3EKLA

Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
345
structure length
333
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGLYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase
publication title Structural basis for catalysis of a tetrameric class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 134
structure length 333
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3eklA00
4GC4A 4NJKA 3C2OA 2DZVA 3N9SA 1KFJA 5DY2A 5I3GA 1TQJA 4O17A 3G8RA 4IX0A 4XTDA 1I45A 4N9CA 1XL9A 3LGEA 4NXKA 3TAOA 1SSGA 1D3HA 5CZJA 1DV7A 3V75A 1TMHA 3GAYA 1O5XA 5C6MA 1LOLA 1KM2A 1VZWA 5AOUA 4YCOA 1JR1A 3LXBA 2WJZA 3FEMA 3P82A 4NNAA 3WFAA 3KRSA 2A7PA 4ZQRA 3EXRA 1X7FA 4PC8A 2W0UA 3OVQA 3LCIA 4FXRA 1VHNA 4WUIA 1NEYA 4JY8A 1W5QA 4MJMA 3W2MA 5IM51 2A7NA 2NUYA 1QWGA 2VELA 1PS9A 4RZ4A 5D2WA 5C54A 3UPBA 3U2OA 4Z1DA 3SSJA 4NJHA 3R8RA 2TYSA 5AHNA 4B5NA 3THQA 1WAUA 1EUAA 1T99A 4UTKA 4IPJA 1D3GA 4OV4A 1GEQA 1UASA 5K2ZA 2V2CA 1YDVA 4JICA 1SW3A 3EEGA 4LC6A 2QDHA 3GLCA 4KFPA 1OX5A 1OVDA 1GG0A 3W7LA 1OYBA 3W1RA 4YL2A 3TW6A 1H51A 2I14A 2D73A 4HNTA 4AEOA 2QCLA 3HB9A 5AHLA 3FJLA 3FS2A 5G4EA 1EB3A 1K7EA 1OFEA 3NQAA 2HMCA 4FB7A 2JKEA 3AJXA 2NWRA 1ADOA 4WJEA 3PWAA 3W7MA 1QPRA 1F6KA 4MFDA 1F2JA 3B0VC 4MLJA 3TSBA 4LVDA 3NPXA 2GUUA 3QW4B 1TTJA 3H54A 3I6RA 2RHGA 1M7PA 1QCWA 4JEQA 2EKCA 3CM4A 2Y61A 4XWUA 1VR6A 1W3NA 3MI3A 3G1SA 2CLMA 1SUXA 3HGJA 1GZGA 3UZ5A 1H62A 4M7TA 4IWWA 5AYZA 1OYCA 4P61A 2Q3RA 2V9DA 2BLEA 2HTMA 4A21A 4YMZA 3QM3A 5DLCA 1JQVA 1QOQA 2YXGA 2G5WA 3QW3A 3GR8A 2C14A 3KRUA 5DY3A 2CWNA 2JKPA 3TQVA 1QFEA 4P2VA 5DXYA 3YPIA 2QCDB 1NF0A 4W9TA 3GVGA 4Y8FA 2J24A 1B3OA 2OMAA 5CGQA 3W1MA 5BMWA 3CQ0A 3UXDA 2AAMA 3NNTA 1F05A 5I3HA 3R5EA 2E68A 3L0NA 4GUIA 3S1XA 4S2BA 2DZUA 1BWKA 1M7OA 4DO5A 4HIBA 4AXKA 4DF0A 3DHFA 3W7JA 3UWYA 3LCLA 4I7UA 3DAQA 1ICQA 4LVGA 4BR1A 4FF7A 3MO7A 3W76A 3KRZA 2EF9A 4UTTC 3UYCA 3IVUA 3STEA 4TIMA 2ZTJA 4OE7A 1UBSA 1RZMA 3L68A 1KM4A 5LKYA 5A5WA 3O16A 1TJPA 5E93A 2J27A 1X8FA 2Z6IA 4JTUA 4UFMA 5LNSA 2EPHA 4LS2A 3W1AA 2QR6A 3A23A 1P5BA 1WBJA 3QRHA 4H6KA 5G1TA 3LHTA 3HO8A 3BG5A 3NVTA 5LNUA 4Z1AA 2QDGA 3NM3A 1QO2A 4A2SA 3GK0A 3KVKA 5HMSA 3A5VA 1C29A 5LHEA 2XFWA 3GNNA 1FCUA 1D9EA 4PCFA 2TSYA 4N4PA 4A3UA 2ISVA 4WXZA 1H1YA 4JDBA 3LXCA 4RZ5A 1VLWA 1H7RA 3OIXA 5BW6A 4QIUA 1F74A 1EEPA 3RLVA 3G0UA 1GPWA 5G4WA 3NPWA 6TIMA 3AO0A 3EXTA 3MP3A 1B57A 2DZSA 3HPXA 4H3DA 3G18A 3N3MA 4X2RA 5AHIA 3TQ0A 1MXSA 5AC7A 4I7VA 3VI2A 2DORA 2G97A 5TQLA 5D09A 3N73A 1R30A 3L65A 2H8ZA 3BPWA 2HSAA 1ZHAA 3W73A 2Y70A 3PSWA 2QCDA 1E51A 5I3KA 3G1VA 1DJQA 2ZZ1A 1LM1A 2E5CA 2E6FA 3K30A 1EP1A 3TV8A 1H60A 5K9CA 4WY0F 1OYAA 1VYPX 5F1VA 1L2UA 4Y96A 5U4NA 1ZALA 2ZRZA 3GX9A 4MOZA 3WJWA 1SZNA 3NOEA 3DKLA 2DZPA 3O05A 4MJZA 4RX0A 4AAJA 2CLEA 4PL2A 3A21A 1VYRA 4DO4A 4IPIA 1VYSX 2JBMA 3THAA 3P81A 3P8IA 3LHVA 4K7VA 3PC0A 4QM1A 4JD4A 3C56A 3LHWA 4N6EA 2YZRA 1JUEA 3DGRA 5FEXA 3DHDA 1SZFA 4M19A 3SJ3A 1J5TA 3L2IA 2QCNA 1K7XA 3NQDA 1TSIA 3IRDA 3BLFA 4YLWA 3EWXA 3BLIA 2PC4A 2CLHA 4QNEA 5CSRA 4D2JA 3LCHA 6ALDA 5G5IA 3IGUA 3UY8A 4JTKA 2NXHA 3W2LA 3TIMA 1QPNA 2E1DA 3DFTA 2ZZ2A 3P80A 3W1XA 5HQEA 3LXAA 5TBOA 1R2RA 4S1FA 2GVGA 4E2BA 3DFNA 4TR9A 4OU1A 1TYGA 3IGXA 3PB2A 3W7DA 3DZ1A 1Z42A 2ZZ5A 3FFSA 1SW0A 4UTHA 4UTUA 5LGZA 1X6UA 1TPDA 3OA3A 4N6FA 4N02A 3W1PA 3FLUA 2BZNA 3M5XA 3ZS4A 2QEZA 5D02A 3ATYA 3L5LA 2BXVA 1TREA 4FX8A 1ME7A 1KM3A 5BNKA 4CNOA 3PUEA 2V30A 3SECA 3MJYA 4FNQA 4JTTA 1TPH1 3W7CA 3B8DA 1TQXA 3U8GA 1PIIA 2WNNA 5F2LA 3ABQA 3T4CA 4LRSA 3C6CA 4ALDA 1Q6OA 3W9ZA 1XFBA 4FEZA 4E38A 5KMYA 1AL8A 3P7YA 1WBHA 1MZHA 3HPSA 1OFOA 4NUWA 3LCGA 3GDMA 3TXVA 3NAVA 3NZRA 4OV9A 5CPLA 3T7VA 3LI1A 1F5ZA 1PHQA 3NXFA 3CLMA 1GVQA 1H61A 4N2YA 4MY8A 3TFCA 2J9ZA 3QMTA 4RK8A 5EBUA 3W7OA 2ZFAA 4FIQA 3TE9A 1KBIA 2E09A 1WYIA 4LRTA 1OX4B 1W5MA 2RKXA 3W7QA 2H8XA 5HWMA 4GWEA 4GRSA 3WJSA 1JCLA 4O57A 4XQ6A 3BK0A 2NX9A 2JGYA 1GWJA 1LRTA 1FQ0A 1R2TA 1YDOA 4JTLA 1K3UA 4ZQMA 4XBSA 2NWSA 4MFEA 4ZQNA 5FI8A 3HF3A 1H5YA 1UB3A 1G67A 3S5YA 4YWIA 3E9AA 5DBUA 2QAPA 4UTJA 2A4AA 3WJXA 4NJGA 2JK2A 2Z1BA 4M5PA 3TC6A 3PG8A 4JTHA 3W71A 4JXCA 5G2WA 1T0OA 5KTLA 3EB2A 4UFLA 3QQ0A 2FDSA 4HPJA 3TKFA 4MY9A 3G1FA 4WOQA 3B0UX 3EWZA 3TUUA 1OF8A 3W85A 3PBYA 2QCGA 1OFQA 2TPSA 2YSWA 3NL5A 2WOQA 3HJZA 1KFCA 4O54A 4ICNA 1GVSA 2H3DA 3DFQA 4XBKA 1QOPA 3IVSA 2ZA2A 5FEZA 4UNKA 3S5ZA 4PODA 1QPQA 1OK4A 1EIXA 3I65A 3LHUA 5F2IA 3W1TA 2ZDRA 4FIRA 1SO5A 3O06A 4O0ZA 1F73A 1FWWA 1P4CA 3L0KA 3UWWA 5AC8A 5D33A 5FESA 1SU5A 4UTIA 5HUPA 5E0KA 2ZA1A 4ZZ9A 1JUKA 2P10A 1FCVA 4CNNA 1Y0EA 2DJLA 2RDTA 3V1PA 4DBDA 2QCHA 4O28A 1JRCA 2NV2A 3SY5A 2PRLA 3E02A 1OX4A 4IX2A 1I2PA 1FY6A 5D2VA 3P67A 1RQBA 4UMAA 3O6CA 3TFXA 1MEHA 3WK3A 2RH9A 2GPTA 1JULA 1VCFA 1EP3A 4QJ1A 2V2HA 3C4UA 3G3DA 3W7EA 2FTPA 3PSVA 3PBWA 4ORMA 3B04A 1HO4A 2E6YA 3HG2A 2VFIA 4JTIA 3SIZA 4K38A 3GIYA 5HINA 4LY8A 1XBXA 2JKAA 4YCPA 3NDOA 4K37A 3PB0A 1WA3A 4JDYA 2Y7EA 3FKKA 3IIVA 5EY5A 2UV8G 4I7WA 1JCXA 3OVRA 3PAJA 4K6AA 1H7XA 5FEPA 4K8EA 4ZQOA 5SWUA 3R2GA 4IMEA 4IMDA 1L9WA 1W0MA 3MYOA 3LHYA 1G4TA 