4KGEA 2MJWB 3TS5B 1AP4A 1A4PA 1Z1PA 1BF5A 4W6GA 1HT9A 1U5IB 2KI4C 3CFAA 4PE1A 1DTLA 4HRGA 1CV7A 5BT0A 1UHJA 1UHHA 4L9MA 3I5GB 3VGOA 3PALA 3JTDB 2H8QA 1J7RA 3DQ1A 5I8NA 1SPYA 3U0LA 4I2YA 1KWOC 2DUHA 1G33A 2F3ZA 5CSIA 1SBJA 4MZLA 3E5WA 4ANJA 4PHJA 4DXPA 2K7OA 1GL4A 1QX2A 5J2OA 1YHGA 5G08A 4IK1A 2KQYA 2JOJA 4W6NA 1K93D 5F6TA 1JC0A 2AWMA 1F8HA 1R6PA 4U2VA 2KI6C 4PALA 1NWDA 1YRUB 1IRJA 2SASA 3CZTX 5EXBA 2KYFA 1XMZA 1KQMB 1TRFA 1L2OB 2V4EA 1MF8B 2KAVA 5BQLA 2V4EC 1DJWA 2G9BA 4AOMA 1IJ5A 2V53A 1F70A 1XAEA 4XVPA 2PSRA 1YX7A 2CTNA 4ZINA 3I5IC 2M7LA 1RWYA 3DQMA 2BCBA 5AXIA 1KFXS 4M2QA 2DD7A 2VADA 1HCJA 3UG0A 1B8CA 2P4MA 2HGDA 2LCPA 1PSBA 4QJ3B 5HBDA 3A4UB 2YE1A 5J3XA 2G6EA 1IQ3A 1A2XA 1UHIA 1DGUA 2BL0B 2OTBA 2KFHA 2L4IA 4AQJA 5H87A 4ZIOA 2E30A 5BPJA 1W7SA 3DQJA 2JTTA 4NDBA 5LK4A 1PVAA 2YDZA 1ZACA 4XL5A 2JTZA 4W6BA 2EGDA 1MXLC 3SVEA 2KI6D 2K7DA 1OXFA 4W6TA 3CLNA 4ZCVA 4C0KA 5KSZA 3GJ2A 5HZOA 3SSTA 2HCGA 1XVJA 1KFXL 1PRWA 3PLFB 4RTCA 3DQ9A 3DPWA 1QYFA 5H88A 4B5YA 3GJ1A 2KAXA 3BXAA 3VHTA 3TDIA 5FVIA 4FQOA 5HKWA 4Q9XA 1YZWA 5EHUA 1M46A 2K2AA 2AHAA 2Z1OA 2WNDA 4KF4A 1H8BA 1CLBA 3W1DA 1DJXA 2K7BA 5PALA 2GGMA 1WLZA 2JZIA 2M0RA 4Z4KA 1NSHA 4MRXA 1J7OA 1CFDA 4Z4MA 2Y4QA 2BTJA 1K96A 2KBMA 4ZF3A 1XFUO 4ZF5A 2DOQA 1CFPA 2KFFA 1NIWA 3EVUA 3C1VA 1CTRA 4OKHA 3O78A 1YVLA 1BFPA 3ZWHA 2BBMA 5DKRA 4EDSA 1QY3A 3WNXB 3EVPA 1QLKA 1B7TY 2NXQA 4RYSA 1TTXA 4PFEA 1R2UA 4W6DA 4KW4A 2KDHA 2GX0A 5ER4X 1SR6B 3RWTA 3ZNIA 4NDCA 1JBYA 1BMOA 2WURA 2GV5A 1S26D 4DS7A 3HCMA 3O4YA 4IK3A 3ICBA 1CM4A 3TUYB 1JSAA 5I2QA 3SV5A 2DUIA 1Y1UA 3A8SA 3LL8B 4HE4A 4PPLA 1BODA 4A4CA 1H6RA 1F09A 4BY5A 5EBJA 2BL0C 2H5QA 1EJ3A 1NX2A 4Q7TA 1C07A 5DRFA 1CB1A 1RM9A 1CDPA 3NT3A 3SSKA 1OZOA 1BG1A 1TOPA 3CWGA 2MA2A 2JU0A 4YGBB 2MLEC 2MLFC 1B4CA 1PK0D 2O29A 5CSNA 4W7RA 1EMAA 1DVIA 1G8IA 2LE9B 1IJ6A 1N0YA 3PJ7A 4YGDB 4MLWA 4GESB 1JFKA 3IF7A 2O24A 3JVTB 1EH2A 1YUUA 3LVDA 3DQCA 2H61C 3SSPA 5D69A 4IZNA 1J7QA 3BUNB 4QJ4B 2BCXA 1ZGOA 2A46A 3NF0A 3NEZA 4P2YB 5CSFA 4ORAB 3WLDA 3VRPA 2LNKA 1IGVA 1GFLA 1ALVA 1MOVA 4MSPA 1EMEA 1YFPA 1EXRA 3GB3A 5LTRA 1TN4A 4W7FA 1SL7A 5T3IA 3U8PA 3BOWA 2VRGA 4AR7A 4DXQA 2ZFDA 1RROA 2KGBC 4JFGA 2WOSA 3S05A 2KI4B 1Q4BA 1Y0VH 1FBVA 2LM5A 2M7NA 2Z6XA 4EULA 1N2DA 2BE6A 1XFYO 1NCZA 3BUOB 3O2PA 2CXJA 2Y1MA 5DTYA 3EK4A 2LLUA 1CFCA 4N3DA 3O6BA 2K0JA 2OKYA 3MSEB 1K95A 3BXBA 3SVBA 1TNQA 3O77A 1KWOB 2DUEA 4BY4A 3U8AA 1TNWA 1UP5A 2EMOA 5EJUA 4W6CA 1F4QA 1QX5B 2GW3A 4WQ3A 4W7AA 1SR6C 4DXNA 2B3QA 3LVCA 4KPIA 2NZ0A 3M22A 2HF5A 3AKBA 2HETA 2MHHA 4OV2A 3SSYA 2OTGC 3P8UA 5FVFA 3TUYC 1YVHA 3SG6A 1MOUA 5HZSA 3H1RA 1KK7Z 4ICBA 5D7FA 2WHUA 1QYQA 4GF6B 2M9GA 5DKNA 2H5OA 2G3OA 2V4EB 2Y5IA 2K7CA 1K8UA 4W72A 3AKOA 4W7EA 3KCSA 2KFGA 5AERA 1EMLA 3I5IB 5LTPA 1QVIY 3KEVA 1L7ZA 4ORCB 1A03A 4F0ZB 1GGXA 1DJIA 4I5KA 3DVEA 1W7IB 3DVMA 3RM1A 4N5XA 2ZNEA 4J8AA 1SCVA 4W6SA 4IK8A 4H3MA 5DTLA 1NCYA 1Q4CA 2Q4UA 1DT7B 3I5FC 3JVTC 4AS8A 1RFJA 1F71A 4D1EA 1BJFA 4W76A 4MRYA 2NCOA 1MXEA 5GQQC 1QIWA 2B3PA 1JF0A 3U0KA 4E68A 1M39A 1K9KA 1B9AA 1IKUA 2EC6C 2LMUA 5KTYA 2JXCA 2K2FA 1IH0A 3AI5A 1PULA 4HQCA 1WY9A 2JADA 3CBEA 2M97A 4JPZB 2QACA 2HRSA 2AH8A 3U0NA 5DQMA 3WCKA 3WXAA 2OTEA 2G6YA 4P76A 4XOVA 4ZCUA 1WDCC 1LA3A 4DXOA 4LJCA 4BDUA 3VHTB 1C4FA 2LC5A 1ODBA 1JBAA 2QLGA 2WC8A 3M0WA 2LVJA 1CNPA 3SSLA 3DQDA 1SW8A 3VROA 1UHNA 3VRNA 1EL4A 1V1GA 3DQKA 2CCMA 1DJYA 5HLVA 2O2BA 1D1OA 5H89A 2H5PA 4HQ8A 2KHNA 1YTZC 2HQZA 4YI9A 3QRXA 4M2PA 1GJYA 3NSKA 3M24A 3SG5A 2JT0A 1MQ1A 2EHBA 2D8NA 2QLEA 2SCPA 4Q7RA 4R6DA 2HPSA 1QTXA 3G9AA 4CLNA 3ZUFA 1ZMZA 2KGRA 2KQ6A 1S5GZ 2GW4B 2LMTA 2OS8C 1QLSA 4DKMA 2OKWA 1KCYA 1OZSA 1J7PA 5JJGA 2VVIA 3CB9A 2YFPA 1CDLA 1CKKA 2G5ZB 1Q4EA 2HFCA 5HLOA 3BUWB 4EDOA 1JC2A 1OE9B 1XYDA 1KK8C 2Q57A 3H4SE 1K9PA 5AEQA 4W77A 1ZFSA 1NCXA 1IG5A 4L13A 1PSRA 1WRZA 1QATA 2JQ6A 1YR5A 1BT6A 5DPGA 3CFFA 4XGYA 2FWQA 4CFQA 2AUCA 1WLMA 4LW5A 4PHNA 1ZUZA 1KYRA 1S36A 5CSJA 2Q91A 4J88A 1DJZA 4NWSA 3TDUA 2EMNA 1UUSA 4DCKA 1TIZA 4OQWA 4PE7A 3D0YA 2B1UA 5CPVA 2AWLA 4ETOA 3ED8A 3PATA 3TDZA 2A54B 1LKJA 2C9JA 1NX3A 5HZTA 4LQTA 1OOJA 3DQ4A 1XO5A 5HGEA 1CDMA 2L0PA 3FIAA 1A75A 3OX6A 2WCBA 2CT9A 4LJDA 4PPKA 3ST4A 3DQOA 4LJDC 4B30A 3ZULA 2LUXA 1AVSA 3BOWB 2F3YA 1K90D 1GGZA 1S6IA 5KU1A 4H48A 1MWNA 3KO0A 2FZUA 4GNKB 4NDDA 3SG7A 3OHMB 1UISA 2H6VA 2JXLA 1EMKA 1RJVA 1EG3A 2LUCA 1SYMA 3OSQA 4P5OE 4L12A 2FL1A 1B9CA 3DQLA 3GK4X 2IOVA 1QJTA 4MBEA 3IR8A 4KF5A 4A4BA 3DQ3A 4ZFSA 1SKTA 3ST3A 1OMVA 2G2SB 1ZUXA 4KF5C 1OMRA 1F4OA 2ARLA 2A53B 4IK5A 2LANA 5AANA 4N1FA 2PXSA 4ZBLA 4OY4A 2IB6A 4KEXA 1MHOA 3U0MA 4KGFA 4MEWA 4PE0A 3SG2A 3WLCA 4OR9B 2OTGB 1TCOB 3DQ7A 1BLQA 2LHLA 2ZMUA 1SY9A 3VRRA 4I5LB 4W6JA 3SVSA 2Z6ZA 2LP2A 1AUIB 2ZN9A 3K1KA 1DGVA 4GBAA 3LSAA 4HSZA 3ST0A 2ZRSA 1OXEA 2I7AA 3BUMB 5DQBA 3NSLA 2AAOA 1JF2A 1HUYA 4IK9A 3OGOA 3K21A 4ORNA 3WHUB 3CS1A 1XFWO 1B1GA 2KOTA 3NSOA 3KHEA 4W74A 2R2IA 2K8MB 4HVFA 5BTTA 3DQEA 2O60A 1LA0A 2BKIB 5K89A 3I5FB 1G4YR 2HJOA 1FPWA 2AWKA 3OP0A 1XK4A 1RTP1 3CGLA 1XK4C 3ST2A 2F33A 1KSOA 2ZNDA 4I5NB 3BYAA 2A50B 4H3NA 2QRFA 2WSNA 2JPTA 3DQFA 2ZO7A 1OMDA 5FYXA 3AAJA 4W7CA 4DIRA 5I2OA 3OB2B 1M63B 2JWWA 2PXWA 3CTNA 2EC6B 2DUGA 1S3PA 2LLTA 4UTSA 3UFZA 4YI8A 1JUOA 4W73A 2M29A 3A8RA 4CIDA 3PIBA 1J55A 2RH7A 1S6JA 2Q6PA 3ZUJA 1VRKA 2M49B 1Z1QA 3VICA 4U8DA 1RMMA 1J1DA 1OXDA 3CR5X 3SSVA 1DF0A 5HW9A 1WDCB 3FS7A 2E6WA 3LF3A 3EVRA 3E3RA 1KFUL 1NYAA 3SIAA 1RECA 1XFZO 2WORA 2QLGB 2JNXA 1KYSA 3OSRA 1EG4A 4JEOA 4Q7UA 1QV1A 2ZRTA 5AQBB 3PN7C 1M45A 3DPXA 1YUSA 2A56B 1CFFA 2DDDA 4JC2A 1K9UA 4L1IA 1Q4DA 3DF0A 3W1CA 4H3LA 2QU1A 3ZTFA 1W7TA 5DTZA 2M1UA 3VK1A 1YRTB 1RRXA 2GGZA 3KPXA 4MVFA 4Q04A 3SVNA 3AI4A 2FJUB 3RLZA 2NLNA 2POXA 4W6PA 1EMMA 2KBIA 2OS8B 4CPVA 4AQIA 1A29A 2VVHA 1YURA 4PHKA 1RMOA 4KAGA 2M8UA 3E5VA 1QIVA 1EMBA 2A47A 4W6LA 1NX0A 4GGNA 3BXKA 2LVKA 3DQ2A
chains in the Genus database with same CATH superfamily
4OHSA 1DMOA 1KK8B 1OQPA 4W6AA 1GGWA 3FWCA 1F55A 1FW4A 5F9GA 4YGCB 5I2LA 2LP3A 3SRYA 3RZSA 3SS3A 4TNCA 1NUBA 1YHIA 1KP5A 1XA9A 3DXLA 1AJ4A 4ZB1A 1C7VA 3CR2A 1B7TZ 1DJHA 5FI7A 1G7KA 4W7DA 1Q73A 3EK8A 2I2RE 3LA1A 5EXUA 1F54A 2HQWA 1YUTA 3CZ2A 2WCEA 2PYQA 1ZGQA 2QLIA 4MN0A 5DKQA 2K61A 2FCEA 3K1EA 3LS3A 3GK1A 4J89A 5ER5A 4JWQA 1TUJA 3D0YB 4INXA 1XSSA 2MRDA 2HGYA 3PJBA 1V1FA 3GOFA 3E5TA 2BECA 4W6OA 5DRGA 1RK9A 3R1VA 2KAYA 5DPIA 3BUXB 3L47A 2C9IA 4ZF4A 4I5JA 2MBXA 1Q4AA 4F7FA 1A75B 2QT2A 3I5HB 5TNCA 1S6CA 2G3DB 4B30B 1YJ2A 1J1EA 3SJSA 4W6RA 3DQ6A 1QYOA 4W6UA 4PCWA 5IBWA 4RYWA 4PHMA 5DPJA 4TZGA 3OB1B 2WSOA 3EKHA 2LVVA 4W6HA 4XJKA 4GOBA 2L50A 2QLHA 2DDCA 5EB6A 3D78A 3CZ1A 3CD1A 4R1EA 4IL1A 4W6MA 2PRUA 2HQKA 4TZAA 3VRQA 4C0LA 5HZUA 4JKTA 5FI6A 3D10A 1XQMA 1ALWA 1W7UA 5DPHA 3P28A 3SG3A 1KSMA 2MAZA 1UHKA 2H9WA 1TNXA 2ISDA 4W7XA 2BE4A 3H1OA 3NT9A 2ZMWA 4OVNF 4KA9A 1SMGA 1YJFA 4M2OA 4H47A 2PASA 2KSPA 1TNPA 4W69A 1ZGPA 2I18A 4CFRA 2WISA 1NP8A 1EMGA 2M3WA 3S0DA 4W6IA 3SSHA 2AMIA 2VVJA 1IIOA 4JQ0D 4JF9A 1CMFA 4R6BA 1K94A 1F0BA 1M31A 1PALA 1X02A 2HQ8A 3IQOA 1B47A 4N1GA 3VB1A 5DY6A 2ZN8A 1FF1A 2OJKA 1N65A 1LINA 4W75A 1IQ5A 3KCTA 1MYWA 1SCMB 5JOLA 2IS9A 2GX2A 1CLMA 2WCFA 3IP2A 1B8LA 3R1PA 4EN1A 3TS5C 1IWQA 5BTTB 2Z6YA 2O5GA 5B8IB 4WQ2A 3SVDA 5LTQA 3DQNA 4LQUA 1U5IA 2WC5A 1UWOA 2H2KA 1JWDA 2WHSA 2IE2A 4UPGA 3KF9A 3V2LA 2LV7A 4MZKA 3DQAA 1KK7Y 1BR4B 1K2HA 4OCIA 5DU0A 1Z2CB 1QS7A 3PJ5A 3I5HC 5HKYA 3CFHA 3I5GC 3CD9A 3CGAA 3OX5A 2WIQA 2RGIA 3SS0A 1UURA 3JTDC 4JRBA 2JC2A 2LLSA 1QVIZ 3HX4A 2G16B 2NCPA 2A52B 3BXCA 1FI6A 3DPZA 3LK1A 1H4BA 4HREE 1WRKA 3I19A 3AKAA 3TMRA 3BX9A 3TZ1A 3SVOA 2OPOA 2L4HA 2L2EA 1DF0B 4FTGA 4PE4A 2ERBA 3B6XA 4DXMA 1FI5A 1HQVA 4P1QA 2F2PA 1EMCA 2COLB 3GL4A 1SNLA 2BKHB 3FWBA 1NPQA 1KQMC 1L2OC 3PN7B 1SRAA 1YHHA 3D73A 4EMQA 1QXPA 1SK6D 1TCFA 2LHIA 2FOTA 3DVKA 3LCPC 1SL8A 3DF0B 4YGAA 2YE0A 4HQ9A 1QXTA 3LF4B 2VZXA 4C0JA 1B8RA 4JGEA 2VAEA 2LVIA 2DD9A 4USLA 3U8CA 3GK2A 4GGFA 4GGFC 2PMYA 1SCMC 3S0AA 3DQHA 2A48A 2TN4A 1ZOTB 3CR4X 3MGFA 1XA5A 1Y6WA 1XFXO 4YRUA 1AK8A 2F8PA 2JT8A 2LAPA 1EMFA 1LXFC 3OBVA 5FVGA 3DVJA 4IK4A 5FHVA 1AHRA 4NQGA 1KFUS 3AAKA 1QV0A 4KW8A 3WHTB 3SVCA 2ICRA 3RWAA 2KYCA 2H61A 1JC1A 1CM1A 4GAOA 2PVBA 1KQVA 