3EKLA

Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
345
structure length
333
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGLYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalysis of a tetrameric class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase
total genus 134
structure length 333
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3eklA00
3N14A 3UPBA 2V5LA 2FB3A 3STCA 3C2EA 5C54A 2X1RA 2WV8A 4JX5A 1ZFJA 1ME8A 2A21A 5LSMA 3FKKA 3ANYA 5L9FA 1Z41A 2ISSA 2OMAA 1IXOA 3W7QA 2P10A 3EXRA 3ZWSA 3W1MA 5I3FA 4GE8A 1TV8A 4IMGA 5H2ZA 3LV5A 3SGUA 5HWJA 5CZSA 4NUWA 2Y7FA 4YL2A 3C56A 5G1TA 2E68A 4NJKA 3O8AA 3S9YA 2JKAA 4O4VA 2YGYA 3STEA 3W9ZA 3NO5A 4AWUA 3H53A 1MEHA 1NAL1 5G2HA 5G5IA 4K36A 1ADOA 3LHWA 1LRTA 3GKFA 2XN0A 4N6FA 1FX6A 4JTGA 1OG0A 3W7RA 4GC4A 4XBKA 7TIMA 1N55A 1YPIA 5D2YA 1VHCA 4HSNA 1QO5A 3T78A 1AL8A 2V8ZA 3GAKA 4O18A 5A5WA 3A21A 1S5VA 4UXDA 3P81A 1D3HA 2QCLA 1H63A 3QRHA 3CT7A 3QW4B 4LVDA 4UMBA 2AAMA 3T40A 1P1XA 3LI1A 4EF8A 3RLUA 3MI3A 1KM3A 1Z48A 3FLUA 2Y63A 2QCGA 4N4QA 3LLDA 2RHGA 3W1UA 2HTMA 2RDWA 3BV4A 4XBSA 4JIQA 1TTIA 4UTJA 5KSWA 3S5ZA 3B0VC 4AWTA 3QC3A 3JS3A 1GJPA 1EIXA 3NQVA 1EUAA 2E5DA 2R91A 1GT8A 4ZQNA 3CM4A 4DBEA 1KBJA 1LBMA 3S5OA 1XBZA 5LHEA 2Y89A 5U4NA 3PR2A 1TB3A 4GUHA 4RZ4A 3SIZA 2FFCA 2VXNA 3GVGA 4MZYA 1M6JA 3BARA 1B3OA 2WKJA 1G6CA 2YX0A 5KZDA 2QCDB 4HKPA 4UFHA 4NXKA 3CEPA 1TYGA 2OX1A 5CPMA 1RVGA 3P61A 1X7FA 4OE7A 3W74A 3HIJA 3ZS4A 3NQDA 5D2WA 1Y0EA 1HO4A 1F6KA 4LVAA 4DF2A 1G7VA 5ABTA 2VEPA 5EKYA 1AG1O 1JRBA 1OX6A 2VELA 3MJYA 3MHFA 1EB3A 3BG5A 2C0AA 4LU0A 3NL2A 1VYPX 4FX8A 1I2RA 1RV8A 4M19A 3W76A 3W7HA 3SR7A 2FPTA 3G1SA 2E5BA 5AHLA 1HFBA 3LCLA 4LVBA 4OT7A 1JUBA 3HOJA 4AHPA 4Y8FA 1UJPA 2TYSA 2A6NA 5D03A 1H7XA 3O16A 2YFOA 3PBUA 1CW2A 5AYYA 3DI0A 2EGZA 1I2QA 4GXMA 3HPZA 4IMFA 4JEQA 1UUMA 3U2OA 4MKNA 1OFAA 1YPFA 3PUEA 3BGJA 4LTSA 1QFEA 3RK8A 3TSDA 1FWRA 1KM2A 3PG9A 1F2JA 4TU1A 4CLMA 1XBXA 1VQTA 1T99A 4WOZA 4FO4A 4O16A 2WPBA 2ZA3A 1L9WA 1WAUA 4RXFA 1PHQA 4CCDA 4MPQA 2XN1A 5CPOA 5IBXC 2H3BA 3MW7A 4RKAA 1K03A 1RQHA 1R47A 4K7YA 3GDTA 3TK7A 5F2IA 1FCVA 3W7EA 5EPDA 2ATMA 2B0MA 1VJIA 3S8HA 3W1LA 3MP4A 3H55A 3FJLA 3PG8A 3F4NA 1TPVA 1QPNA 3LHYA 2DJLA 3C8FA 4FNQA 3DKJA 3BLIA 1BTMA 2J9XA 5LNVA 2J88A 2YR1A 1TTQA 2ZZ2A 3E02A 2EF9A 1K3UA 3PSWA 1EP1A 2NZLA 1XL9A 3R13A 1U83A 1ZAHA 3IGXA 1XXXA 3E96A 3DFPA 3W88A 4UTKA 4OU1A 5T26A 3MI6A 1W0MA 3S5YA 1VH7A 1Q3NA 1TTPA 1SO6A 4XUGA 4IJBA 2W79A 3IVTA 3CIXA 3FOKA 4GUJA 5LNRA 1NVMA 3W7GA 2GVJA 1JCLA 2R94A 5A8GA 1VYRA 3W2JA 1AMKA 2JKPA 1OFQA 1X1OA 4Z08A 3EWBX 3DXIA 2CLHA 2G96A 2QF7A 4H3DA 3P82A 3LCGA 1K7XA 1FY6A 5K4ZA 1W5NA 1YADA 2ABBA 4JY9A 2VKZG 4WY0F 4HNUA 3TSBA 2X1TA 3LOTA 2Q3RA 1W54A 5D38A 5HMSA 1TPFA 1WBHA 1VR6A 1PCWA 4R53A 3VE7A 1I45A 5IM51 4GRSA 4PC8A 4K6AA 2QCDA 4MZ8A 2Y6ZA 3O63A 2JK2A 4GNJA 4O17A 2V9DA 4N9EA 1Z44A 3P8IA 4HIBA 2ZZ7A 3LXCA 1IXPA 3KOFA 3H54A 2C16A 2X1SA 3DU0A 3W1AA 3VFLA 3R2GA 1FWSA 1N7KA 3DFQA 4E2BA 4NX0A 4AHQA 5K2ZA 1GQNA 3PUDA 3G22A 4HNTA 1ZENA 5J5RA 5AHMA 3P5YA 2C6QA 5G2IA 1EA0A 3NPWA 2YFNA 3MYPA 3V1PA 4RJEA 1H7WA 1F6PA 1J4EA 5I3IA 1XKYA 4AXKA 1VCFA 2CZEA 1OYBA 3LBCA 1JCYA 1KBIA 1O5KA 2A7RA 3LRLA 4A21A 3F1QA 4IXXA 5K3VA 3O07A 4N9CA 5CSSA 1WQ5A 3T4CA 4UTIA 1QOQA 1AK5A 3G1HA 1OX4B 4IPJA 2DZWA 2FIQA 3HB9A 2CZ5A 4X3ZA 3M0ZA 4IQLA 2RFGA 1V5XA 4WXZA 1JCNA 2ZZ5A 1PL9A 1PE1A 3NVTA 1TJPA 4IWWA 1XDMA 3WK3A 5G2WA 4M6VA 4JN6A 3IVUA 3WK0A 4WJEA 3VE9A 4NJHA 3QEZA 2QDGA 3LM7A 3PB0A 5K7JA 5E1QA 4NX5A 3QJAA 2ZQ0A 4MY8A 3N9RA 4NZJA 5AC8A 3R5EA 3ABRA 5FI8A 2J9ZA 4RXGA 3EX2A 2CZFA 3TW7A 1YDOA 5CZJA 1X6UA 3BGGA 2I1OA 5KZEA 1VCVA 1ZCOA 1CX9A 3MP5A 4M6QA 5D02A 3PBVA 4O57A 2AGKA 1TMHA 2Z0IA 4KFPA 5CZ0A 1I2PA 1OX4A 1TO3A 3FA5A 3CWNA 3TROA 4NZFA 4Y90A 1G7UA 4OV4A 1A5CA 4LNYA 3NZ1A 2C18A 3W7OA 1PHWA 1TRIA 4AWSA 1WOAA 2E1DA 1KV8A 3EWYA 1OFEA 4UNKA 4K37A 3N3MA 3CU2A 4DXVA 2QKFA 4O8RA 3QSRA 5AHNA 3UWUA 1JCMP 4RK8A 2ZRUA 2BX7A 3FYPA 5F4XA 1SZEA 3EWXA 3JRKA 1TTJA 4EIVA 1X1ZA 3QQ1A 1AW1A 5D32A 3C2OA 1EX5A 2RDTA 5FESA 1ZALA 2EKCA 1JULA 2CWNA 1ALDA 1MSSA 4EWND 2GJLA 2PRHA 3LV6A 4TMCA 1JR1A 3KVJA 4N02A 2PCQA 2CLKA 5D37A 3L68A 4U4MA 4GJ1A 4I9AA 4NVTA 2A1YA 1R46A 1U5JA 3W1PA 4YXGA 3NGJA 3KXQA 1Q6RA 2DU2A 2CLMA 3PM6A 5KITA 1TPEA 3S0CA 1SSGA 3BK0A 1YTKA 3NM3A 2QR6A 5CZTA 4X2RA 4IMDA 4LRSA 2YZRA 5FF7A 1H62A 1H7NA 4G1KA 5KMYA 3UD6A 1FWNA 5HUOA 5HR6A 4M7TA 3CQ0A 1TQJA 4ZQPA 4JTUA 2PRMA 3W7KA 2LLEA 1SFJA 3G24A 1TPWA 3W2NA 3GDLA 3KHJA 4QNEA 4RZ6A 4AB4A 2OZ0A 3B8DA 1Q6OA 3TJXA 3IIOA 3NQFA 1KFBA 2YCEA 4IX0A 4ONVA 2KZHA 1JJKA 4XTDA 1DORA 1SUXA 2E77A 1VZWA 4UMCA 4LC8A 2C15A 3IVSA 1W3IA 3E12A 4QAIA 3WJWA 2GJNA 2YSWA 1KTNA 3IIVA 4TMBA 3AO0A 1H61A 5F2GA 2W0UA 1JQXA 3QPYA 1SQ7A 1L6SA 5BOOA 2B7QA 3EX1A 3L0GA 3M1ZA 3PAJA 3RMJA 2NX9A 4AH7A 5HR7A 4UTMA 3QH2A 3M16A 3FYOA 2YYTA 3SFKA 4XTIA 1GVOA 3EX4A 3LRKA 4S2BA 4B5NA 3GXNA 1VS1A 4BF9A 3GAYA 4QQ3A 1QOPA 4LUJA 1JCXA 1WA3A 4ZVJA 1B9BA 4CNPA 5E0KA 3Q2DA 3LCIA 5K9XA 1TPC1 2TRSA 4PODA 1OYAA 2VFEA 5EA9A 1ME9A 3TAKA 2GQAA 