3F4NA 4N9EA 2EHHA 4DEFA 3CTLA 1XI3A 2AQWA 3TDFA 3TK7A 4JTJA 1ONRA 3P60A 1FXPA 3UWZA 3MHGA 2NLIA 2B7OA 3BO9A 1NFBA 1FX6A 3G0SA 2V5BA 2NUXA 2X1RA 1XBYA 1FBAA 3H55A 3LTSA 2Q8ZA 4HNNA 1TTIA 2C3ZA 1AW1A 1H63A 4MY1A 2GVLA 1M5WA 1LLWA 3S5NA 3GKAA 5HULA 5I3JA 4CNPA 2V0TA 3QJAA 3TX9A 1UJPA 3SFKA 2RDUA 3S5OA 1TTQA 4NZJA 2NXGA 4UXDA 4AWTA 1OX6A 3TR2A 3TH6A 1WDWA 1NAL1 2X1TA 1LRQA 4OHQA 1LRNA 4UNLA 3R89A 2H90A 1QAPA 3GAKA 3NL6A 2YDAA 2E5DA 3ANYA 1B9BA 5F2GA 1WXJA 5F4XA 1Z48A 2FB3A 5BOOA 3CWOX 1TV5A 3T40A 1XC4A 1T8XA 3WK1A 3O6DA 2YW4A 1YXCA 4QAIA 4KWWA 3MMTA 2I1OA 3KFTA 4M7SA 1GVRA 3P62A 5D38A 2A85A 3ZR4A 5DCDA 3W1QA 3RLUA 3LV6A 2YYTA 2YX0A 3GYEA 3NEVA 3BW4A 2QJIA 2QCFA 4HNVA 2CLOA 3MP4A 1IIGA 2ZA3A 3BGJA 2JGQA 1LCOA 3M7WA 1GTHA 1OFPA 3TJLA 3MW7A 4PFMA 1OFRA 1O95A 4FO4A 3ABSA 3HOJA 2ABAA 2C19A 1N8FA 3GXTA 2YFNA 3C61A 4JX5A 5EMUA 5C55A 2DJXA 3UWUA 1XXXA 2VFGA 4LVAA 3S1UA 4GNJA 4DELA 5DN1A 1G4SA 4O4WA 3QFEA 5D2YA 5FF3A 5CKSA 1QDSA 1XM3A 2CU0A 1AK5A 4HNUA 3HIJA 1WV2A 5FF4A 1K8YA 3ATZA 2ABBA 1VCGA 2NX3A 2ZRWA 5F2MA 3DXIA 1WOBA 3QF0A 5K9XA 4MYAA 1JRBA 1XBVA 5KSWA 5FF0A 5K9DA 2B7QA 3I7RA 3NYZA 3UZJA 4RV8A 3KOFA 3DI1A 2YGYA 4WQ6A 1GVOA 1S5VA 1FWSA 2ZZ7A 5AHMA 4ONVA 5EPDA 5L6UA 4H4IA 1YTEA 3N34A 1G7UA 4DQWA 1KFBA 2QKFA 3U6WA 1ML1A 1VS1A 2Y7GA 3VE7A 3EXSA 2V81A 3LRLA 2FLIA 3LDVA 4OT7A 2HS8A 3VFLA 1PCKA 1JCNA 2R91A 3Q94A 1KM5A 3FA5A 1Z41A 3W2NA 4X9SA 2R8WA 4GE8A 4TMBA 4TU1A 3N2MA 1RV8A 1YDNA 3TMQA 3P84A 4GUGA 3RU6A 5D30A 4IMGA 3DFSA 3EX1A 4WY0B 3NO5A 3LHZA 3GDRA 4R34A 1GOXA 3G1AA 4OQVA 3ABRA 4JTFA 1EP2A 4L4LA 1HG3A 2Z2UA 4JTGA 4NU7A 3IGSA 4XKYB 5A8GA 4BFAA 3EX4A 3OHIA 3W7HA 1DHPA 1W37A 3QH2A 1ZJIA 3D0CA 2WKJA 4ZVJA 2WSRA 4AHPA 2G96A 2E5BA 3LI0A 2ZRXA 3G3MA 4K7YA 1DJNA 1AL7A 5AYYA 1SQ7A 1DBTA 4EF9A 1YTDA 3G1DA 3GXPA 4JIQA 4LW7A 1OJXA 3HG5A 5AHFA 2FJKA 5K3VA 1LBMA 3PG9A 3F1QA 4IUOA 3C2EA 4GFSA 3FYPA 2A0NA 1FWRA 4EIVA 4O14A 4NQ1A 1TPB1 1PV8A 3CWNA 3IV3A 4EOUA 1YXYA 2CLLA 4PTNA 4Y9AA 3PY2A 2C15A 2QCEA 3E0IA 3KVJA 1P0NA 1VQTA 4FXSA 1X1ZA 2X30A 4MIMA 4UR7A 2GOUA 3W72A 1Q6LA 5AN7A 2GVJA 1TTPA 1OK6A 2NXIA 1ZAIA 3P8JA 3IEBA 3L66A 3LB0A 4K39A 3PF3A 2BWGA 1KFEA 5E1QA 3UWVA 1RQHA 1AG1O 1GYNA 1KA9F 2R94A 4POCA 4WY0A 1SFLA 1A5SA 3TJXA 4O15A 4X3ZA 4A29A 4UR8A 3TC7A 1QNVA 3MHUA 4XKYA 1H50A 3M43A 3IIPA 1GVFA 1LROA 4HKPA 4KFNA 1HTIA 2ISWA 2DU2A 3E49A 1V7YA 3A9IA 3QMRA 5D2XA 1HO1A 3NQ6A 3SGZA 3STCA 2QUUA 2CLFA 3M9YA 2VXNA 1A5CA 1TRDA 3W6YA 3PR2A 3WJZA 4CQ8A 4MZYA 3L9CA 5HWNA 3MI2A 1O5KA 1H7OA 3W2JA 3LCFA 2CZFA 3NQ8A 3L67A 4EF8A 3RF9A 3BG9A 2VFDA 2WSQA 2FQIA 4JYEA 3LERA 1Q6RA 3R13A 4O8RA 1WQ5A 3PUOA 3JR2A 3N19B 3C2RA 1KM0A 1PE1A 1CI1A 2R14A 2J9XA 1KM1A 2RDWA 3BW2A 1H7WA 5IBXA 2QCCA 3NL2A 2X16A 3L21A 3CIWA 2CLIA 2FB2A 3MUXA 4GJ1A 1SZEA 3SI9A 3W83A 4HT3A 3O07A 3W7NA 1GJPA 3S1WA 1BKSA 3M16A 3RNDA 4QISA 1EUNA 2J9YA 4BWLA 1LDCA 4JIPA 4JGDA 1Q6QA 4AVFA 2ISSA 2Z6JA 2YPIA 2ZRUA 3M5YA 4HPXA 3LTYA 1THFD 2E77A 3A5FA 1LBLA 3BW3A 3F03K 4TO8A 5DELA 2C18A 5AB3A 4NX0A 4CCCA 3CHVA 3G1XA 4R33A 3W74A 1RQEA 3C3NA 1W56A 3JS3A 5EYWA 4RLIA 3QEZA 3G0XA 4DXVA 5DCEA 5LNWA 1ZFJA 3HPZA 1R2SA 2H3BA 4TX9A 1SO6A 3B4UA 3O15A 2A6LA 3PVFA 4XUGA 2J88A 3FOKA 1W5PA 1EWDA 2PCQA 4N9BA 4IXXA 1C9DA 1ZCOA 4KFOA 1F76A 4O1BA 2WNQA 4NXSA 1XUUA 1B4EA 2B7NA 3VNDA 3LRKA 3NL3A 3OBKA 4IGHA 3W86A 5GVJA 8TIMA 1ICSA 4Z1BA 1XDLA 1KTBA 5LNRA 1SPQA 2I9EA 1JJKA 4ADSA 3W2UA 4IQLA 1KLYA 2XN0A 1MO0A 1G7VA 3EX6A 2HS6A 3IIOA 2WSYA 4X22A 4BI7A 5HR7A 3S42A 5KINA 4GUHA 3W84A 4Y90A 3HG4A 2ATMA 3WK0A 1B4KA 3HBLA 4AMAA 4IXHA 3LBCA 1PL9A 4LV9A 3B0PA 3N14A 2BTMA 1W3IA 4BF9A 3B03A 5H2ZA 1WOAA 3TA6A 1DL3A 3M47A 3Q37A 3STGA 3S6DA 4E2DA 1DQWA 5EKYA 3OEXA 4AF0B 1OABA 5CPOA 1I2QA 2PRHA 1BEUA 2ALDA 2GJNA 4O53A 1GG1A 2E6DA 4GBUA 2WPBA 3NQ7A 2OX1A 1W54A 1ZNNA 4KWVA 1OHLA 3DBPA 3ZWTA 4N4QA 2VC6A 3NA8A 2GQAA 3LCXA 3UWQA 4WX2A 3O8AA 1JCYA 4FNTA 1SR9A 1VLIA 2Y7DA 5DBTA 5HUOA 3NPUA 3GR7A 4JNMA 2VENA 5F1UA 1T96A 4UTLA 4ADUA 2X2GA 2B0MA 1ICPA 3NQ2A 3L0GA 3EKLA 4LNYA 3M5VA 5CZSA 3NM1A 5G1YA 3ZFHA 1GQNA 1TPUA 4M6QA 1LYXA 2P0OA 5HNRA 2C13A 2QUTA 2ZQ0A 2C6QA 2X1SA 1W5NA 1XDMA 4Q32A 4RXFA 4O4VA 3TAKA 4R53A 1R47A 4MPQA 2Y62A 4O19A 2EAWA 4NJIA 4PH6A 3W22A 4A2RA 3P5YA 3M41A 3GNDA 4BK9A 1Q3NA 2V82A 2V2DA 1KV8A 3PM6A 2LLEA 1DQXA 4ZQCA 1XCFA 1A53A 4Z0JA 1EA0A 3CC1A 4Y6GA 3W1NA 1ME8A 2C16A 4U4MA 3SGUA 1TV7A 4FNUA 5F4SA 1H7PA 2Q8LA 1LBFA 1RPXA 4CCEA 5C5YA 2H6RA 2A1YA 3CU2A 1UCWA 1NSJA 1PHWA 1K8ZA 3QSTA 4UCGA 3W7IA 1H7NA 3P61A 2AGKA 2CFFA 2PE4A 1RR2A 2V5LA 3OVPA 3W7GA 2WNZA 1FUYA 4I9AA 3UNDA 1J2WA 4AWUA 4LT9A 1IIHA 1VH7A 3B06A 3W7KA 5BMXA 5H91A 1H1ZA 1M6JA 4AF0A 4AHOA 1I2RA 1G6CA 4ML9A 2J6XA 3O6YX 1V5XA 1ALDA 1VCVA 1K02A 3TQKA 3P5ZA 4UIOA 1LLZA 4S2CA 1TO3A 4WXYA 1FDYA 5CZ0A 3C52A 3DFPA 3G1HA 5AC6A 3E96A 1BTMA 1FDJA 1VRDA 1A50A 4UFIA 3F4WA 3CT7A 1ZAJA 5IBXC 1JCJA 5J5RA 3UD6A 3UPWA 1TPFA 4JYFA 3CPRA 3GZ3A 1TPEA 2QAFA 1MSSA 2VFFA 4LUJA 3WJYA 4QSHA 1SW7A 2TRSA 4MVAA 3VE9A 1DVJA 3O1NA 2VEIA 1SFJA 3GKFA 1BWLA 1YPFA 4PEKA 5CG7A 3DH7A 4O1CA 4BWLC 3BG3A 1KV5A 