3GEXA 1Q80A 5DICA 3S0GA 5DTXA 3TMTA 3DQUA 4DXIA 4LJBA 4W6KA 1LVCD 5HKZA 2JULA 4OGSA 1OSAA 1S5GY 3CDNA 1CLLA 1GM0A 2DUFA 2G2BA 2KLEA 2KNEA 2A4JA 4OJ0A 2CNPA 3DD4A 1WRLA 4MZJA 3PSRA 3EK7A 5EB7A 1S6ZA 3PFVA 2H5RA 1W7JB 3EVVA 1SL9A 5AFPA 5HYDA 3DQ5A 4PPJA 4ORBB 2BNXA 4KW9A 2QEHA 2FCDA 3V3DA 2Y1NA 1RMPA 3SG4A 4GFTA 3NSIA 2G6XA 1H4UA 1KYPA 3LK0A 5EXCI 2LMVA 3DQ8A 3UO9A 4PDZA 2QPTA 1QWVA 3LVAA 1BR1B 2AWJA 4YGEB 2HPWA 1Y1XA 4XJKB 4DUQA 3SIBA 3SVUA 1C7WA 1YX8A 4DRWA 1CDNA 1Y1AA 2IB5A 3F45A 1BU3A 4DKNA 1QASA 3NXAA 1S1EA 2M1KB 1CMGA 3NEDA 1GQMA 4W6FA 2BCAA 4WRIA 3ADFA 2WCKA 1MR8A 2WCHA 2F2OA 1E8AA 4XYNA 1JBZA 1DJGA 4GPLB 3DQIA 2JPOA 2L51A 2JNFA 2I94A 1JFJA 1AJ5A 4QJ5B 2GTEA 4XOWA 3B87A 1PVBA 3LLEA 2EMDA 2WHTA 2L98A 3SVRA 2P6BB 2QZ0A 3IVTA 4GUKA 2CBLA 1QX7A 3PM8A 3S0FA 2PALA 3L4LA 2Y0GA 1BOCA 3O4XA 1XFVO 3CZ0A 3BQ3A 3IQQA 2BBNA 4YBHB 4HRHA 2OGRA 4Q9WA 3N7HA 2ZKMX 2ZO6A 3EKJA 1NX1A 2L5XB 1MUXA 2JRFA 2JT3A 3B88A 5KTGA 4KGEA 2MJWB 3TS5B 1AP4A 1A4PA 2KPHA 1Z1PA 1BF5A 4W6GA 1HT9A 1C3ZA 1U5IB 2KI4C 4JD9A 3CFAA 4PE1A 1DTLA 1W9ZA 4HRGA 1CV7A 5BT0A 1UHJA 1UHHA 4L9MA 3I5GB 3VGOA 3PALA 3JTDB 2H8QA 1J7RA 3DQ1A 5I8NA 1SPYA 3EG5B 3U0LA 4I2YA 1KWOC 2DUHA 1G33A 2F3ZA 5CSIA 1SBJA 4MZLA 3E5WA 4ANJA 4PHJA 4DXPA 2K7OA 1GL4A 1QX2A 5J2OA 1YHGA 5G08A 4IK1A 2KQYA 2JOJA 4W6NA 1K93D 5F6TA 1JC0A 2AWMA 1F8HA 1R6PA 4U2VA 2KI6C 4PALA 1NWDA 1YRUB 1IRJA 2SASA 3CZTX 5EXBA 2KYFA 1XMZA 1KQMB 1TRFA 1L2OB 2V4EA 1MF8B 2KAVA 5BQLA 2V4EC 1DJWA 2G9BA 4AOMA 1IJ5A 3SS4A 2V53A 1F70A 1XAEA 4XVPA 1LS8A 1OOIX 2PSRA 1YX7A 2CTNA 4ZINA 3I5IC 2M7LA 1RWYA 3DQMA 2BCBA 5AXIA 1KFXS 4M2QA 3DY9A 2DD7A 3NGVA 3PJIA 2VADA 1HCJA 5D3OA 3UG0A 1B8CA 2P4MA 2HGDA 2LCPA 1PSBA 4QJ3B 5HBDA 2KLDA 3A4UB 2YE1A 5J3XA 2G6EA 1TWOA 1IQ3A 1A2XA 1UHIA 1DGUA 2BL0B 2OTBA 2KFHA 2L4IA 4AQJA 5H87A 4ZIOA 2E30A 5BPJA 1W7SA 3DQJA 2JTTA 4NDBA 5LK4A 1PVAA 2YDZA 1ZACA 4XL5A 2JTZA 4W6BA 2EGDA 1T14A 1MXLC 3SVEA 2KI6D 2K7DA 1OXFA 4W6TA 3CLNA 4ZCVA 4C0KA 5KSZA 3GJ2A 5HZOA 3SSTA 2HCGA 1XVJA 1KFXL 1PRWA 3PLFB 4RTCA 3DQ9A 3DPWA 1QYFA 5H88A 4B5YA 3CYZA 3GJ1A 2KAXA 2WC6A 3BXAA 3S0BA 3VHTA 3TDIA 5FVIA 4FQOA 5HKWA 3BJHA 4Q9XA 1YZWA 5EHUA 1M46A 4OZDA 2K2AA 2AHAA 2Z1OA 2WNDA 4KF4A 1H8BA 1CLBA 3W1DA 1DJXA 2WCJA 2K7BA 5PALA 1DEKA 2GGMA 1WLZA 2JZIA 2M0RA 4Z4KA 1NSHA 4MRXA 1J7OA 1CFDA 4Z4MA 2Y4QA 2BTJA 1K96A 2KBMA 4ZF3A 1XFUO 4ZF5A 2DOQA 1CFPA 2KFFA 1NIWA 3EVUA 3C1VA 1CTRA 4OKHA 3O78A 1YVLA 1BFPA 3ZWHA 2BBMA 2H8VA 1OOFA 5DKRA 4EDSA 1QY3A 3WNXB 3EVPA 1QLKA 1B7TY 2NXQA 4RYSA 3D74A 1TTXA 4PFEA 1R2UA 4W6DA 4KW4A 2KDHA 2GX0A 3S0EA 5ER4X 1SR6B 3RWTA 3ZNIA 4NDCA 1JBYA 1BMOA 2WURA 2GV5A 1S26D 4DS7A 3HCMA 3O4YA 1DC1A 4IK3A 3ICBA 1CM4A 3TUYB 1JSAA 5I2QA 3SV5A 2DUIA 1Y1UA 3A8SA 3LL8B 4HE4A 4PPLA 1BODA 4A4CA 1H6RA 1F09A 4BY5A 3D75A 5EBJA 2BL0C 2H5QA 1EJ3A 1NX2A 4Q7TA 1C07A 5DRFA 1CB1A 1RM9A 1CDPA 3NT3A 3SSKA 3BFAA 1OZOA 1BG1A 1TOPA 3CWGA 2MA2A 5HL1A 2JU0A 4YGBB 2MLEC 1C3YA 2MLFC 3B86A 1B4CA 1PK0D 2O29A 5CSNA 4W7RA 1EMAA 1DVIA 1G8IA 2LE9B 1IJ6A 1N0YA 3PJ7A 4YGDB 4MLWA 4GESB 1JFKA 3IF7A 2O24A 3JVTB 1EH2A 1YUUA 3LVDA 3DQCA 2H61C 3SSPA 5D69A 4IZNA 1J7QA 3BUNB 4QJ4B 2BCXA 1ZGOA 2A46A 3NF0A 3NEZA 4P2YB 5CSFA 3R1OA 4FQTA 4ORAB 3WLDA 2L5YA 3VRPA 2LNKA 1IGVA 1GFLA 1ALVA 1MOVA 4MSPA 1EMEA 1YFPA 1EXRA 3GB3A 5LTRA 1TN4A 4W7FA 1SL7A 5T3IA 3U8PA 3BOWA 2VRGA 4AR7A 4DXQA 2ZFDA 1RROA 2KGBC 4JFGA 2WOSA 3S05A 2KI4B 1Q4BA 1Y0VH 1FBVA 2LM5A 2M7NA 2Z6XA 4EULA 1N2DA 2BE6A 1XFYO 1NCZA 3BUOB 3B7AA 3O2PA 2CXJA 2Y1MA 5DTYA 3EK4A 2LLUA 1CFCA 4N3DA 3O6BA 2K0JA 2OKYA 3MSEB 3OGNA 1K95A 3BXBA 3SVBA 1TNQA 3O77A 1KWOB 2DUEA 4BY4A 3U8AA 1TNWA 1UP5A 2EMOA 5EJUA 4W6CA 1F4QA 1QX5B 2GW3A 4WQ3A 4W7AA 4IJ7A 3UNWA 1SR6C 4DXNA 2B3QA 3LVCA 4KPIA 2NZ0A 3M22A 2HF5A 3AKBA 2HETA 2WCMA 2P70A 2MHHA 4OV2A 3SSYA 2BAPA 2OTGC 3P8UA 5FVFA 3TUYC 1YVHA 3SG6A 1MOUA 5HZSA 3H1RA 1KK7Z 4ICBA 5D7FA 2WHUA 3Q8IA 1QYQA 4GF6B 2M9GA 5DKNA 2H5OA 2G3OA 2V4EB 2Y5IA 2K7CA 1K8UA 2PQLA 4W72A 3AKOA 4W7EA 3KCSA 2KFGA 5AERA 1EMLA 3I5IB 5LTPA 1QVIY 3L4AA 2QEBA 4KYNA 3KEVA 1L7ZA 4ORCB 1A03A 4F0ZB 1GGXA 1DJIA 4I5KA 3DVEA 1W7IB 3DVMA 3RM1A 4N5XA 2ZNEA 4J8AA 1SCVA 4W6SA 4IK8A 4H3MA 5DTLA 1NCYA 1Q4CA 2Q4UA 1DT7B 3I5FC 3JVTC 4AS8A 1RFJA 1F71A 4D1EA 1BJFA 4W76A 4MRYA 2NCOA 1MXEA 5GQQC 1QIWA 2B3PA 1JF0A 2P71A 3U0KA 1OOHA 4E68A 1M39A 1K9KA 1B9AA 1IKUA 2EC6C 2LMUA 5KTYA 2JXCA 2K2FA 1IH0A 3AI5A 1PULA 4HQCA 1WY9A 2JADA 3CBEA 2M97A 4JPZB 2QACA 3DYEA 2HRSA 2AH8A 2K60A 3U0NA 5DQMA 3WCKA 3WXAA 2OTEA 2G6YA 4P76A 1ORGA 4XOVA 4ZCUA 1WDCC 1LA3A 4DXOA 4LJCA 4BDUA 3VHTB 1C4FA 2LC5A 1ODBA 1JBAA 2QLGA 2WC8A 3M0WA 2LVJA 3NHIA 1CNPA 1DELA 3SSLA 3DQDA 1SW8A 3VROA 1UHNA 3VRNA 1EL4A 1V1GA 3DQKA 2CCMA 1DJYA 5HLVA 2O2BA 1D1OA 5H89A 2H5PA 4HQ8A 2KHNA 1YTZC 2HQZA 4YI9A 3QRXA 4M2PA 1GJYA 3NSKA 3M24A 2YGUA 3SG5A 2JT0A 1MQ1A 2EHBA 2D8NA 2QLEA 2SCPA 4Q7RA 4R6DA 2HPSA 1QTXA 3G9AA 3CABA 4CLNA 3ZUFA 1ZMZA 2KGRA 2KQ6A 1TUZA 1S5GZ 2GW4B 2LMTA 2OS8C 1QLSA 4DKMA 2OKWA 1KCYA 1OZSA 1J7PA 5JJGA 2VVIA 3CB9A 2YFPA 1CDLA 1CKKA 2G5ZB 1Q4EA 2HFCA 5HLOA 3BUWB 4EDOA 1JC2A 1OE9B 1XYDA 1KK8C 2Q57A 3H4SE 1K9PA 5AEQA 4W77A 1ZFSA 1NCXA 1IG5A 4L13A 1PSRA 1WRZA 1QATA 2JQ6A 1YR5A 1BT6A 5DPGA 3CFFA 4XGYA 2FWQA 4CFQA 2AUCA 1WLMA 4INWA 5EL2A 4LW5A 4PHNA 1ZUZA 1KYRA 1S36A 5CSJA 2Q91A 4J88A 1DJZA 4NWSA 1XFRA 3TDUA 2EMNA 1UUSA 4DCKA 1TIZA 4OQWA 4PE7A 3D0YA 2B1UA 5CPVA 2AWLA 4ETOA 3ED8A 3PATA 3QMEA 3TDZA 2A54B 1LKJA 3R72A 2C9JA 1NX3A 5HZTA 4LQTA 1OOJA 3DQ4A 1XO5A 3NHTA 5HGEA 1CDMA 2L0PA 3FIAA 1A75A 3OX6A 2WCBA 2CT9A 4LJDA 4PPKA 3ST4A 3DQOA 4LJDC 4B30A 3ZULA 2LUXA 1AVSA 3BOWB 2F3YA 1K90D 1GGZA 1S6IA 5KU1A 4H48A 1MWNA 3KO0A 2FZUA 4GNKB 4NDDA 3SG7A 1SSEB 3OHMB 1UISA 2H6VA 2JXLA 1EMKA 1RJVA 1EG3A 2LUCA 1SYMA 3OSQA 4P5OE 4L12A 2FL1A 1B9CA 3DQLA 3GK4X 2IOVA 1QJTA 4MBEA 3IR8A 4KF5A 4A4BA 3DQ3A 4ZFSA 1SKTA 3ST3A 1OMVA 2G2SB 1ZUXA 4KF5C 1OMRA 1F4OA 2ARLA 2A53B 4IK5A 2LANA 5AANA 4N1FA 2PXSA 5I94A 4ZBLA 4OY4A 2IB6A 4KEXA 1MHOA 3U0MA 4KGFA 4MEWA 4PE0A 3SG2A 3WLCA 4OR9B 2OTGB 1TCOB 3DQ7A 1BLQA 2LHLA 2QEOA 2ZMUA 1SY9A 3VRRA 4I5LB 4W6JA 2QDIA 3SVSA 2Z6ZA 2LP2A 1AUIB 2ZN9A 3K1KA 1DGVA 4GBAA 3LSAA 4HSZA 3ST0A 5FI2A 2ZRSA 1OXEA 2I7AA 3BUMB 5DQBA 3NSLA 2AAOA 2QEVA 1JF2A 1HUYA 4IK9A 3OGOA 3K21A 3FE6A 4ORNA 1OOGA 3WHUB 2WCLA 3CS1A 3FE8A 1XFWO 1B1GA 2KOTA 3NSOA 3KHEA 4W74A 2R2IA 2K8MB 4HVFA 5BTTA 3DQEA 2O60A 1LA0A 2BKIB 5K89A 3BFHA 3I5FB 1G4YR 2HJOA 1FPWA 2AWKA 3OP0A 1XK4A 1RTP1 3CGLA 1XK4C 3ST2A 1DQEA 3DZTA 2F33A 1KSOA 2ZNDA 4I5NB 3BYAA 3D77A 2A50B 3SS5A 4H3NA 2QRFA 2WSNA 2JPTA 3DQFA 2ZO7A 1OMDA 5FYXA 3AAJA 4W7CA 4DIRA 5I2OA 3OB2B 1M63B 2JWWA 2PXWA 3CTNA 2EC6B 2DUGA 1S3PA 2LLTA 4UTSA 3UFZA 4YI8A 1JUOA 4W73A 2M29A 3A8RA 4CIDA 3PIBA 1J55A 3D76A 2RH7A 1S6JA 2Q6PA 3ZUJA 1VRKA 2M49B 1Z1QA 1OW4A 3VICA 4U8DA 1RMMA 1J1DA 1OXDA 3CR5X 3SSVA 1DF0A 5HW9A 1WDCB 3FS7A 2E6WA 3LF3A 3EVRA 3E3RA 1KFUL 1NYAA 3SIAA 1RECA 1XFZO 2WORA 2QLGB 2JNXA 3FE9A 1KYSA 3OSRA 1EG4A 4JEOA 4Q7UA 1QV1A 2ZRTA 5AQBB 3PN7C 1M45A 3DPXA 1YUSA 2A56B 1CFFA 3PM2A 2DDDA 4JC2A 1K9UA 4L1IA 3BFBA 1Q4DA 3DF0A 3W1CA 4H3LA 2QU1A 3ZTFA 1W7TA 5DTZA 2M1UA 3VK1A 1YRTB 1P28A 2FJYA 1RRXA 2GGZA 3KPXA 4MVFA 4Q04A 3SVNA 3AI4A 2FJUB 3RLZA 2NLNA 2POXA 4W6PA 1Z4HA 1EMMA 2KBIA 2OS8B 4CPVA 4AQIA 1A29A 2VVHA 1YURA 4PHKA 1RMOA 2L2CA 4KAGA 3E5VA 2M8UA 4PT1A 1QIVA 1EMBA 2A47A 4W6LA 1NX0A 4GGNA 3BXKA 2LVKA 3DQ2A
chains in the Genus database with same CATH topology