3TX9A 1F7BA 3IV3A 1BEUA 5DXXA 3UXDA 4N4PA 3TU9A 3LCXA 2TSYA 3PVFA 1F73A 1DBTA 4UTTC 1Q6LA 2OT1A 2NXGA 3DBPA 3GK0A 3W1XA 1KFKA 1WYIA 4RLIA 1ONRA 3W23A 4Y6GA 4AMAA 4TIMA 3ATZA 4O1BA 3IEBA 3T7VA 5HNRA 3W86A 2ISVA 3BVJA 1I8JA 1DKWA 3MI2A 3E49A 1QAPA 2J24A 4JTKA 3G0UA 3DHDA 4IOTA 3OBKA 4TX9A 1M7OA 4QNWA 1H51A 3KVKA 5HINA 2NXHA 2WQPA 4DO4A 4PL2A 3SGZA 4DF0A 3YPIA 1FXPA 1M7PA 2DZPA 3TV8A 4ADTA 4HPJA 4ORIA 2GVLA 3P84A 1IGSA 1VCGA 3F03K 5CPNA 4O0ZA 1ICPA 2ZYFA 2V2DA 2ZRXA 4XWUA 5FF0A 2BZNA 4PEKA 1C8VA 4DPPA 1LOQA 1KTCA 5AHEA 1WXJA 4FIQA 1TPUA 5AN7A 2A5HA 3DH7A 3G3MA 2E6AA 3IGSA 4N9DA 5D33A 3W3OA 3TJLA 4JTEA 3FIGA 5CGQA 3M5XA 3NPXA 4LW7A 5DELA 3BLEA 3BW3A 2FPVA 1PS9A 1SZFA 1YDVA 3CWOX 4OWGA 4IMEA 4JTIA 3HG4A 1DVJA 2YXGA 5BMXA 4FX7A 3JR2A 3VNDA 1YXDA 2RDUA 4K39A 1H7OA 1GEQA 4UR7A 2VC6A 5HUPA 4Y96A 5AYXA 5AC7A 4LS2A 2VEIA 2QCFA 1QR7A 1BWLA 1XDLA 4JICA 5AC6A 1HO1A 3W2LA 1KM4A 4MYAA 2G97A 3M43A 4RV8A 3HO8A 5G4EA 2DZSA 2VEKA 1XBYA 1DHPA 4CQAA 5H91A 3ATYA 3OG3A 3NQ7A 2E6YA 2V82A 5EBUA 5TBOA 2XFWA 3ZFHA 1TCDA 4QSHA 1QNVA 1H1YA 1GZGA 2V5BA 4P61A 4LS0A 4NJIA 3TAOA 3UZ5A 4FB7A 3W85A 3M5VA 5LZLA 3W7JA 3S1XA 3TW6A 4MOZA 3W22A 3F4WA 4O11A 1W37A 2NWRA 1C29A 3UWQA 5F2MA 4YLWA 3W71A 3B06A 2X2GA 3DGRA 3IGUA 3LHUA 2CZDA 3TQKA 3UQNA 2GUUA 3L2IA 1KFEA 2E6DA 4JTTA 5BMWA 3N2XA 5AFDA 3G0SA 3PUOA 4KFNA 3MP3A 2R8WA 4NNCA 3LX9A 1YLVA 5IBXA 4MVAA 3EWUA 3PWAA 4DO5A 1QPOA 1VPXA 3DI1A 1W5QA 2QJHA 5HWNA 2GOUA 3LTSA 2UV8G 3MWAA 4WOQA 3P62A 3RU6A 1LZOA 1W5MA 4M7SA 3C0JA 2HMCA 4JIPA 3CTLA 1KM5A 3TMLA 2TPSA 3E9AA 3GX9A 1WBJA 5CKSA 4ICNA 1NFBA 4BI7A 1LP6A 3TDFA 3TFXA 2C14A 1UASA 1W3TA 4ZL1A 3K30A 1OHLA 3TXZA 3GR8A 4UR8A 1XI3A 4NU7A 3DAQA 3TR2A 1ICSA 2RKXA 1WX0A 3LXAA 4O1CA 4MLJA 3O6DA 1G4SA 1SO5A 3TC6A 2Y61A 2J27A 3C3NA 3LTPA 1GYLA 1TV5A 1ZNNA 1VYSX 3HPSA 3THQA 3IRDA 4PH6A 3CB8A 3I7SA 3NL3A 1PV8A 2G5WA 4Z0SA 4GUGA 2NUYA 1YXYA 4U28A 3IIPA 3L5AA 3QW3A 4OV9A 4P2VA 4UMAA 1SPQA 1G4PA 4FF7A 2VFIA 4HNNA 2OJPA 3EXTA 3SY5A 3M5YA 1QWGA 3B0UX 2I14A 4MJZA 3I6RA 3A22A 2FDSA 4JYDA 1UUOA 4WUIA 2J6XA 4IUOA 1JQVA 2WNNA 1YYAA 2C3ZA 1NF0A 3QMRA 1ME7A 3O1NA 1KA9F 2YW4A 1GVFA 4XZ9A 4GBUA 1DQXA 2Y62A 3MBFA 3EX3A 1H7RA 1AW2A 3UPWA 2ISWA 1JUKA 1PCKA 2ZA1A 5HQEA 1QPQA 4ZMGA 4HPXA 5KZMA 3G3DA 4LS1A 4LY8A 1LRQA 3L5LA 5DLCA 1OVDA 3L21A 2NV2A 4GUFA 3QM3A 5DY3A 1MXSA 5HWMA 5C2XA 3PBWA 2VOMA 1EP2A 2CLLA 3NAVA 1JCJA 3P5ZA 5GVJA 3W70A 1L2UA 2EPHA 4QISA 3W1NA 1R2TA 3UYCA 1K7EA 4QM1A 3QF0A 2EAWA 3IIZA 4RR4A 3SECA 2AQWA 1OK4A 2ZRWA 3C4UA 3G18A 4KWWA 3P60A 3PY2A 4CCCA 1CI1A 3HG3A 4AF0B 1FCQA 4O15A 3B04A 3W87A 5EMUA 1DQWA 3O05A 1RR2A 2ABAA 5I3GA 4YWIA 3M5ZA 3LRMA 2HS8A 1T0OA 2NXIA 1O60A 3G1YA 2YDAA 5DY2A 1MEWA 1SU5A 3NQCA 3OEXA 4UFJA 1K7FA 3KVMA 4BI5A 1DOSA 1FCBA 3A9IA 3TUUA 2QAPA 3TQVA 1ZAJA 3GYEA 3TIMA 4NNBA 4ML9A 4A22A 1JVNA 1GVQA 1XC4A 4ZZ9A 3S6DA 1XM3A 1O5XA 3NQEA 4FNRA 1EP3A 4E2DA 1XFBA 2ZRYA 1KTBA 4O12A 2JGQA 2WO5A 1LCOA 1OJXA 2QCNA 3NL5A 3T44A 1P5BA 3VI2A 1DV7A 3NR0A 4PA8A 4MY1A 1Q45A 2PC4A 3NQAA 3Q94A 4O52A 4E0CA 4UTUA 4UTLA 1ZAIA 3L66A 4EVZA 3DFSA 3G1VA 1XUZA 4D2JA 3NZRA 3CIWA 1O95A 3WK2A 4LVFA 3DHFA 2P1FA 4TO8A 1VC4A 5CG7A 4ORMA 4CCEA 1Z42A 1LORA 4JTSA 3Q58A 5LNWA 4GFSA 4ALDA 2R14A 3G1FA 3NEVA 5AYZA 4FXRA 1HL2A 1GVRA 3A24A 2HS6A 4Z0JA 3NM1A 5F1VA 1K8XA 2ZZ3A 1H5YA 1UB3A 4MIMA 2Y88A 1TV7A 1D9EA 2H8XA 2ZA2A 4FXSA 4ZQOA 5HULA 2QAFA 5I3HA 4YCPA 5AHIA 3LXBA 3WJYA 4MJMA 3HGOA 4UFIA 4UTTA 1GG1A 3C2FA 2VFHA 3HG2A 4JX6A 2ZFAA 3L0NA 2QUTA 4QJ1A 3SJ3A 4AVFA 2HSAA 4O19A 1LBFA 3W1QA 3HGJA 4WZHA 3PULA 5FEXA 2E09A 2W6RA 3LCWA 3TH6A 5G1YA 4I7UA 3V75A 3W83A 3KRSA 4DBDA 1G69A 3U6WA 3FEMA 4JXCA 4O4WA 2H3DA 3L0KA 1W56A 2Y70A 1V7YA 2ZTJA 4BWLA 1KM0A 4MUZA 3I65A 2A6LA 4RCXA 2WSYA 4Q32A 2Y7EA 3RFAA 4PL1A 1AL7A 2D73A 4R7JA 3WJXA 4PFMA 2QCEA 3BO9A 4JNMA 4N9BA 1ZY9A 1VLIA 1NEYA 4FNPA 4UTWA 3W2MA 2VEMA 3W7PA 1GG0A 3M41A 4XKYB 3STGA 1FXQA 2F84A 5G4WA 4YCOA 3DFNA 1EEPA 1H60A 3INPA 2H90A 1QPRA 3NA8A 4S2CA 4DO6A 1ZHAA 1K8YA 3FJ6A 3OHIA 1KM1A 2QEZA 3TE9A 4ZQMA 1K02A 3FS2A 3C2RA 2Z6JA 2FPYA 1MO0A 1EWDA 3C52A 4I7VA 1J2WA 3HMJG 3KFTA 3LTYA 3UWZA 4CNOA 5D2XA 1RZMA 4FX6M 1EUNA 4EF9A 3HQ1A 3TSMA 3QPZA 4K8EA 2X16A 2Z2UA 4QITA 2H8ZA 1LYXA 1FCUA 2YPIA 5LKYA 4XKYA 5DCDA 1I4NA 3N34A 1A5BA 2GVGA 3L67A 5AB3A 2GQ9A 2JGYA 4Y9AA 1O4UA 1EPXA 1F5ZA 1GPWA 3W84A 3UXAA 4AEOA 3P80A 2ZZ4A 1XBVA 3G1XA 1GWJA 3UWYA 5L6UA 4RZ5A 5E93A 4H4IA 1KV5A 3GNNA 1GTEA 3EWWA 4JY8A 1M5WA 2OT0A 3LB0A 1FBAA 2VENA 5C55A 3W7DA 4JDBA 3NPVA 2QCMA 4KKXA 3CEUA 4OQVA 3ABQA 5F4SA 3RNDA 3UWVA 2O7QA 2X1UA 4O53A 3W75A 1BWKA 2B4GA 4LC6A 1VGAA 4MYXA 2YW3A 2A0NA 1RQBA 3LHZA 4LUIA 2V2CA 3RF9A 3MBDA 1YDNA 2YYUA 3DFTA 1AW5A 3S1VA 2V2HA 4LV9A 1DJQA 2CLEA 5CPLA 3OVPA 1FDZA 3DZ1A 2QCHA 3TCEA 1TPB1 1F76A 2QUVA 1BKSA 4DF1A 5FF4A 1XCFA 4WD0A 2ZZ1A 2ZRZA 4R34A 4MY9A 2PURA 1TIMA 3MO7A 4L4LA 3UY8A 4FNTA 2ZCGA 5I3KA 5FEZA 4BWLC 1W1ZA 1LOLA 3EKLA 4OBTA 4PTNA 4JS3A 3A23A 2NLIA 1S3HA 5I3JA 1WV2A 3R12A 4MFDA 3LBMA 3WJZA 2BXVA 4A2SA 4DEFA 3GDKA 5DCEA 2DZXA 4Z1AA 2GPTA 1IIHA 4WY0A 3BPWA 