5K4ZA 3A24A 3QC3A 1N7KA 5LSMA 1MEWA 3MP5A 4U28A 1GTEA 4G1KA 1NF7A 2O7QA 1L6YA 2CZ5A 3TCEA 3RFAA 1WX0A 3DI0A 2QUVA 4HN4A 4J9JA 5CZTA 3GXNA 1U83A 2VEKA 3HGRA 3CB8A 4R7JA 1PVNA 1IXPA 2GQ9A 4PA8A 4N9DA 4O0KA 1FCBA 4TMCA 2A21A 5MHBA 5HJLA 1LZOA 5G2HA 4AH7A 3SZ8A 1ZENA 1MEIA 4O13A 2A6NA 3EWYA 3NQFA 4CQAA 1ME9A 1FCQA 3GDTA 3KHJA 2DZWA 5U7SA 7TIMA 3TMLA 1YTKA 5KZDA 1S5WA 4UUIA 2V8ZA 2CLKA 1XUZA 2WO5A 4NT0A 4LWWA 4EVZA 3QPYA 4CCDA 1KLZA 2ZBTA 1RD5A 2VFHA 3S9YA 3QSRA 3KAOA 3QQ1A 4OBTA 4O1AA 4DF1A 4FNRA 4O11A 2VEMA 3W1UA 1CW2A 2OCZA 1G4PA 1HL2A 3VKJA 1W1ZA 4IOTA 4HHPA 5EA9A 1OG0A 1R46A 3WK2A 2WQPA 1DORA 3L5MA 5AHEA 5G2IA 3M44A 2A7RA 1A5BA 1VPXA 2RFGA 4JS3A 1PCWA 2ZRYA 1TV8A 3UY7A 3TNOA 4C1LA 3Q2DA 4IMFA 4GUJA 3O63A 1UUMA 4DPQA 1LP6A 1KM6A 4WOZA 2EGZA 2ATSA 4MKNA 2QF7A 2P1FA 3ABOA 1A5AA 2TMDA 1EX5A 3BV4A 4NZFA 4L4MA 1VHCA 4JY9A 3NQEA 4FX7A 4LC8A 2CW6A 3NQCA 5K7JA 1TPC1 3LTPA 1TIMA 3LCWA 5AYXA 2GQ8A 2B7PA 5FEWA 2BX7A 2C0AA 4QITA 1O94A 1S3HA 4O16A 3TROA 2ZRVA 4XZ9A 4QNWA 3W88A 5D32A 3Q58A 1SO4A 3N2XA 1HFBA 1L6WA 2F84A 3PBUA 4UFHA 3E12A 2OZ0A 2Z0IA 3HQ1A 1YLVA 2XN2A 2Q3OA 5DCBA 1LOQA 3DENA 4AB4A 1FDZA 4DF2A 3MBDA 5HWJA 2NUWA 1CX9A 3HG3A 3G24A 1ZY9A 1QO5A 3DKJA 1FWNA 2O7SA 3FJ6A 1G69A 1YXDA 3CEUA 2VEPA 2ZZ6A 5F4WA 4DO6A 1OFBA 3W70A 4Q33A 4OWGA 4RKAA 4RXGA 3RK8A 1AW2A 4M6VA 3A22A 4RJEA 3TU9A 2IQTA 2DZTA 3I7SA 2Y7FA 4LOCA 2OT1A 2YCEA 2ZTKA 4MYXA 4XTIA 2Y89A 1EWEA 5CPMA 3QZEA 4JR5A 1I4NA 4LTSA 2C1HA 3W23A 3PUDA 1YPIA 4HSNA 1N55A 4AWSA 5D05A 4UTWA 1SSDA 3LV5A 3GDLA 3H53A 4UMCA 3ELFA 3FKRA 3C0JA 3C2VA 2ZZ3A 1FWTA 1O4UA 3L5AA 3EWBX 3MWAA 1I8JA 3W75A 1XBZA 2ZCGA 3USBA 3EKZA 4RCXA 4AHQA 1GYLA 1JUBA 1Q45A 3BARA 4IMCA 1P0KA 2DP3A 5FF2A 3W7PA 4DPPA 1KTNA 1DOSA 5HR6A 2WV8A 3LLFA 4Z08A 5D03A 3MBFA 1OF6A 2BSLA 5AFDA 3TW7A 4M6PA 1IXOA 1TPWA 1W8SA 1W31A 3W2KA 2VKZG 4FNPA 3UXAA 2KZHA 3KX6A 4MZ1A 4NNCA 4RZ6A 3KVLA 5CPNA 1GT8A 4A22A 3I7QA 1U5JA 2VFEA 4NNBA 1AMKA 1QPOA 2FPTA 4EWND 4DBEA 1IXNA 1JCMP 3KVMA 3W87A 1F7BA 3NQGA 3ZWSA 1SZGA 3T78A 1L6SA 3EX3A 5J5DA 3IVTA 2FIQA 3IIXA 2NZLA 5LNVA 1EPXA 3TSMA 3QPZA 1P1XA 5D37A 2QJGA 4JX6A 4O50A 4NVTA 1QMLA 5K4XA 5KZMA 1UUOA 1TJRA 3S1VA 1K7FA 4NJJA 3EWWA 3JRKA 1IF2A 3FIGA 3T55A 2OJPA 3M1ZA 3OG3A 3M0ZA 3GDKA 3T44A 2ZZ4A 1X1OA 3W07A 3EWUA 4CQ9A 3NZ1A 1LTDA 3SR7A 4FX6M 3W3OA 1KFKA 4LS1A 3STFA 3S8HA 1SO3A 3BGGA 3TXZA 4Z0SA 1AW5A 1DKWA 2Y6ZA 1QR7A 4MZ8A 2E6AA 1J4EA 4BI5A 2VOMA 4LS0A 5I3IA 1C8VA 3N9RA 4FHAA 2YYUA 4LVFA 5KITA 3LX9A 3PBVA 2F7FA 5D2TA 3PS7A 4ZQPA 1K8XA 4O52A 3RMJA 2FFCA 3EX2A 5LHFA 3HMJG 3LM7A 4ZL1A 5C2XA 4MLRA 1IGSA 1FXQA 3DFOA 2XN1A 2G95A 3LBMA 5LZLA 3C8FA 4UMBA 1TB3A 5ABTA 4O18A 3LOTA 3G1YA 4ZMGA 1OFDA 1JVNA 1Z44A 3VCRA 4HSOA 2NX1A 4ADTA 3KXQA 2B4GA 5EL1A 4GXMA 1F6PA 3MI6A 2QCMA 4LVBA 5BRBA 3INPA 3QMSA 1OFAA 3I68A 4JN6A 3CEPA 2W79A 1YYAA 3IIZA 4KKXA 4LUIA 1VJIA 5LGXA 3NR0A 5T26A 1I2OA 5TIMA 1TPVA 2FPYA 2NV1A 2OT0A 5DXXA 4K8HA 4RR4A 2ZYFA 5I3FA 4WD0A 4Z1CA 3BLEA 4YXGA 3MHFA 5KZEA 4GUFA 4O12A 1LOSA 4CLMA 1I2NA 1RVGA 1JQXA 1IXQA 1KTCA 5D04C 4NX5A 5L9FA 3G22A 4JX4A 3MYPA 3SW6A 2Y88A 4BI6A 2DZXA 4QQ3A 2PRMA 2Y85A 1K03A 4PL1A 3C2FA 3LLDA 3W7RA 1NVMA 3G8EA 3NPVA 4UTTA 4ORIA 3BVJA 1S5TA 4O10A 2GJLA 3PULA 1VGAA 3LRMA 4LU0A 4MUZA 2CZDA 4JTSA 3NGJA 1O60A 5CSSA 4JYDA 2YR1A 2YFOA 4UTWC 1TRIA 3HGSA 2Y63A 1KW1A 4UFJA 4FNSA 3NQVA 4Q4KA 3HGOA 3R12A 4OGZA 3TSDA 3UQNA 3B05A 2A5HA 1W5OA 3FYOA 3W1LA 4IJBA 4UFKA 4C1KA 3M6YA 4LV4A 2A2IA 4UTMA 2X1UA 2QJHA 2FPVA 4K36A 4WZHA 3S0CA 2YW3A 3GB6A 5FF7A 1ZAHA 3CIXA 3P74A 2CZEA 1W3TA 3NQMA 1LORA 1G4EA 1TCDA 1XKYA 3DU0A 1KFLA 4UC5A 1HUVA 1VC4A 4E0CA 3QYQA 3NG3A 2PURA 1KBJA 4O1DA 4JTEA 2W6RA 1YADA 3M5ZA
chains in the Genus database with same CATH superfamily
2C79A 3C2OA 2XGBA 4J3ZA 5DY2A 1BWVA 1P48A 4O17A 4GXWA 3B9AA 1B2YA 1HJSA 1LF1A 4NXKA 3TAOA 1XF0A 5BXSA 2PTZA 3T2QA 3H2CA 1O5XA 4OTKA 5C6MA 5AOUA 3BCDA 3RPTA 2C71A 2IQ0A 3FEMA 4H6RA 3KE0A 3LCIA 1S2CA 2PDCA 4HYWA 3GHSA 3BSHA 1W5QA 3EPNA 4PYSA 1QWGA 1J93A 4RZ4A 3KBVA 3RO8A 4Z1DA 1MXDA 1AVAA 3WLTA 5AHNA 4W7WA 4DYEA 1UHVA 3EZ4A 2WHJA 2AGTA 2V2CA 1YDVA 1BYAA 1OCBA 6REQA 2QDHA 4KFPA 4MSSA 3W1RA 3TW6A 4FLSA 2OQLA 2D73A 4AEOA 4J27A 3FJLA 3RPMA 2QF8A 1TR1A 3MT1A 1RLDA 2ZWYA 3B9NA 2HMCA 3U3HA 2JKEA 1SGJA 2XIMA 4LBSA 4HQVA 4V33A 1QHZA 4WJEA 3ZJKA 4GABA 4MFDA 3IJ6A 3UA4A 2POZA 2YL8A 3B0VC 6A3HA 3CHFA 4AUBA 3I6RA 4O0QA 2ANUA 3GNPA 4JEQA 1W3LA 3NSNA 3CM4A 4AD2A 2JFEX 2Y61A 1W3NA 1F3EA 4P7LA 5HPOA 1W9DM 2J79A 1CDGA 3G1SA 4XVDA 1EGVA 4Y7EA 3CGTA 2WMIA 1H62A 3CZKA 4M7TA 1FWFC 1V3HA 4W4QA 1GKPA 3P0XA 2BLEA 4A21A 4YMZA 5HNNA 1MDLA 3RILA 3KBNA 4EXBA 4IPNB 2JKPA 3LUTA 2D23A 1IR2A 1US3A 1HF6A 4DX3A 3CQ0A 1JYNA 1KGXA 2PD9A 4L1GA 4BA0A 4Z2JA 4GQBA 4DO5A 4AXKA 3W7JA 3W0KA 4LUSB 4CVWA 4UTTC 3ABXA 3UYCA 1BGAA 3I3EA 4TIMA 1UBSA 3MVIA 1W6TA 4DWSA 3O16A 2RGMA 1XYAA 1X8FA 2Z6IA 4UFMA 5LNSA 2HROA 1QRQA 2D69A 4PMZA 4LS2A 1P5BA 5T9BG 4XAFA 3LHTA 3BG5A 3NVTA 3GXFA 4Z1AA 2QDGA 4IPLA 1QO2A 4HOZA 1H1NA 3KVKA 5LHEA 1C29A 2HXUA 4X0VA 1D9EA 2TSYA 2FZ8A 1V93A 3POCA 1AQFA 