4OHSA 1DMOA 1KK8B 1OQPA 4W6AA 1GGWA 3FWCA 1F55A 1FW4A 5F9GA 4YGCB 5I2LA 2LP3A 3SRYA 4TNCA 1NUBA 1YHIA 1KP5A 1XA9A 1AJ4A 4ZB1A 1C7VA 3CR2A 1B7TZ 1DJHA 1G7KA 4W7DA 1Q73A 3EK8A 2I2RE 3LA1A 5EXUA 1F54A 2HQWA 1YUTA 2WCEA 1ZGQA 2QLIA 4MN0A 5DKQA 2K61A 2FCEA 3LS3A 3GK1A 4J89A 5ER5A 4JWQA 3D0YB 1XSSA 2MRDA 2HGYA 3PJBA 1V1FA 3GOFA 3E5TA 2BECA 4W6OA 5DRGA 1RK9A 2KAYA 5DPIA 3BUXB 2C9IA 4ZF4A 4I5JA 2MBXA 1Q4AA 1A75B 2QT2A 3I5HB 5TNCA 1S6CA 2G3DB 4B30B 1YJ2A 1J1EA 3SJSA 4W6RA 3DQ6A 1QYOA 4W6UA 4PCWA 5IBWA 4RYWA 4PHMA 5DPJA 4TZGA 3OB1B 2WSOA 3EKHA 2LVVA 4W6HA 4XJKA 4GOBA 2L50A 2QLHA 2DDCA 5EB6A 3CD1A 4R1EA 4IL1A 4W6MA 2PRUA 2HQKA 4TZAA 3VRQA 4C0LA 5HZUA 3D10A 1XQMA 1ALWA 1W7UA 5DPHA 3P28A 3SG3A 1KSMA 2MAZA 1UHKA 2H9WA 1TNXA 2ISDA 4W7XA 2BE4A 3H1OA 3NT9A 2ZMWA 4OVNF 4KA9A 1SMGA 1YJFA 4M2OA 4H47A 2PASA 2KSPA 1TNPA 4W69A 1ZGPA 2I18A 4CFRA 2WISA 1NP8A 1EMGA 2M3WA 4W6IA 3SSHA 2AMIA 2VVJA 4JQ0D 4JF9A 1CMFA 4R6BA 1K94A 1F0BA 1M31A 1PALA 1X02A 2HQ8A 3IQOA 1B47A 4N1GA 5DY6A 2ZN8A 1FF1A 2OJKA 1N65A 1LINA 4W75A 1IQ5A 3KCTA 1MYWA 1SCMB 5JOLA 2IS9A 2GX2A 1CLMA 2WCFA 3IP2A 1B8LA 4EN1A 3TS5C 1IWQA 5BTTB 2Z6YA 2O5GA 5B8IB 4WQ2A 3SVDA 5LTQA 3DQNA 4LQUA 1U5IA 1UWOA 2H2KA 1JWDA 2WHSA 2IE2A 4UPGA 3KF9A 2LV7A 4MZKA 3DQAA 1KK7Y 1BR4B 1K2HA 4OCIA 5DU0A 1QS7A 3PJ5A 3I5HC 5HKYA 3CFHA 3I5GC 3CD9A 3CGAA 3OX5A 2WIQA 2RGIA 3SS0A 1UURA 3JTDC 4JRBA 2JC2A 2LLSA 1QVIZ 3HX4A 2G16B 2NCPA 2A52B 3BXCA 1FI6A 3DPZA 3LK1A 1H4BA 4HREE 1WRKA 3I19A 3AKAA 3TMRA 3BX9A 3TZ1A 3SVOA 2OPOA 2L4HA 2L2EA 1DF0B 4FTGA 4PE4A 4DXMA 1FI5A 1HQVA 4P1QA 2F2PA 1EMCA 2COLB 3GL4A 1SNLA 2BKHB 3FWBA 1NPQA 1KQMC 1L2OC 3PN7B 1SRAA 1YHHA 4EMQA 1QXPA 1SK6D 1TCFA 2LHIA 2FOTA 3DVKA 3LCPC 1SL8A 3DF0B 4YGAA 2YE0A 4HQ9A 1QXTA 3LF4B 2VZXA 4C0JA 1B8RA 4JGEA 2VAEA 2LVIA 2DD9A 4USLA 3U8CA 3GK2A 4GGFA 4GGFC 2PMYA 1SCMC 3DQHA 2A48A 2TN4A 1ZOTB 3CR4X 3MGFA 1XA5A 1Y6WA 1XFXO 4YRUA 1AK8A 2F8PA 2JT8A 2LAPA 1EMFA 1LXFC 5FVGA 3DVJA 4IK4A 5FHVA 1AHRA 4NQGA 1KFUS 3AAKA 1QV0A 4KW8A 3WHTB 3SVCA 2ICRA 3RWAA 2KYCA 2H61A 1JC1A 1CM1A 4GAOA 2PVBA 1KQVA 3GEXA 1Q80A 5DTXA 3TMTA 3DQUA 4DXIA 4LJBA 4W6KA 1LVCD 5HKZA 2JULA 4OGSA 1OSAA 1S5GY 1CLLA 2DUFA 2G2BA 2KNEA 2A4JA 4OJ0A 2CNPA 3DD4A 1WRLA 4MZJA 3PSRA 3EK7A 5EB7A 1S6ZA 3PFVA 2H5RA 1W7JB 3EVVA 1SL9A 5AFPA 5HYDA 3DQ5A 4PPJA 4ORBB 4KW9A 2FCDA 3V3DA 2Y1NA 1RMPA 3SG4A 4GFTA 3NSIA 2G6XA 1H4UA 1KYPA 3LK0A 5EXCI 2LMVA 3DQ8A 4PDZA 2QPTA 3LVAA 1BR1B 2AWJA 4YGEB 2HPWA 1Y1XA 4XJKB 4DUQA 3SIBA 3SVUA 1C7WA 1YX8A 4DRWA 1CDNA 1Y1AA 2IB5A 3F45A 1BU3A 4DKNA 1QASA 3NXAA 1S1EA 2M1KB 1CMGA 3NEDA 1GQMA 4W6FA 2BCAA 4WRIA 3ADFA 1MR8A 2F2OA 1E8AA 4XYNA 1JBZA 1DJGA 4GPLB 3DQIA 2L51A 2JNFA 2I94A 1JFJA 1AJ5A 4QJ5B 4XOWA 1PVBA 3LLEA 2EMDA 2WHTA 2L98A 3SVRA 2P6BB 2QZ0A 4GUKA 2CBLA 1QX7A 3PM8A 2PALA 2Y0GA 1BOCA 1XFVO 3BQ3A 3IQQA 2BBNA 4YBHB 4HRHA 2OGRA 4Q9WA 2ZKMX 2ZO6A 3EKJA 1NX1A 2L5XB 1MUXA 2JRFA 2JT3A 5KTGA 4KGEA 2MJWB 3TS5B 1AP4A 1A4PA 1Z1PA 1BF5A 4W6GA 1HT9A 1U5IB 2KI4C 3CFAA 4PE1A 1DTLA 4HRGA 1CV7A 5BT0A 1UHJA 1UHHA 4L9MA 3I5GB 3VGOA 3PALA 3JTDB 2H8QA 1J7RA 3DQ1A 5I8NA 1SPYA 3U0LA 4I2YA 1KWOC 2DUHA 1G33A 2F3ZA 5CSIA 1SBJA 4MZLA 3E5WA 4ANJA 4PHJA 4DXPA 2K7OA 1GL4A 1QX2A 5J2OA 1YHGA 5G08A 4IK1A 2KQYA 2JOJA 4W6NA 1K93D 5F6TA 1JC0A 2AWMA 1F8HA 1R6PA 4U2VA 2KI6C 4PALA 1NWDA 1YRUB 1IRJA 2SASA 3CZTX 5EXBA 2KYFA 1XMZA 1KQMB 1TRFA 1L2OB 2V4EA 1MF8B 2KAVA 5BQLA 2V4EC 1DJWA 2G9BA 4AOMA 1IJ5A 2V53A 1F70A 1XAEA 4XVPA 2PSRA 1YX7A 2CTNA 4ZINA 3I5IC 2M7LA 1RWYA 3DQMA 2BCBA 5AXIA 1KFXS 4M2QA 2DD7A 2VADA 1HCJA 3UG0A 1B8CA 2P4MA 2HGDA 2LCPA 1PSBA 4QJ3B 5HBDA 3A4UB 2YE1A 5J3XA 2G6EA 1IQ3A 1A2XA 1UHIA 1DGUA 2BL0B 2OTBA 2KFHA 2L4IA 4AQJA 5H87A 4ZIOA 2E30A 5BPJA 1W7SA 3DQJA 2JTTA 4NDBA 5LK4A 1PVAA 2YDZA 1ZACA 4XL5A 2JTZA 4W6BA 2EGDA 1MXLC 3SVEA 2KI6D 2K7DA 1OXFA 4W6TA 3CLNA 4ZCVA 4C0KA 5KSZA 3GJ2A 5HZOA 3SSTA 2HCGA 1XVJA 1KFXL 1PRWA 3PLFB 4RTCA 3DQ9A 3DPWA 1QYFA 5H88A 4B5YA 3GJ1A 2KAXA 3BXAA 3VHTA 3TDIA 5FVIA 4FQOA 5HKWA 4Q9XA 1YZWA 5EHUA 1M46A 2K2AA 2AHAA 2Z1OA 2WNDA 4KF4A 1H8BA 1CLBA 3W1DA 1DJXA 2K7BA 5PALA 2GGMA 1WLZA 2JZIA 2M0RA 4Z4KA 1NSHA 4MRXA 1J7OA 1CFDA 4Z4MA 2Y4QA 2BTJA 1K96A 2KBMA 4ZF3A 1XFUO 4ZF5A 2DOQA 1CFPA 2KFFA 1NIWA 3EVUA 3C1VA 1CTRA 4OKHA 3O78A 1YVLA 1BFPA 3ZWHA 2BBMA 5DKRA 4EDSA 1QY3A 3WNXB 3EVPA 1QLKA 1B7TY 2NXQA 4RYSA 1TTXA 4PFEA 1R2UA 4W6DA 4KW4A 2KDHA 2GX0A 5ER4X 1SR6B 3RWTA 3ZNIA 4NDCA 1JBYA 1BMOA 2WURA 2GV5A 1S26D 4DS7A 3HCMA 3O4YA 4IK3A 3ICBA 1CM4A 3TUYB 1JSAA 5I2QA 3SV5A 2DUIA 1Y1UA 3A8SA 3LL8B 4HE4A 4PPLA 1BODA 4A4CA 1H6RA 1F09A 4BY5A 5EBJA 2BL0C 2H5QA 1EJ3A 1NX2A 4Q7TA 1C07A 5DRFA 1CB1A 1RM9A 1CDPA 3NT3A 3SSKA 1OZOA 1BG1A 1TOPA 3CWGA 2MA2A 2JU0A 4YGBB 2MLEC 2MLFC 1B4CA 1PK0D 2O29A 5CSNA 4W7RA 1EMAA 1DVIA 1G8IA 2LE9B 1IJ6A 1N0YA 3PJ7A 4YGDB 4MLWA 4GESB 1JFKA 3IF7A 2O24A 3JVTB 1EH2A 1YUUA 3LVDA 3DQCA 2H61C 3SSPA 5D69A 4IZNA 1J7QA 3BUNB 4QJ4B 2BCXA 1ZGOA 2A46A 3NF0A 3NEZA 4P2YB 5CSFA 4ORAB 3WLDA 3VRPA 2LNKA 1IGVA 1GFLA 1ALVA 1MOVA 4MSPA 1EMEA 1YFPA 1EXRA 3GB3A 5LTRA 1TN4A 4W7FA 1SL7A 5T3IA 3U8PA 3BOWA 2VRGA 4AR7A 4DXQA 2ZFDA 1RROA 2KGBC 4JFGA 2WOSA 3S05A 2KI4B 1Q4BA 1Y0VH 1FBVA 2LM5A 2M7NA 2Z6XA 4EULA 1N2DA 2BE6A 1XFYO 1NCZA 3BUOB 3O2PA 2CXJA 2Y1MA 5DTYA 3EK4A 2LLUA 1CFCA 4N3DA 3O6BA 2K0JA 2OKYA 3MSEB 1K95A 3BXBA 3SVBA 1TNQA 3O77A 1KWOB 2DUEA 4BY4A 3U8AA 1TNWA 1UP5A 2EMOA 5EJUA 4W6CA 1F4QA 1QX5B 2GW3A 4WQ3A 4W7AA 1SR6C 4DXNA 2B3QA 3LVCA 4KPIA 2NZ0A 3M22A 2HF5A 3AKBA 2HETA 2MHHA 4OV2A 3SSYA 2OTGC 3P8UA 5FVFA 3TUYC 1YVHA 3SG6A 1MOUA 5HZSA 3H1RA 1KK7Z 4ICBA 5D7FA 2WHUA 1QYQA 4GF6B 2M9GA 5DKNA 2H5OA 2G3OA 2V4EB 2Y5IA 2K7CA 1K8UA 4W72A 3AKOA 4W7EA 3KCSA 2KFGA 5AERA 1EMLA 3I5IB 5LTPA 1QVIY 3KEVA 1L7ZA 4ORCB 1A03A 4F0ZB 1GGXA 1DJIA 4I5KA 3DVEA 1W7IB 3DVMA 3RM1A 4N5XA 2ZNEA 4J8AA 1SCVA 4W6SA 4IK8A 4H3MA 5DTLA 1NCYA 1Q4CA 2Q4UA 1DT7B 3I5FC 3JVTC 4AS8A 1RFJA 1F71A 4D1EA 1BJFA 4W76A 4MRYA 2NCOA 1MXEA 5GQQC 1QIWA 2B3PA 1JF0A 3U0KA 4E68A 1M39A 1K9KA 1B9AA 1IKUA 2EC6C 2LMUA 5KTYA 2JXCA 2K2FA 1IH0A 3AI5A 1PULA 4HQCA 1WY9A 2JADA 3CBEA 2M97A 4JPZB 2QACA 2HRSA 2AH8A 3U0NA 5DQMA 3WCKA 3WXAA 2OTEA 2G6YA 4P76A 4XOVA 4ZCUA 1WDCC 1LA3A 4DXOA 4LJCA 4BDUA 3VHTB 1C4FA 2LC5A 1ODBA 1JBAA 2QLGA 2WC8A 3M0WA 2LVJA 1CNPA 3SSLA 3DQDA 1SW8A 3VROA 1UHNA 3VRNA 1EL4A 1V1GA 3DQKA 2CCMA 1DJYA 5HLVA 2O2BA 1D1OA 5H89A 2H5PA 4HQ8A 2KHNA 1YTZC 2HQZA 4YI9A 3QRXA 4M2PA 1GJYA 3NSKA 3M24A 3SG5A 2JT0A 1MQ1A 2EHBA 2D8NA 2QLEA 2SCPA 4Q7RA 4R6DA 2HPSA 1QTXA 3G9AA 4CLNA 3ZUFA 1ZMZA 2KGRA 2KQ6A 1S5GZ 2GW4B 2LMTA 2OS8C 1QLSA 4DKMA 2OKWA 1KCYA 1OZSA 1J7PA 5JJGA 2VVIA 3CB9A 2YFPA 1CDLA 1CKKA 2G5ZB 1Q4EA 2HFCA 5HLOA 3BUWB 4EDOA 1JC2A 1OE9B 1XYDA 1KK8C 2Q57A 3H4SE 1K9PA 5AEQA 4W77A 1ZFSA 1NCXA 1IG5A 4L13A 1PSRA 1WRZA 1QATA 2JQ6A 1YR5A 1BT6A 5DPGA 3CFFA 4XGYA 2FWQA 4CFQA 2AUCA 1WLMA 4LW5A 4PHNA 1ZUZA 1KYRA 1S36A 5CSJA 2Q91A 4J88A 1DJZA 4NWSA 3TDUA 2EMNA 1UUSA 4DCKA 1TIZA 4OQWA 4PE7A 3D0YA 2B1UA 5CPVA 2AWLA 4ETOA 3ED8A 3PATA 3TDZA 2A54B 1LKJA 2C9JA 1NX3A 5HZTA 4LQTA 1OOJA 3DQ4A 1XO5A 5HGEA 1CDMA 2L0PA 3FIAA 1A75A 3OX6A 2WCBA 2CT9A 4LJDA 4PPKA 3ST4A 3DQOA 4LJDC 4B30A 3ZULA 2LUXA 1AVSA 3BOWB 2F3YA 1K90D 1GGZA 1S6IA 5KU1A 4H48A 1MWNA 3KO0A 2FZUA 4GNKB 4NDDA 3SG7A 3OHMB 1UISA 2H6VA 2JXLA 1EMKA 1RJVA 1EG3A 2LUCA 1SYMA 3OSQA 4P5OE 4L12A 2FL1A 1B9CA 3DQLA 3GK4X 2IOVA 1QJTA 4MBEA 3IR8A 4KF5A 4A4BA 3DQ3A 4ZFSA 1SKTA 3ST3A 1OMVA 2G2SB 1ZUXA 4KF5C 1OMRA 1F4OA 2ARLA 2A53B 4IK5A 2LANA 5AANA 4N1FA 2PXSA 4ZBLA 4OY4A 2IB6A 4KEXA 1MHOA 3U0MA 4KGFA 4MEWA 4PE0A 3SG2A 3WLCA 4OR9B 2OTGB 1TCOB 3DQ7A 1BLQA 2LHLA 2ZMUA 1SY9A 3VRRA 4I5LB 4W6JA 3SVSA 2Z6ZA 2LP2A 1AUIB 2ZN9A 3K1KA 1DGVA 4GBAA 3LSAA 4HSZA 3ST0A 2ZRSA 1OXEA 2I7AA 3BUMB 5DQBA 3NSLA 2AAOA 1JF2A 1HUYA 4IK9A 3OGOA 3K21A 4ORNA 3WHUB 3CS1A 1XFWO 1B1GA 2KOTA 3NSOA 3KHEA 4W74A 2R2IA 2K8MB 4HVFA 5BTTA 3DQEA 2O60A 1LA0A 2BKIB 5K89A 3I5FB 1G4YR 2HJOA 1FPWA 2AWKA 3OP0A 1XK4A 1RTP1 3CGLA 1XK4C 3ST2A 2F33A 1KSOA 2ZNDA 4I5NB 3BYAA 2A50B 4H3NA 2QRFA 2WSNA 2JPTA 3DQFA 2ZO7A 1OMDA 5FYXA 3AAJA 4W7CA 4DIRA 5I2OA 3OB2B 1M63B 2JWWA 2PXWA 3CTNA 2EC6B 2DUGA 1S3PA 2LLTA 4UTSA 3UFZA 4YI8A 1JUOA 4W73A 2M29A 3A8RA 4CIDA 3PIBA 1J55A 2RH7A 1S6JA 2Q6PA 3ZUJA 1VRKA 2M49B 1Z1QA 3VICA 4U8DA 1RMMA 1J1DA 1OXDA 3CR5X 3SSVA 1DF0A 5HW9A 1WDCB 3FS7A 2E6WA 3LF3A 3EVRA 3E3RA 1KFUL 1NYAA 3SIAA 1RECA 1XFZO 2WORA 2QLGB 2JNXA 1KYSA 3OSRA 1EG4A 4JEOA 4Q7UA 1QV1A 2ZRTA 5AQBB 3PN7C 1M45A 3DPXA 1YUSA 2A56B 1CFFA 2DDDA 4JC2A 1K9UA 4L1IA 1Q4DA 3DF0A 3W1CA 4H3LA 2QU1A 3ZTFA 1W7TA 5DTZA 2M1UA 3VK1A 1YRTB 1RRXA 2GGZA 3KPXA 4MVFA 4Q04A 3SVNA 3AI4A 2FJUB 3RLZA 2NLNA 2POXA 4W6PA 1EMMA 2KBIA 2OS8B 4CPVA 4AQIA 1A29A 2VVHA 1YURA 4PHKA 1RMOA 4KAGA 2M8UA 3E5VA 1QIVA 1EMBA 2A47A 4W6LA 1NX0A 4GGNA 3BXKA 2LVKA 3DQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OHS A;  1DMO A;  1KK8 B;  1OQP A;  4W6A A;  1GGW A;  3FWC A;  1F55 A;  1FW4 A;  5F9G