3EKZA

Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
345
structure length
334
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGKLYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalysis of a tetrameric class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords Fructose-bisphosphate aldolase
total genus 130
structure length 334
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ekzA00
5CGQA 2J9XA 4N4QA 1FWNA 3W85A 3TSBA 3MI6A 5F4XA 3TA6A 5CPLA 3NEVA 3R89A 3S5YA 1WDWA 4O11A 3P8IA 2A6LA 4OQVA 3JRKA 4AXKA 3MMTA 5CKSA 3USBA 1VLIA 5GVJA 3PM6A 5ABTA 1WYIA 1QWGA 4JR5A 1AL8A 1KM1A 4M6QA 2NV1A 1XI3A 3EX6A 1AW5A 4S2CA 1J5TA 4RK8A 1X7FA 1IIGA 3UWQA 1JCLA 3DENA 5F2GA 2E1DA 4G1KA 1FCQA 4TMBA 1W0MA 3QJAA 3PULA 4O50A 1P4CA 4FX7A 4O12A 4WY0B 3WK3A 4YXGA 5DCDA 3NA8A 1Q3NA 3O16A 1LRQA 3SGUA 3DI0A 2ZZ5A 1M7PA 1TQXA 3S6DA 4TO8A 4RCXA 3LRMA 4YL2A 4LOCA 3I7QA 3QSTA 4IWWA 4PODA 5U4NA 4N6FA 4M7TA 3QF0A 3MJYA 3L66A 4M5PA 3IIXA 1OJXA 3WJWA 1Q6OA 5HQEA 3CTLA 3FLUA 4LV4A 1Z41A 5J5RA 2D73A 4JTUA 4Q32A 1TYGA 2VC6A 3DAQA 4JD4A 4AWSA 5HUPA 1QAPA 4KKXA 4RZ5A 4A21A 5AYZA 1LZOA 2B7NA 3TC6A 1VZWA 4O17A 1SFLA 1D3HA 3NPXA 4FO4A 4O4VA 3HGOA 1KTNA 3C2VA 3IGUA 3NQFA 4OBTA 4DELA 3LTPA 3P81A 4C1KA 1THFD 3L5AA 4OV4A 4FB7A 1TIMA 2ZA2A 3V75A 3H54A 1F7BA 2Q3OA 4RX0A 4QNWA 5KZEA 2C14A 4BK9A 1V7YA 3PG8A 1FCVA 3B0VC 5I3JA 3LTYA 5K4XA 2ZZ3A 2YXGA 3L68A 3NQCA 2V81A 3LRKA 4Z1AA 2OMAA 4DBEA 3O15A 3G8EA 3LERA 3UWYA 3W1PA 1L6SA 4HNTA 4UFKA 5L6UA 1FWRA 3GLCA 4O14A 1DJQA 4HIBA 1E51A 4XZ9A 4DQWA 1YXDA 4CCDA 3CIXA 3W87A 3TV8A 3G3MA 4PL2A 4LWWA 4QAIA 4UFIA 4MZ8A 5G4EA 1F6KA 1SZGA 3RLUA 4IPIA 1PE1A 2JKEA 4MKNA 2ISWA 3SGZA 2E6AA 5C5YA 3PUEA 3K30A 2A5HA 2HTMA 1SZFA 2DJXA 1OYAA 4Z1BA 5C54A 3L21A 3L5LA 3TH6A 1LTDA 1N7KA 1VYPX 3UXAA 2FQIA 4KWWA 3CWNA 4AWUA 2TYSA 3Q2DA 