5BXTA 4WXZA 2R82A 3T8QA 1H7RA 4E8CA 2YJQA 4PUMA 2WC4A 3RLVA 3G0UA 3KTXA 3VGGA 2D2JA 1UKSA 6TIMA 3MP3A 3WUGA 5AHIA 2DV0A 5AC7A 4K8GA 5D09A 3GU9A 1R30A 3EGJA 1F07A 3NDZA 2CLPA 3UEQA 1OB0A 4CVUA 3PSWA 1M65A 1E51A 5I3KA 2XHYA 5FAGA 4F66A 4XO7A 1HVQA 2NQZA 5K9CA 4HPGA 3TONA 3MUZ1 3THDA 4Q8UA 3QC0A 1DQUA 5LYRA 4W86A 5U4NA 4Q8WA 2PI6A 4WSHA 3C8NA 3VKDA 3B4YA 4FPSA 4MOZA 4UB9A 4FOJA 1SZNA 2DZPA 2YB4A 3O05A 4AAJA 4U10A 4PL2A 4IPIA 2BVWA 4H8HA 1VYSX 3WQEA 3P8IA 4BCEA 4QM1A 1P0DA 4GY7A 3VOIA 3LHWA 2YZRA 1JUEA 5FEXA 3DHDA 1I6NA 2FDMA 1K7XA 3ERPA 1TSIA 3BOXA 2V3EA 2PC4A 5CSRA 4ZXLA 3LCHA 6ALDA 2DIEA 2W63A 4UZSA 2XJ7A 2YA0A 4JTKA 1ITQA 3W2LA 1QPNA 5I00A 2P5NA 3W53A 4TTUA 3PK7A 3P80A 3WD4A 4PMXA 4GOAA 4S1FA 1CENA 3DFNA 4OU1A 2BMBA 3PB2A 2YLAA 2CITA 2BVDA 4RUBA 2ZZ5A 4UTUA 1SW0A 4BEQA 4KEMA 3SCPA 2BXZA 4L9ZA 1VP5A 1L8NA 4MWAB 3CZJA 2P88A 3ATYA 4XZLX 2PP3A 4QRNA 3HU7A 4CNOA 3ZM8A 3MJYA 2BHZA 3BSMA 5I0DA 2OSWA 2P76A 3N4FA 4RNHA 4IGNA 3USZA 4WJXA 4BQ4A 3U8GA 3L12A 1NARA 3T4CA 3H23A 3C6CA 2OOFA 1Q6OA 4EPBC 1XFBA 3VOGA 1ESWA 4NI3A 3NWRA 3UVAA 4QG8A 1MZHA 3HPSA 3TXVA 2VX5A 2CERA 3T7VA 1F5ZA 2Y5JA 1P6WA 1PHQA 1E5JA 3NXFA 3D5HA 3W7OA 3K2GA 3VKKA 5DRIA 1EJ7L 1KBIA 1JF6A 4LRTA 4M1RA 7XIMA 2H8XA 2GSHA 4GCAA 1XLEA 4IFKB 4GRSA 1OIMA 1YDOA 2AKMA 1H49A 5IDZA 2GOKA 4JTLA 1E4IA 4HJWA 1VFOA 2DSVA 4N7QA 1PZ1A 1UB3A 1AA1B 4Q8PA 4YWIA 3AWNA 1PBGA 3E9AA 1CLVA 2W61A 2A4AA 5A6SA 2JK2A 2PDLA 2Z1BA 3HQNA 1E0VA 3B8VA 3PG8A 3EDDA 3T1GA 4JXCA 5G2WA 3TTYA 1ZBWA 4KW2A 4JZ5A 3BUVA 4UFLA 8XIMA 4MY9A 1IEIA 4QJ3B 1OZMA 1VBRA 2Z26A 3VX0A 3AMGA 4B3KA 4QJ4B 2CHOA 3PBYA 1S2UA 1UJQA 3NL5A 1Q4NX 5FACA 4XBKA 1VJSA 3IVSA 3FVMA 5FEZA 4ZTYA 3S5ZA 1R3RA 5CSUA 1OK4A 3I65A 3TJ4A 1UH2A 3D46A 4ZEPA 2G3JA 2PS2A 1DIDA 3SM0A 3W25A 4O0ZA 5JH2A 1F73A 2Y5SA 3H6OA 4LQ1A 4PULA 1P4CA 4MKSA 4GQ0A 1KQZA 1SU5A 5E0KA 3VKBA 1J12A 4Z2LA 1HIZA 4ZZ9A 4QS6A 2ONEA 1JFXA 4CNNA 5GNXA 3SUWA 4ILSA 5A94A 1O5QA 4DBDA 2QCHA 1JRCA 3SY5A 1OX4A 3ZSTA 2EKGA 3P67A 5ENLA 4Z2HA 4MB3A 1MEHA 3L7RA 2GPTA 4QJ1A 3C4UA 3G3DA 2QT3A 3W7EA 3VZXA 3VDHA 3HG2A 3SIZA 4AXNA 1B90A 3UG3A 2JKAA 4K37A 4ZFCA 4HNOA 4Q7NA 4JDYA 2DSWA 4B16A 2UV8G 1MFUA 3KBMA 3OVRA 3PAJA 3SQLA 4ZQOA 5FEPA 3R2GA 2OEKA 4UBPC 1IEWA 3PNZA 3WELA 3VVGA 3MYOA 2FZDA 3UPMA 2D0FA 3CTLA 1XI3A 3SUUA 3DCPA 1ONRA 4JTJA 4I9JA 4W84A 3LG3A 1BD0A 3P3BA 4QDPA 3VCCA 3OHMB 3S6OA 4DBSA 1I1XA 3LN3A 1JZ8A 1XBYA 1XRVA 4LUTA 1FBAA 3H55A 4HNNA 1TTIA 1H63A 2QMJA 2GVLA 3S5NA 4CNPA 3HQOA 1LL7A 1XLGA 5EBAA 4H01A 4PTXA 1W9PA 4IL2A 1EJRC 4UXDA 5CZKA 3QPEA 4L4PA 3TH6A 1NAL1 2ZIDA 2X1TA 1LRNA 4UNLA 3R89A 3OZOA 4BHYA 1U1JA 1QAPA 5JVLA 4KERA 2J4GA 4F3HA 4TVUA 1WDPA 1UZHA 2VI0A 2X42A 5F2GA 1WXJA 1TV5A 1XC4A 3JU2A 4I9TA 2W92A 1G01A 1YXCA 2D24A 3WUBA 1VFMA 1XV8A 5EMJA 2XFYA 3KFTA 4KEUA 1GVRA 5D38A 4JHMA 3ZR4A 3RLUA 1ODUA 2CZVA 4L6HA 1OGGA 3L2MA 3AXXA 1KCZA 1V77A 4A3RA 1W9XA 1UWAA 2E40A 4NZ5A 1GTHA 1OFPA 3CUGA 4DI9A 4DLFA 1WZLA 3TJLA 1OD8A 4PFMA 5DF0A 1O95A 1S5NA 3GXTA 1QNPA 2YFNA 3GNRA 2DJXA 3WF2A 3UWUA 1XG4A 1DWFM 3R0DA 4DELA 3QFEA 5AC5A 1HKJA 1Q4WA 1AK5A 4EXQA 2D20A 4RNJA 1H0IA 3EPOA 3HIJA 1WV2A 4MWAC 1WDSA 4JCLA 3TZFA 1NWTA 2Z25A 1UP0A 1WOBA 3RX4A 4C6DA 5K9XA 1C90A 1XRTA 2B7QA 3U2ZA 1F3XA 5D9NA 4YTRA 4RV8A 3KOFA 3DI1A 5I78A 4Q4OA 4ONVA 1Q85A 4H4IA 3N34A 3V0UA 3WLRA 4FR6A 1G7UA 1RPKA 2PWDA 3UF9A 1VBHA 4CD7A 1KWGA 3QXBA 3VFLA 5GPRA 1PCKA 4WSKA 2FTYA 3PBGA 1KM5A 1CGVA 3DG6A 4MF4A 3W2NA 2XVGA 3N2MA 3GTNA 3TMQA 3O7UA 3VKAA 3ZT7A 5D30A 1JXJA 1M7JA 4F8XA 1GW9A 1E0TA 1L0PA 1C8YA 3GDRA 4R34A 3NJ3A 3WF4A 2FKPA 1PZ0A 4B9YA 2GUYA 3NGFA 1XS2A 4CCZA 4NU7A 2Z2UA 3IGSA 4HPHA 4BFAA 1FP9A 1XCXA 3UETA 3EX4A 3OHIA 3OQ8A 3W7HA 1DHPA 4NF7A 3A4XA 1RH9A 3CQHA 2CNCA 1ZJIA 5JU6A 3W6MA 2E5BA 3H8AA 3SDOA 1UWQA 1DJNA 3VX1A 1SQ7A 5HA7A 3G1DA 1RBOB 1OJXA 3HG5A 3O3RA 2FJKA 2R1LA 4P7OA 5K3VA 3C0QA 1TX0A 3K4WA 1TV2A 1BVWA 4EWJA 2P8CA 1EA9C 4EIVA 4AZCA 1CGYA 4HZ6A 4NQ1A 3AIBA 1LJYA 4PB3A 2OLAA 4IIEA 5HBFA 3XISA 1JL8A 4Z17A 2QCEA 4L9XA 1JAKA 1HQTA 3VOFA 4PCPA 2X30A 4UR7A 1PO9A 1Q6LA 3EOEA 1LWIA 2INZA 2OZ8A 3EOSA 1ZAIA 3P8JA 1VBJA 4AZHA 1DJWA 2PUZA 3AISA 4ASTA 2B31A 4NYYA 4YVPA 4FS9A 3W81A 1RJPA 3UWVA 1RQHA 4H8VA 1AG1O 4TXEA 4P7RA 4I5UA 3AIVA 4NZCA 1U30A 3RIKA 4Z2GA 3C5QA 2EPMX 4JL1A 4Q7IA 3BL3A 3TC7A 3NXLA 4F40A 3GVQA 4XKYA 1J0YA 2PAJA 4PFHA 1XISA 3IIPA 4HKPA 2PEVA 1T40A 1V7YA 1FRBA 3SCUA 1JIBA 3GTFA 3TYDA 1HO1A 1FFQA 5FD0A 1UOZA 2QUUA 4PBEA 4RDZA 1TRDA 3M0HA 1L8PA 3GZAA 2HISA 1EDGA 4Y9NA 5HWNA 1H7OA 1AH4A 1GKRA 3LCFA 4C6MA 4WDTA 4D1JA 4LBRA 3RF9A 2WSQA 1OIFA 1ZP3A 3AXMA 3LERA 3R13A 4K2SA 4O8RA 3PUOA 2GWNA 4G5DA 1MQRA 3KOZA 2J9XA 1KM1A 1XSIA 2RDWA 3BW2A 3JW7A 4PUDA 3CJPA 1OADA 2PF0A 2J66A 4GJ1A 1K8CA 4HT3A 3GXDA 3A3HA 3S1WA 1EUNA 2J9YA 4BWLA 4DI8A 1S39A 2XG9A 2YPIA 3GH7A 2WHKA 4HPXA 3UJSA 2J7CA 2ZXAA 1JD7A 1OC7A 4ERIA 5JQ9A 1JPKA 3B0YA 1DIOA 4R33A 2BV9A 1XFCA 4W88A 4FALA 3DC0A 3VNIA 5DCEA 3C3UA 3CHDA 1S1RA 1R2SA 3P14A 2OEMA 3PUGA 2A6LA 3F2BA 2F2KA 4XUGA 2J88A 3FOKA 3SGGA 1W1IE 2OYMA 2PCQA 1JAEA 1CZ1A 1ZCOA 1FWDC 1GHRA 