A;  4YGC B;  5I2L A;  2LP3 A;  3SRY A;  4TNC A;  1NUB A;  1YHI A;  1KP5 A;  1XA9 A;  1AJ4 A;  4ZB1 A;  1C7V A;  3CR2 A;  1B7T Z;  1DJH A;  1G7K A;  4W7D A;  1Q73 A;  3EK8 A;  2I2R E;  3LA1 A;  5EXU A;  1F54 A;  2HQW A;  1YUT A;  2WCE A;  1ZGQ A;  2QLI A;  4MN0 A;  5DKQ A;  2K61 A;  2FCE A;  3LS3 A;  3GK1 A;  4J89 A;  5ER5 A;  4JWQ A;  3D0Y B;  1XSS A;  2MRD A;  2HGY A;  3PJB A;  1V1F A;  3GOF A;  3E5T A;  2BEC A;  4W6O A;  5DRG A;  1RK9 A;  2KAY A;  5DPI A;  3BUX B;  2C9I A;  4ZF4 A;  4I5J A;  2MBX A;  1Q4A A;  1A75 B;  2QT2 A;  3I5H B;  5TNC A;  1S6C A;  2G3D B;  4B30 B;  1YJ2 A;  1J1E A;  3SJS A;  4W6R A;  3DQ6 A;  1QYO A;  4W6U A;  4PCW A;  5IBW A;  4RYW A;  4PHM A;  5DPJ A;  4TZG A;  3OB1 B;  2WSO A;  3EKH A;  2LVV A;  4W6H A;  4XJK A;  4GOB A;  2L50 A;  2QLH A;  2DDC A;  5EB6 A;  3CD1 A;  4R1E A;  4IL1 A;  4W6M A;  2PRU A;  2HQK A;  4TZA A;  3VRQ A;  4C0L A;  5HZU A;  3D10 A;  1XQM A;  1ALW A;  1W7U A;  5DPH A;  3P28 A;  3SG3 A;  1KSM A;  2MAZ A;  1UHK A;  2H9W A;  1TNX A;  2ISD A;  4W7X A;  2BE4 A;  3H1O A;  3NT9 A;  2ZMW A;  4OVN F;  4KA9 A;  1SMG A;  1YJF A;  4M2O A;  4H47 A;  2PAS A;  2KSP A;  1TNP A;  4W69 A;  1ZGP A;  2I18 A;  4CFR A;  2WIS A;  1NP8 A;  1EMG A;  2M3W A;  4W6I A;  3SSH A;  2AMI A;  2VVJ A;  4JQ0 D;  4JF9 A;  1CMF A;  4R6B A;  1K94 A;  1F0B A;  1M31 A;  1PAL A;  1X02 A;  2HQ8 A;  3IQO A;  1B47 A;  4N1G A;  5DY6 A;  2ZN8 A;  1FF1 A;  2OJK A;  1N65 A;  1LIN A;  4W75 A;  1IQ5 A;  3KCT A;  1MYW A;  1SCM B;  5JOL A;  2IS9 A;  2GX2 A;  1CLM A;  2WCF A;  3IP2 A;  1B8L A;  4EN1 A;  3TS5 C;  1IWQ A;  5BTT B;  2Z6Y A;  2O5G A;  5B8I B;  4WQ2 A;  3SVD A;  5LTQ A;  3DQN A;  4LQU A;  1U5I A;  1UWO A;  2H2K A;  1JWD A;  2WHS A;  2IE2 A;  4UPG A;  3KF9 A;  2LV7 A;  4MZK A;  3DQA A;  1KK7 Y;  1BR4 B;  1K2H A;  4OCI A;  5DU0 A;  1QS7 A;  3PJ5 A;  3I5H C;  5HKY A;  3CFH A;  3I5G C;  3CD9 A;  3CGA A;  3OX5 A;  2WIQ A;  2RGI A;  3SS0 A;  1UUR A;  3JTD C;  4JRB A;  2JC2 A;  2LLS A;  1QVI Z;  3HX4 A;  2G16 B;  2NCP A;  2A52 B;  3BXC A;  1FI6 A;  3DPZ A;  3LK1 A;  1H4B A;  4HRE E;  1WRK A;  3I19 A;  3AKA A;  3TMR A;  3BX9 A;  3TZ1 A;  3SVO A;  2OPO A;  2L4H A;  2L2E A;  1DF0 B;  4FTG A;  4PE4 A;  4DXM A;  1FI5 A;  1HQV A;  4P1Q A;  2F2P A;  1EMC A;  2COL B;  3GL4 A;  1SNL A;  2BKH B;  3FWB A;  1NPQ A;  1KQM C;  1L2O C;  3PN7 B;  1SRA A;  1YHH A;  4EMQ A;  1QXP A;  1SK6 D;  1TCF A;  2LHI A;  2FOT A;  3DVK A;  3LCP C;  1SL8 A;  3DF0 B;  4YGA A;  2YE0 A;  4HQ9 A;  1QXT A;  3LF4 B;  2VZX A;  4C0J A;  1B8R A;  4JGE A;  2VAE A;  2LVI A;  2DD9 A;  4USL A;  3U8C A;  3GK2 A;  4GGF A;  4GGF C;  2PMY A;  1SCM C;  3DQH A;  2A48 A;  2TN4 A;  1ZOT B;  3CR4 X;  3MGF A;  1XA5 A;  1Y6W A;  1XFX O;  4YRU A;  1AK8 A;  2F8P A;  2JT8 A;  2LAP A;  1EMF A;  1LXF C;  5FVG A;  3DVJ A;  4IK4 A;  5FHV A;  1AHR A;  4NQG A;  1KFU S;  3AAK A;  1QV0 A;  4KW8 A;  3WHT B;  3SVC A;  2ICR A;  3RWA A;  2KYC A;  2H61 A;  1JC1 A;  1CM1 A;  4GAO A;  2PVB A;  1KQV A;  3GEX A;  1Q80 A;  5DTX A;  3TMT A;  3DQU A;  4DXI A;  4LJB A;  4W6K A;  1LVC D;  5HKZ A;  2JUL A;  4OGS A;  1OSA A;  1S5G Y;  1CLL A;  2DUF A;  2G2B A;  2KNE A;  2A4J A;  4OJ0 A;  2CNP A;  3DD4 A;  1WRL A;  4MZJ A;  3PSR A;  3EK7 A;  5EB7 A;  1S6Z A;  3PFV A;  2H5R A;  1W7J B;  3EVV A;  1SL9 A;  5AFP A;  5HYD A;  3DQ5 A;  4PPJ A;  4ORB B;  4KW9 A;  2FCD A;  3V3D A;  2Y1N A;  1RMP A;  3SG4 A;  4GFT A;  3NSI A;  2G6X A;  1H4U A;  1KYP A;  3LK0 A;  5EXC I;  2LMV A;  3DQ8 A;  4PDZ A;  2QPT A;  3LVA A;  1BR1 B;  2AWJ A;  4YGE B;  2HPW A;  1Y1X A;  4XJK B;  4DUQ A;  3SIB A;  3SVU A;  1C7W A;  1YX8 A;  4DRW A;  1CDN A;  1Y1A A;  2IB5 A;  3F45 A;  1BU3 A;  4DKN A;  1QAS A;  3NXA A;  1S1E A;  2M1K B;  1CMG A;  3NED A;  1GQM A;  4W6F A;  2BCA A;  4WRI A;  3ADF A;  1MR8 A;  2F2O A;  1E8A A;  4XYN A;  1JBZ A;  1DJG A;  4GPL B;  3DQI A;  2L51 A;  2JNF A;  2I94 A;  1JFJ A;  1AJ5 A;  4QJ5 B;  4XOW A;  1PVB A;  3LLE A;  2EMD A;  2WHT A;  2L98 A;  3SVR A;  2P6B B;  2QZ0 A;  4GUK A;  2CBL A;  1QX7 A;  3PM8 A;  2PAL A;  2Y0G A;  1BOC A;  1XFV O;  3BQ3 A;  3IQQ A;  2BBN A;  4YBH B;  4HRH A;  2OGR A;  4Q9W A;  2ZKM X;  2ZO6 A;  3EKJ A;  1NX1 A;  2L5X B;  1MUX A;  2JRF A;  2JT3 A;  5KTG A;  4KGE A;  2MJW B;  3TS5 B;  1AP4 A;  1A4P A;  1Z1P A;  1BF5 A;  4W6G A;  1HT9 A;  1U5I B;  2KI4 C;  3CFA A;  4PE1 A;  1DTL A;  4HRG A;  1CV7 A;  5BT0 A;  1UHJ A;  1UHH A;  4L9M A;  3I5G B;  3VGO A;  3PAL A;  3JTD B;  2H8Q A;  1J7R A;  3DQ1 A;  5I8N A;  1SPY A;  3U0L A;  4I2Y A;  1KWO C;  2DUH A;  1G33 A;  2F3Z A;  5CSI A;  1SBJ A;  4MZL A;  3E5W A;  4ANJ A;  4PHJ A;  4DXP A;  2K7O A;  1GL4 A;  1QX2 A;  5J2O A;  1YHG A;  5G08 A;  4IK1 A;  2KQY A;  2JOJ A;  4W6N A;  1K93 D;  5F6T A;  1JC0 A;  2AWM A;  1F8H A;  1R6P A;  4U2V A;  2KI6 C;  4PAL A;  1NWD A;  1YRU B;  1IRJ A;  2SAS A;  3CZT X;  5EXB A;  2KYF A;  1XMZ A;  1KQM B;  1TRF A;  1L2O B;  2V4E A;  1MF8 B;  2KAV A;  5BQL A;  2V4E C;  1DJW A;  2G9B A;  4AOM A;  1IJ5 A;  2V53 A;  1F70 A;  1XAE A;  4XVP A;  2PSR A;  1YX7 A;  2CTN A;  4ZIN A;  3I5I C;  2M7L A;  1RWY A;  3DQM A;  2BCB A;  5AXI A;  1KFX S;  4M2Q A;  2DD7 A;  2VAD A;  1HCJ A;  3UG0 A;  1B8C A;  2P4M A;  2HGD A;  2LCP A;  1PSB A;  4QJ3 B;  5HBD A;  3A4U B;  2YE1 A;  5J3X A;  2G6E A;  1IQ3 A;  1A2X A;  1UHI A;  1DGU A;  2BL0 B;  2OTB A;  2KFH A;  2L4I A;  4AQJ A;  5H87 A;  4ZIO A;  2E30 A;  5BPJ A;  1W7S A;  3DQJ A;  2JTT A;  4NDB A;  5LK4 A;  1PVA A;  2YDZ A;  1ZAC A;  4XL5 A;  2JTZ A;  4W6B A;  2EGD A;  1MXL C;  3SVE A;  2KI6 D;  2K7D A;  1OXF A;  4W6T A;  3CLN A;  4ZCV A;  4C0K A;  5KSZ A;  3GJ2 A;  5HZO A;  3SST A;  2HCG A;  1XVJ A;  1KFX L;  1PRW A;  3PLF B;  4RTC A;  3DQ9 A;  3DPW A;  1QYF A;  5H88 A;  4B5Y A;  3GJ1 A;  2KAX A;  3BXA A;  3VHT A;  3TDI A;  5FVI A;  4FQO A;  5HKW A;  4Q9X A;  1YZW A;  5EHU A;  1M46 A;  2K2A A;  2AHA A;  2Z1O A;  2WND A;  4KF4 A;  1H8B A;  1CLB A;  3W1D A;  1DJX A;  2K7B A;  5PAL A;  2GGM A;  1WLZ A;  2JZI A;  2M0R A;  4Z4K A;  1NSH A;  4MRX A;  1J7O A;  1CFD A;  4Z4M A;  2Y4Q A;  2BTJ A;  1K96 A;  2KBM A;  4ZF3 A;  1XFU O;  4ZF5 A;  2DOQ A;  1CFP A;  2KFF A;  1NIW A;  3EVU A;  3C1V A;  1CTR A;  4OKH A;  3O78 A;  1YVL A;  1BFP A;  3ZWH A;  2BBM A;  5DKR A;  4EDS A;  1QY3 A;  3WNX B;  3EVP A;  1QLK A;  1B7T Y;  2NXQ A;  4RYS A;  1TTX A;  4PFE A;  1R2U A;  4W6D A;  4KW4 A;  2KDH A;  2GX0 A;  5ER4 X;  1SR6 B;  3RWT A;  3ZNI A;  4NDC A;  1JBY A;  1BMO A;  2WUR A;  2GV5 A;  1S26 D;  4DS7 A;  3HCM A;  3O4Y A;  4IK3 A;  3ICB A;  1CM4 A;  3TUY B;  1JSA A;  5I2Q A;  3SV5 A;  2DUI A;  1Y1U A;  3A8S A;  3LL8 B;  4HE4 A;  4PPL A;  1BOD A;  4A4C A;  1H6R A;  1F09 A;  4BY5 A;  5EBJ A;  2BL0 C;  2H5Q A;  1EJ3 A;  1NX2 A;  4Q7T A;  1C07 A;  5DRF A;  1CB1 A;  1RM9 A;  1CDP A;  3NT3 A;  3SSK A;  1OZO A;  1BG1 A;  1TOP A;  3CWG A;  2MA2 A;  2JU0 A;  4YGB B;  2MLE C;  2MLF C;  1B4C A;  1PK0 D;  2O29 A;  5CSN A;  4W7R A;  1EMA A;  1DVI A;  1G8I A;  2LE9 B;  1IJ6 A;  1N0Y A;  3PJ7 A;  4YGD B;  4MLW A;  4GES B;  1JFK A;  3IF7 A;  2O24 A;  3JVT B;  1EH2 A;  1YUU A;  3LVD A;  3DQC A;  2H61 C;  3SSP A;  5D69 A;  4IZN A;  1J7Q A;  3BUN B;  4QJ4 B;  2BCX A;  1ZGO A;  2A46 A;  3NF0 A;  3NEZ A;  4P2Y B;  5CSF A;  4ORA B;  3WLD A;  3VRP A;  2LNK A;  1IGV A;  1GFL A;  1ALV A;  1MOV A;  4MSP A;  1EME A;  1YFP A;  1EXR A;  3GB3 A;  5LTR A;  1TN4 A;  4W7F A;  1SL7 A;  5T3I A;  3U8P A;  3BOW A;  2VRG A;  4AR7 A;  4DXQ A;  2ZFD A;  1RRO A;  2KGB C;  4JFG A;  2WOS A;  3S05 A;  2KI4 B;  1Q4B A;  1Y0V H;  1FBV A;  2LM5 A;  2M7N A;  2Z6X A;  4EUL A;  1N2D A;  2BE6 A;  1XFY O;  1NCZ A;  3BUO B;  3O2P A;  2CXJ A;  2Y1M A;  5DTY A;  3EK4 A;  2LLU A;  1CFC A;  4N3D A;  3O6B A;  2K0J A;  2OKY A;  3MSE B;  1K95 A;  3BXB A;  3SVB A;  1TNQ A;  3O77 A;  1KWO B;  2DUE A;  4BY4 A;  3U8A A;  1TNW A;  1UP5 A;  2EMO A;  5EJU A;  4W6C A;  1F4Q A;  1QX5 B;  2GW3 A;  4WQ3 A;  4W7A A;  1SR6 C;  4DXN A;  2B3Q A;  3LVC A;  4KPI A;  2NZ0 A;  3M22 A;  2HF5 A;  3AKB A;  2HET A;  2MHH A;  4OV2 A;  3SSY A;  2OTG C;  3P8U