2FLIA 4IXHA 1OFRA 1P0KA 5FF3A 1H50A 4Q4KA 1P4CA 4O13A 4WX2A 4POCA 5J5DA 3HJZA 1IF2A 4GUIA 3MUXA 1LOSA 4UUIA 3L9CA 3LGEA 2DZUA 3EX6A 3W6YA 3FFSA 3LERA 2WNQA 2CW6A 3FKRA 1WDWA 3GLCA 2EHHA 5D2VA 3W7NA 3EWZA 5CSRA 4H6KA 2C1HA 4JTFA 3MHUA 1TSIA 3M47A 1ML1A 3RLVA 1FDYA 3STFA 3GXTA 1LLZA 5K9DA 3BG3A 1S5WA 3G8RA 3W07A 4E38A 2WNZA 3LI0A 3O15A 4OGZA 3R8RA 3UY7A 3VCRA 3G1DA 3PS7A 2V81A 2PRLA 3LHVA 5LHFA 3HBLA 2ZZ6A 4Z1BA 3KAOA 1OF6A 3M6YA 1MZHA 3GR7A 2QUUA 3MHGA 1FWTA 1SFLA 3NQ6A 4KWVA 3P74A 4J9JA 2WSRA 2ZDRA 1LTDA 1UBSA 1KLZA 4AF0A 3TKFA 5LNSA 4NNAA 2QCCA 3L5MA 1SO4A 3TQ0A 4EOUA 3W1TA 2OCZA 2PE4A 4LOCA 4HNVA 3NQ2A 3NL6A 4FNSA 3G1AA 3GDMA 4N6EA 3LHTA 4JTLA 3C2VA 3CC1A 5AHFA 1B57A 3CLMA 3QZEA 3LDVA 4QIUA 1UCWA 4JGDA 3UNDA 4FHAA 1A53A 2X30A 1S5TA 4BR1A 1OFPA 3UWWA 5EY5A 2JBMA 3W2UA 3W7IA 3SZ8A 2RH9A 3B05A 3CHVA 5BNKA 5SWUA 2JKEA 4MFEA 1F05A 1RPXA 3TFCA 5K9CA 1J5TA 4CNNA 1GVSA 4X22A 4IMCA 4HHPA 4LRTA 5MHBA 2BSLA 5F1UA 1VLWA 4JYEA 2ZTKA 5D04C 4S1FA 2VFFA 1KM6A 2VFDA 4JYFA 3SI9A 3ABOA 4JD4A 3M44A 2IQTA 2Q8ZA 3TNOA 1DJNA 1OFBA 3GZ3A 4JTHA 1KW1A 3NNTA 1SZNA 3IIXA 3DFOA 3KRUA 3N73A 1SW0A 2P0OA 4NJGA 3EB2A 3DKLA 4C1LA 2NUXA 4UCGA 3QSTA 1YTDA 3ZR4A 1LBLA 4RX0A 3MMTA 2FTPA 2FQIA 1SW7A 4A2RA 2J9YA 2ZBTA 3N19B 3S1UA 5HJLA 3KX6A 3LCHA 2DZTA 3NQMA 1RQEA 1THFD 2V30A 4WXYA 2F7FA 3HF3A 4NT0A 5DXYA 1TQXA 1QDSA 3CPRA 2QJIA 2B7PA 4O14A 3M7WA 3NXFA 5C5YA 1F74A 4IPIA 4NJJA 3O6YX 3A5VA 1FWWA 5FEWA 4HN4A 4DQWA 1EWEA 3GNDA 3WK1A 1FQ0A 4O10A 3P7YA 4Q33A 2NX1A 3B0PA 5KTLA 4O0KA 3R89A 1PVNA 4O28A 4OHQA 1T96A 4M5PA 4WQ6A 4LT9A 4ZQRA 1OFDA 4UFKA 3GIYA 4JR5A 1JUEA 3Q37A 3W2KA 3I68A 3QQ0A 1TREA 3UZJA 4DELA 3KRZA 1OF8A 1GTHA 3QMSA 4BK9A 4ADSA 3S1WA 1XUUA 2Q8LA 2DJXA 5C6MA 3A5FA 3EKZA 4K7VA 4I7WA 4AAJA 5KINA 3TMQA 2VFGA 5F4WA 3NQGA 5AOUA 8TIMA 1W8SA 1L6YA 3NDOA 5DBTA 1QCWA 4O50A 3U8GA 1DL3A 2QJGA 2FJKA 3WFAA 1OK6A 1R2RA 1C9DA 2WOQA 4UIOA 4IX2A 3ELFA 3GDRA 1HG3A 3AJXA 4X9SA 2BLEA 4O1DA 5F2LA 5D09A 4PCFA 3S5NA 3WJSA 1IIGA 3PB2A 2DZVA 1YXCA 1P0NA 3THAA 2C13A 3QFEA 2O7SA 3N9SA 1B4KA 3P67A 4LV4A 1TPH1 3E0IA 1LM1A 1VRDA 4MLRA 4FNUA 1KFLA 3D0CA 3C6CA 1Q6QA 1W5PA 1SO3A 5LGXA 3HG5A 1IXQA 6ALDA 4K38A 2CU0A 1A5AA 2Z6IA 1W5OA 3VKJA 1GOXA 3G8EA 3GKAA 2ZRVA 1OX5A 4XQ6A 2NX3A 4JX4A 4R33A 4W9TA 1QMLA 1JRCA 2NWSA 2CLOA 3NQ8A 1FDJA 3S42A 3SW6A 4M6PA 1R2SA 2Z1BA 3OVRA 1G4TA 5D05A 3OVQA 2DORA 3TA6A 1TJRA 3EEGA 2DP3A 3KVLA 3USBA 3HGSA 4UTHA 4FIRA 4Z1CA 2CLIA 1SSDA 3MYOA 1KLYA 3G0XA 5K4XA 1A50A 1O94A 4MZ1A 1W31A 2NUWA 5EYWA 1LLWA 4L4MA 5BRBA 5DCBA 3B03A 4NQ1A 1RD5A 4IGHA 1OABA 1OYCA 4CQ8A 5EL1A 3I7QA 2E6FA 3QYQA 4TR9A 5U7SA 3O06A 1KFJA 1HUVA 4BFAA 3NPUA 3PF3A 1IXNA 2E5CA 2CFFA 4WY0B 2BTMA 4HT3A 1LROA 1A5SA 2B7OA 1T8XA 2CLFA 1SZGA 1TRDA 4ADUA 2TMDA 2WSQA 1SR9A 4AHOA 1L6WA 1GYNA 5TQLA 1SW3A 1OFOA 4UFMA 1G4EA 3OIXA 1HTIA 3SSJA 3L65A 1KFCA 2FB2A 2H6RA 2NV1A 3BG9A 2B7NA 4A3UA 4O54A 3W1RA 2Y7GA 2I9EA 1G67A 6TIMA 3NG3A 3W73A 3W7LA 3GB6A 3PC0A 4FEZA 4Z1DA 3BW4A 3W72A 2ALDA 5FEPA 3EXSA 3TXVA 2A85A 4UFLA 1B4EA 5DN1A 4O1AA 3HGRA 1H1ZA 5LNUA 1QO2A 3T55A 1VHNA 4LVGA 2WJZA 1W3NA 4LWWA 4KFOA 1PIIA 1I2OA 3NOEA 3QMTA 3C61A 3B4UA 1WOBA 3M9YA 5FF2A 4CQ9A 3LLFA 1YTEA 3LCFA 4C1KA 4ZQCA 4UTWC 2QDHA 5D2TA 3W7CA 4JDYA 4JTJA 3BLFA 5LGZA 1I2NA 2C19A 5D30A 1NF7A 3PSVA 5TIMA 2A7NA 2A7PA 1LDCA 2V0TA 3PBYA 3N2MA 3I7RA 2A2IA 1LRNA 3HPXA 4BI6A 1N8FA 4YMZA 3NYZA 3O6CA 1TPDA 4K8HA 5BW6A 3BW2A 1FUYA 1ICQA 1X8FA 4GWEA 1ZJIA 2A4AA 2G95A 3W7MA 3P8JA 1NSJA 4A29A 2Q3OA 4HSOA 4N2YA 3DENA 2ATSA 4UC5A 4NXSA 1R30A 2BWGA 2Y7DA 2XN2A 1H7PA 1D3GA 4DPQA 5DBUA 1E51A 3GXPA 2Y85A 3TC7A 4UNLA 1K8ZA 3ZWTA 3OA3A 3ABSA 1MEIA 2GQ8A
chains in the Genus database with same CATH superfamily
4XD3A 4HCLA 5C54A 2DVUA 3AHXA 5B7ZA 1XLEA 2XIJA 4AD1A 2A21A 1OT1A 4LCSA 2EO7A 4GVIA 2BNJA 5L9FA 1MFUA 3GW0A 1A3HA 1JD7A 4XX6A 1PO9A 1TV8A 3UP8A 2JIEA 5CZSA 4NUWA 1J0KA 3V16A 1ZJHA 4J3TA 1GW9A 2JKAA 4O4VA 1H1NA 3IAPA 3STEA 1J12A 1RUSA 4L56A 4PUDA 3H53A 1W1A1 4K36A 1ADOA 3GKFA 2XN0A 2OSWA 4JTGA 4ZXOA 1RXOB 1OG0A 3CV6A 3EKGA 3PPCA 1BTCA 2L5HA 1VHCA 3SN4A 3WNPA 4KH2A 4LFYA 1EKOA 4DVOA 2JF7A 1V4YA 1HJWA 3CT7A 4KWSA 4F40A 5ABEA 5DO8A 3T40A 1P1XA 1DPMA 4GNVA 3M46A 4L4PA 5C9UA 3HM7A 3MI3A 4JOMA 1Z48A 3U7BA 3FLUA 1J96A 1HJXA 4DWDA 3QHMA 4N4QA 4B5SA 1A5NC 2VX5A 2RDWA 4XBSA 4JIQA 5J04A 4PBFA 3B0VC 1R6WA 1GOQA 1EIXA 4X63A 3VGFA 1EUAA 2R91A 1GT8A 1VBJA 3K4DA 4I90A 4GI4A 4F9DA 2Z24A 4ZQNA 4JZ5A 1KBJA 3OLDA 5AKQA 3D47A 4MJ2A 2Y89A 4DM2A 4RZ4A 1TB3A 3SIZA 4WK9A 2VXNA 2PZ0A 2EBNA 3CO8A 1EJSC 1M6JA 3CH0A 1G6CA 3QLDA 4NP7A 1Z69A 3QGKC 3RJYA 3CEPA 3NDYA 4UZUA 1X7FA 1S39A 3R11A 3S2JA 3K5XA 3QTPA 5D2WA 1Y0EA 3WN6A 4MSSA 1G7VA 3S83A 1AG1O 3VM7A 4X9YA 4W86A 4E3VA 1JRBA 3BC9A 1PKLA 1TG7A 4MUPA 1OX6A 2VELA 3WUGA 3MJYA 2PP1A 2VDHA 1F9CA 1C8XA 4LU0A 1K70A 4FX8A 1K9TA 3A4WA 4XZHA 3GTHA 4O0QA 4WEVX 1DXEA 2BBFA 1UWTA 3ZJ6A 2A6NA 4DJFD 7A3HA 5CLWA 1CW2A 2XTKA 2EGZA 1I2QA 3VZXA 2V67A 3U2OA 4MKNA 3GFZA 2WM1A 3BGJA 4LTSA 1QFEA 3IANA 3TSDA 1FWRA 2D23A 4IJRA 1UP3A 2OWWA 1WP6A 1KM2A 