4IMGA 1LBMA 4S1FA 1JCXA 2E77A 3SJ3A 3CWOX 2CZFA 2GQ8A 3B0UX 3G1XA 3RU6A 5U7SA 1G7UA 4KWVA 1EUNA 1ICPA 2V30A 3IEBA 2ATMA 2AGKA 1YTDA 3FOKA 3MI2A 1K02A 3UWUA 5AYXA 2WOQA 5EMUA 4ALDA 3HG4A 3HPSA 1UBSA 1VJIA 1GG1A 5F2IA 1H50A 4Z0JA 4AHOA 5LNRA 4GUFA 4I7UA 2NLIA 3O06A 3HG5A 4HNVA 4OGZA 4MLJA 2QAFA 3KHJA 3KRZA 1OYCA 3DXIA 3N2MA 5DBUA 2UV8G 5FEZA 3UPBA 3FYPA 3LCLA 3F4NA 2Y88A 3GIYA 1IGSA 2IQTA 1I2NA 1AW1A 1WA3A 4JIPA 4K7VA 4UMCA 4M7SA 3ANYA 2JKAA 4NX5A 1VS1A 2Y7GA 1B3OA 3NYZA 4FNUA 1DVJA 4UTWC 1W5MA 2Z6JA 4NQ1A 1CI1A 3PY2A 1OK4A 3U8GA 5CSSA 3C2OA 3BLFA 2C18A 3O1NA 3TW7A 2Q8LA 4O1DA 1S5TA 5AHIA 3NPVA 1TPUA 4MOZA 4GUHA 4NX0A 4NJHA 1JQXA 1ADOA 1DQXA 4WQ6A 2NX3A 1FWSA 3BG9A 4DO4A 1U5JA 3GXNA 3W2UA 5LSMA 3N14A 5KMYA 4HNNA 3LHUA 5H2ZA 1CX9A 1DBTA 3G1AA 4OHQA 3RLVA 1C8VA 2X1RA 3QQ1A 2RDWA 1NF7A 1W5OA 3LXAA 4ZQCA 2VFFA 2GVGA 2OT0A 4GBUA 1JRCA 2GJNA 1ZAJA 1RQEA 4P2VA 5F4WA 1NEYA 2A0NA 1QNVA 1TPC1 1SZNA 1FCUA 2C19A 4DPPA 1C29A 2DU2A 4N02A 5AC6A 3NQMA 3EWUA 4JNMA 4LVAA 3LI0A 2QEZA 3GAYA 1PCKA 7TIMA 3ABSA 4UFMA 4XBSA 4WX2A 4IMDA 3WJYA 2WQPA 3TMLA 2H6RA 3LBCA 1XBXA 3W9ZA 2B4GA 4RZ4A 4M19A 1TV8A 1VCVA 4O53A 1BEUA 3O6CA 2X16A 3N34A 3BGJA 5F4SA 2VEIA 4YWIA 3NL5A 1GQNA 3G1SA 3P60A 5EYWA 1A5SA 4JTSA 1R46A 4FHAA 3I6RA 4FF7A 1G69A 3U2OA 3M16A 3BGGA 4LNYA 2GQAA 2DORA 3O8AA 2A7NA 3E12A 1QFEA 2B7QA 3PAJA 1KTCA 3HPXA 3IRDA 5TQLA 3CC1A 2E09A 5E1QA 4A2SA 1O60A 4FIQA 5DCBA 1ML1A 2CFFA 3S42A 2YW3A 2FTPA 3TX9A 3C0JA 5KZDA 2GUUA 3W1AA 3EWBX 3L2IA 4HSOA 4NJKA 5G5IA 2I9EA 1A5BA 3LXCA 4S2BA 3P7YA 2Y7FA 4WJEA 4Q33A 3NG3A 1JCYA 3A23A 1O5KA 1S3HA 3NPWA 5AHEA 3MW7A 5HULA 3N2XA 2VOMA 2E6DA 3QYQA 5LKYA 1TSIA 1SO5A 2DZVA 2H3DA 4JTKA 3N9SA 4UTTA 1XBYA 3F03K 1TQJA 2WKJA 4UFLA 3KVKA 3W71A 3PBYA 3W1RA 3C61A 4NVTA 1GYNA 3S5ZA 3LX9A 4N9CA 2V2DA 1PHQA 5D32A 4AAJA 1A50A 5E93A 3PB0A 5FF0A 3W7GA 3IVSA 1A5AA 3B0PA 4RLIA 4FEZA 3TAOA 1EP3A 3DKLA 2QUUA 4O8RA 2FPTA 3STCA 4YCPA 2BSLA 3NNTA 5EKYA 2PCQA 2A4AA 1W3TA 3HB9A 3DGRA 3W7RA 2A2IA 3B04A 3DFTA 4ORMA 5C55A 4GXMA 1LOQA 2O7QA 3G18A 2ZZ2A 1RQHA 3G8RA 1X1OA 1LDCA 2J24A 4Q4KA 3EWZA 3Q94A 1FDJA 1QCWA 1ICQA 3W76A 1K8ZA 2JK2A 1SQ7A 4M6VA 2V5LA 3E49A 3CQ0A 3QPZA 5LGZA 3EXRA 1OK6A 3TAKA 4K39A 3C2RA 1GEQA 2PRLA 2WSRA 5F1UA 4E38A 3QW4B 2DP3A 3MP3A 1KFBA 2YR1A 2ISSA 4XUGA 4Y90A 4JDBA 3P67A 5D30A 3CEUA 3MYPA 5A5WA 4JTFA 2NZLA 8TIMA 3QPYA 4QM1A 4UTWA 2QCDB 3M5VA 3NZRA 2GVJA 2KZHA 3KFTA 4MFDA 3LGEA 4BF9A 2H8ZA 3ABOA 3M0ZA 5IBXA 4IMCA 4IQLA 1H7NA 5KTLA 1UCWA 5D37A 3O05A 5TBOA 4BR1A 4ZQNA 1VLWA 2CW6A 5CG7A 4N4PA 1Y0EA 3NR0A 1FCBA 4E2BA 1ZAHA 1B4KA 3P61A 5LZLA 4MYAA 4QJ1A 1PVNA 3W1MA 3LHTA 1WBHA 3FKRA 4PEKA 3W74A 2XN2A 2I1OA 3E96A 4HHPA 3TK7A 1Q45A 1W5QA 1XDMA 4GUJA 4JX4A 3BW3A 3W1XA 3DI1A 5AHMA 3DU0A 4ADSA 3UQNA 3QMSA 1M7OA 3OEXA 4HPJA 3HJZA 3MWAA 4H4IA 3NDOA 1BTMA 1YADA 1SO3A 1R30A 3GAKA 4D2JA 2QCNA 1R2TA 4UTIA 4JYFA 5D02A 2VXNA 1EX5A 1GTHA 2V5BA 3M47A 3WJXA 3S9YA 2PC4A 1TCDA 4DF1A 3E9AA 1D3GA 3GDRA 3A24A 3L0GA 5LHEA 2A7PA 3FEMA 2Y6ZA 3TKFA 5BMWA 2ALDA 3DFSA 4LUIA 4FX6M 1D9EA 2VKZG 3BW2A 3MP5A 5BMXA 2FB2A 4UC5A 4XBKA 1QOQA 4UR8A 2EAWA 1YDVA 4O16A 4R33A 3G1VA 3FA5A 2C16A 4X3ZA 2YX0A 5EY5A 2YZRA 3NGJA 3NO5A 3TFXA 5DELA 3L0NA 3TE9A 4MFEA 3EKZA 3N19B 4WD0A 5EPDA 3THAA 5KSWA 2YCEA 2V82A 2GOUA 2Z6IA 4AVFA 1GVRA 2VFEA 2ZZ4A 1DOSA 2RKXA 2ZRVA 2FLIA 1FBAA 3L9CA 1YLVA 4C1LA 3EEGA 3C56A 1LOSA 2OJPA 3LB0A 3P74A 3Q37A 4GE8A 2YYUA 1K8YA 1R2RA 5FI8A 2CLEA 1FDYA 4PL1A 4NNCA 2EKCA 1KBJA 1XXXA 3HGSA 3V1PA 1B9BA 1V5XA 5FESA 2C0AA 1OFRA 5A8GA 4P61A 3T4CA 3EKLA 1VPXA 3MHUA 1KFCA 3NVTA 1W3IA 3TQ0A 1SO4A 1RPXA 4PH6A 3QFEA 4MJZA 3T78A 2CLIA 4XTDA 4JXCA 3M5ZA 4LW7A 1N8FA 2VFIA 4B5NA 3P84A 4ONVA 