A;  5FVF A;  3TUY C;  1YVH A;  3SG6 A;  1MOU A;  5HZS A;  3H1R A;  1KK7 Z;  4ICB A;  5D7F A;  2WHU A;  1QYQ A;  4GF6 B;  2M9G A;  5DKN A;  2H5O A;  2G3O A;  2V4E B;  2Y5I A;  2K7C A;  1K8U A;  4W72 A;  3AKO A;  4W7E A;  3KCS A;  2KFG A;  5AER A;  1EML A;  3I5I B;  5LTP A;  1QVI Y;  3KEV A;  1L7Z A;  4ORC B;  1A03 A;  4F0Z B;  1GGX A;  1DJI A;  4I5K A;  3DVE A;  1W7I B;  3DVM A;  3RM1 A;  4N5X A;  2ZNE A;  4J8A A;  1SCV A;  4W6S A;  4IK8 A;  4H3M A;  5DTL A;  1NCY A;  1Q4C A;  2Q4U A;  1DT7 B;  3I5F C;  3JVT C;  4AS8 A;  1RFJ A;  1F71 A;  4D1E A;  1BJF A;  4W76 A;  4MRY A;  2NCO A;  1MXE A;  5GQQ C;  1QIW A;  2B3P A;  1JF0 A;  3U0K A;  4E68 A;  1M39 A;  1K9K A;  1B9A A;  1IKU A;  2EC6 C;  2LMU A;  5KTY A;  2JXC A;  2K2F A;  1IH0 A;  3AI5 A;  1PUL A;  4HQC A;  1WY9 A;  2JAD A;  3CBE A;  2M97 A;  4JPZ B;  2QAC A;  2HRS A;  2AH8 A;  3U0N A;  5DQM A;  3WCK A;  3WXA A;  2OTE A;  2G6Y A;  4P76 A;  4XOV A;  4ZCU A;  1WDC C;  1LA3 A;  4DXO A;  4LJC A;  4BDU A;  3VHT B;  1C4F A;  2LC5 A;  1ODB A;  1JBA A;  2QLG A;  2WC8 A;  3M0W A;  2LVJ A;  1CNP A;  3SSL A;  3DQD A;  1SW8 A;  3VRO A;  1UHN A;  3VRN A;  1EL4 A;  1V1G A;  3DQK A;  2CCM A;  1DJY A;  5HLV A;  2O2B A;  1D1O A;  5H89 A;  2H5P A;  4HQ8 A;  2KHN A;  1YTZ C;  2HQZ A;  4YI9 A;  3QRX A;  4M2P A;  1GJY A;  3NSK A;  3M24 A;  3SG5 A;  2JT0 A;  1MQ1 A;  2EHB A;  2D8N A;  2QLE A;  2SCP A;  4Q7R A;  4R6D A;  2HPS A;  1QTX A;  3G9A A;  4CLN A;  3ZUF A;  1ZMZ A;  2KGR A;  2KQ6 A;  1S5G Z;  2GW4 B;  2LMT A;  2OS8 C;  1QLS A;  4DKM A;  2OKW A;  1KCY A;  1OZS A;  1J7P A;  5JJG A;  2VVI A;  3CB9 A;  2YFP A;  1CDL A;  1CKK A;  2G5Z B;  1Q4E A;  2HFC A;  5HLO A;  3BUW B;  4EDO A;  1JC2 A;  1OE9 B;  1XYD A;  1KK8 C;  2Q57 A;  3H4S E;  1K9P A;  5AEQ A;  4W77 A;  1ZFS A;  1NCX A;  1IG5 A;  4L13 A;  1PSR A;  1WRZ A;  1QAT A;  2JQ6 A;  1YR5 A;  1BT6 A;  5DPG A;  3CFF A;  4XGY A;  2FWQ A;  4CFQ A;  2AUC A;  1WLM A;  4LW5 A;  4PHN A;  1ZUZ A;  1KYR A;  1S36 A;  5CSJ A;  2Q91 A;  4J88 A;  1DJZ A;  4NWS A;  3TDU A;  2EMN A;  1UUS A;  4DCK A;  1TIZ A;  4OQW A;  4PE7 A;  3D0Y A;  2B1U A;  5CPV A;  2AWL A;  4ETO A;  3ED8 A;  3PAT A;  3TDZ A;  2A54 B;  1LKJ A;  2C9J A;  1NX3 A;  5HZT A;  4LQT A;  1OOJ A;  3DQ4 A;  1XO5 A;  5HGE A;  1CDM A;  2L0P A;  3FIA A;  1A75 A;  3OX6 A;  2WCB A;  2CT9 A;  4LJD A;  4PPK A;  3ST4 A;  3DQO A;  4LJD C;  4B30 A;  3ZUL A;  2LUX A;  1AVS A;  3BOW B;  2F3Y A;  1K90 D;  1GGZ A;  1S6I A;  5KU1 A;  4H48 A;  1MWN A;  3KO0 A;  2FZU A;  4GNK B;  4NDD A;  3SG7 A;  3OHM B;  1UIS A;  2H6V A;  2JXL A;  1EMK A;  1RJV A;  1EG3 A;  2LUC A;  1SYM A;  3OSQ A;  4P5O E;  4L12 A;  2FL1 A;  1B9C A;  3DQL A;  3GK4 X;  2IOV A;  1QJT A;  4MBE A;  3IR8 A;  4KF5 A;  4A4B A;  3DQ3 A;  4ZFS A;  1SKT A;  3ST3 A;  1OMV A;  2G2S B;  1ZUX A;  4KF5 C;  1OMR A;  1F4O A;  2ARL A;  2A53 B;  4IK5 A;  2LAN A;  5AAN A;  4N1F A;  2PXS A;  4ZBL A;  4OY4 A;  2IB6 A;  4KEX A;  1MHO A;  3U0M A;  4KGF A;  4MEW A;  4PE0 A;  3SG2 A;  3WLC A;  4OR9 B;  2OTG B;  1TCO B;  3DQ7 A;  1BLQ A;  2LHL A;  2ZMU A;  1SY9 A;  3VRR A;  4I5L B;  4W6J A;  3SVS A;  2Z6Z A;  2LP2 A;  1AUI B;  2ZN9 A;  3K1K A;  1DGV A;  4GBA A;  3LSA A;  4HSZ A;  3ST0 A;  2ZRS A;  1OXE A;  2I7A A;  3BUM B;  5DQB A;  3NSL A;  2AAO A;  1JF2 A;  1HUY A;  4IK9 A;  3OGO A;  3K21 A;  4ORN A;  3WHU B;  3CS1 A;  1XFW O;  1B1G A;  2KOT A;  3NSO A;  3KHE A;  4W74 A;  2R2I A;  2K8M B;  4HVF A;  5BTT A;  3DQE A;  2O60 A;  1LA0 A;  2BKI B;  5K89 A;  3I5F B;  1G4Y R;  2HJO A;  1FPW A;  2AWK A;  3OP0 A;  1XK4 A;  1RTP 1;  3CGL A;  1XK4 C;  3ST2 A;  2F33 A;  1KSO A;  2ZND A;  4I5N B;  3BYA A;  2A50 B;  4H3N A;  2QRF A;  2WSN A;  2JPT A;  3DQF A;  2ZO7 A;  1OMD A;  5FYX A;  3AAJ A;  4W7C A;  4DIR A;  5I2O A;  3OB2 B;  1M63 B;  2JWW A;  2PXW A;  3CTN A;  2EC6 B;  2DUG A;  1S3P A;  2LLT A;  4UTS A;  3UFZ A;  4YI8 A;  1JUO A;  4W73 A;  2M29 A;  3A8R A;  4CID A;  3PIB A;  1J55 A;  2RH7 A;  1S6J A;  2Q6P A;  3ZUJ A;  1VRK A;  2M49 B;  1Z1Q A;  3VIC A;  4U8D A;  1RMM A;  1J1D A;  1OXD A;  3CR5 X;  3SSV A;  1DF0 A;  5HW9 A;  1WDC B;  3FS7 A;  2E6W A;  3LF3 A;  3EVR A;  3E3R A;  1KFU L;  1NYA A;  3SIA A;  1REC A;  1XFZ O;  2WOR A;  2QLG B;  2JNX A;  1KYS A;  3OSR A;  1EG4 A;  4JEO A;  4Q7U A;  1QV1 A;  2ZRT A;  5AQB B;  3PN7 C;  1M45 A;  3DPX A;  1YUS A;  2A56 B;  1CFF A;  2DDD A;  4JC2 A;  1K9U A;  4L1I A;  1Q4D A;  3DF0 A;  3W1C A;  4H3L A;  2QU1 A;  3ZTF A;  1W7T A;  5DTZ A;  2M1U A;  3VK1 A;  1YRT B;  1RRX A;  2GGZ A;  3KPX A;  4MVF A;  4Q04 A;  3SVN A;  3AI4 A;  2FJU B;  3RLZ A;  2NLN A;  2POX A;  4W6P A;  1EMM A;  2KBI A;  2OS8 B;  4CPV A;  4AQI A;  1A29 A;  2VVH A;  1YUR A;  4PHK A;  1RMO A;  4KAG A;  2M8U A;  3E5V A;  1QIV A;  1EMB A;  2A47 A;  4W6L A;  1NX0 A;  4GGN A;  3BXK A;  2LVK A;  3DQ2 A; 
#chains in the Genus database with same CATH topology
 4OHS A;  1DMO A;  1KK8 B;  1OQP A;  4W6A A;  1GGW A;  3FWC A;  1F55 A;  1FW4 A;  5F9G A;  4YGC B;  5I2L A;  2LP3 A;  3SRY A;  3RZS A;  3SS3 A;  4TNC A;  1NUB A;  1YHI A;  1KP5 A;  1XA9 A;  3DXL A;  1AJ4 A;  4ZB1 A;  1C7V A;  3CR2 A;  1B7T Z;  1DJH A;  5FI7 A;  1G7K A;  4W7D A;  1Q73 A;  3EK8 A;  2I2R E;  3LA1 A;  5EXU A;  1F54 A;  2HQW A;  1YUT A;  3CZ2 A;  2WCE A;  2PYQ A;  1ZGQ A;  2QLI A;  4MN0 A;  5DKQ A;  2K61 A;  2FCE A;  3K1E A;  3LS3 A;  3GK1 A;  4J89 A;  5ER5 A;  4JWQ A;  1TUJ A;  3D0Y B;  4INX A;  1XSS A;  2MRD A;  2HGY A;  3PJB A;  1V1F A;  3GOF A;  3E5T A;  2BEC A;  4W6O A;  5DRG A;  1RK9 A;  3R1V A;  2KAY A;  5DPI A;  3BUX B;  3L47 A;  2C9I A;  4ZF4 A;  4I5J A;  2MBX A;  1Q4A A;  4F7F A;  1A75 B;  2QT2 A;  3I5H B;  5TNC A;  1S6C A;  2G3D B;  4B30 B;  1YJ2 A;  1J1E A;  3SJS A;  4W6R A;  3DQ6 A;  1QYO A;  4W6U A;  4PCW A;  5IBW A;  4RYW A;  4PHM A;  5DPJ A;  4TZG A;  3OB1 B;  2WSO A;  3EKH A;  2LVV A;  4W6H A;  4XJK A;  4GOB A;  2L50 A;  2QLH A;  2DDC A;  5EB6 A;  3D78 A;  3CZ1 A;  3CD1 A;  4R1E A;  4IL1 A;  4W6M A;  2PRU A;  2HQK A;  4TZA A;  3VRQ A;  4C0L A;  5HZU A;  4JKT A;  5FI6 A;  3D10 A;  1XQM A;  1ALW A;  1W7U A;  5DPH A;  3P28 A;  3SG3 A;  1KSM A;  2MAZ A;  1UHK A;  2H9W A;  1TNX A;  2ISD A;  4W7X A;  2BE4 A;  3H1O A;  3NT9 A;  2ZMW A;  4OVN F;  4KA9 A;  1SMG A;  1YJF A;  4M2O A;  4H47 A;  2PAS A;  2KSP A;  1TNP A;  4W69 A;  1ZGP A;  2I18 A;  4CFR A;  2WIS A;  1NP8 A;  1EMG A;  2M3W A;  3S0D A;  4W6I A;  3SSH A;  2AMI A;  2VVJ A;  1IIO A;  4JQ0 D;  4JF9 A;  1CMF A;  4R6B A;  1K94 A;  1F0B A;  1M31 A;  1PAL A;  1X02 A;  2HQ8 A;  3IQO A;  1B47 A;  4N1G A;  3VB1 A;  5DY6 A;  2ZN8 A;  1FF1 A;  2OJK A;  1N65 A;  1LIN A;  4W75 A;  1IQ5 A;  3KCT A;  1MYW A;  1SCM B;  5JOL A;  2IS9 A;  2GX2 A;  1CLM A;  2WCF A;  3IP2 A;  1B8L A;  3R1P A;  4EN1 A;  3TS5 C;  1IWQ A;  5BTT B;  2Z6Y A;  2O5G A;  5B8I B;  4WQ2 A;  3SVD A;  5LTQ A;  3DQN A;  4LQU A;  1U5I A;  2WC5 A;  1UWO A;  2H2K A;  1JWD A;  2WHS A;  2IE2 A;  4UPG A;  3KF9 A;  3V2L A;  2LV7 A;  4MZK A;  3DQA A;  1KK7 Y;  1BR4 B;  1K2H A;  4OCI A;  5DU0 A;  1Z2C B;  1QS7 A;  3PJ5 A;  3I5H C;  5HKY A;  3CFH A;  3I5G C;  3CD9 A;  3CGA A;  3OX5 A;  2WIQ A;  2RGI A;  3SS0 A;  1UUR A;  3JTD C;  4JRB A;  2JC2 A;  2LLS A;  1QVI Z;  3HX4 A;  2G16 B;  2NCP A;  2A52 B;  3BXC A;  1FI6 A;  3DPZ A;  3LK1 A;  1H4B A;  4HRE E;  1WRK A;  3I19 A;  3AKA A;  3TMR A;  3BX9 A;  3TZ1 A;  3SVO A;  2OPO A;  2L4H A;  2L2E A;  1DF0 B;  4FTG A;  4PE4 A;  2ERB A;  3B6X A;  4DXM A;  1FI5 A;  1HQV A;  4P1Q A;  2F2P A;  1EMC A;  2COL B;  3GL4 A;  1SNL A;  2BKH B;  3FWB A;  1NPQ A;  1KQM C;  1L2O C;  3PN7 B;  1SRA A;  1YHH A;  3D73 A;  4EMQ A;  1QXP A;  1SK6 D;  1TCF A;  2LHI A;  2FOT A;  3DVK A;  3LCP C;  1SL8 A;  3DF0 B;  4YGA A;  2YE0 A;  4HQ9 A;  1QXT A;  3LF4 B;  2VZX A;  4C0J A;  1B8R A;  4JGE A;  2VAE A;  2LVI A;  2DD9 A;  4USL A;  3U8C A;  3GK2 A;  4GGF A;  4GGF C;  2PMY A;  1SCM C;  3S0A A;  3DQH A;  2A48 A;  2TN4 A;  1ZOT B;  3CR4 X;  3MGF A;  1XA5 A;  1Y6W A;  1XFX O;  4YRU A;  1AK8 A;  2F8P A;  2JT8 A;  2LAP A;  1EMF A;  1LXF C;  3OBV A;  5FVG A;  3DVJ A;  4IK4 A;  5FHV A;  1AHR A;  4NQG A;  1KFU S;  3AAK A;  1QV0 A;  4KW8 A;  3WHT B;  3SVC A;  2ICR A;  3RWA A;  2KYC A;  2H61 A;  1JC1 A;  1CM1 A;  4GAO A;  2PVB A;  1KQV A;  3GEX A;  1Q80 A;  5DIC A;  3S0G A;  5DTX A;  3TMT A;  3DQU A;  4DXI A;  4LJB A;  4W6K A;  1LVC D;  5HKZ A;  2JUL A;  4OGS A;  1OSA A;  1S5G Y;  3CDN A;  1CLL A;  1GM0 A;  2DUF A;  2G2B A;  2KLE A;  2KNE A;  2A4J A;  4OJ0 A;  2CNP A;  3DD4 A;  1WRL A;  4MZJ A;  3PSR A;  3EK7 A;  5EB7 A;  1S6Z A;  3PFV A;  2H5R A;  1W7J B;  3EVV A;  1SL9 A;  5AFP A;  5HYD A;  3DQ5 A;  4PPJ A;  4ORB B;  2BNX A;  4KW9 A;  2QEH A;  2FCD A;  3V3D A;  2Y1N A;  1RMP A;  3SG4 A;  4GFT A;  3NSI A;  2G6X A;  1H4U A;  1KYP A;  3LK0 A;  5EXC I;  2LMV A;  3DQ8 A;  3UO9 A;  4PDZ A;  2QPT A;  1QWV A;  3LVA A;  1BR1 B;  2AWJ A;  4YGE B;  2HPW A;  1Y1X A;  4XJK B;  4DUQ A;  3SIB A;  3SVU A;  1C7W A;  1YX8 A;  4DRW A;  1CDN A;  1Y1A A;  2IB5 A;  3F45 A;  1BU3 A;  4DKN A;  1QAS A;  3NXA A;  1S1E A;  2M1K B;  1CMG A;  3NED A;  1GQM A;  4W6F A;  2BCA A;  4WRI A;  3ADF A;  2WCK A;  1MR8 A;  2WCH A;  2F2O A;  1E8A A;  4XYN A;  1JBZ A;  1DJG A;  4GPL B;  3DQI A;  2JPO A;  2L51 A;  2JNF A;  2I94 A;  1JFJ A;  1AJ5 A;  4QJ5 B;  2GTE A;  4XOW A;  3B87 A;  1PVB A;  3LLE A;  2EMD A;  2WHT A;  2L98 A;  3SVR A;  2P6B B;  2QZ0 A;  3IVT A;  4GUK A;  2CBL A;  1QX7 A;  3PM8 A;  3S0F A;  2PAL A;  3L4L A;  2Y0G A;  1BOC A;  3O4X A;  1XFV O;  3CZ0 A;  3BQ3 A;  3IQQ A;  2BBN A;  4YBH B;  4HRH A;  2OGR A;  4Q9W A;  3N7H A;  2ZKM X;  2ZO6 A;  3EKJ A;  1NX1 A;  2L5X B;  1MUX A;  2JRF A;  2JT3 A;  3B88 A;  5KTG A;  4KGE A;  2MJW B;  3TS5 B;  1AP4 A;  1A4P A;  2KPH A;  1Z1P A;  1BF5 A;  4W6G A;  1HT9 A;  1C3Z A;  1U5I B;  2KI4 C;  4JD9 A;  3CFA A;  4PE1 A;  1DTL A;  1W9Z A;  4HRG A;  1CV7 A;  5BT0 A;  1UHJ A;  1UHH A;  4L9M A;  3I5G B;  3VGO A;  3PAL A;  3JTD B;  2H8Q A;  1J7R A;  3DQ1 A;  5I8N A;  1SPY A;  3EG5 B;  3U0L A;  4I2Y A;  1KWO C;  2DUH A;  1G33 A;  2F3Z A;  5CSI A;  1SBJ A;  4MZL A;  3E5W A;  4ANJ A;  4PHJ A;  4DXP A;  2K7O A;  1GL4 A;  1QX2 A;  5J2O A;  1YHG A;  5G08 A;  4IK1 A;  2KQY A;  2JOJ A;  4W6N A;  1K93 D;  5F6T A;  1JC0 A;  2AWM A;  1F8H A;  1R6P A;  4U2V A;  2KI6 C;  4PAL A;  1NWD A;  1YRU B;  1IRJ A;  2SAS A;  3CZT X;  5EXB A;  2KYF A;  1XMZ A;  1KQM B;  1TRF A;  1L2O B;  2V4E A;  1MF8 B;  2KAV A;  5BQL A;  2V4E C;  1DJW A;  2G9B A;  4AOM A;  1IJ5 A;  3SS4 A;  2V53 A;  1F70 A;  1XAE A;  4XVP A;  1LS8 A;  1OOI X;  2PSR A;  1YX7 A;  2CTN A;  4ZIN A;  3I5I C;  2M7L A;  1RWY A;  3DQM A;  2BCB A;  5AXI A;  1KFX S;  4M2Q A;  3DY9 A;  2DD7 A;  3NGV A;  3PJI A;  2VAD A;  1HCJ A;  5D3O A;  3UG0 A;  1B8C A;  2P4M A;  2HGD A;  2LCP A;  1PSB A;  4QJ3 B;  5HBD A;  2KLD A;  3A4U B;  2YE1 A;  5J3X A;  2G6E A;  1TWO A;  1IQ3 A;  1A2X A;  1UHI A;  1DGU A;  2BL0 B;  2OTB A;  2KFH A;  2L4I A;  4AQJ A;  5H87 A;  4ZIO A;  2E30 A;  5BPJ A;  1W7S A;  3DQJ A;  2JTT A;  4NDB A;  5LK4 A;  1PVA A;  2YDZ A;  1ZAC A;  4XL5 A;  2JTZ A;  4W6B A;  2EGD A;  1T14 A;  1MXL C;  3SVE A;  2KI6 D;  2K7D A;  1OXF A;  4W6T A;  3CLN A;  4ZCV A;  4C0K A;  5KSZ A;  3GJ2 A;  5HZO A;  3SST A;  2HCG A;  1XVJ A;  1KFX L;  1PRW A;  3PLF B;  4RTC A;  3DQ9 A;  3DPW A;  1QYF A;  5H88 A;  4B5Y A;  3CYZ A;  3GJ1 A;  2KAX A;  2WC6 A;  3BXA A;  3S0B A;  3VHT A;  3TDI A;  5FVI A;  4FQO A;  5HKW A;  3BJH A;  4Q9X A;  1YZW A;  5EHU A;  1M46 A;  4OZD A;  2K2A A;  2AHA A;  2Z1O A;  2WND A;  4KF4 A;  1H8B A;  1CLB A;  3W1D A;  1DJX A;  2WCJ A;  2K7B A;  5PAL A;  1DEK A;  2GGM A;  1WLZ A;  2JZI A;  2M0R A;  4Z4K A;  1NSH A;  4MRX A;  1J7O A;  1CFD A;  4Z4M A;  2Y4Q A;  2BTJ A;  1K96 A;  2KBM A;  4ZF3 A;  1XFU O;  4ZF5 A;  2DOQ A;  1CFP A;  2KFF A;  1NIW A;  3EVU A;  3C1V A;  1CTR A;  4OKH A;  3O78 A;  1YVL A;  1BFP A;  3ZWH A;  2BBM A;  2H8V A;  1OOF A;  5DKR A;  4EDS A;  1QY3 A;  3WNX B;  3EVP A;  1QLK A;  1B7T Y;  2NXQ A;  4RYS A;  3D74 A;  1TTX A;  4PFE A;  1R2U A;  4W6D A;  4KW4 A;  2KDH A;  2GX0 A;  3S0E A;  5ER4 X;  1SR6 B;  3RWT A;  3ZNI A;  4NDC A;  1JBY A;  1BMO A;  2WUR A;  2GV5 A;  1S26 D;  4DS7 A;  3HCM A;  3O4Y A;  1DC1 A;  4IK3 A;  3ICB A;  1CM4 A;  3TUY B;  1JSA A;  5I2Q A;  3SV5 A;  2DUI A;  1Y1U A;  3A8S A;  3LL8 B;  4HE4 A;  4PPL A;  1BOD A;  4A4C A;  1H6R A;  1F09 A;  4BY5 A;  3D75 A;  5EBJ A;  2BL0 C;  2H5Q A;  1EJ3 A;  1NX2 A;  4Q7T A;  1C07 A;  5DRF A;  1CB1 A;  1RM9 A;  1CDP A;  3NT3 A;  3SSK A;  3BFA A;  1OZO A;  1BG1 A;  1TOP A;  3CWG A;  2MA2 A;  5HL1 A;  2JU0 A;  4YGB B;  2MLE C;  1C3Y A;  2MLF C;  3B86 A;  1B4C A;  1PK0 D;  2O29 A;  5CSN A;  4W7R A;  1EMA A;  1DVI A;  1G8I A;  2LE9 B;  1IJ6 A;  1N0Y A;  3PJ7 A;  4YGD B;  4MLW A;  4GES B;  1JFK A;  3IF7 A;  2O24 A;  3JVT B;  1EH2 A;  1YUU A;  3LVD A;  3DQC A;  2H61 C;  3SSP A;  5D69 A;  4IZN A;  1J7Q A;  3BUN B;  4QJ4 B;  2BCX A;  1ZGO A;  2A46 A;  3NF0 A;  3NEZ A;  4P2Y B;  5CSF A;  3R1O A;  4FQT A;  4ORA B;  3WLD A;  2L5Y A;  3VRP A;  2LNK A;  1IGV A;  1GFL A;  1ALV A;  1MOV A;  4MSP A;  1EME A;  1YFP A;  1EXR A;  3GB3 A;  5LTR A;  1TN4 A;  4W7F A;  1SL7 A;  5T3I A;  3U8P A;  3BOW A;  2VRG A;  4AR7 A;  4DXQ A;  2ZFD A;  1RRO A;  2KGB C;  4JFG A;  2WOS A;  3S05 A;  2KI4 B;  1Q4B A;  1Y0V H;  1FBV A;  2LM5 A;  2M7N A;  2Z6X A;  4EUL A;  1N2D A;  2BE6 A;  1XFY O;  1NCZ A;  3BUO B;  3B7A A;  3O2P A;  2CXJ A;  2Y1M A;  5DTY A;  3EK4 A;  2LLU A;  1CFC A;  4N3D A;  3O6B A;  2K0J A;  2OKY A;  3MSE B;  3OGN A;  1K95 A;  3BXB A;  3SVB A;  1TNQ A;  3O77 A;  1KWO B;  2DUE A;  4BY4 A;  3U8A A;  1TNW A;  1UP5 A;  2EMO A;  5EJU A;  4W6C A;  1F4Q A;  1QX5 B;  2GW3 A;  4WQ3 A;  4W7A A;  4IJ7 A;  3UNW A;  1SR6 C;  4DXN A;  2B3Q A;  3LVC A;  4KPI A;  2NZ0 A;  3M22 A;  2HF5 A;  3AKB A;  2HET A;  2WCM A;  2P70 A;  2MHH A;  4OV2 A;  3SSY A;  2BAP A;  2OTG C;  3P8U A;  5FVF A;  3TUY C;  1YVH A;  3SG6 A;  1MOU A;  5HZS A;  3H1R A;  1KK7 Z;  4ICB A;  5D7F A;  2WHU A;  3Q8I A;  1QYQ A;  4GF6 B;  2M9G A;  5DKN A;  2H5O A;  2G3O A;  2V4E B;  2Y5I A;  2K7C A;  1K8U A;  2PQL A;  4W72 A;  3AKO A;  4W7E A;  3KCS A;  2KFG A;  5AER A;  1EML A;  3I5I B;  5LTP A;  1QVI Y;  3L4A A;  2QEB A;  4KYN A;  3KEV A;  1L7Z A;  4ORC B;  1A03 A;  4F0Z B;  1GGX A;  1DJI A;  4I5K A;  3DVE A;  1W7I B;  3DVM A;  3RM1 A;  4N5X A;  2ZNE A;  4J8A A;  1SCV A;  4W6S A;  4IK8 A;  4H3M A;  5DTL A;  1NCY A;  1Q4C A;  2Q4U A;  1DT7 B;  3I5F C;  3JVT C;  4AS8 A;  1RFJ A;  1F71 A;  4D1E A;  1BJF A;  4W76 A;  4MRY A;  2NCO A;  1MXE A;  5GQQ C;  1QIW A;  2B3P A;  1JF0 A;  2P71 A;  3U0K A;  1OOH A;  4E68 A;  1M39 A;  1K9K A;  1B9A A;  1IKU A;  2EC6 C;  2LMU A;  5KTY A;  2JXC A;  2K2F A;  1IH0 A;  3AI5 A;  1PUL A;  4HQC A;  1WY9 A;  2JAD A;  3CBE A;  2M97 A;  4JPZ B;  2QAC A;  3DYE A;  2HRS A;  2AH8 A;  2K60 A;  3U0N A;  5DQM A;  3WCK A;  3WXA A;  2OTE A;  2G6Y A;  4P76 A;  1ORG A;  4XOV A;  4ZCU A;  1WDC C;  1LA3 A;  4DXO A;  4LJC A;  4BDU A;  3VHT B;  1C4F A;  2LC5 A;  1ODB A;  1JBA A;  2QLG A;  2WC8 A;  3M0W A;  2LVJ A;  3NHI A;  1CNP A;  1DEL A;  3SSL A;  3DQD A;  1SW8 A;  3VRO A;  1UHN A;  3VRN A;  1EL4 A;  1V1G A;  3DQK A;  2CCM A;  1DJY A;  5HLV A;  2O2B A;  1D1O A;  5H89 A;  2H5P A;  4HQ8 A;  2KHN A;  1YTZ C;  2HQZ A;  4YI9 A;  3QRX A;  4M2P A;  1GJY A;  3NSK A;  3M24 A;  2YGU A;  3SG5 A;  2JT0 A;  1MQ1 A;  2EHB A;  2D8N A;  2QLE A;  2SCP A;  4Q7R A;  4R6D A;  2HPS A;  1QTX A;  3G9A A;  3CAB A;  4CLN A;  3ZUF A;  1ZMZ A;  2KGR A;  2KQ6 A;  1TUZ A;  1S5G Z;  2GW4 B;  2LMT A;  2OS8 C;  1QLS A;  4DKM A;  2OKW A;  1KCY A;  1OZS A;  1J7P A;  5JJG A;  2VVI A;  3CB9 A;  2YFP A;  1CDL A;  1CKK A;  2G5Z B;  1Q4E A;  2HFC A;  5HLO A;  3BUW B;  4EDO A;  1JC2 A;  1OE9 B;  1XYD A;  1KK8 C;  2Q57 A;  3H4S E;  1K9P A;  5AEQ A;  4W77 A;  1ZFS A;  1NCX A;  1IG5 A;  4L13 A;  1PSR A;  1WRZ A;  1QAT A;  2JQ6 A;  1YR5 A;  1BT6 A;  5DPG A;  3CFF A;  4XGY A;  2FWQ A;  4CFQ A;  2AUC A;  1WLM A;  4INW A;  5EL2 A;  4LW5 A;  4PHN A;  1ZUZ A;  1KYR A;  1S36 A;  5CSJ A;  2Q91 A;  4J88 A;  1DJZ A;  4NWS A;  1XFR A;  3TDU A;  2EMN