1F2JA 3WQFA 5LIYX 1XBXA 1VQTA 4WOZA 4FO4A 1VBHA 1L9WA 4KERA 4CCDA 3ALFA 1QNPA 4DI8A 3TK7A 1FCVA 1S3TC 2B0MA 1KR1A 1KWKA 4B2DD 2CBJA 3W1LA 3MP4A 3ZJ8A 4XSLA 4A35A 1TPVA 2DJLA 2F6XA 3C8FA 3WQ5A 3BLIA 3DKJA 2J9XA 5LNVA 2QV4A 2KAUC 2EF9A 4IFKA 4Q8WA 3HA1A 2BY0A 1QHOA 1TV2A 3DFPA 4GXWA 4LPCA 4UTKA 3VOCA 5JXQA 1Q3NA 2W79A 3IVTA 5LNRA 3FOKA 1JCLA 3EPNA 3S46A 1ZP4A 4J3WA 1ITCA 1X1OA 2AL1A 4FS9A 3CUGA 3EWBX 1TZ7A 1XW8A 3SCVA 3DXIA 2IXVA 3H7RA 4MB5A 4UBPC 5C2GA 5K4ZA 1YADA 4IFRA 3IARA 3WLJA 3WQGA 4WDXA 4HNUA 2PWGA 3L4YA 2X1TA 3PZ9A 4C6OA 1W54A 4RE4A 1F3EA 1R3YA 2QDEA 1IR2A 3N2CA 1PCWA 4IH3A 2VURA 3VKCA 3EOSA 2Y6ZA 4GYKA 3P8IA 4DLFA 2IKIA 1IXPA 1XKJA 3LXCA 4CVWA 2F8QA 4GNKB 1T5AA 1RY0A 4NX0A 1GQNA 1WNOA 3LPPA 1PZ2A 4B15A 1A80A 5AHMA 2D2GA 3WLMA 1QNQA 3IJLA 3ZT5A 1F6PA 1J4EA 1JDEA 5I3IA 4KEZA 2NT1A 1JCYA 2XU2A 2A7RA 4IXXA 5K3VA 3WSUA 5ABFA 1EC9A 2BGNE 5HNTA 4UTIA 2X0HA 1GQIA 4B90A 1AVAA 4IQLA 4ERIA 1EOKA 5CG0A 5CSUA 1PL9A 3NVTA 1TJPA 4IWWA 5G2WA 4JN6A 3IVUA 3VE9A 3P0XA 3QEZA 3QY8A 3G6MA 4HPNA 2BOGX 5C7HA 4NZJA 4TTUA 4DRSA 3R5EA 1JGMA 2IPGA 1UR1A 3EX2A 4S3GA 4GOAA 5CZJA 1D3CA 5ECVA 1TJ0A 1V02E 3BSMA 1X6UA 2GJXA 1XX1A 2Y8UA 1VCVA 3GU1A 2YCIX 1RK6A 3A9BA 4B9YA 1HKWA 1OCBA 3B3DA 3HURA 1E15A 1U1HA 2O9OA 5BOFA 4W8LA 1OX4A 3CWNA 4R3UA 4NZFA 4LNYA 2C18A 4QXIA 3RITA 3A3HA 1E5NA 1XRFA 2E1DA 4C60A 4WDTA 1MUMA 4DXVA 2QKFA 4ZENA 4O8RA 3T05A 4CU8A 4O8AA 1JCMP 4YU1A 1UC5A 1VAHA 4F0MA 2I7GA 2F61A 3JRKA 1X1ZA 5D32A 1EX5A 3JUGA 1JULA 3CV1A 1ALDA 3LV6A 1EGZA 4TMCA 2XIMA 4M1RA 4J3VA 2QMJA 3TYDA 1GOWA 3VOJA 4NVTA 1BAGA 3WEZA 3WF0A 4C6BA 4C6NA 1XINA 3IJ9A 3OIHA 4GYPC 3W6LA 3BK0A 3NM3A 1YTKA 2QR6A 4LRSA 3VDCA 5A2BA 1H62A 3NZGA 1H7NA 3T09A 4QJ4B 3UBPC 1FWNA 1TQJA 3OGRA 2PRMA 4HPHA 4J3SA 2LLEA 3I3DA 4PUWA 3GDLA 1H49A 3CUXA 4RZ6A 4AB4A 3GE7A 1HP5A 3WF2A 3TJXA 1CXIA 3IIOA 1ZGDA 2BG5A 3MUCA 2KX9A 3NQFA 3QR3A 3UVAA 1KFBA 1W9PA 3G2GA 4GISA 4IX0A 1HKJA 2IUZA 1QHPA 1SUXA 4GX9A 4H1ZA 2XIQA 3PZOA 4D71A 2OXNA 3E12A 2YSWA 3SY8A 4GIYA 5FJTA 4I8YA 1JQXA 1L6SA 2B7QA 3EX1A 5XINA 1X1NA 1PX8A 3H26A 3HQOA 4QP0A 2DH2A 4ACYA 3SFKA 3EX4A 3LRKA 3M0MA 5IHSA 1QOPA 4LUJA 4ZVJA 2ZXQA 3DFHA 4CNPA 5E0KA 4UQ9A 3WFLA 5CAHA 3TCSA 4PODA 1YIXA 5EA9A 1K4GA 1R3TA 3PVFA 2A3CA 1F73A 3VIFA 1Q6LA 1NDWA 2OT1A 3II1A 4CQBA 2D0HA 3GK0A 2EKGA 4AVOA 1W3JA 1XFCA 2P5NA 3FAWA 1ONRA 4TIMA 2AKZA 1XCWA 5CGMA 3FK4A 3ITTA 1NTHA 2WCAA 4LCRA 2I5GA 3MV11 2RUSA 3SN0A 1EEXA 3BOFA 2FZ9A 2VCBA 4UOQA 1KGWA 4ACZB 5HINA 2WQPA 3FV9A 4FK9A 4DF0A 1FXPA 1M7PA 4XZLX 3LD5A 3TV8A 3AJ7A 3GD6A 3AC0A 1JF6A 4O0ZA 3TYEA 4CCZA 4DWSB 4S39A 5KETA 4AYSA 4ML4A 2ZRXA 1HXJA 1LOQA 5AHEA 3KOWA 3VNYA 2CXEA 2GWGA 3IGSA 5D33A 5BCAA 3S2LA 3GVVA 4UNIA 5CGQA 3A13A 3H2FA 4QBXA 3M5XA 4LNCA 3BLEA 3CBWA 5HQMA 1PS9A 1SZFA 1XPYA 1YDVA 3EWDA 4HU3A 4OWGA 1MRQA 1DVJA 3LZ3A 3OBAA 3JR2A 2BP1A 3BCJA 1GEQA 3PPHA 1AFSA 2VC6A 5HUPA 5CJMA 3MWCA 1QR7A 4B5TA 4JICA 4GXPA 1RJPA 1OCQA 1H11A 2JEPA 1KM4A 2G97A 9CGTA 3SFWA 4RV8A 1VFSA 3HO8A 1XBYA 2HJPA 1V7AA 3OG3A 1S38A 4U31A 3RX2A 5TBOA 5EBUA 1TCDA 4XZIA 4QSHA 1H1YA 3AHZA 3ABXA 3KDNA 5FD0A 4NL1A 2V5BA 1LWIA 2C0HA 4Q6JA 1XWYA 1ZBVA 3MKVA 3FA3A 4NJIA 6ENLA 3W85A 5LZLA 1RLDA 4PBEA 3W22A 2REQB 3F4WA 4O11A 5DX7A 1HJVA 2Z25A 1C29A 1IEXA 2FZDA 3IPWA 5DEZA 1EZWA 1UC4A 3TQKA 2BGQA 4QROA 4JTTA 3N2XA 5AFDA 4B91A 3UJ2A 3G0SA 3MP3A 3B8SA 3R0UA 4YTTA 1QJWA 1YLVA 5IBXA 3DX5A 3PWAA 2XYLA 3DI1A 4CEXC 1W5QA 2Y5EA 1A4MA 1UPPA 2GOUA 4WOQA 3P62A 2Y5JA 3RU6A 1QW9A 3RM4A 5DFAA 1GZJA 2VM8A 1CGXA 1Y8BA 3C0JA 4G2DA 1B2YA 3UJFA 1KM5A 3TMLA 2TPSA 4JN8A 4D6JA 3F4VA 3GX9A 2FMOA 1WBJA 5CKSA 3EDKA 1TKKA 1LP6A 3TDFA 3TFXA 2C14A 4DBUA 4PCNA 4HVXA 4QR6A 2YIHA 3GR8A 4DJDD 1JDDA 1E6ZA 3DAQA 5I0DA 1ICSA 3WH5A 2ZWYA 3R7MA 4NILA 4MLJA 3TC6A 1TIWA 4PTMA 1W9DM 4ACZA 1FWHC 2HQAA 2PS2A 4K8GA 3THQA 4JEJA 3I7SA 3R0DA 3HPAA 4GUGA 1YXYA 2WHLA 3LPOA 3EAUA 3DOPA 2WM0A 2DT2A 1A5OC 3MKCA 3TTYA 4FF7A 2OJPA 3NDZA 5ABHA 3R58A 3DYOA 3OGSA 4J35A 4MJZA 3I6RA 1J93A 4X0NA 2VL4A 3TQPA 1EBHA 2J6XA 3PP7A 2QUNA 4JFUA 2WNNA 1YYAA 2PDCA 5FL1A 3CZGA 1NF0A 1C8QA 1OD0A 4ZCWA 2WKLA 4G1NA 2Y62A 1EJVC 2PBGA 1H7RA 4Q22A 4L1GA 2GWNA 5FIPA 3IUIA 4ZMGA 4HPXA 4GZJA 2PGRA 1J0JA 3L5LA 4GUFA 3QM3A 1PWMA 3SURA 3H2CA 1AD4A 1MXSA 3AZRA 5HMEA 1XC6A 3HV9A 2VOMA 3ITCA 1EP2A 3P5ZA 1XLHA 3L4WA 1L2UA 2J4GA 3M0LA 3C86A 5H6HA 4DY1A 3UYCA 2XISA 2ASHA 3WMBA 3QHOA 4C1NA 4AZBA 2WVTA 2C71A 4PUMA 1BYAA 4KWWA 1EO5A 4LAKA 2CC0A 3E2RA 2HK0A 1A3WA 3MUIA 3SADA 2ABAA 1NIUA 1SU5A 3NQCA 1K7FA 8RUCA 4OOUA 2CBVA 1DOSA 1FCBA 3OOQA 1U22A 3A9IA 3TUUA 4MTVA 2AMXA 4H6RA 4NIRA 4H04A 3TQVA 3CAWA 4NNBA 3VINA 1J11A 1PKNA 1M9HA 4DXXA 3IACA 1M03A 4G7EB 1HX0A 3UCCA 2HCVA 4IQDA 4O12A 4DBSA 2JGQA 2WO5A 2QCNA 3T44A 1PWLA 4AIEA 2PWEA 4Y9NA 3E3HA 3T0CA 3AS2A 1NWSA 3NTYA 1Q45A 2PC4A 2FZ8A 2PDYA 3UG8A 4YTSA 1ZAIA 2NV9A 2DUAA 4H2CA 3ES7A 3NCOA 3WK2A 1ZCCA 2EPOA 2FZMA 3DHFA 4CCEA 5A6TC 5LNWA 2XWEA 4ALDA 3G1FA 3NEVA 3USZA 4FXRA 2QJNA 4RNHA 1FA2A 5AZ1A 3ES8A 6A3HA 4YYCA 4UZSA 4W84A 4PTDA 2D2JA 3CB3A 1TV7A 3CUJA 2X7WA 5HULA 4AW7A 