4PCNA 6CGTA 4NXSA 1XUUA 1EO5A 1RUSA 1NJJA 2B7NA 1VIWA 4U2ZA 3NL3A 3ZXWA 4ERGA 4EE9A 3W86A 8TIMA 2DW7A 1ICSA 2VC5A 3BZJA 1SPQA 2I9EA 1JJKA 3BLDA 5MF5A 3EX6A 5IDIA 3A3WA 3ZO9A 3LQLA 2XIIA 4BI7A 2OO0A 5KINA 3BMVA 3KP1A 2V5JA 4Y90A 5I3DA 2YCLB 1XDJA 1NDZA 4HCLA 4LV9A 1J0IA 3SCRA 3B03A 5H2ZA 4JIRA 3STGA 1J01A 3UU0A 2PD5A 2WSKA 4AF0B 3UZZA 1SFSA 3N12A 1XD0A 2QNEA 3TZNA 4DJED 2E6DA 3G1RA 3CO8A 1J9YA 2OX1A 4S3AA 3EA3A 4GI8A 5H6HA 2OGJA 3NA8A 1MQPA 1S2VA 3O8AA 1JCYA 4FNTA 1K6AA 1SR9A 4NKCA 2PU0A 3WLKX 4DXXA 3R79A 2QZRA 3NZPA 4S3BA 1CWYA 1PUDA 3GO2A 3EKLA 5CZSA 3QV8A 3ZFHA 1GQNA 2J7DA 2QYGA 4E4FA 2GVYA 2C13A 2VD9A 1REQA 2C6QA 1AJZA 2Z00A 1W5NA 1XDMA 4O4VA 1XLCA 4MPQA 4C1NB 1WXZA 3CWHA 6REQB 1X96A 4YPJA 4XIAA 3M41A 2WC3A 5I23A 1JPHA 1NQKA 1Q3NA 2F6XA 1JDAA 4C6LA 4G1NA 3M0MA 4IQJA 2FH8A 4E2VA 1EA0A 4DBWA 3W1NA 3WD0A 2WWDA 1J79A 2YBVA 5F4SA 1POJA 1LBFA 1RPXA 3CU2A 2Y24A 1TCMA 4QTGA 1NSJA 1A80A 1FH9A 1K8ZA 2ZC8A 5CBBA 1OGSA 1RCOB 1F61A 4H9UA 2V5LA 2Y8VA 3W7GA 5KEZA 2OTDA 1IWBA 3TJIA 4I9AA 5RUBA 4L5ZA 3UNDA 1MVYA 3WN6A 1VH7A 4LAUA 5H91A 1H1ZA 1KC7A 4F9DA 3VABA 4ML9A 4KESA 4ZE4A 1LQAA 4S2CA 2OKOA 1BXBA 4E8DA 1HN1A 3G1HA 3E96A 1IT8A 1FDJA 4XZBA 5JBDA 4J2MA 5ABFB 4H9TA 4UFIA 3F4WA 4LPCA 1ZAJA 2NLYA 1XW8A 4W85A 3PWIA 1IZJA 3UPWA 1TPFA 4AQLA 3RX3A 3SCQA 1XH2A 2V63A 4JL2A 1SW7A 2DZBA 1QI3A 2ZVIA 1BWLA 4QR6A 5CG7A 4HNLA 4Q4PA 4DBUA 3BG3A 1S1PA 3QC3A 1N7KA 1AQHA 2ICSA 1ZPTA 1ADDA 4A8IA 3WYZA 1RAKA 1QI0A 4H1ZA 1UR1A 3RO6A 1GVYA 3O0FA 1NF7A 2HV5A 2O7QA 4OBRA 2J7HA 3RFAA 3DI0A 4J9JA 5CZTA 1K9EA 3GXNA 1U83A 3M0LA 3HGRA 3DESA 1HNYA 1GNXA 1FCBA 5M5DA 5CSYA 1VAHA 1LZOA 1E56A 4NZ1A 4AH7A 3SZ8A 2HBVA 3OVGA 3OYZA 5HMFA 2ZWZA 2FH6A 4GD0A 6XIMA 3GDTA 4IM4A 3TMLA 3ITVA 5KZDA 1S5WA 3VC5A 1IZCA 4GISA 5BYWA 5A2BA 4NAEA 4NT0A 3VIJA 5F7UA 1YE4A 3ES7A 3QPYA 3GU2A 3QSRA 1R3QA 4O1AA 4JIHA 4FNRA 1S2WA 1E1EA 2OCZA 3VTRA 3VKJA 2GWGA 5EA9A 2WMHA 3WK2A 1X98A 3FSTA 1A5BA 1VPXA 1PCWA 2ZRYA 4GIEA 3UY7A 4HMEA 1EC9A 4WDWA 3LM3A 4S3DA 3TCSA 1KM6A 4KETA 2EGZA 3VO0A 2OLHA 2R6OA 4YU1A 3EOUA 2TMDA 3VGHA 4NZFA 4AIBA 3QR3A 4BF7A 5A6JA 4LC8A 2CW6A 3AU2A 5FJTA 1W1PA 1TIMA 1TUFA 5E9XA 2B7PA 4Q4RA 3TROA 4XZ9A 4QNWA 3CXOA 2AOSA 5D32A 3CV1A 1GW1A 5CG0A 5EMLA 3PWGA 2OZ0A 3TN4A 3DENA 4AB4A 2EEXA 1FDZA 3VGBA 1GOMA 3HG3A 3G24A 5A2CA 3DKJA 3RU8X 5CBJA 1XYFA 3AYSA 4FZIA 3ITLA 1IEXA 4EXAA 1GK8A 2VEPA 2XIJA 4UR9A 4OOZA 2ZZ6A 2QPXA 1OFBA 1QBAA 3ZVHA 3AHVA 1XJBA 3W70A 4Q33A 1C9WA 1AW2A 3A22A 3N6QA 5E0FA 2Y7FA 4LOCA 3IJ8A 5DMYA 1A4MA 1GHSA 3E5PA 2VWSA 1M7XA 2VX7A 1HKVA 2VR4A 1YPIA 4W8LA 2D2HA 3MTWA 4HSNA 4AWSA 1F3WA 1Q63A 3BLLA 3UXLA 4PMVA 1TMLA 3WMCA 1Q65A 1S3TC 3H7VA 3C2VA 1G5AA 5DRCA 3L5AA 1GJWA 3LK6A 3W75A 3WQ6A 2ZCGA 3USBA 4ZOBA 3VOJA 1GKQA 1GYLA 3BARA 4IMCA 2WQDA 3P0WA 1RHCA 1DJYA 3BJSA 4DPPA 1KTNA 1DOSA 2VZOA 2WV8A 3GHUA 2I56A 2BSLA 3WEOA 4AMCA 3PTKA 2VKZG 3UXAA 2CETA 4U3AA 2I17A 1AMKA 2FZMA 3LA4A 4UWMA 1FHLA 3NQGA 1L6SA 4CN6A 4Z1YA 3IVTA 1KBBA 3VILA 3V0SA 1Q2SA 4MPKA 3O0KA 4JX6A 3W29A 1QMLA 5K4XA 3UR2A 3FYYA 3ZJ6A 3M7SA 4KT2A 4NJJA 4FMVA 1TZZA 1IF2A 4MADA 3GRIA 1ZJHA 3GDKA 3NSXA 3EWUA 3NZ1A 4LS1A 3STFA 3S8HA 4GBDA 1SO3A 3BGGA 3TYBA 2VUYA 3CL6A 2AQOA 1BVNP 1N2VA 3HPFA 3RR4A 3B40A 4JFSA 2BHYA 1GUVA 3ITTA 1C8VA 2O9TA 3SN4A 1L6FA 3N9RA 3PBVA 3IJDA 4AC7C 1J0KA 1KR1A 5C9UA 4ZQPA 2FFCA 3EX2A 3HMJG 3GYCA 4ZL1A 5C2XA 2Q8XA 1QJWA 4HD5A 3LBMA 1RLCL 2HVNA 3C8FA 1TB3A 5AZ1A 4J7RA 4O18A 3RUBL 5CBIA 4ZMGA 4LEFA 1Z44A 4S39A 3VCRA 4B2DD 4HSOA 3KXQA 5EL1A 2QGHA 4C91A 1F6PA 4KMQA 2WJFA 1ODZA 3QMSA 2PDHA 2VC7A 3PZTA 4KKXA 1DJIA 1FKWA 2ZX8A 1VF8A 2D2GA 1W3JA 3NR0A 3NTYA 4HA1A 5T26A 2J7GA 2G4FA 3N2CA 4B4FA 2D0GA 5CJ5A 2OT0A 2QXWA 1XIHA 1ZBVA 4RR4A 2ZYFA 4B3LA 4D8LA 3XIMA 4TUFA 4FXFA 4AISA 3HQPA 2OSYA 2OWCA 1TIWA 2FVKA 2BY0A 1YQ2A 5KZEA 4O12A 2EO7A 2IXUA 2WKGA 4JIIX 1BPLB 2YCKX 1X6NA 3AS0A 1KTCA 4TQTA 1FWIC 4GKLA 3N4AA 4JX4A 3W37A 4HZ7A 4AZIA 3GC4A 4IF2A 3V35A 1C7SA 4QQ3A 2C0HA 4RDWA 4LUTB 3BDKA 1DJXA 3G8EA 3V5OA 4UTTA 4ORIA 1S5TA 5M03A 1EIBA 5BRQA 3LRMA 5IHSA 4LU0A 4DB7A 4MUZA 3T0BA 3NGJA 2FJUB 4XAPA 3DUGA 2F8QA 4UTWC 1TRIA 2J6VA 3MS8A 4QX4A 4FNSA 4R3UA 1Q7ZA 4OGZA 3TSDA 1W5OA 5FA5A 1WZKA 4UFKA 3PZUA 3M6YA 4LV4A 2DPEA 1M41A 3WNOA 4U2YA 4WZHA 2YW3A 3HV9A 2D1ZA 1QU4A 3H22A 1Y5WA 3GB6A 3ITCA 1W3HA 4GYJA 4R7WA 1MW3A 3S2LA 4GVFA 1EQPA 3GFZA 1UH4A 2EXOA 1E40A 4E0CA 3QYQA 3NG3A 1KBJA 4FI4A 4DXKA 4O1DA 1J0ZA 3ZT6A 1Q8AA 5BWAA 1IGWA 2D22A 3G8RA 4IX0A 2EBNA 4XTDA 1RVKA 1I45A 4N9CA 1SSGA 4BKNA 4HP5A 1KXVA 1J2BA 4ACYA 4CD8A 1F8IA 2OYLA 3VNZA 3VD4A 1H2JA 1E73M 3LXBA 1DE5A 4J3SA 2O9OA 4ZQRA 3TP4A 2W0UA 1J5SA 3CZGA 2YL9A 3WQWA 1VHNA 1AH3A 4AWEA 1NEYA 3D3AA 3MKCA 3W2MA 2A7NA 5I02A 5C54A 4EX4A 1NWRA 2FZNA 4M56A 2NQJA 1WAUA 3T8LA 4UTKA 4IPJA 4OV4A 3KS6A 1UASA 2OZTA 5K2ZA 4REQA 3E2RA 2EQDA 4LC6A 1SJCA 3STPA 3GXIA 4XZNX 1NP2A 1OX5A 2HNHA 3NIYA 1GG0A 2VVSA 1FWJC 1OYBA 3GC2A 3W7LA 4AD0A 1H51A 4HNTA 4CU6A 5G4EA 1QXLA 3NQAA 4FB7A 1A3WA 1ADOA 3AXIA 3WG6A 5DMNA 3W7MA 3WEZA 4A6GA 1F2JA 3RCNA 1ITXA 4Y9OA 1D8WA 3QKZA 1TTJA 2P3ZA 