A;  1UUS A;  4DCK A;  1TIZ A;  4OQW A;  4PE7 A;  3D0Y A;  2B1U A;  5CPV A;  2AWL A;  4ETO A;  3ED8 A;  3PAT A;  3QME A;  3TDZ A;  2A54 B;  1LKJ A;  3R72 A;  2C9J A;  1NX3 A;  5HZT A;  4LQT A;  1OOJ A;  3DQ4 A;  1XO5 A;  3NHT A;  5HGE A;  1CDM A;  2L0P A;  3FIA A;  1A75 A;  3OX6 A;  2WCB A;  2CT9 A;  4LJD A;  4PPK A;  3ST4 A;  3DQO A;  4LJD C;  4B30 A;  3ZUL A;  2LUX A;  1AVS A;  3BOW B;  2F3Y A;  1K90 D;  1GGZ A;  1S6I A;  5KU1 A;  4H48 A;  1MWN A;  3KO0 A;  2FZU A;  4GNK B;  4NDD A;  3SG7 A;  1SSE B;  3OHM B;  1UIS A;  2H6V A;  2JXL A;  1EMK A;  1RJV A;  1EG3 A;  2LUC A;  1SYM A;  3OSQ A;  4P5O E;  4L12 A;  2FL1 A;  1B9C A;  3DQL A;  3GK4 X;  2IOV A;  1QJT A;  4MBE A;  3IR8 A;  4KF5 A;  4A4B A;  3DQ3 A;  4ZFS A;  1SKT A;  3ST3 A;  1OMV A;  2G2S B;  1ZUX A;  4KF5 C;  1OMR A;  1F4O A;  2ARL A;  2A53 B;  4IK5 A;  2LAN A;  5AAN A;  4N1F A;  2PXS A;  5I94 A;  4ZBL A;  4OY4 A;  2IB6 A;  4KEX A;  1MHO A;  3U0M A;  4KGF A;  4MEW A;  4PE0 A;  3SG2 A;  3WLC A;  4OR9 B;  2OTG B;  1TCO B;  3DQ7 A;  1BLQ A;  2LHL A;  2QEO A;  2ZMU A;  1SY9 A;  3VRR A;  4I5L B;  4W6J A;  2QDI A;  3SVS A;  2Z6Z A;  2LP2 A;  1AUI B;  2ZN9 A;  3K1K A;  1DGV A;  4GBA A;  3LSA A;  4HSZ A;  3ST0 A;  5FI2 A;  2ZRS A;  1OXE A;  2I7A A;  3BUM B;  5DQB A;  3NSL A;  2AAO A;  2QEV A;  1JF2 A;  1HUY A;  4IK9 A;  3OGO A;  3K21 A;  3FE6 A;  4ORN A;  1OOG A;  3WHU B;  2WCL A;  3CS1 A;  3FE8 A;  1XFW O;  1B1G A;  2KOT A;  3NSO A;  3KHE A;  4W74 A;  2R2I A;  2K8M B;  4HVF A;  5BTT A;  3DQE A;  2O60 A;  1LA0 A;  2BKI B;  5K89 A;  3BFH A;  3I5F B;  1G4Y R;  2HJO A;  1FPW A;  2AWK A;  3OP0 A;  1XK4 A;  1RTP 1;  3CGL A;  1XK4 C;  3ST2 A;  1DQE A;  3DZT A;  2F33 A;  1KSO A;  2ZND A;  4I5N B;  3BYA A;  3D77 A;  2A50 B;  3SS5 A;  4H3N A;  2QRF A;  2WSN A;  2JPT A;  3DQF A;  2ZO7 A;  1OMD A;  5FYX A;  3AAJ A;  4W7C A;  4DIR A;  5I2O A;  3OB2 B;  1M63 B;  2JWW A;  2PXW A;  3CTN A;  2EC6 B;  2DUG A;  1S3P A;  2LLT A;  4UTS A;  3UFZ A;  4YI8 A;  1JUO A;  4W73 A;  2M29 A;  3A8R A;  4CID A;  3PIB A;  1J55 A;  3D76 A;  2RH7 A;  1S6J A;  2Q6P A;  3ZUJ A;  1VRK A;  2M49 B;  1Z1Q A;  1OW4 A;  3VIC A;  4U8D A;  1RMM A;  1J1D A;  1OXD A;  3CR5 X;  3SSV A;  1DF0 A;  5HW9 A;  1WDC B;  3FS7 A;  2E6W A;  3LF3 A;  3EVR A;  3E3R A;  1KFU L;  1NYA A;  3SIA A;  1REC A;  1XFZ O;  2WOR A;  2QLG B;  2JNX A;  3FE9 A;  1KYS A;  3OSR A;  1EG4 A;  4JEO A;  4Q7U A;  1QV1 A;  2ZRT A;  5AQB B;  3PN7 C;  1M45 A;  3DPX A;  1YUS A;  2A56 B;  1CFF A;  3PM2 A;  2DDD A;  4JC2 A;  1K9U A;  4L1I A;  3BFB A;  1Q4D A;  3DF0 A;  3W1C A;  4H3L A;  2QU1 A;  3ZTF A;  1W7T A;  5DTZ A;  2M1U A;  3VK1 A;  1YRT B;  1P28 A;  2FJY A;  1RRX A;  2GGZ A;  3KPX A;  4MVF A;  4Q04 A;  3SVN A;  3AI4 A;  2FJU B;  3RLZ A;  2NLN A;  2POX A;  4W6P A;  1Z4H A;  1EMM A;  2KBI A;  2OS8 B;  4CPV A;  4AQI A;  1A29 A;  2VVH A;  1YUR A;  4PHK A;  1RMO A;  2L2C A;  4KAG A;  3E5V A;  2M8U A;  4PT1 A;  1QIV A;  1EMB A;  2A47 A;  4W6L A;  1NX0 A;  4GGN A;  3BXK A;  2LVK A;  3DQ2 A; 
#chains in the Genus database with same CATH homology
 4OHS A;  1DMO A;  1KK8 B;  1OQP A;  4W6A A;  1GGW A;  3FWC A;  1F55 A;  1FW4 A;  5F9G A;  4YGC B;  5I2L A;  2LP3 A;  3SRY A;  4TNC A;  1NUB A;  1YHI A;  1KP5 A;  1XA9 A;  1AJ4 A;  4ZB1 A;  1C7V A;  3CR2 A;  1B7T Z;  1DJH A;  1G7K A;  4W7D A;  1Q73 A;  3EK8 A;  2I2R E;  3LA1 A;  5EXU A;  1F54 A;  2HQW A;  1YUT A;  2WCE A;  1ZGQ A;  2QLI A;  4MN0 A;  5DKQ A;  2K61 A;  2FCE A;  3LS3 A;  3GK1 A;  4J89 A;  5ER5 A;  4JWQ A;  3D0Y B;  1XSS A;  2MRD A;  2HGY A;  3PJB A;  1V1F A;  3GOF A;  3E5T A;  2BEC A;  4W6O A;  5DRG A;  1RK9 A;  2KAY A;  5DPI A;  3BUX B;  2C9I A;  4ZF4 A;  4I5J A;  2MBX A;  1Q4A A;  1A75 B;  2QT2 A;  3I5H B;  5TNC A;  1S6C A;  2G3D B;  4B30 B;  1YJ2 A;  1J1E A;  3SJS A;  4W6R A;  3DQ6 A;  1QYO A;  4W6U A;  4PCW A;  5IBW A;  4RYW A;  4PHM A;  5DPJ A;  4TZG A;  3OB1 B;  2WSO A;  3EKH A;  2LVV A;  4W6H A;  4XJK A;  4GOB A;  2L50 A;  2QLH A;  2DDC A;  5EB6 A;  3CD1 A;  4R1E A;  4IL1 A;  4W6M A;  2PRU A;  2HQK A;  4TZA A;  3VRQ A;  4C0L A;  5HZU A;  3D10 A;  1XQM A;  1ALW A;  1W7U A;  5DPH A;  3P28 A;  3SG3 A;  1KSM A;  2MAZ A;  1UHK A;  2H9W A;  1TNX A;  2ISD A;  4W7X A;  2BE4 A;  3H1O A;  3NT9 A;  2ZMW A;  4OVN F;  4KA9 A;  1SMG A;  1YJF A;  4M2O A;  4H47 A;  2PAS A;  2KSP A;  1TNP A;  4W69 A;  1ZGP A;  2I18 A;  4CFR A;  2WIS A;  1NP8 A;  1EMG A;  2M3W A;  4W6I A;  3SSH A;  2AMI A;  2VVJ A;  4JQ0 D;  4JF9 A;  1CMF A;  4R6B A;  1K94 A;  1F0B A;  1M31 A;  1PAL A;  1X02 A;  2HQ8 A;  3IQO A;  1B47 A;  4N1G A;  5DY6 A;  2ZN8 A;  1FF1 A;  2OJK A;  1N65 A;  1LIN A;  4W75 A;  1IQ5 A;  3KCT A;  1MYW A;  1SCM B;  5JOL A;  2IS9 A;  2GX2 A;  1CLM A;  2WCF A;  3IP2 A;  1B8L A;  4EN1 A;  3TS5 C;  1IWQ A;  5BTT B;  2Z6Y A;  2O5G A;  5B8I B;  4WQ2 A;  3SVD A;  5LTQ A;  3DQN A;  4LQU A;  1U5I A;  1UWO A;  2H2K A;  1JWD A;  2WHS A;  2IE2 A;  4UPG A;  3KF9 A;  2LV7 A;  4MZK A;  3DQA A;  1KK7 Y;  1BR4 B;  1K2H A;  4OCI A;  5DU0 A;  1QS7 A;  3PJ5 A;  3I5H C;  5HKY A;  3CFH A;  3I5G C;  3CD9 A;  3CGA A;  3OX5 A;  2WIQ A;  2RGI A;  3SS0 A;  1UUR A;  3JTD C;  4JRB A;  2JC2 A;  2LLS A;  1QVI Z;  3HX4 A;  2G16 B;  2NCP A;  2A52 B;  3BXC A;  1FI6 A;  3DPZ A;  3LK1 A;  1H4B A;  4HRE E;  1WRK A;  3I19 A;  3AKA A;  3TMR A;  3BX9 A;  3TZ1 A;  3SVO A;  2OPO A;  2L4H A;  2L2E A;  1DF0 B;  4FTG A;  4PE4 A;  4DXM A;  1FI5 A;  1HQV A;  4P1Q A;  2F2P A;  1EMC A;  2COL B;  3GL4 A;  1SNL A;  2BKH B;  3FWB A;  1NPQ A;  1KQM C;  1L2O C;  3PN7 B;  1SRA A;  1YHH A;  4EMQ A;  1QXP A;  1SK6 D;  1TCF A;  2LHI A;  2FOT A;  3DVK A;  3LCP C;  1SL8 A;  3DF0 B;  4YGA A;  2YE0 A;  4HQ9 A;  1QXT A;  3LF4 B;  2VZX A;  4C0J A;  1B8R A;  4JGE A;  2VAE A;  2LVI A;  2DD9 A;  4USL A;  3U8C A;  3GK2 A;  4GGF A;  4GGF C;  2PMY A;  1SCM C;  3DQH A;  2A48 A;  2TN4 A;  1ZOT B;  3CR4 X;  3MGF A;  1XA5 A;  1Y6W A;  1XFX O;  4YRU A;  1AK8 A;  2F8P A;  2JT8 A;  2LAP A;  1EMF A;  1LXF C;  5FVG A;  3DVJ A;  4IK4 A;  5FHV A;  1AHR A;  4NQG A;  1KFU S;  3AAK A;  1QV0 A;  4KW8 A;  3WHT B;  3SVC A;  2ICR A;  3RWA A;  2KYC A;  2H61 A;  1JC1 A;  1CM1 A;  4GAO A;  2PVB A;  1KQV A;  3GEX A;  1Q80 A;  5DTX A;  3TMT A;  3DQU A;  4DXI A;  4LJB A;  4W6K A;  1LVC D;  5HKZ A;  2JUL A;  4OGS A;  1OSA A;  1S5G Y;  1CLL A;  2DUF A;  2G2B A;  2KNE A;  2A4J A;  4OJ0 A;  2CNP A;  3DD4 A;  1WRL A;  4MZJ A;  3PSR A;  3EK7 A;  5EB7 A;  1S6Z A;  3PFV A;  2H5R A;  1W7J B;  3EVV A;  1SL9 A;  5AFP A;  5HYD A;  3DQ5 A;  4PPJ A;  4ORB B;  4KW9 A;  2FCD A;  3V3D A;  2Y1N A;  1RMP A;  3SG4 A;  4GFT A;  3NSI A;  2G6X A;  1H4U A;  1KYP A;  3LK0 A;  5EXC I;  2LMV A;  3DQ8 A;  4PDZ A;  2QPT A;  3LVA A;  1BR1 B;  2AWJ A;  4YGE B;  2HPW A;  1Y1X A;  4XJK B;  4DUQ A;  3SIB A;  3SVU A;  1C7W A;  1YX8 A;  4DRW A;  1CDN A;  1Y1A A;  2IB5 A;  3F45 A;  1BU3 A;  4DKN A;  1QAS A;  3NXA A;  1S1E A;  2M1K B;  1CMG A;  3NED A;  1GQM A;  4W6F A;  2BCA A;  4WRI A;  3ADF A;  1MR8 A;  2F2O A;  1E8A A;  4XYN A;  1JBZ A;  1DJG A;  4GPL B;  3DQI A;  2L51 A;  2JNF A;  2I94 A;  1JFJ A;  1AJ5 A;  4QJ5 B;  4XOW A;  1PVB A;  3LLE A;  2EMD A;  2WHT A;  2L98 A;  3SVR A;  2P6B B;  2QZ0 A;  4GUK A;  2CBL A;  1QX7 A;  3PM8 A;  2PAL A;  2Y0G A;  1BOC A;  1XFV O;  3BQ3 A;  3IQQ A;  2BBN A;  4YBH B;  4HRH A;  2OGR A;  4Q9W A;  2ZKM X;  2ZO6 A;  3EKJ A;  1NX1 A;  2L5X B;  1MUX A;  2JRF A;  2JT3 A;  5KTG A;  4KGE A;  2MJW B;  3TS5 B;  1AP4 A;  1A4P A;  1Z1P A;  1BF5 A;  4W6G A;  1HT9 A;  1U5I B;  2KI4 C;  3CFA A;  4PE1 A;  1DTL A;  4HRG A;  1CV7 A;  5BT0 A;  1UHJ A;  1UHH A;  4L9M A;  3I5G B;  3VGO A;  3PAL A;  3JTD B;  2H8Q A;  1J7R A;  3DQ1 A;  5I8N A;  1SPY A;  3U0L A;  4I2Y A;  1KWO C;  2DUH A;  1G33 A;  2F3Z A;  5CSI A;  1SBJ A;  4MZL A;  3E5W A;  4ANJ A;  4PHJ A;  4DXP A;  2K7O A;  1GL4 A;  1QX2 A;  5J2O A;  1YHG A;  5G08 A;  4IK1 A;  2KQY A;  2JOJ A;  4W6N A;  1K93 D;  5F6T A;  1JC0 A;  2AWM A;  1F8H A;  1R6P A;  4U2V A;  2KI6 C;  4PAL A;  1NWD A;  1YRU B;  1IRJ A;  2SAS A;  3CZT X;  5EXB A;  2KYF A;  1XMZ A;  1KQM B;  1TRF A;  1L2O B;  2V4E A;  1MF8 B;  2KAV A;  5BQL A;  2V4E C;  1DJW A;  2G9B A;  4AOM A;  1IJ5 A;  2V53 A;  1F70 A;  1XAE A;  4XVP A;  2PSR A;  1YX7 A;  2CTN A;  4ZIN A;  3I5I C;  2M7L A;  1RWY A;  3DQM A;  2BCB A;  5AXI A;  1KFX S;  4M2Q A;  2DD7 A;  2VAD A;  1HCJ A;  3UG0 A;  1B8C A;  2P4M A;  2HGD A;  2LCP A;  1PSB A;  4QJ3 B;  5HBD A;  3A4U B;  2YE1 A;  5J3X A;  2G6E A;  1IQ3 A;  1A2X A;  1UHI A;  1DGU A;  2BL0 B;  2OTB A;  2KFH A;  2L4I A;  4AQJ A;  5H87 A;  4ZIO A;  2E30 A;  5BPJ A;  1W7S A;  3DQJ A;  2JTT A;  4NDB A;  5LK4 A;  1PVA A;  2YDZ A;  1ZAC A;  4XL5 A;  2JTZ A;  4W6B A;  2EGD A;  1MXL C;  3SVE A;  2KI6 D;  2K7D A;  1OXF A;  4W6T A;  3CLN A;  4ZCV A;  4C0K A;  5KSZ A;  3GJ2 A;  5HZO A;  3SST A;  2HCG A;  1XVJ A;  1KFX L;  1PRW A;  3PLF B;  4RTC A;  3DQ9 A;  3DPW A;  1QYF A;  5H88 A;  4B5Y A;  3GJ1 A;  2KAX A;  3BXA A;  3VHT A;  3TDI A;  5FVI A;  4FQO A;  5HKW A;  4Q9X A;  1YZW A;  5EHU A;  1M46 A;  2K2A A;  2AHA A;  2Z1O A;  2WND A;  4KF4 A;  1H8B A;  1CLB A;  3W1D A;  1DJX A;  2K7B A;  5PAL A;  2GGM A;  1WLZ A;  2JZI A;  2M0R A;  4Z4K A;  1NSH A;  4MRX A;  1J7O A;  1CFD A;  4Z4M A;  2Y4Q A;  2BTJ A;  1K96 A;  2KBM A;  4ZF3 A;  1XFU O;  4ZF5 A;  2DOQ A;  1CFP A;  2KFF A;  1NIW A;  3EVU A;  3C1V A;  1CTR A;  4OKH A;  3O78 A;  1YVL A;  1BFP A;  3ZWH A;  2BBM A;  5DKR A;  4EDS A;  1QY3 A;  3WNX B;  3EVP A;  1QLK A;  1B7T Y;  2NXQ A;  4RYS A;  1TTX A;  4PFE A;  1R2U A;  4W6D A;  4KW4 A;  2KDH A;  2GX0 A;  5ER4 X;  1SR6 B;  3RWT A;  3ZNI A;  4NDC A;  1JBY A;  1BMO A;  2WUR A;  2GV5 A;  1S26 D;  4DS7 A;  3HCM A;  3O4Y A;  4IK3 A;  3ICB A;  1CM4 A;  3TUY B;  1JSA A;  5I2Q A;  3SV5 A;  2DUI A;  1Y1U A;  3A8S A;  3LL8 B;  4HE4 A;  4PPL A;  1BOD A;  4A4C A;  1H6R A;  1F09 A;  4BY5 A;  5EBJ A;  2BL0 C;  2H5Q A;  1EJ3 A;  1NX2 A;  4Q7T A;  1C07 A;  5DRF A;  1CB1 A;  1RM9 A;  1CDP A;  3NT3 A;  3SSK A;  1OZO A;  1BG1 A;  1TOP A;  3CWG A;  2MA2 A;  2JU0 A;  4YGB B;  2MLE C;  2MLF C;  1B4C A;  1PK0 D;  2O29 A;  5CSN A;  4W7R A;  1EMA A;  1DVI A;  1G8I A;  2LE9 B;  1IJ6 A;  1N0Y A;  3PJ7 A;  4YGD B;  4MLW A;  4GES B;  1JFK A;  3IF7 A;  2O24 A;  3JVT B;  1EH2 A;  1YUU A;  3LVD A;  3DQC A;  2H61 C;  3SSP A;  5D69 A;  4IZN A;  1J7Q A;  3BUN B;  4QJ4 B;  2BCX A;  1ZGO A;  2A46 A;  3NF0 A;  3NEZ A;  4P2Y B;  5CSF A;  4ORA B;  3WLD A;  3VRP A;  2LNK A;  1IGV A;  1GFL A;  1ALV A;  1MOV A;  4MSP A;  1EME A;  1YFP A;  1EXR A;  3GB3 A;  5LTR A;  1TN4 A;  4W7F A;  1SL7 A;  5T3I A;  3U8P A;  3BOW A;  2VRG A;  4AR7 A;  4DXQ A;  2ZFD A;  1RRO A;  2KGB C;  4JFG A;  2WOS A;  3S05 A;  2KI4 B;  1Q4B A;  1Y0V H;  1FBV A;  2LM5 A;  2M7N A;  2Z6X A;  4EUL A;  1N2D A;  2BE6 A;  1XFY O;  1NCZ A;  3BUO B;  3O2P A;  2CXJ A;  2Y1M A;  5DTY A;  3EK4 A;  2LLU A;  1CFC A;  4N3D A;  3O6B A;  2K0J A;  2OKY A;  3MSE B;  1K95 A;  3BXB A;  3SVB A;  1TNQ A;  3O77 A;  1KWO B;  2DUE A;  4BY4 A;  3U8A A;  1TNW A;  1UP5 A;  2EMO A;  5EJU A;  4W6C A;  1F4Q A;  1QX5 B;  2GW3 A;  4WQ3 A;  4W7A A;  1SR6 C;  4DXN A;  2B3Q A;  3LVC A;  4KPI A;  2NZ0 A;  3M22 A;  2HF5 A;  3AKB A;  2HET A;  2MHH A;  4OV2 A;  3SSY A;  2OTG C;  3P8U A;  5FVF A;  3TUY C;  1YVH A;  3SG6 A;  1MOU A;  5HZS A;  3H1R A;  1KK7 Z;  4ICB A;  5D7F A;  2WHU A;  1QYQ A;  4GF6 B;  2M9G A;  5DKN A;  2H5O A;  2G3O A;  2V4E B;  2Y5I A;  2K7C A;  1K8U A;  4W72 A;  3AKO A;  4W7E A;  3KCS A;  2KFG A;  5AER A;  1EML A;  3I5I B;  5LTP A;  1QVI Y;  3KEV A;  1L7Z A;  4ORC B;  1A03 A;  4F0Z B;  1GGX A;  1DJI A;  4I5K A;  3DVE A;  1W7I B;  3DVM A;  3RM1 A;  4N5X A;  2ZNE A;  4J8A A;  1SCV A;  4W6S A;  4IK8 A;  4H3M A;  5DTL A;  1NCY A;  1Q4C A;  2Q4U A;  1DT7 B;  3I5F C;  3JVT C;  4AS8 A;  1RFJ A;  1F71 A;  4D1E A;  1BJF A;  4W76 A;  4MRY A;  2NCO A;  1MXE A;  5GQQ C;  1QIW A;  2B3P A;  1JF0 A;  3U0K A;  4E68 A;  1M39 A;  1K9K A;  1B9A A;  1IKU A;  2EC6 C;  2LMU A;  5KTY A;  2JXC A;  2K2F A;  1IH0 A;  3AI5 A;  1PUL A;  4HQC A;  1WY9 A;  2JAD A;  3CBE A;  2M97 A;  4JPZ B;  2QAC A;  2HRS A;  2AH8 A;  3U0N A;  5DQM A;  3WCK A;  3WXA A;  2OTE A;  2G6Y A;  4P76 A;  4XOV A;  4ZCU A;  1WDC C;  1LA3 A;  4DXO A;  4LJC A;  4BDU A;  3VHT B;  1C4F A;  2LC5 A;  1ODB A;  1JBA A;  2QLG A;  2WC8 A;  3M0W A;  2LVJ A;  1CNP A;  3SSL A;  3DQD A;  1SW8 A;  3VRO A;  1UHN A;  3VRN A;  1EL4 A;  1V1G A;  3DQK A;  2CCM A;  1DJY A;  5HLV A;  2O2B A;  1D1O A;  5H89 A;  2H5P A;  4HQ8 A;  2KHN A;  1YTZ C;  2HQZ A;  4YI9 A;  3QRX A;  4M2P A;  1GJY A;  3NSK A;  3M24 A;  3SG5 A;  2JT0 A;  1MQ1 A;  2EHB A;  2D8N A;  2QLE A;  2SCP A;  4Q7R A;  4R6D A;  2HPS A;  1QTX A;  3G9A A;  4CLN A;  3ZUF A;  1ZMZ A;  2KGR A;  2KQ6 A;  1S5G Z;  2GW4 B;  2LMT A;  2OS8 C;  1QLS A;  4DKM A;  2OKW A;  1KCY A;  1OZS A;  1J7P A;  5JJG A;  2VVI A;  3CB9 A;  2YFP A;  1CDL A;  1CKK A;  2G5Z B;  1Q4E A;  2HFC A;  5HLO A;  3BUW B;  4EDO A;  1JC2 A;  1OE9 B;  1XYD A;  1KK8 C;  2Q57 A;  3H4S E;  1K9P A;  5AEQ A;  4W77 A;  1ZFS A;  1NCX A;  1IG5 A;  4L13 A;  1PSR A;  1WRZ A;  1QAT A;  2JQ6 A;  1YR5 A;  1BT6 A;  5DPG A;  3CFF A;  4XGY A;  2FWQ A;  4CFQ A;  2AUC A;  1WLM A;  4LW5 A;  4PHN A;  1ZUZ A;  1KYR A;  1S36 A;  5CSJ A;  2Q91 A;  4J88 A;  1DJZ A;  4NWS A;  3TDU A;  2EMN A;  1UUS A;  4DCK A;  1TIZ A;  4OQW A;  4PE7 A;  3D0Y A;  2B1U A;  5CPV A;  2AWL A;  4ETO A;  3ED8 A;  3PAT A;  3TDZ A;  2A54 B;  1LKJ A;  2C9J A;  1NX3 A;  5HZT A;  4LQT A;  1OOJ A;  3DQ4 A;  1XO5 A;  5HGE A;  1CDM A;  2L0P A;  3FIA A;  1A75 A;  3OX6 A;  2WCB A;  2CT9 A;  4LJD A;  4PPK A;  3ST4 A;  3DQO A;  4LJD C;  4B30 A;  3ZUL A;  2LUX A;  1AVS A;  3BOW B;  2F3Y A;  1K90 D;  1GGZ A;  1S6I A;  5KU1 A;  4H48 A;  1MWN A;  3KO0 A;  2FZU A;  4GNK B;  4NDD A;  3SG7 A;  3OHM B;  1UIS A;  2H6V A;  2JXL A;  1EMK A;  1RJV A;  1EG3 A;  2LUC A;  1SYM A;  3OSQ A;  4P5O E;  4L12 A;  2FL1 A;  1B9C A;  3DQL A;  3GK4 X;  2IOV A;  1QJT A;  4MBE A;  3IR8 A;  4KF5 A;  4A4B A;  3DQ3 A;  4ZFS A;  1SKT A;  3ST3 A;  1OMV A;  2G2S B;  1ZUX A;  4KF5 C;  1OMR A;  1F4O A;  2ARL A;  2A53 B;  4IK5 A;  2LAN A;  5AAN A;  4N1F A;  2PXS A;  4ZBL A;  4OY4 A;  2IB6 A;  4KEX A;  1MHO A;  3U0M A;  4KGF A;  4MEW A;  4PE0 A;  3SG2 A;  3WLC A;  4OR9 B;  2OTG B;  1TCO B;  3DQ7 A;  1BLQ A;  2LHL A;  2ZMU A;  1SY9 A;  3VRR A;  4I5L B;  4W6J A;  3SVS A;  2Z6Z A;  2LP2 A;  1AUI B;  2ZN9 A;  3K1K A;  1DGV A;  4GBA A;  3LSA A;  4HSZ A;  3ST0 A;  2ZRS A;  1OXE A;  2I7A A;  3BUM B;  5DQB A;  3NSL A;  2AAO A;  1JF2 A;  1HUY A;  4IK9 A;  3OGO A;  3K21 A;  4ORN A;  3WHU B;  3CS1 A;  1XFW O;  1B1G A;  2KOT A;  3NSO A;  3KHE A;  4W74 A;  2R2I A;  2K8M B;  4HVF A;  5BTT A;  3DQE A;  2O60 A;  1LA0 A;  2BKI B;  5K89 A;  3I5F B;  1G4Y R;  2HJO A;  1FPW A;  2AWK A;  3OP0 A;  1XK4 A;  1RTP 1;  3CGL A;  1XK4 C;  3ST2 A;  2F33 A;  1KSO A;  2ZND A;  4I5N B;  3BYA A;  2A50 B;  4H3N A;  2QRF A;  2WSN A;  2JPT A;  3DQF A;  2ZO7 A;  1OMD A;  5FYX A;  3AAJ A;  4W7C A;  4DIR A;  5I2O A;  3OB2 B;  1M63 B;  2JWW A;  2PXW A;  3CTN A;  2EC6 B;  2DUG A;  1S3P A;  2LLT A;  4UTS A;  3UFZ A;  4YI8 A;  1JUO A;  4W73 A;  2M29 A;  3A8R A;  4CID A;  3PIB A;  1J55 A;  2RH7 A;  1S6J A;  2Q6P A;  3ZUJ A;  1VRK A;  2M49 B;  1Z1Q A;  3VIC A;  4U8D A;  1RMM A;  1J1D A;  1OXD A;  3CR5 X;  3SSV A;  1DF0 A;  5HW9 A;  1WDC B;  3FS7 A;  2E6W A;  3LF3 A;  3EVR A;  3E3R A;  1KFU L;  1NYA A;  3SIA A;  1REC A;  1XFZ O;  2WOR A;  2QLG B;  2JNX A;  1KYS A;  3OSR A;  1EG4 A;  4JEO A;  4Q7U A;  1QV1 A;  2ZRT A;  5AQB B;  3PN7 C;  1M45 A;  3DPX A;  1YUS A;  2A56 B;  1CFF A;  2DDD A;  4JC2 A;  1K9U A;  4L1I A;  1Q4D A;  3DF0 A;  3W1C A;  4H3L A;  2QU1 A;  3ZTF A;  1W7T A;  5DTZ A;  2M1U A;  3VK1 A;  1YRT B;  1RRX A;  2GGZ A;  3KPX A;  4MVF A;  4Q04 A;  3SVN A;  3AI4 A;  2FJU B;  3RLZ A;  2NLN A;  2POX A;  4W6P A;  1EMM A;  2KBI A;  2OS8 B;  4CPV A;  4AQI A;  1A29 A;  2VVH A;  1YUR A;  4PHK A;  1RMO A;  4KAG A;  2M8U A;  3E5V A;  1QIV A;  1EMB A;  2A47 A;  4W6L A;  1NX0 A;  4GGN A;  3BXK A;  2LVK A;  3DQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...