4AIOA 1JDCA 3BURA 5I3HA 5EBAA 1H09A 1GG1A 3NQBA 3RPMA 2VFHA 1D7KA 1OM0A 3HG2A 3RXZA 4OVXA 3BMXA 5EMKA 3C3UA 1EBGA 4AVFA 2NSOA 3TNBA 4W93A 2OR2A 2VZVA 4ZSTA 3PULA 1SJCA 4ZE4A 2E09A 4GACA 3H4GA 1OSEA 4IGNA 1J01A 3N6QA 1ISXA 3FEMA 4O4WA 3WCZA 3L0KA 4A8LA 4JTRA 2YL5A 4XG1A 1V7YA 3L4ZA 1S2AA 1KM0A 1V79A 3WMLA 3NUKA 3WJXA 1F07A 1YX1A 4PFMA 2QCEA 3STPA 1V3LA 4H83A 4J2PA 4YYFA 1NEYA 4FNPA 4NRRA 2CLPA 3OU8A 3TTOA 3GSMA 4S3KA 1U5VA 5G4WA 1J0ZA 3INPA 2H90A 4BZYA 1QPRA 4HN8A 4NF7A 1FFRA 2R9RA 3FJ6A 1DWGM 2WLZA 1MZRA 4G6CA 3PZGA 4OKDA 1K02A 3C2RA 4UQBA 3K1DA 2VGBA 2YB4A 4NY2A 1P6CA 3C52A 3GO2A 4D72A 2FTYA 4PMRA 1X97A 1NWTA 1RZMA 4PTVA 1E6QM 2ZUSA 3TSMA 4Q4MA 4K8EA 4CNTA 2X16A 1LYXA 1FCUA 2PU1A 2HZGA 3BLLA 2JGYA 4G7FA 4DZIA 2W61A 4G8TA 1F5ZA 3UXAA 4MNLA 4AEOA 3WUEA 3G1XA 1ISVA 4S3CA 3M0HA 5E93A 1IYXA 1BD0A 2OU4A 4ATLA 4H4IA 1KV5A 3GNNA 1GTEA 4NASA 2DV0A 2ODOA 4H8VA 2Z26A 1M5WA 2UY3A 3BLOA 1FBAA 4JNYA 2EPNA 3NPVA 4KKXA 2WMIB 2O7QA 3QHNA 4C6IA 4MGGA 4TVDA 3C0QA 4RNIA 2YW3A 1RQBA 3RF9A 3WELA 4RUBA 1C7TA 3DFTA 5HMDA 4JIIX 3CT2A 1PPIA 1DJQA 2NT0A 5CPLA 3OVPA 1FDZA 3KLLA 1TFVA 3TCEA 2EG8A 5E6ZA 1XLGA 1QBAA 1GZ1A 2X2YA 4AFYA 1WXYA 4AQLA 1Z7AA 1XCFA 2ZRZA 1S5MA 4MY9A 4J3XA 4U3AA 3CAQA 3MO7A 3CTTA 4IPPA 1HIZA 5FEZA 4PMUA 1L6FA 1LOLA 3VZZA 4PTNA 2NLIA 2DZAA 1U1JA 4MFDA 1K8CA 3QC0A 2IXUA 1WDRA 3BL3A 4Z1AA 1J10A 4TVCA 3AQUA 1OFRA 3NVDA 4GZIA 1V51A 4Q4PA 1OIFA 3ICJA 4K68A 4Q4KA 5MKGA 4POCA 4GUIA 4UUIA 3L9CA 4IQEA 2PDHA 1B54A 2DZUA 3AMCA 3EX6A 3FFSA 3LERA 4PN2A 4CQCA 2POTA 3NFUA 5CSRA 1GVIA 4H6KA 3RLVA 1FDYA 3WBAA 4KGLA 2GDQA 2J13A 2QULA 3W07A 4E38A 3MSRA 3AIQA 2WNZA 3R8RA 2JEQA 2VTFA 2R1NA 1DWHM 1WAWA 4WR3A 4LJ3A 3PS7A 2PRLA 3HBLA 1ZBKA 2QV5A 3M6YA 3GR7A 3H2NA 3MHGA 1FWTA 1P7TA 3CPGA 3NQ6A 1RHCA 2ZVRA 3RO6A 3P74A 2WSRA 4UQCA 1LTDA 4QG8A 2G3JA 1UBSA 2XINA 5HPCA 1TJ2A 3WBXA 5FOOA 3OYXA 2QIWA 4NNAA 4Q4OA 4IGMA 1WKFA 4HNVA 1MMFA 3NQ2A 3SO7A 4LUTA 4FNSA 3LHTA 3GXDA 3T07A 2WPGA 4GBDA 1FRBA 4EPEC 1UP2A 4J3ZA 1E0UA 1UCWA 3HMCA 2VUYA 1UPMB 1TUXA 3TA9A 1S5TA 5IDIA 1YNYA 3RRXA 5EY5A 2JBMA 4V15A 3W2UA 3W7IA 2VRJA 4RL3A 1W3LA 3F5LA 2JKEA 4MFEA 4Y8EA 1YKWA 2ZADA 1WE5A 3C0SA 3LEPA 4BA0A 4IMCA 2OOFA 3WF1A 4HHPA 4AY1A 4PTXA 1Y7VA 2OYKA 4LRTA 2G4JA 2BSLA 2P3EA 1E56A 2ZTKA 2VFFA 4I9TA 3SI9A 4C6EA 1HP4A 3ABOA 2PTXA 1DWAM 3KBVA 1HKVA 3BQ6A 1Q7QA 3AXIA 1G0CA 4AISA 3NNTA 3IIXA 1YBQA 3DFOA 1KXTA 1OCJA 1MI3A 1SW0A 3E2QA 1XR2A 4C1LA 3SIMA 5I07A 2NUXA 4UCGA 2E25A 2VGFA 2BGSA 3SSZA 6XIMA 2ZBTA 3UG4A 5JU6A 4F3HA 2V30A 4EACA 2HBXA 1IEWA 4HOXA 1E4NA 2QGYA 2F7FA 3HF3A 1TQXA 1QDSA 3NZQA 3CPRA 2QJIA 2B7PA 4O14A 5BROA 3OZMA 1Q8AA 1IWBA 1N8IA 3DG6A 5KTLA 4O0KA 3R89A 4J5NA 1OFDA 3GIYA 1JUEA 4GQQA 3VU2A 3W2KA 3UR5A 4CN4A 3APYA 4FP1A 1TREA 1VPYA 3ZR5A 2XIBA 1XRTA 4V33A 1GTHA 3O3RA 5AZ0A 4BK9A 1W9BM 4YPJA 3T0TA 1BGAA 1P0DA 4GC3A 1DWFM 3V0SA 3S1WA 1XUUA 2Q8LA 5C6MA 2E1WA 1CPUA 2WBGA 3A5FA 3EKZA 3T81A 3MC5A 5FJUA 3QLLA 3OLIA 3NQGA 2XGBA 1XF0A 8TIMA 5DBTA 3BSGA 1DL3A 3W01A 2FJKA 1V6VA 2QLYA 3VPLA 3OYZA 1M65A 1VF8A 1TA3B 4IX2A 5FACA 1PEZA 3AXMA 2E9LA 4O1DA 4XZNX 1LG2A 1Y5VA 1XG3A 1D8CA 3PB2A 2DZVA 3WX7A 1P0EA 5HDRA 3N9SA 2DQWA 3E0IA 4W89A 1EIBA 2WLYA 1Q6QA 2WC7A 5LGXA 2Q71A 1S1RA 1P0BA 2VC5A 2Z6IA 1W5OA 1BSIA 1LL7A 1UR8A 3VKJA 2ZRVA 1OX5A 2XVKA 1U5HA 5A8MA 1QMLA 1JRCA 3FYYA 1J6PA 1PKMA 2DEPA 1FDJA 3LQLA 4GINA 4AIBA 3ZZ1A 1G4TA 4MPKA 3EEGA 2DP3A 3KVLA 4E8CA 3USBA 4WVXA 1KLYA 3G0XA 5K4XA 1O94A 3PJUA 1W31A 4L4MA 1BRLA 3ZVIA 5GQBA 2W9MA 1RD5A 4IGHA 1OABA 4CQ8A 2QPSA 5JIWA 5EL1A 2YBTA 1A5UA 4MHBA 2XFRA 5LA0A 4KWOA 1OC5A 4PUJA 4MAZA 3O06A 5U7SA 1HUVA 1OB0A 4JN7A 4BFAA 2XFFA 3FN9A 1R86A 3VGBA 4WY0B 5HNNA 3WKZA 4HT3A 1R87A 5JH1A 1CGYA 1SZRA 6REQA 5IRPA 3H8AA 3WY1A 4FLQA 4IICA 1XIMA 2X1IA 1OEPA 4PMYA 1JPIA 3CXOA 4D9PA 1GYNA 2O9PA 5H8PA 1FHVA 3RR4A 4MB1A 5I03A 3VD4A 3ZQ9A 1ODUA 1XIEA 2NV1A 2Z2BA 1DTNA 4LQ1A 2PZNA 4ERGA 2O56A 1G67A 3WLOA 4I3GA 3W73A 3SCNA 4XD5A 3BLPX 5A8NA 1NU5A 4O1AA 3H21A 1F3TA 2CKRA 2NVDA 4LYQA 4LVGA 1FTXA 1XYLA 3T55A 2WJZA 3BAJA 2PDBA 4KRZA 1I2OA 1PBGA 1DIEA 1YBQB 3C61A 1WOBA 4OFCA 1WUEA 1XD1A 4JL1A 3FAXA 4XAZA 4DJDA 3H2EA 4ZQCA 2Z00A 4UTWC 4Q8QA 1OIMA 3I4EA 2VDIA 5LGZA 2C19A 3A4AA 4RV3A 1JNDA 2GSEA 4BQ2A 2A7NA 1OWQA 3GZAA 4GYJA 3PBYA 3N2MA 4XV0A 1F6YA 5DRIA 2J7BA 1TPDA 4AYGA 4K8HA 1BGGA 4H9TA 3C8NA 1FUYA 3VK5A 1NM9A 4GO9A 3P6LA 4QG9A 1NSJA 2UY4A 4A29A 1EQCA 7XIMA 1CGUA 1IZJA 1F61A 1Z8AA 1Q66A 3DENA 3M0KA 1DIDA 1I9CB 2NQ5A 1RJRA 4YS1A 2O55A 1I0DA 3VILA 2GQ8A 2WKGA 1TUFA 1VENA 3CQHA 2FMNA 2CHNA 1ZFJA 4Y9PA 3B9EA 4R7WA 2VCAA 1ME8A 1SYTA 3C0LA 4AZGA 2OMAA 1IXOA 3EXRA 3W1MA 2HNHA 1KKOA 4IMGA 5H2ZA 2Z2AA 2ZXDA 1C8YA 4CNSA 3H23A 1Z9AA 1QW8A 3S9YA 3K13A 3NO5A 1QBBA 1NAL1 5G5IA 3LHWA 3HJEA 3RYSA 3NSXA 3W7RA 3W24A 1YPIA 5D2YA 4JKMA 3T78A 1AL8A 3SDOA 2J47A 4O18A 5A5WA 4UXDA 3P81A 4CN1A 2QCLA 1H63A 1VEPA 4UMBA 1EPVA 4L1WA 4EF8A 1KM3A 2Y63A 1XICA 3B40A 5LXEA 3CZJA 4LBSA 3VIMA 3UR7A 4H00A 4ROPA 1RK5A 4CNUA 1X39A 3NQVA 3SRFA 3F5KA 2E5DA 2E3ZA 1LBMA 4Z2HA 3PR2A 4GUHA 2ACRA 3QBUA 3EMZA 3L2MA 2FFCA 1MRAA 3VIGA 2YX0A 1ONEA 3S2CA 3MQTA 3UGRA 2OX1A 2OEMA 4QS5A 3W74A 2GJPA 3HIJA 3OHMB 3ZLGA 3MO4A 4LVAA 4DF2A 4HZ7A 2BHYA 4OTKA 2WVVB 3AHYA 3URNA 4LUYA 5KZ6A 4CEUC 4DJED 3UW6A 3PBGA 4N7QA 1EB3A 2C79A 3T4WA 1MXDA 4HA4A 1RV8A 4M19A 3W76A 3W7HA 4F66A 2OVLA 2CEQA 5HXMA 4WKHA 1HFBA 2PODA 4LVBA 4P8UA 4NRSA 1W2PA 2TYSA 5D03A 1QI4A 2YFOA 3AZTA 4EANA 2YB1A 5ECUA 3NOYA 1MW3A 2WJDA 3HPZA 4CD6A 3AHVA 4JEQA 1UUMA 3MT1A 1E55A 3W0KA 2HE5A 4IP7A 4KS0A 3RK8A 1ZBCA 4GIAA 2BS9A 5A6KA 4B4HA 1QHZA 2PGFA 3R94A 3DYPA 2ZA3A 3PTDA 1WAUA 4RXFA 3UZZA 1TZZA 1REQA 2G50A 4JKKA 3MCMA 1UKSA 3MW7A 4RKAA 2PLJA 4GGBA 4HA0A 1UR2A 4S3BA 4IL0A 1V93A 4K7YA 1NOUA 3W7EA 1JGIA 3GTXA 3BJFA 5FAGA 3S8HA 3H55A 1JPKA 3PG8A 8CGTA 3R8GA 3N6JA 1RBAA 3GR4A 4GH1A 4FNQA 1IEQA 3UZXA 1BTMA 1B3VA 1TTQA 2Y1HA 3E02A 4NI3A 2WBKA 3PSWA 2C7FA 3VFCA 1ZAHA 4Q3MA 1A5KC 3LPGA 1KBLA 3BDKA 5T26A 3MI6A 3WL0A 4XBJA 4JAWA 4XUGA 3OA5A 4AC1X 5C2CA 2GVJA 4C1NB 5G4HC 2OX4A 3M0YA 3W2JA 2JKPA 1E6PA 2VJXA 4Z08A 3RLGA 2XH2A 3FSTA 1XLLA 3NEHA 1ZQ5A 2CLHA 2G96A 3FDGA 5B7YA 2EEXA 2VC9A 3AHTA 5JUVA 3DECA 1K7XA 2OZTA 1OINA 4RDVA 1QNOA 3DIPA 4E4UA 4WY0F 3TSBA 2C1IA 1TPFA 2B81A 3F5JA 1XG4A 1HJUA 3PZUA 4S38A 4GRSA 4PC8A 2QCDA 3QXBA 4MZ8A 4X2PA 3JZUA 2JK2A 3V35A 2V9DA 3CL6A 3DHUA 4HIBA 2ZZ7A 3KOFA 3O2LA 4JQ3A 3GH4A 4CU6A 2C16A 3DU0A 3R2GA 3TJ4A 2FVMA 1XHGA 1IV8A 3VNIA 5K2ZA 3PUDA 1V02A 3N4EA 3G22A 2HDJA 1XLFA 4PR4A 3P5YA 5G2IA 2OWXA 1W9VA 3NPWA 2YFNA 3TYBA 2NVCA 3DCPA 1NOWA 3GFYA 1HT6A 2GVEA 1XKYA 3KWXA 2E67A 1RLCL 1VCFA 3DUGA 1RH9A 1O5KA 3ZVHB 1HZYA 2XWDA 3F1QA 3H22A 1BVWA 4QX4A 1WQ5A 1AK5A 4IPJA 4FLOA 2FIQA 3WDQA 1XRVA 1Q4NX 5BRPA 4D6CA 2JALA 1V5XA 4ICMA 1JCNA 1X98A 3R0KA 2ZZ5A 1W6TA 1XDMA 3NGFA 4M6VA 2DW7A 2RGMA 3WK0A 1JDFA 4REQA 2QDGA 2XVLA 2E9BA 2PDPA 4E5TA 3WO8A 3E0VA 1QOXA 3M0JA 4A3RA 3R25A 3ABRA 3OP2A 3CUIA 4NYUA 4WLCA 4JFVA 4PFHA 3BGGA 4M56A 2ZX7A 2I1OA 1OGSA 4ZO6A 2ZWZA 1N8WA 1CX9A 3PBVA 3FJ4A 4L9ZA 2YJQA 2Z0IA 4KFPA 3GVQA 3UYIA 1I2PA 1TO3A 4PTWA 4FXJA 3TROA 1RD6A 4KEVA 3DHPA 4FLRA 3NZ1A 3CV2A 4AWSA 4NI8A 4F0KA 1Z89A 3N3MA 5JVLA 2HVMA 2CHOA 3WH8A 3T1GA 3QSRA 2WCGA 1OG6A 4FR6A 1UMLA 3VNMA 2ZRUA 2BX7A 4QRNA 4V1XA 1UBPC 3PZVA 1SZEA 4GH3A 4QLLA 4EIVA 3L23A 3C2YA 4F9JA 3EOLA 4LCQA 5FESA 5CSYA 3HPFA 4EWND 1MSSA 3WEMA 1RY8A 2CLKA 2YLAA 2AGTA 3L68A 4N0RA 4JQ2A 3GVRA 5C70A 3RX3A 3NGJA 3LMYA 1QWKA 2VR4A 3GVWA 3S0CA 4DX3A 1EDQA 5FF7A 3QFWA 1JYVA 4G1KA 3UD6A 2QXWA 1FHUA 2YA0A 2WWCA 3CQ0A 2Y8VA 1ZLPA 4AZ6A 1TPWA 3KHJA 3K1GA 5C9XA 3GUWA 2O9RA 3N18A 4GQ0A 1QTWA 4XD4A 3TYCA 3PJTA 2W67A 1E5JA 3KS5A 4NZ5A 4PMZA 3KLKA 3BCDA 3P3BA 4AD0A 3IVSA 4M1BA 1W3IA 4L65A 1PYFA 1KTNA 4LEFA 3UESA 4ZFCA 1H61A 3GBDA 2W0UA 3QPYA 1XIDA 1XQKA 5BOOA 2BMBA 2QUMA 3AUOA 1N82A 3M1ZA 4GI6A 5AC5A 1EXBA 2BDQA 4LALA 3M16A 3VX0A 2HPIA 2O4QA 3U2CA 2YYTA 3CZKA 1GGOA 4WSKA 3UCQA 4B5NA 1VS1A 3GAYA 4QQ3A 1EF2A 2CYGA 1B9BA 4GHRA 1AA1B 4LANA 3Q2DA 4QQUA 1PJ9A 3AIWA 3GNXA 3LCIA 2A79A 1OYAA 3VIPA 1ME9A 3CS2A 2OQHA 3I3EA 3LA4A 3UXDA 1WPCA 3QKZA 2TSYA 4HZ8A 1DBTA 5FJPA 3DBPA 4RLIA 3I4KA 1LUCA 4AMAA 1W8GA 2YA1A 3IGHX 3IEBA 3T7VA 3L7RA 5HNRA 2V38A 3W86A 3BVJA 1I8JA 3QVQA 5EMLA 2WVUA 2J24A 3VIOA 3G0UA 3DHDA 3R43A 1JCTA 2VWTA 4A8RA 3UZYA 5HBFA 3ITOA 1M7OA 5A2AA 2VWSA 1UQYA 1YPXA 3KVKA 4PL2A 3SGZA 3WNOA 4HPJA 3Q67A 3SY1A 4X60A 2GVLA 3P84A 1V6XA 4L9YA 1VCGA 3F03K 4M0XA 2ZYFA 1XYBA 1IEVA 2O9TA 1DTUA 2GDUA 4DPPA 1WXJA 1ZP3A 4Q4RA 3WBWA 3AYSA 3DH7A 2E6AA 1NJJA 4N9DA 2ON3A 3W3OA 2CERA 3FIGA 3TJIA 1TX2A 4LYKA 3NPXA 4LW7A 5M03A 4AY8A 4YNGA 3KOXA 2DVTA 4AX6A 2XDFA 3WQCA 3HG4A 1JZ2A 5BMXA 1ENUA 4UB9A 3VNDA 2W62A 3A64A 4UR7A 1XDLA 4EKJA 3WBEA 2G3IA 4K1GA 1IWPA 3EB3A 3QV7A 1J9YA 2YXXA 4WDUA 2VEKA 3WH7A 5H91A 3ATYA 3H4XA 4Y9MA 2WJFA 1QNVA 4AX7A 3EDEA 3QV8A 2I5IA 4P61A 5HJYA 2PDMA 3UZ5A 3M5VA 3HFYA 3W7JA 1FKXA 4XAFA 4GO8A 1W37A 2NWRA 2C8NA 5F2MA 5HA7A 3UERA 1PX3A 2DVXA 1OADA 3SQSA 2X2GA 3C5QA 1Q85A 3D6NA 3ECQA 3LHUA 3UQNA 1CXKA 1AD1A 4QTGA 2GUUA 3L2IA 4RW5A 4B5WA 3GHTA 3OJGA 1G01A 3VD7A 1SJDA 3M64A 1E0XA 4MVAA 3URBA 3EWUA 4CGTA 3TW9A 2E8ZA 1J79A 1QPOA 1VPXA 4B3KA 3VDGA 3DC0A 3IV8A 2X42A 4M7SA 4IQJA 4JIEA 1UZ4A 4JIPA 4XVEA 3CTLA 3QGVA 2R24A 3E9AA 2UWFA 3GH5A 4ICNA 1B31A 4KPLA 3CUFA 3VIKA 3SRDA 4GQRA 4QCFA 3WQVA 1UASA 3V0UA 1A47A 1XSJA 3VAVA 3RN6A 2BY1A 4KGJA 4J40A 2VZSA 4NU7A 3TR2A 2WC4A 1ZTVA 3LXAA 4LBUA 3ITVA 2PTYA 3DN5A 4XD6A 3KBWA 4FR1A 3WEOA 3C3NA 4Q7BA 2DUZA 5GNZA 3HPSA 2EPMX 2VHLA 3N15A 3NL3A 1PV8A 1S2WA 3VNJA 1BKHA 4Z0SA 1EJTC 3OO2A 4U28A 1E0VA 1XSIA 4OIFA 3AISA 4H7CA 3QW3A 4OV9A 1SPQA 5DMLA 4NG3A 2ONEA 1G4PA 4EPDC 3BSHA 1EQPA 3IS4A 4L1XA 2F2KA 3SY5A 1GJUA 2I14A 3A22A 2FDSA 4JYDA 3ZIZA 1QNRA 4QE1A 4DJEA 4WUIA 2OTDA 4LH8A 1EYWA 1JQVA 2FDMA 2C3ZA 1CGWA 3WDPP 2VP8A 2YW4A 1GVFA 4I6KA 2PEVA 1DQXA 1JUKA 3MPGA 2XZ9A 1OVDA 3L21A 4FMVA 2NV2A 3A47A 4GI9A 3AIUA 3TYZA 5C2XA 2CESA 3PBWA 1FHLA 2ZC1A 2ZC8A 5A8OA 3NAVA 5GVJA 3W70A 2GOKA 1AH0A 3UETA 4I5UA 4QISA 3MCOA 1R2TA 3WLLA 5CAKA 1K7EA 4QM1A 3QF0A 2QJJA 1PZ1A 2EAWA 1WUFA 3IIZA 1TA3A 4IIEA 4OBSA 2AQWA 