1F2JA 3WK2A 1EPXA 3RNDA 1QPRA 2PURA 5AC8A 4DPQA 1RZMA 2TRSA 5AHFA 4Z1CA 1XM3A 1JUBA 3EX1A 2ZA1A 2WV8A 3B06A 4AHPA 5G1TA 3S1XA 1SR9A 2DZXA 3R12A 2QCMA 2FDSA 3P5YA 5AN7A 4TMCA 1I2OA 2JGQA 3R13A 3YPIA 3P80A 1ZJIA 2ISVA 1H61A 2WNZA 4MYXA 1UUOA 3F1QA 1OFEA 3W86A 1FWTA 3LHZA 3UWZA 1EP1A 2A1YA 1I2QA 2ZYFA 3MI3A 3SZ8A 1KV8A 4O19A 2V9DA 1JUEA 4YLWA 2Y70A 4QQ3A 4R7JA 4W9TA 1XL9A 1ZALA 4WY0F 1JJKA 4LU0A 2CZEA 1NFBA 1HFBA 4E0CA 1YXYA 1VHCA 1K8XA 3NL2A 3EXTA 3NQ8A 3PSVA 3W6YA 4ZQOA 1G6CA 3THQA 1H62A 4JTEA 1RVGA 5H91A 5BNKA 3NAVA 3VFLA 3PWAA 1HUVA 5DXXA 3RMJA 3W7QA 1OFQA 4R53A 2P0OA 2G5WA 5D33A 1GVFA 1SFJA 2B7PA 1UB3A 2FFCA 4UMBA 3TFCA 3W2LA 4UTMA 3NQAA 1EP2A 5BW6A 4DF0A 2F84A 2DZSA 2CWNA 1AW2A 2EGZA 3M44A 5CZ0A 3HF3A 1X6UA 1N55A 1G67A 2DZPA 3LCGA 4LS1A 4BWLC 2C13A 1G4SA 2Y7DA 1UASA 1IXQA 5FEWA 3GKAA 1VCFA 2YPIA 3LLFA 2NX1A 3BPWA 2CLOA 3PUOA 1Q6LA 1XC4A 1FY6A 4DF2A 3PBWA 4Y6GA 3PF3A 1SUXA 1GT8A 3HG2A 2QCDA 4JEQA 4UTUA 3W2KA 3WFAA 6ALDA 3P5ZA 1JQVA 3NQVA 5HJLA 3VI2A 3IGXA 3GDMA 5FF7A 2ZFAA 1M6JA 2ZA3A 4EOUA 3EX2A 3EWWA 2A7RA 1K3UA 2YSWA 3IVTA 4LS0A 1MZHA 2BX7A 2CZDA 3IIPA 1P5BA 3G1HA 1J2WA 3DKJA 4O10A 3EWXA 4JX5A 3DFPA 4X22A 2C3ZA 3ZWTA 3E02A 3JR2A 3W7EA 3W7MA 3G1FA 1PIIA 5AB3A 1L2UA 1ZAIA 4EIVA 4NZJA 3HMJG 2QF7A 4MLRA 3HBLA 2C6QA 4BI5A 1SPQA 1W1ZA 3LXBA 4HT3A 2QCGA 1A5CA 3R5EA 4Y9AA 4K8HA 2CLMA 5CZTA 4EVZA 3GDTA 3GXTA 4MVAA 5I3HA 3TIMA 3UD6A 2RFGA 2PE4A 5I3GA 1IXOA 2Q8ZA 5G4WA 4FXRA 3T7VA 1DJNA 2OZ0A 3R8RA 2Z2UA 2CLKA 5HNRA 3LV5A 5K9DA 2A85A 3GB6A 3S5OA 5LNWA 5G2IA 5DY3A 3IGSA 5F2MA 1P0NA 3HGRA 4RKAA 1S5WA 3T55A 5K9XA 1L6YA 4MIMA 3G1YA 2W6RA 1VYSX 3PSWA 1F5ZA 2ZTJA 4MZYA 3O6YX 1W3NA 4NXKA 5KZMA 1DORA 5T26A 1LYXA 4O0KA 4O28A 1KFJA 2A21A 3FFSA 4CCEA 4QITA 1VC4A 1RQBA 2X1TA 4RZ6A 3C8FA 1VGAA 3C6CA 3W3OA 4A29A 2QUTA 1DHPA 3W7OA 3UYCA 4NU7A 2RHGA 