3H54A 2WVVB 4HZMA 1M7PA 3EOOA 4KEVA 3T42A 3WBAA 4IHCA 1VR6A 3OG2A 5E6ZA 4MJ2A 1AZ2A 1NDVA 1XSKA 1SUXA 1ZLPA 1DYSA 3HGJA 3VIOA 1ZCCA 2CESA 4HN8A 3IANA 1OYCA 2Q3RA 1FWEC 1YMYA 4R88A 5DLCA 1JQVA 2YXGA 4UOQA 3GR8A 2C14A 1NFGA 5I7GA 4W8AA 4P2VA 4AZCB 4PMUA 5TD4A 5DXYA 3YPIA 3A64A 4WKHA 3GTHA 3ALGA 1V4YA 1Y65A 4ICCX 1O1ZA 3AZSA 4Y8FA 1EFZA 3ITGA 3QV9A 5CJNA 2CPUA 3BLKA 2E68A 3L0NA 3S1XA 2E0PA 1BWKA 1M7OA 3OPSA 4HIBA 2A3EA 3DHFA 1B3WA 3LCLA 3SO7A 4WCJA 1UC4A 4BR1A 4M51A 5CPTA 3W76A 1HXJA 2E9MA 3KRZA 4KGJA 4TVCA 3FA4A 1C3FA 2ZTJA 2IPGA 1RZMA 1KO0A 3CB3A 1NH6A 3L68A 4JQ2A 5E93A 1NU5A 2IKIA 3M4HA 1BKHA 1DXEA 2EPHA 2W4XA 4PMJA 4QP0A 3HO8A 3LMYA 2E9LA 3DN5A 3GK0A 3QKEA 2CHNA 1V7AA 3GNNA 4H7CA 2OZ3A 3SB0A 1CXLA 4N4PA 1ISZA 5JBEA 3IJLA 3LXCA 1VLWA 5IOBA 1PPIA 4HOWA 1F74A 2CBJA 3UR8A 1GPWA 4GHRA 4ZSTA 2WBGA 5G4WA 3SY8A 1RSCA 1XLIA 1B57A 1A5KC 4H3DA 3G18A 3N3MA 1MXSA 3VI2A 2G97A 3VZZA 1F4HA 2WHMA 3L65A 3U7VA 5IXEA 4GI6A 1PTDA 1ZHAA 2XIBA 2DUAA 3G1VA 1BXNA 1LM1A 3GU1A 3CUFA 2E5CA 4OZOA 1EP1A 8CGTA 3LY0A 3CHEA 4PUKA 4TTGA 1EC7A 5F1VA 4H7VA 4Y96A 4Q7BA 3UXIA 1RCXB 4LUSA 5C71A 3GX9A 1YE6A 1JZ6A 4MDOA 3VNYA 4DJEC 2OU4A 3RHGA 3WLQA 1VYRA 3P81A 1XYZA 7TAAA 4K7VA 1E0XA 4QFUA 1XHGA 5I79A 4B15A 3E2QA 3WLMA 3DGRA 1SZFA 3PP7A 3SJ3A 3VAVA 1J5TA 4GO9A 2QCNA 1BGGA 4G56A 3TN5A 1KKOA 4YLWA 2CLHA 2YL5A 3ARSA 4D2JA 1T7LA 3AHXA 1W1TA 2VEFA 3TIMA 1XIJA 2E1DA 3W1XA 3DHPA 5HQEA 4F48A 5TBOA 3G6MA 4Q4MA 1TYGA 3VGEA 4S3GA 3FK4A 1S2TA 3DZ1A 3VDAA 2BASA 1Z42A 4UTHA 1MYRA 1X6UA 4W5UA 4ZGYA 1UZ1A 1VBGA 4N6FA 3W1PA 5HANA 3MWCA 3UFYA 1QNRA 3L5LA 1TREA 2DH3A 1EBHA 1JI1A 3PUEA 1VFSA 1J10A 4FNQA 2Q6ZA 1TPH1 3WQFA 3W7CA 1B54A 3DC8A 1OD0A 5CLWA 3IJ9A 3OJGA 2H9AB 4KBXA 1CXEA 5F2LA 1TVNA 4IT1A 3H4WA 2YDQA 3T2PA 2BHUA 3WY1A 1AL8A 2O55A 5FOOA 1GOQA 3WDQA 3P7YA 3CZEA 1WBHA 3QZAA 3TYZA 3U0HA 2XH4A 4BQ5A 4NZ3A 1EO7A 3QMTA 2NSXA 4Q4QA 3TE9A 3MCOA 4H2CA 2E09A 3T2OA 1ONXA 3FXGA 1WYIA 3W7QA 4Z42C 2WHLA 2NX9A 2WK2A 2JGYA 1I1WA 2Y2WA 3QHOA 3TEVA 1R2TA 3FXYA 2DVUA 1GOIA 2NWSA 4KGLA 4MFEA 1H5YA 1UWTA 3S5YA 2J8GA 1K70A 3W6LA 4MB5A 1U2YA 3ITYA 3MKVA 4D1IA 1UP2A 3VNLA 3WH7A 1VFHA 3PAOA 1T0OA 3ALFA 4MWAA 4FOUA 3TKFA 3G1FA 1X8CA 4GYFA 3MJMA 2TPSA 4GX9A 2YSWA 4Q8NA 5I07A 4HVXA 4JFVA 4G7EB 1XLDA 1KFCA 1UD5A 1EC8A 4ICNA 1GVSA 2H3DA 3DFQA 2J77A 2ZA2A 1JDDA 4PODA 3BTNA 1QPQA 1EIXA 4F2TA 2ZDRA 2ZUVA 1SO5A 4IFOA 1CT5A 4GI4A 2GQ3A 3RXZA 4F79A 4G6CA 5FESA 1US2A 2ZA1A 3KTCA 1FCVA 4IIGA 2DJLA 2DY3A 2RDTA 4O28A 5CC3A 3M6DA 2NV2A 2PRLA 3E02A 4IX2A 1I2PA 1FY6A 3FHAA 4IFKA 3TFXA 3C86A 1Z3NA 2B81A 3MZ2A 1CBGA 2FTPA 2V3FA 1HO4A 4RE2A 4FR1A 4HCDA 4GJIA 2VFIA 3CMGA 1M03A 1IWAA 2BDQA 1FP8A 5HINA 4LY8A 3SUSA 1VKFA 4AD4A 1XBXA 4B5WA 3PB0A 2ZOXA 1I9CB 1MXGA 5CEWA 3BV7A 4MAVA 4K6AA 1H7XA 4A3QA 1GORA 3LHYA 1V3IA 5JIWA 2EHHA 4DEFA 1MMFA 4DHGA 1UKOA 2AQWA 3RITA 3MA8A 1CEOA 4QJ5B 1FXPA 3MHGA 4H9YA 2NLIA 2W27A 2B7OA 3BO9A 1V08A 3OGRA 1FX6A 4NRSA 1WB0A 3N2TA 2V5BA 1S2AA 3HFTA 3U7BA 2WZEA 2BY1A 3H2AA 2VRKA 1KRAC 4JAWA 4MY1A 1LLWA 3NUKA 2RUSA 3MB9A 5I3JA 1MDRA 3TX9A 1UJPA 3S5OA 1H5VA 3WNKA 2NXGA 4E8GA 1K1DA 3CNYA 5XIMA 1OX6A 1IT7A 1LRQA 2VWTA 4OHQA 2XU2A 2H90A 3LGDA 1KQYA 4KIEA 2GJXB 2YDAA 3KDOA 1ZJAA 1NTHA 1B9BA 2XSXA 5F4XA 3H21A 2P50A 1Z48A 2FB3A 5BOOA 4CGTA 3T40A 1T8XA 3L4XA 3O6DA 2YW4A 1DWAM 1MW2A 4GY1A 3MMTA 1DP0A 1TWZA 4M7SA 4IIFA 3P62A 4Q4SA 1GQKA 3ARXA 4GA8A 3W26A 2XM1A 3LV6A 1FOBA 3S83A 3BW4A 3GWQA 2QJIA 3AMCA 2C1IA 4GK8A 2CLOA 4FK9A 3CUXA 1K77A 2JGQA 1LCOA 2BVTA 3P93A 3UCQA 3MW7A 4FO4A 2FGLA 3GM8A 3V18A 1EX1A 1BF6A 4JX5A 5C55A 5E0CA 1AD1A 1XC6A 2POTA 5FL0A 3S1UA 1T5AA 3MMUA 4HMNA 2P8BA 4QDWA 3GG0A 4JTCA 1BYBA 1D8CA 2WCAA 4O4WA 5D2YA 2CU0A 4Q22A 1BG9A 2MUCA 1R5YA 4M24A 1JEZA 3LYEA 3ATZA 2ACSA 3E74A 1GOOA 2HVMA 3DXIA 5FJJA 4MYAA 5FF0A 3UZJA 3M0JA 3L23A 4WQ6A 1S5VA 1UPPA 2ZZ7A 1U1UA 4H6QA 3V16A 2SFPA 1KFBA 3VE7A 3EXSA 4OT7A 2HS8A 5BZAA 1JCNA 3Q94A 3IJQA 1Z41A 2CXGA 1J8VA 2R8WA 4GE8A 1RV8A 2ZX9A 1YDNA 1UD4A 4LYQA 4PUNA 3DFSA 3EX1A 4RPQA 4WY0B 5HATA 1V3LA 4AZGA 2PTDA 3G1AA 4OQVA 1EP2A 5A1AA 3U4FA 3QH2A 4QXIA 4JOMA 3B3DA 3VUPA 4PB4A 1KXQA 3KHDA 3N6JA 2PP1A 2ZRXA 1AL7A 4HYRA 1DPMA 5FJRA 2PDKA 1YTDA 3PZ9A 3GXPA 1WZAA 4JIQA 4LW7A 2W91A 2HXTA 2V6AA 5AHFA 1EJXC 4C65A 1MFVA 1LBMA 1XLLA 3F1QA 4IUOA 4KWSA 4ATLA 1R3TA 1FWRA 4C7FA 2AL1A 2G50A 2WWCA 4DWDA 1ZQ5A 2ISFA 3Q45A 2C1GA 4W5ZA 1C92A 4Y9AA 3WBEA 3T0AA 1FWHC 3R1ZA 1P0NA 1VQTA 1X1ZA 4LALA 4MIMA 4W7VA 3U48A 4RW5A 2GOUA 5DX7A 4IGSA 5AN7A 4LJ3A 2NXIA 3GH4A 1XQKA 4K39A 2Z1WA 3QY8A 5CC7A 3GSMA 1KFEA 4GX8A 3H70A 2OR2A 3WDHA 3WDIA 1GYNA 2R94A 4POCA 2DT3A 1TG7A 1SFLA 3QY6A 3TJXA 3CAVA 1QNVA 4V1XA 4LNCA 3AC0A 4OUEA 1O68A 1AJ2A 1H50A 2JF7A 1HX0A 4NSBA 1GVFA 4KFNA 2ON3A 2ISWA 2DU2A 3EDEA 3G2GA 4WJ8A 4CD6A 5D2XA 3NQ6A 3QFWA 3SGZA 3LSCA 3STCA 2CLFA 4J35A 2J75A 4LB3A 3PR2A 1AFSA 3WJZA 2PFHA 4LYPA 4CQ8A 3MI2A 1O5KA 4MWAD 3W2JA 3VINA 4I90A 3H7UA 2I5GA 2OWWA 2VFDA 2HEJA 2EG8A 5A8QA 1ONEA 3N19B 1F9CA 2VM8A 1KM0A 1PE1A 4XD4A 4LCQA 2WJDA 2OX4A 3RCMA 2QDEA 3ZLFA 1PTAA 3AJ7A 1EZ2A 3ARZA 