2ZRWA 4HCDA 2GL5A 3P60A 5LYRA 3SGGA 5C71A 4D1JA 3LS9A 3H24A 4CCCA 2NQ9A 2OQYA 1LL6A 4L9XA 5I3GA 1ESWA 3U57A 3LRMA 1I0BA 3QKEA 1GW1A 1XQLA 3G1YA 2YDAA 1MEWA 4UFJA 1AJZA 2OKOA 4BI5A 5C8BB 1ZAJA 1BWVA 3GYEA 4RDZA 5CGTA 4C7GA 4A22A 1XC4A 4LYPA 4ECLA 3S6DA 2AQOA 1AZ1A 3T2OA 3VIHA 1EP3A 1AQ0A 4M81A 4J4KA 1OJXA 2WYSA 3TC3A 3VI2A 5T9BG 4ZGYA 1DV7A 3NR0A 4KCWA 3EEZA 4MY1A 3NQAA 4ZTYA 2RJHA 3Q94A 4O52A 3WDRA 4E0CA 4UTUA 2J7EA 3L66A 4EVZA 3DFSA 2X41A 5A94A 2XUCA 3LK6A 1S2VA 4D8ZA 1A49A 2G0WA 2P1FA 4J7RA 4BQ4A 2FZNA 2BASA 3HZ3A 4UOJA 1AJ2A 1E73M 4WCJA 3W00A 4PSRA 3W6MA 1UD2A 4GFSA 5D8ZA 2EG6A 1QUMA 3W29A 4HZ6A 1GVRA 1CBGA 3PZQA 3N2TA 3M0VA 3NM1A 3QQWA 1TE1A 2WQDA 3T9PA 1UB3A 3MB9A 4MIMA 2Y88A 2VMFA 2H8XA 2ZA2A 4FXSA 4ZQOA 3AXKA 5E0FA 9RUBA 5AHIA 4UTTA 1O6IA 5I77A 1CCWB 3TZNA 4C6PA 3GHSA 3BZGA 3VGDA 3GW3A 3W1QA 5IDZA 4KEUA 4REQB 3PWGA 1B3ZA 2XZ7A 3WLHA 3ZYZA 5G1YA 1KRAC 4ZO7A 3W83A 4HBKA 4JXCA 2F38A 2H3DA 5T8GA 3M07A 2Y70A 1R9XA 2J7FA 2ZX9A 2WSPA 2Y7EA 3N4AA 2G8ZA 4M29A 3GG1A 2D73A 4AD3A 1H2JA 4LBRA 4UTWA 3W7PA 1BYBA 1FXQA 3QTGA 1H60A 3L12A 4AXNA 1XPGA 4OOZA 1ZHAA 3TN3A 4Z2JA 3VNKA 2GVYA 1KM1A 3OHIA 2QEZA 1WXZA 3TN6A 4ZQMA 2JQXA 3N2BA 4GPNA 2FPYA 4ILSA 4IIBA 1J2WA 3HMJG 2IMRA 5FSEC 3KFTA 3LTYA 1UYQA 4IGSA 3F2DA 2V5CA 2H8ZA 1AJ0A 3FA4A 3GRIA 4NHVA 4XKYA 1I4NA 3WIJA 2GVGA 4Y9AA 4QGCA 3KL3A 1GPWA 4FOJA 1PX4A 1JZ4A 3GNPA 2AKMA 1XBVA 2BVTA 1GWJA 3LSCA 3UWYA 4RZ5A 3MJMA 4R9XA 3MMWA 5A6JA 5D9PA 5I24A 2OT0A 2R82A 5M1TA 2VENA 5CPQA 4JDBA 3IJIA 4KMQA 3CEUA 5F4SA 3ABQA 3UWVA 1KNWA 2X1UA 1W1B1 1VGAA 4MYXA 3LHZA 3JW7A 1UZHA 3VM5A 2V2CA 4WF7A 1NY1A 3RDKA 4TTGA 2D3LA 4DN1A 1GKRA 1TPB1 1KXVA 3NZPA 1S5NA 1BKSA 4DF1A 1BVZA 2PF0A 4PMNA 5FF4A 4R34A 1UD3A 2PURA 4K2SA 1U1UA 2WNWA 1E3ZA 3BV7A 3ID7A 3UY8A 2Z28A 3WLRA 2ZCGA 1XV8A 3VD9A 3WQOA 1E6SM 3EKLA 3FX4A 3A23A 1W1IE 4MB3A 3ZXWA 1QU4A 1WV2A 3LBMA 2Z1SA 2CZVA 2AL2A 1MQPA 1FKWA 4A2SA 4ZR8A 5IHRA 1IZCA 3VOFA 2CBUA 2GPTA 1Q63A 3BPWA 5DMYA 4IXHA 4CQDA 1P4CA 3HJZA 2HPMA 2EQDA 3MUXA 1LOSA 2BY3A 4KETA 1H0IA 3D46A 3LGEA 1NQ6A 2EHHA 3CYVA 3F4CA 4IL2A 2C1HA 4JTFA 3MHUA 3M47A 1ML1A 1HKKA 3STFA 4PRRA 4P7OA 3G8RA 3FGCB 5DANA 3UY7A 2P0IA 4W4QA 3TN5A 4GMEA 3GU9A 2GZXA 4Z1BA 1V08A 3KAOA 3W25A 4AU0A 3LU2A 2QUUA 3SCRA 1CB7B 1R5YA 1RA0A 3AS1A 1M04A 4J9JA 2PLKA 3SUTA 1JPHA 4HD5A 2OZ3A 2ZDRA 5T91A 4AF0A 3BWWA 1POJA 1VFHA 2GLKA 4QDMA 3TKFA 5LNSA 1SO4A 3TQ0A 3S1GA 3AXXA 4LOCA 2WMJA 3NL6A 4XUYA 4JTLA 3B8TA 1SR0A 4EAMA 1K6WA 3CLMA 3QZEA 2BOFX 3R8HA 1FOBA 3GTNA 3UNDA 3MANA 1A53A 4BR1A 4FXFA 2E7FA 4GKLA 1PYMA 3DEQA 2RH9A 4YHGA 3SZ8A 1CT5A 5BNKA 5SWUA 4WRHA 2EJ1A 4C7FA 3TFCA 1J5TA 3SEPA 3JVAA 2A3BA 2UY5A 1YEYA 4HP5A 1PIFA 2WSKA 1WB0A 2P88A 2VQUA 1VLWA 1YDYA 5A6LA 2VFDA 4JYFA 3SUSA 3T2PA 4JD4A 3M44A 1YRRA 1NP0A 3CL8A 5C0QA 3W38A 3KRUA 3URAA 2J8GA 3EB2A 3O0KA 2GJXB 1DP0A 4U2YA 3QSTA 1LBLA 4H6QA 3A4XA 4YHEA 3MMTA 2FTPA 2FQIA 4JL2A 2J9YA 2SFPA 3A6OA 3N19B 3S1UA 3VXGA 3KX6A 2DZTA 1RQEA 4K3ZA 3P0WA 5I78A 4WXYA 5DXYA 1E1FA 2ZUUA 4PMVA 5CC6A 3CQJA 3M7WA 5B80A 2QNEA 4GA8A 3U5YA 2Z27A 2XVPA 2BXZA 1W9UA 2X0YA 3TTSA 3UR2A 3GNDA 4RNJA 1MW2A 2NX1A 1FWEC 1V0MA 3EA1A 4QSFA 1K9EA 1KB3A 1T96A 2RGLA 3OBEA 4UFKA 5BXTA 3G6LA 4JR5A 1AUSL 3QQ0A 4DELA 1W3KA 4D6IA 1T40A 4BS0A 1O12A 3K4AA 3N25A 2PLCA 4XSMA 3UU0A 3WD4A 4KWUA 2DJXA 4AAJA 4F79A 4LAMA 5AOUA 4NAFB 5LIWX 5BXRA 3T0DA 4B5XA 1QCWA 2QJGA 1UZDA 3WFAA 1R2RA 4UIOA 2WOQA 4X9SA 3PFRA 2GSHA 4M6UA 5F2LA 2INFA 1LJYA 3KOYA 1K4HA 4PCFA 4GD0A 3K46A 2DW6A 3KBMA 4AZ5A 4GABA 3LY0A 3THAA 3T42A 1EJ7L 1KCXA 3P67A 1TPH1 1LM1A 3BICA 1EOMA 1VRDA 4FSAA 1XIFA 4FNUA 4MF4A 1SO3A 3ERPA 1US3A 4QLKA 3UFYA 6ALDA 3WLQA 4K38A 3WQPA 2CU0A 1VBGA 3BJSA 4XQ6A 2ICSA 1FWCC 4JX4A 2NSXA 4W9TA 2Y0FA 1V8EA 3CWHA 3W53A 4BEQA 3NO3A 2Z1WA 2REQA 4H19A 2Z1BA 1GKQA 3OVRA 2CKSA 4QDWA 1OZMA 2HWGA 2GJRA 4RPPA 3TWAA 4OJYA 3HGSA 4UTHA 1ITUA 4Z1CA 2GFTA 3VCNA 4CN6A 4C90A 4MWAC 4MZ1A 1LLWA 2ZOXA 5DCBA 3B03A 3WDJA 1HVXA 1E1CB 2D0GA 2E6FA 2HBVA 3QYQA 4ZODA 1MXGA 1XYMA 1KFJA 2CXGA 1R9YA 3NPUA 3WENA 4IG2B 1IXNA 2CFFA 3EMQA 5LIKX 5A8PA 4INFA 1XSKA 4UCFA 3ZM8A 3BJTA 1VEMA 1UHVA 1IE7C 2CWXA 1TRDA 3MSDA 1JG9A 2BFGA 1MYRA 4ADUA 1NQKA 2PDLA 1SR9A 3N6HA 1UWUA 4AHOA 1JI1A 1LQAA 1L6WA 1TWZA 4UFMA 4UQDA 3SUVA 3SSJA 3Q4DA 2H6RA 4JIRA 3KRBA 3CAVA 1M53A 3RRAA 2QVNA 2B7NA 4A3UA 1I75A 3W1RA 1ZJAA 4NSBA 2F6UA 1CB2A 1MQQA 3GB6A 1US0A 4FEZA 1X96A 3BW4A 3AIBA 4JTDA 4UFLA 1B4EA 4JQ4A 5DN1A 4TV6A 3SAZA 1L6GA 1JFHA 1VHNA 3KCJA 2ACQA 1W91A 1W3NA 4W7UA 4LWWA 4KFOA 3GDBA 3NOEA 3QMTA 2A3LA 2OLAA 5FF2A 3GUGA 8XIMA 4I6VA 4CQ9A 3LLFA 1YTEA 3T0AA 1IZKA 1WKYA 2D1ZA 1SFTA 2OODA 3CHCA 2QW5A 5D9MA 4F2TA 4JTJA 1I2NA 5JBDA 5TIMA 4BY3A 2V0TA 1DIOA 3VGGA 1LRNA 3HPXA 4W5UA 1N8FA 4YMZA 4DUVA 3NYZA 5BW6A 2DFAA 3ANUA 3TR9A 5CBJA 2A4AA 1V03A 4XIAA 3EYPA 3P8JA 4NKCA 1UD6A 4GI8A 2DT1A 2Q3OA 4HSOA 4N2YA 3QV9A 4IP5A 3B9DA 4UC5A 4A8IA 4NXSA 3PBMA 3CL7A 1M1BA 5H8UA 2WZMA 1D3GA 1VBUA 4QHRA 4Q8NA 5DBUA 2XG9A 1MQRA 3GXPA 1K8ZA 3ZWTA 3ABSA 1MEIA 1RBOB 3N14A 1FFQA 3RIKA 3UPBA 2FB3A 3C2EA 2NQHA 