3NQ2A 4ZQPA 1WXJA 2J9ZA 3H55A 3OVPA 1NF0A 3A5VA 3MBFA 4ADTA 4NJGA 3UNDA 2Y7EA 4FX8A 1DQWA 4HPXA 3BARA 1JR1A 3LM7A 3HO8A 2FPVA 2VENA 4ZVJA 4N2YA 1OVDA 3MYOA 1GVSA 1AK5A 2NXHA 3TJXA 3KVMA 4JIQA 3QMRA 2TPSA 3CPRA 4ZQMA 4MY8A 1GG0A 3ATZA 5G2WA 4QISA 5BRBA 3QRHA 1RV8A 1ZENA 4MZ1A 3NL6A 3STGA 1GTEA 4GUIA 3HOJA 2ZQ0A 4ZMGA 2R94A 3OVQA 5CZJA 3DHDA 4DBDA 1FXQA 3FKKA 1QO5A 3WK0A 1W31A 2YFNA 3L65A 4O52A 2CZ5A 4CLMA 5G2HA 4IOTA 3W7JA 1XBVA 1FXPA 3O07A 2NUYA 4ML9A 2VELA 1SW7A 2Z1BA 4O57A 1KTBA 1KFKA 1H7RA 1MXSA 2BLEA 2J9YA 3ATYA 2QJHA 2X2GA 5D04C 1GZGA 3QQ0A 3WJZA 4UR7A 1TPH1 3D0CA 3GNNA 2YW4A 1KFEA 1MEIA 3SI9A 3O63A 1KM6A 2Y61A 3G0SA 4FIRA 1EA0A 4HNUA 2ZTKA 2J6XA 4UXDA 2WSYA 2X1UA 4JTIA 5D03A 1EIXA 4BI6A 3PUDA 1GPWA 3R2GA 3GX9A 3W70A 4ICNA 1JCJA 3PBVA 1ICSA 2E6YA 1FX6A 5HWNA 3LLDA 5HUOA 1OX6A 3SFKA 2XN1A 3NQ6A 3LHWA 2ZZ1A 3KOFA 2Q3RA 3O6DA 4AHQA 1SU5A 4H3DA 5HWJA 2DJLA 2LLEA 4RXGA 3KVLA 4GC4A 4O54A 4A3UA 5DN1A 3GYEA 4UTLA 1H63A 4ZQRA 1L6WA 5K9CA 3LTSA 3DFOA 1LRTA 1TRIA 3BLEA 2J88A 2WNQA 4A22A 5DBTA 4RXFA 1OABA 3I65A 1YTEA 2P1FA 1ME9A 2BWGA 3PG9A 2DZUA 3W7HA 2TMDA 4CCCA 1T8XA 5DXYA 1UJPA 5F2LA 4YMZA 3B4UA 1YDOA 4OWGA 3TJLA 1OYBA 4NT0A 1B57A 4HKPA 4JTHA 1I45A 1ZCOA 3TQKA 2VEKA 3WK1A 2EPHA 4UTTC 1VCGA 2Z0IA 1GVQA 3N9RA 4CNPA 3W88A 2V8ZA 2HMCA 2R8WA 3C2EA 3NQGA 3NQDA 4WY0A 1LOLA 1JCMP 1XCFA 3G24A 3M5XA 4IMEA 1VQTA 1HO4A 5AYYA 3VKJA 2WJZA 4FXSA 4TR9A 3MHGA 4AH7A 3IV3A 2C1HA 4MY1A 3OIXA 1ZY9A 1H51A 4Y8FA 3AO0A 4JDYA 1CW2A 3LHVA 1MO0A 3CIWA 3W7PA 1LROA 1OX4B 3NXFA 3OA3A 4JTTA 5K7JA 4N9EA 4WXZA 2ZRWA 3GDLA 3OBKA 3ELFA 4L4LA 5LNVA 3SW6A 2QCEA 3TU9A 3W1TA 3T44A 5DCEA 5D2XA 2B0MA 3M41A 4LT9A 1K03A 4WOZA 1PS9A 4L4MA 4MPQA 1KFLA 1SW3A 2BZNA 2VFGA 3W7NA 4MY9A 3SECA 3TDFA 1TV5A 3GKFA 4UNKA 2ZRZA 5E0KA 1XUUA 5I3IA 2ZZ6A 2Y89A 5K2ZA 1JRBA 3EX3A 3BW4A 3VNDA 