3CIWA 4TX8A 1W1A1 3W83A 4XISA 1Z7AA 4YHGA 1FHVA 3WEMA 1EJWC 3M16A 3RNDA 4M29A 4AYGA 3IK4A 3APTA 1E6ZA 1Q6QA 3BCJA 4AVFA 3PZNA 4NHVA 1XYLA 2Z6JA 4HK6A 3OP2A 2IMRA 3M5YA 3WH6A 1ISWA 4JQ4A 2UWFA 3LTYA 1THFD 3A5FA 3F03K 4NX0A 4CCCA 3CHVA 1KBLA 2BS9A 3FN9A 1ZFJA 5EU9A 1Q5MA 3KP0A 4TV5A 1SO6A 3B4UA 5G4HC 3H2FA 3PVFA 1PKYA 4N9BA 4ZA0A 4KFOA 3AZRA 1UR2A 2GK1B 4O1BA 1M53A 2WNQA 5H1WA 3DOPA 1B4EA 3TN3A 2VGGA 4DWSC 2DUZA 3EBVA 3VNDA 3GXMA 3S4TA 3OBKA 3WNLA 4Z1BA 1XDLA 1KTBA 5FSEC 2OWXA 2CBIA 4IQLA 1MO0A 3M64A 4ZOCA 2PBOA 2HS6A 2WSYA 5HR7A 4YTQA 3SCOA 3N3TA 5HQMA 1ZSXA 1D3CA 4LAKA 1B4KA 3HBLA 3WK0A 3L4YA 1PL9A 2BTMA 4B90A 3A6OA 4M81A 2NV9A 1DL3A 3M47A 4E2DA 5EKYA 2VR5A 4QLKA 5CPOA 3A4AA 1KCLA 1H09A 3NVDA 1BEUA 2ALDA 3BH4A 4O53A 1GG1A 4YJ5A 5E9AA 2J8TA 4GBUA 4YVXA 1KKRA 3NQ7A 3DBPA 4FLRA 1QI2A 5GJPA 2UY3A 2VC6A 3IRSA 2BOFX 3LZ3A 2EG6A 2HZGA 3NPUA 1B3VA 2VENA 4O1FA 4UTLA 4ADUA 3NSMA 4J1OA 2B0MA 2DT1A 1ICPA 1XICA 2QPUA 3UVIA 3VA8A 1PJ9A 4A8RA 2Z1XA 3M5VA 2WKLA 5EB8A 1UA7A 3W01A 1YRRA 1EH9A 2P0OA 5HNRA 2QUTA 5FJUA 2X1SA 5B7ZA 2OXNA 2O9PA 4WLCA 3CUHA 2EAWA 4NJIA 4PH6A 2Q71A 3I6EA 2J13A 2CC0A 3GNDA 3MC5A 4BK9A 3R25A 1RK6A 4FOKA 2V82A 1UQYA 2CWXA 1E3XA 2HE5A 2PDJA 2LLEA 2X0HA 2X2YA 4IIBA 3GH5A 4Z0JA 3GBEA 3UJFA 2QJJA 1MNSA 4O1EA 1TV7A 4FNUA 2Q8LA 2H6RA 3BCFA 4C7DA 3BAWA 2OQHA 1PHWA 3MPGA 4UCGA 3OVPA 2YCLA 1FUYA 1J2WA 4GNKB 4AWUA 1IIHA 4AF0A 1I2RA 5T8GA 2J6XA 3O6YX 1V5XA 2VVNA 2WVSA 1LLZA 3MY9A 1R7AA 3C52A 3WMSA 1BTMA 1OCNA 3U57A 4P8XA 3K4AA 1AH0A 3EMQA 4QBXA 2NVAA 1E1FA 4EPKA 5IBXC 1YPXA 3UD6A 1TPEA 1MSSA 3BMXA 4L1XA 1N8IA 3KOXA 2ZKMX 1LG1A 3WLOA 2TRSA 4RL3A 4F0SA 1DVJA 3O1NA 2VEIA 4W7UA 1SFJA 3OB8A 3GKFA 1XIGA 1YPFA 3AUOA 3DH7A 4O1CA 3PJUA 4C1NA 5K4ZA 3A24A 1CCWB 4HPNA 4V15A 3VZYA 1MRAA 1N82A 4HSHA 4GQQA 3MP5A 1GTEA 3CV2A 5AYBA 1PWLA 3U2EA 4C6QA 1WX0A 4KRTA 3T6CA 4M1BA 2VC9A 2VEKA 1B3YA 1IXPA 1E4LA 2CCRA 1GQJA 4O0KA 1PIFA 4TMCA 1GQIA 2A21A 4JFWA 5HJLA 3W02A 3QHMA 3MKKA 4UOZA 5G2HA 1MEIA 1CNVA 1FCQA 2WZTA 2DZWA 4LF2A 3R8GA 5A6TC 1YTKA 4CN1A 2V8ZA 1M01A 3KM8A 2CLKA 2PGWA 2Z1VA 1TWIA 4GKTA 2VFHA 3S9YA 3QQ1A 2ACUA 3EKGA 2RJGA 3VM7A 5CGMA 4XZWA 3W1UA 2ESCA 1FWBC 1CW2A 4RE3A 5EMYA 1QW9A 2GJPA 2HPIA 1Z8AA 5ABFA 3E5BA 3BMWA 3VXGA 1OG0A 5D9OA 3VNJA 3L5MA 4PCTA 2A7RA 3M0KA 4JS3A 4US6A 1V03A 3WUFA 1VFTA 1TA3B 4H9VA 1BQGA 4C1LA 2R9RA 4GUJA 3O63A 4MWAE 4DPQA 1LP6A 3UW6A 1PYFA 1Q7MA 4MKNA 2QF7A 3VIGA 2A79A 1SYTA 1A5AA 3BV4A 3LPFA 4HBKA 4ACZB 1V6WA 4L4MA 4JY9A 3KWXA 2GL5A 5K7JA 1TPC1 3LTPA 4QSFA 2GQ8A 5FEWA 2BX7A 1O94A 4QE1A 2X0SA 4E4UA 3Q58A 3CMFA 4XD5A 3TLQA 1I0DA 3BSGA 3DX5A 1UKPA 4UFHA 2CBVA 4WGXA 2Z0IA 1ZBCA 1B31A 4BY3A 2Q3OA 5DCBA 5HJYA 4JFTA 3MBDA 4JPGA 3MV11 4CEXC 4JQAA 3DG3A 3ARPA 1FWNA 3RG6A 1DWHM 1G69A 5FJOA 3AYRA 2V67A 4D9PA 1CGWA 1XQLA 2PZ0A 2WMFA 4A3YA 2J7EA 5F4WA 3CAWA 2BP1A 3CMJA 3APYA 3ZT5A 3GIQA 2V5DA 3RK8A 1VFLA 3ICJA 2Y8UA 3WO8A 2IQTA 4OOUA 2UY5A 2W5FA 3KCJA 3DDMA 2ZTKA 3OLIA 4RNIA 3QZEA 4JR5A 4LTSA 3FNDA 2PCEA 4ZO7A 1KCKA 4XIMA 1N55A 3AALA 5D05A 2DW6A 3B9OA 2VL4A 3VMOA 1KRMA 4UTWA 3LV5A 2JEPA 4JQ1A 4UMCA 3ELFA 3FKRA 2IXVA 4PMDA 1IEQA 4LX4A 1O4UA 5ABGA 5LIKX 5A8PA 3EWBX 3MWAA 1XBZA 4R9OA 4RE4A 3EKZA 1ADSA 3QOMA 2HE8A 4WKFA 2WZHA 3W7PA 1Y8BA 2PB1A 1R3YA 3LPGA 1RK5A 5HR6A 3LLFA 1WE5A 4Z08A 4C6BA 5D03A 3MBFA 4PBGA 1OF6A 2DDXA 2Z27A 1I60A 5IRPA 3TW7A 4M6PA 1YBQB 4A8NA 1W31A 1E55A 3N18A 2DIJA 1H3GA 5A6MA 3KDNA 4RZ6A 1GT8A 3I7QA 1O12A 3WF3A 3JUGA 3TC3A 1QPOA 3U2CA 1WUEA 4PMRA 1QK2A 1JCMP 1MI3A 3BC9A 3W87A 1VFUA 2ZX5A 4ZTXA 3UJEA 2W67A 5C70A 5J5DA 2F9RA 2C8NA 1YKWA 3N04A 4PRTA 4AD5A 1D7KA 5HMEA 2QJGA 4NVTA 5IFPA 1V0NA 2VGFA 1C8XA 1UUQA 2D0HA 3JRKA 5CGTA 3OG3A 3W07A 4CQ9A 2ZZ4A 1X1OA 1QPKA 4KPLA 4L7ZA 4FX6M 2WCGA 1KFKA 4IJRA 3GQYA 2GSJA 2VCBA 3TXZA 2ZXQA 1GYMA 4TVDA 4C6PA 2PLKA 3DGBA 1DKWA 3UZXA 2JIEA 3F4CA 2W66A 4IIDA 1J4EA 2V5CA 4BI5A 1XINA 2VOMA 3ABZA 5KITA 4M8UA 3ITOA 4BF5A 4NZ4A 2OO6A 4GVIA 3PS7A 1K8XA 5LHFA 3RM8A 4JTAA 2XWEA 1XLFA 3VNMA 1IGSA 4H9XA 3R6IA 2XN1A 4J5NA 3WF1A 2G95A 5LZLA 2R1PA 5ABTA 3JZUA 3LOTA 3AXHA 3G1YA 2IQDA 3TOYA 4CQDA 4MNJA 3CIVA 2B4GA 1EBGA 2VCAA 4LVBA 2BXYA 1WUFA 5BWFA 5A8NA 3INPA 1OFAA 4GMEA 3CEPA 2OG9A 3GS6A 4GH1A 4LUIA 1VJIA 5LGXA 3H7RA 1UYQA 2XSBA 2O4MA 4U5KA 4CD4A 3K8LA 1HKKA 1P0BA 1KGUA 2FPYA 2I16A 1CGUA 2Z29A 4L4OA 5I3FA 2PZNA 4HYVA 4HA3A 3WLLA 4MG4A 3BLEA 4YXGA 4ENLA 3WENA 3MHFA 1EXPA 2OGYA 4GUFA 3VU2A 1MW1A 1FVPA 1I2NA 3KLKA 1E6NA 4GPNA 5EMKA 4NX5A 9XIAA 5L9FA 3GFXA 4IL0A 3MYPA 3RLHA 2Y88A 1ZZMA 4WSJA 5FAJA 4HGXA 2Y85A 1MUWA 4LB4A 3ZIZA 4PL1A 3C2FA 3GTXA 1NVMA 3F2DA 4L61A 5DMMA 1U5VA 3BVJA 4O10A 1OGBA 2GJLA 2P3EA 3PHAA 3V4BA 4ES4A 1O60A 4C6IA 5CSSA 4DZ5A 1RJQA 3CH0A 4F0RA 3HGSA 1KW1A 1BQCA 4Q4KA 3HGOA 3R12A 3IGHX 1J96A 3B05A 2ZDSA 1EJUC 2VNCA 5A6LA 3AU6A 4IJBA 4HU8A 4G7FA 1OQFA 3GBDA 2X1UA 3WSUA 1SMDA 2FPVA 4AZ6A 4GI9A 5FF7A 1ZAHA 2XIQA 3C0LA 1W3TA 3CPUA 1W32A 3NQMA 4JKLA 3UXKA 4CNUA 3TLLA 1KFLA 1NY1A 4NAFB 4LAOA 2PURA 1UZ4A 2IPWA 4JTEA 3AIEA 3GHRA 3FX4A 4MNLA 4NJKA 3HFYA 2DZVA 3LLXA 5DEZA 5I3GA 