1H41A 3LSBA 2E0PA 4JX5A 2EPKX 4XK2A 3VYLA 3WL1A 3CMGA 4GJIA 1FWBC 2XM1A 5LSMA 3ANYA 1Z41A 1Y5WA 2ISSA 4S3DA 2P50A 3W7QA 1ONWA 2P10A 3ZWSA 5I3FA 4D6FA 2PD9A 4GE8A 2Q8XA 5XIAA 4Q8PA 4HU8A 3LV5A 5HWJA 2Y7FA 2YBUA 4HZMA 3C56A 2E68A 3LYEA 3W02A 1R3WA 4W85A 3RUBL 2YGYA 4P8VA 4AWUA 3BOLA 1MEHA 5G2HA 3EB4A 2BOEX 1LRTA 2HVOA 4N6FA 5A6BA 1PZ0A 4GC4A 1N55A 2FH6A 4HSNA 1QO5A 3CHEA 1AMYA 4PULA 2GGHA 4MMWA 5E9AA 4B9ZA 2GYIA 4HMEA 1XYZA 1NDZA 1XIBA 3ARVA 2YOCA 4RE2A 4S23A 3QW4B 4KESA 4LVDA 2PDXA 1R3SA 3RLUA 1VRXA 1NOFA 5T9CE 2QCGA 4GCAA 3SBFA 4DYKA 2RHGA 3W1UA 3WD1A 3BV4A 4ZOAA 1TTIA 4UTJA 2WAGA 3S5ZA 2QGHA 2DZBA 4AWTA 3JS3A 2EXOA 1GJPA 1VD6A 5BU9A 4JFSA 1E40A 3RCNA 2DQXA 4EAYA 3V7PA 2DSKA 3CM4A 1RSCA 2J8FA 3WNLA 5JQ9A 5U4NA 1HNYA 4LF1A 4HTBA 3VKBA 3VMPA 4MZYA 4E3TA 1B3OA 4EWJA 2WKJA 4HKPA 4UFHA 1TYGA 1AQHA 1UWIA 3P61A 5E0CA 1TR9A 3ZS4A 4KCUA 4H9YA 1HO4A 1F6KA 5M2FX 1NWUA 2VEPA 1BHGA 1O66A 4M24A 2XVGA 4OUEA 1GHRA 1UG6A 4CUCA 3MHFA 2WZTA 1DEDA 3SCTA 4ATWA 2D20A 5I09A 2C0AA 3WD2A 1EJXC 3WLPA 4I9MA 6TAAA 3SR7A 1C93A 3G1SA 3VABA 4Y8FA 2ESCA 1E9IA 4GY0A 3OTRA 4HCHA 2WC3A 3GH7A 5AYYA 4UQEA 1E43A 2XSBA 3J7HA 4TVUA 4IMFA 4MADA 4FOUA 1OFAA 2FJUB 1UOKA 3AS3A 2QS8A 3WLKX 1VIZA 3PG9A 5LIUX 3UJEA 3SRKA 4CLMA 1JF5A 4PUKA 1T99A 4WIWA 1IT8A 1ZRQA 4O16A 1P43A 2OYMA 2WPBA 3LENA 5E09A 1T7LA 3CUZA 4OUIA 4X61A 2QZRA 1Q6EA 3DFYA 2GGIA 5A6AA 4MPQA 2XN1A 5CPOA 5IBXC 2MNRA 1JZ8A 1K03A 1R47A 3F2BA 4IHCA 3GDTA 4HK5A 1OC7A 1CLKA 3APGA 3FJLA 4BQ3A 3F4NA 3ARSA 3BE7A 4EXBA 4GK8A 4GIRA 3RILA 2DIEA 3WQDA 4XISA 2ZZ2A 1GUVA 1KRMA 3N4FA 4FZIA 1TE6A 1EP1A 2NZLA 1U83A 1XXXA 3E96A 3UNTA 4KCVA 3W88A 1TWDA 2PDGA 2Z1KA 1TTPA 1Q65A 4A3YA 3TTQA 4DUWA 1XYFA 4GUJA 2FYMA 1JXKA 1NVMA 3W7GA 1KC7A 2R94A 1AQMA 1TWSA 1FWFC 1VYRA 1TWIA 1OFQA 1VFOA 1ELSA 1UR0A 4P7LA 2V63A 1UZ1A 4H3DA 4URIA 3E0WA 2P3ZA 3LCGA 5DRCA 4PRTA 2ABBA 2VKZG 1TR1A 3LOTA 1C7SA 1KR0A 5D38A 3QY6A 4HK7A 3VE7A 3PZIA 1J0IA 3DG7A 5IM51 4GGHA 1HL8A 3AAMA 3GXMA 3PZNA 2XSAA 4K6AA 1XIJA 1TELA 1YE4A 4DAFA 3DGBA 4O17A 4R85A 3UEQA 4N9EA 4TXEA 1GOIA 3VA8A 1Z44A 2A3EA 1XLIA 2YLLA 3W1AA 2PTDA 3VFLA 1FWSA 1N7KA 3B0XA 3DFQA 1KWGA 4AHQA 1QT1A 2CCRA 2VX7A 4HNTA 1XLKA 4GG9A 2ZXBA 4TOQA 1E0WA 4HHMA 3MYPA 4JCLA 1DJXA 3H6OA 5E6YA 4ERAA 4RJEA 3AMDA 1H7WA 1FVPA 4GY1A 3CMJA 1M41A 1BRLB 1OYBA 3LRLA 3HFTA 4A21A 3O07A 4N9CA 4RE0A 2PWFA 5HATA 3VKAA 3T4CA 5DT7A 1TZ9A 1RBLA 5CC3A 3CAKA 3CV7A 4HMDA 2CZ5A 4X3ZA 1W32A 4V27A 2RFGA 3ITGA 4Z1YA 4WXZA 1Q6DA 2X8RA 5GNXA 1PE1A 3WK3A 3H7UA 3UVIA 3WQ6A 1H3GA 4UR9A 4Q7IA 5K7JA 5XIMA 1VJSA 3H2MA 4MY8A 2J9ZA 4RXGA 3KUMA 3EWCA 4MWAD 1QI3A 3VDHA 3GYCA 1UW9A 2OO6A 1RJQA 5KZEA 2TAAA 2I9UA 3AMKA 1ZCOA 2PUZA 3FHAA 2PDIA 2PTZA 2ISFA 3TZFA 3MP5A 4M6QA 3VCCA 1G5AA 2J74A 5CZ0A 3FA5A 3RG6A 4Y90A 1G7UA 1A5CA 1J2BA 3W7OA 1PHWA 4DJEC 1TRIA 1E70M 4AD2A 1POKA 1CXFA 3EWYA 3WMSA 2PFHA 1YNPA 2JFEX 2VNCA 4K37A 4B92A 2VUNA 3RHGA 3ARQA 1H5VA 2XGZA 3ARZA 2YZ5A 4S3FA 4W88A 4DYEA 2FHBA 2FTWA 1EC7A 3WYZA 1TTJA 4Q4QA 3B8VA 1JI2A 3RO8A 3XISA 3C2OA 2RDTA 2EKCA 1XGZA 2IQ0A 3S5SA 1M7JA 2CWNA 5RUBA 3U3HA 2GJLA 2PRHA 5IXEA 3KVJA 2PCQA 4W87A 5D37A 1DWJM 3CASA 4U4MA 4GJ1A 2A1YA 5CC5A 3W1PA 1X8CA 3JZEA 2TODA 3BGAA 3O0FA 4YXGA 3KXQA 4Q8UA 2CLMA 3PM6A 4GZEA 1SSGA 5CZTA 4X2RA 1EO7A 2YZRA 5AYBA 5M17A 1HKIA 2I16A 3CQIA 5HR6A 3N9KA 4M7TA 4ZQPA 3W7KA 3OQEA 3S9IA 1SFJA 5I7GA 1QW7A 3ONBA 1V6TA 4B3LA 1IEIA 3CO4A 4Q6XA 4D6EA 1DJIA 1Q6OA 4DJFA 3OPSA 2PB1A 5AC4A 2ACSA 1J6OA 5A6SA 2YCEA 3DERA 1PDZA 4ONVA 1TCMA 1JPDX 2KZHA 2PDNA 3HN3A 1JJKA 4XTDA 3EA3A 3HV8A 5A1AA 1X7IA 5BXSA 4LC8A 2C15A 5JBFA 2VZUA 2YDQA 2DH3A 1PIGA 4QAIA 1QASA 3NSMA 3IIVA 4TMBA 5F2GA 1Y5XA 2G41A 3GWQA 4PGLA 5IOBA 2FKPA 3PAJA 9XIMA 2NX9A 4AH7A 2WHMA 4UTMA 5IFPA 1ONXA 3L4XA 3KW3A 1M01A 3MTWA 1GK8A 4XTIA 3N29A 3MS8A 4NAEB 4S2BA 3GXNA 4BF9A 3QPEA 2V69A 4MDPA 1W9XA 3FCPA 1E72M 1SMAA 4EX4A 2TRSA 2VFEA 1K6AA 2GQAA 1F7BA 3IV3A 5DXXA 4N4PA 1BQCA 3TU9A 3LCXA 3LGGA 4HJWA 2JF6A 2B31A 2NXGA 3W1XA 1KFKA 2PWUA 1F8MA 2ZXAA 3PUGA 3W23A 1PXGA 3IK4A 4RDWA 2Z29A 1CDGA 3AROA 4YWSA 2ISVA 5I00A 1DKWA 3MI2A 1R7AA 3E49A 1QAPA 4JTKA 2ZUTA 1FH8A 2UBPC 1TJ1A 4IOTA 5D4YA 4TX9A 3OG2A 4QNWA 1H51A 2NXHA 4U3CA 2OLHA 4DO4A 3YPIA 3DESA 4MB4A 4QLJA 4ORIA 5HPOA 1QRQA 5EU9A 4F2BA 1WDDA 1V3KA 4ATDA 4PMXA 3S2MA 3K2GA 3GTFA 1UKTA 4XWUA 5FF0A 3M6DA 3FNDA 2BZNA 4PEKA 3LN3A 1C8VA 5EB8A 2WVVA 3KM8A 1TPUA 5AN7A 2A5HA 3G3MA 5GJNA 2GUYA 4JTEA 3FVDA 3RX4A 2XFYA 2ZDSA 1BXBA 5DELA 3BW3A 4LGXA 3RR1A 1XRSA 4H7VA 3CWOX 2VX4A 2V3EA 2WZEA 4JTIA 1C9WA 1UD8A 4ZB0A 4FX7A 1IR1A 1YXDA 1EDGA 4K39A 1ZB5A 1H7OA 2VQTA 4FLSA 4KIRA 4Y96A 2W3ZA 5AYXA 4HMNA 1MDLA 2VEIA 5MKGB 2IKGA 3W2LA 3M43A 1TVLA 3VIJA 5G4EA 2DZSA 1V3JA 1D2KA 1WDSA 2WK2A 4CQAA 1UR3M 4MG4A 4IM4A 2E6YA 1VJZA 2XFWA 3ZFHA 5JH2A 1GZGA 2WXDM 3IUDA 4LS0A 3TAOA 1CXHA 3S1XA 3TW6A 4MOZA 1I6NA 5DMNA 4I9JA 4Y7EA 3LQGA 4BF5A 3W71A 2F6KA 3DGRA 3WH6A 3IGUA 4HPGA 1KFEA 4KCTA 1R7OA 3LBOA 3K4WA 7PTDA 3BLKA 1ZJBA 3PUOA 4KFNA 1XH1A 5GJPA 2R8WA 3KOZA 4NNCA 2OSXA 3K8MA 2HNEA 4PBGA 2PWVA 2PTWA 3S9ZA 2G4FA