3AQUA 1TQJA 1XLMA 2PWFA 3VGFA 4HNCA 1XL9A 3LGEA 3PZIA 1D3HA 5CZJA 1DV7A 3V75A 3VUSA 4GZJA 1TMHA 2GUBA 1LOLA 3RRXA 3TNBA 1V6TA 3BGAA 3APGA 4NNAA 3WFAA 3KRSA 4Q8VA 4L6DA 3EXRA 1X7FA 4PC8A 2VRQA 3ZZ1A 4V27A 3FDGA 4FXRA 1C7TA 2Z7GA 4JY8A 3R58A 5IM51 1U1HA 3KCLA 3EWCA 1PS9A 3MV01 3UPBA 4DJEA 3U2OA 3QQWA 3SSJA 4F0LA 1MUCA 2ZX7A 2TYSA 3G5EA 4UQDA 3RR1A 4B5NA 4YTSA 3THQA 1T99A 5A6BD 1D3GA 1GEQA 2XYLA 1Q8JA 3CQJA 2PWUA 2PTWA 1XPYA 3GLCA 1OVDA 4YL2A 2I14A 3UBPC 3EDKA 5DO8A 3HB9A 5AHLA 3ARVA 3RM9A 4I6VA 2X7VA 4GIYA 4QQUA 1CLXA 1MNZA 2YXOA 1LWHA 4WHBA 3PWAA 1IT0A 5BRPA 1QPRA 4JN7A 3VMPA 1UD8A 3AMDA 2DQWA 1V0LA 3WH9A 3GG8A 3POHA 2FFIA 4MLJA 3TSBA 4LVDA 3NPXA 2GUUA 2BY3A 3L4WA 4QLJA 3CAKA 2RHGA 1BHGA 2F38A 4LFYA 3VD5A 4XWUA 2HK1A 1G1YA 4HU3A 2CLMA 3DYPA 1NDYA 2XZ9A 5HAOA 5C9ZA 1PDYA 1GZGA 4IWWA 5AYZA 4P61A 3UG8A 2HTMA 1ZB5A 2G5WA 3QW3A 3LENA 3I10A 2CWNA 3TYAA 5DMLA 2FTWA 3Q65A 1QFEA 3BZGA 4EP8C 2ZC1A 1EGMA 2VQTA 2QCDB 1NF0A 4B91A 4PR4A 1OT1A 3F5KA 6ENLA 2J24A 2OLSA 2OMAA 1SVDA 5CGQA 3W1MA 4YTUA 2AAMA 3NNTA 4FF5A 4JN8A 3R5EA 4GUIA 4S2BA 1PZ2A 2DZUA 3KWSA 1CGXA 3LBOA 2BG5A 4I7UA 3S2JA 1TUXA 1UC5A 3RLGA 3W28A 1NM9A 1A5MC 2QS8A 3AIWA 5AKQA 3IVUA 3STEA 4OE7A 5GNZA 1KM4A 5LKYA 3Q4DA 5XINA 2J27A 2WC7A 4JTUA 3MCMA 1FH7A 1JPDX 3A23A 1WBJA 3QRHA 4H6KA 5G1TA 1VFFA 3BICA 2WVVA 4QCEA 5LNUA 3SEPA 3AWOA 4C60A 3WIJA 5HMSA 4PCFA 3TTOA 2ISVA 4JCMA 1H1YA 4JDBA 4RZ5A 3TTSA 4YNGA 5BU6A 4WKAA 1AQ0A 4QHRA 2NQLA 2O4QA 2J7BA 3CQIA 3AO0A 4DJDD 3TQ0A 4X2RA 3WD3A 3VCNA 5HNTA 3N73A 3D3FA 2UY4A 4GQRA 4D6EA 3BPWA 1UPMB 2HSAA 3TA9A 3W73A 2Y70A 4X63A 3PZVA 3SSZA 5HPCA 1JXKA 3M46A 5HQLA 1W1VA 5LIUX 2WPGA 2E6FA 3S47A 1XRSA 3PPFA 3OZMA 1H60A 2P53A 4PRWA 4NG3A 2INFA 2QJNA 3EEZA 2ACQA 1ISYA 3JVAA 1WZMA 1ZALA 4I8DA 2XH2A 4OFCA 3KRBA 4KH2A 2BFGA 1XGZA 2NW0A 3WJWA 3DKLA 4MJZA 4RX0A 3CUZA 4B5XA 3IACA 5D4YA 1P1MA 3VIMA 4ZB0A 3LHVA 4D8AA 1AMYA 3O2LA 3PC0A 3RYSA 3E0VA 1KBKA 2VHLA 3WMLA 1RD6A 4XG1A 3L2IA 3QVQA 3ID7A 3FAWA 3NQDA 3BLFA 3EWXA 1VEMA 3BLIA 4QNEA 5G5IA 3IGUA 1K4GA 3DFTA 1CXIA 2YXXA 3DBNA 1S5MA 1KRCC 2PDUA 4CQBA 4E2BA 1CB2A 3IGXA 1ZGDA 1R9ZA 3FFSA 2X8RA 1GOWA 1A3HA 3OA3A 2PDMA 4N02A 3WD1A 2AAAA 3FLUA 2BZNA 3BQ5A 2EPNA 3M5XA 2QEZA 5D02A 5HXMA 3VD3A 2WVUA 3E38A 2BXVA 5H8PA 1ME7A 1KM3A 1Q66A 3B8WA 1Q6EA 1M3UA 3T0TA 3L4TA 2V30A 4EK7A 4MMWA 1GEHA 4JTTA 3EB3A 5HJXA 2VGIA 4IIHA 1W2VA 4QROA 3B8DA 1TQXA 4NYUA 2WNNA 1X39A 1YEYA 3ABQA 3RJXA 4PMYA 1B3ZA 5GJNA 1TWDA 4FEZA 1ZU8A 1U33A 2VO5A 2PLMA 4QDMA 2YA1A 3AOFA 4PUEA 1UIPA 3GDMA 3FA3A 2IS7A 3NZRA 5T9CE 3LI1A 3H24A 3UZYA 4N2YA 1GVQA 1H61A 3TFCA 2JF6A 2J9ZA 1P6BA 1T41A 2W3ZA 5EBUA 2ZFAA 4FIQA 1UD2A 1J0HA 3IUIA 1IR1A 1B3XA 1W5MA 2RKXA 1OZQA 2ISDA 3UT0A 3RMEA 4GWEA 4HCHA 3T08A 1JCLA 1QOXA 1IE7C 1GWJA 2J62A 4C6EA 3QN3A 1FQ0A 3SCWA 1B1YA 3L4VA 3B8TA 1CIUA 4ZQMA 4ZQNA 1EXBA 1G67A 1JF5A 1C93A 4DZHA 3OODA 4GYPC 3VIIA 1E6XM 2QAPA 3ITXA 3QZ6A 1WPCA 3TC6A 4EANA 4F2BA 1EF3A 3W71A 2FVLA 2Y8KA 4PTMA 3SQSA 5KTLA 3EB2A 2QUNA 1OCJA 4LXFA 4HPJA 1ONWA 2GDVA 1JPIA 1XIFA 3EWZA 3REQB 2R1NA 2AL2B 1W9BM 1XWYA 4J4KA 1YNPA 2QCGA 1OFQA 2WOQA 3HJZA 3VD9A 3PZMA 3BANA 3GVVA 1SM9A 4XSMA 4S23A 4XAYA 1VBUA 1ECQA 2H9AA 4J2PA 1QI5A 3S2MA 4UQBA 3ZJ8A 3TWAA 4Z2KA 4FIRA 4D6IA 1UMYA 3CQKA 3O6AA 1FWWA 5AC8A 5D33A 4UTIA 1R9YA 1ZJBA 2QPSA 5E09A 1EJSC 2P10A 3QGVA 1HKWA 1CXKA 2JIWA 1R3SA 3IAQA 7ODCA 3V1PA 2BGQA 3CO4A 2NT1A 4M80A 3NQBA 1E15A 3VFCA 1RQBA 4H7ZA 3LU2A 1LLOA 4UMAA 3O6CA 1ZTVA 3WK3A 4HB7A 3WLPA 4PSPA 1JULA 4BQ2A 1EP3A 3BE7A 3PSVA 1OBAA 4AX7A 3OO2A 3B04A 2E6YA 2DSUA 3CT2A 3OGSA 2DUXA 4K38A 1UROA 3GIYA 1QATA 1Q6FA 4FP1A 4B2DA 3NDOA 3R11A 1WA3A 1UR8A 2Y7EA 1UOKA 3S6TA 3IIVA 3OW1A 3DYMA 5EY5A 3NO1A 4L65A 4ZE5A 5SWUA 4ZOEA 3EPMA 4IMEA 4IMDA 4XD6A 1TMQA 1L9WA 1G4TA 4N9EA 4FLQA 3QYSA 1J11A 3UZWA 4D6CA 3TK7A 4G7EA 3ZLGA 3KL0A 4BZYA 2XINA 1NFBA 4MB1A 2C7FA 2X1RA 1PDZA 3GUWA 4GJJA 2C3ZA 3V7PA 1Q6GA 3AFBA 1M5WA 3OGVA 3GKAA 5HULA 4A8LA 4C6KA 5JXQA 4INFA 3V5CA 2V0TA 3H4GA 3WFLA 3QJAA 2ZUWA 1E4NA 5LIXX 2RDUA 5AZ0A 1ZBKA 2Q02A 4AWTA 3TR2A 4S3CA 2WCSA 2UBPC 2AMXA 2QV5A 5CQ1A 2E5DA 2VX4A 3M07A 3XINA 2V3DA 1OC5A 2PWGA 1UIOA 1I75A 2ZX6A 4QAIA 4UOJA 4KWWA 2DIKA 1TKKA 3PZQA 2XUCA 4KS0A 1D2KA 4LUYA 3F5LA 1RA5A 2GGJA 1SJAA 3W1QA 4HMDA 4YIWA 1V79A 2YX0A 3GYEA 3NEVA 1QVBA 3UJRA 4S3FA 2QCFA 3UGRA 2WVTA 1V6YA 1HL8A 3FJNA 3AXKA 4IISA 3MP4A 1BTCA 2ZA3A 3PANA 4NILA 1JZ5A 2DSZA 1KXTA 3TN6A 2PTYA 3WH8A 1OFRA 2I5QA 2XH7A 3ABSA 3HOJA 2ABAA 3AYVA 2C19A 3C61A 4KF1A 2Z2AA 1XXXA 2VFGA 3E0FA 2X41A 2PF8A 1QHOA 4BEUA 1E72M 4CNTA 5H8MA 2OSXA 1WAWA 1JCTA 5FF3A 1JD9A 1QDSA 1XM3A 1XR2A 4HNUA 4AVNA 2ZUSA 5HOSA 1K8YA 3VIHA 2ZRWA 3H4XA 5F2MA 2ALRA 1Z89A 1WXYA 1HGYA 7A3HA 3ARWA 1JRBA 3NYZA 2P0IA 1UMLA 1FWSA 5L6UA 2EG7A 3E0LA 2WW5A 4DQWA 2QKFA 1ML1A 1VS1A 2GJXA 2V81A 1R38A 3N6HA 1QNSA 1US0A 1XGDA 2R91A 4ZOAA 1HP4A 3WQGA 4X9SA 4TMBA 3BAJA 3P84A 3THCA 3AZTA 1Z32X 1XH0A 3RU6A 4IMGA 1RBLA 5MKGB 2GVEA 3NO5A 3LHZA 2OB3A 1GOXA 1O5RA 4MM1A 2ZADA 3CZ8A 4IP7A 3ABRA 4JTGA 5KZ6A 3MDUA 2VD8A 5A8GA 2FZ9A 3SJNA 3P2VA