4LVGA 4WUIA 3ABQA 1WV2A 3HIJA 4K8EA 3W83A 5K3VA 1OF6A 2G95A 3MBDA 1IF2A 1KLZA 2WNNA 2V2CA 4XKYA 1WAUA 3NM3A 5CPMA 3M6YA 1JUKA 4NZFA 1ZHAA 2YGYA 3LCFA 2YFOA 1SSDA 3AJXA 5L9FA 1O94A 3TC7A 4CQ9A 2WSQA 1PHWA 4NNBA 5FF4A 5DY2A 1SO6A 2CLHA 2E5CA 3GZ3A 1DKWA 4LS2A 5IM51 1YDNA 3IVUA 1XFBA 1T99A 3Q58A 4I9AA 1OFOA 1JVNA 4K37A 4AMAA 2RH9A 5HINA 3S8HA 2HSAA 4JS3A 5AFDA 3TNOA 1NVMA 4LUJA 3MHFA 3G3DA 3G1DA 1H7WA 1PL9A 4UUIA 2VEPA 1QO2A 3LCIA 1W37A 1I4NA 3NQEA 1YPFA 4TU1A 3EB2A 3PC0A 4MJMA 4IGHA 3UWWA 3M43A 1TTJA 3H53A 1LORA 1JCNA 1HL2A 1WOAA 2ZRUA 3A9IA 1AMKA 3W1NA 4PFMA 1Q6QA 1B4EA 3PS7A 1GOXA 1ALDA 2HS8A 5HWMA 2NWRA 3W7CA 1IXPA 5TIMA 3DFNA 3N3MA 1QPNA 4CQ8A 2Y63A 3QM3A 4JTGA 3C52A 1W54A 1EUAA 3CHVA 4JYEA 1PV8A 4PA8A 2NUWA 1X8FA 2ZBTA 3KRSA 4TX9A 3PR2A 3JS3A 3M1ZA 3FJ6A 2RDUA 4DO6A 3U6WA 4Z1DA 3CT7A 1TPDA 2H90A 3LHYA 1TPFA 1C9DA 3OVRA 2ZZ7A 3BK0A 1MEWA 5D2YA 2QKFA 3GR7A 3SR7A 1VHNA 4O4WA 3C2FA 2BXVA 4EF9A 3KX6A 4M6PA 3KRUA 4XWUA 1G4PA 1W56A 3C3NA 3TSDA 3INPA 1OX4A 4U4MA 1EWEA 4RR4A 3A22A 2AAMA 4ZL1A 1TJPA 3LCHA 5FF3A 4FNSA 5LNUA 4LVFA 3TSMA 1VH7A 5D38A 4XQ6A 1KA9F 4GWEA 4OT7A 3BV4A 3A5FA 4IX0A 2H8XA 1SZEA 1RD5A 4Y96A 1FWWA 4JN6A 1O4UA 3L67A 2XFWA 3I7RA 3P82A 3ZWSA 1TPEA 5HR6A 4AF0A 2X1SA 4JICA 5I3FA 3W2JA 3RK8A 2E6FA 3LOTA 3KVJA 1S5VA 3B8DA 3G0UA 4HN4A 1ME7A 4E2DA 3UPWA 1OHLA 1KM0A 4CNNA 1Q6RA 2FB3A 4LRSA 1R47A 1H1YA 1XBZA 4FNQA 2TSYA 4AF0B 2X30A 4KFNA 1OX5A 3SSJA 3P8JA 4O0ZA 3W2NA 4X9SA 4NXSA 5SWUA 3TR2A 3GXPA 2G96A 4DO5A 4R34A 1K7FA 1ZFJA 3QEZA 3E0IA 5FF2A 5C6MA 4IJBA 4QNEA 4LC6A 3EWYA 5D05A 4MUZA 4OE7A 4WZHA 2ATSA 3TXZA 2WO5A 3STFA 1UUMA 1EEPA 1BKSA 3LRLA 1IXNA 1I2RA 3LBMA 4DEFA 2R14A 1JULA 2E5BA 1Z42A 3STEA 3P62A 2QUVA 3MUXA 3UZ5A 4N9BA 1TB3A 4IXHA 4O1CA 1LCOA 5D2VA 4AEOA 4AWTA 2W79A 5LNSA 2CLFA 2Y85A 3LI1A 3QC3A 1EWDA 2DZTA 2YYTA 4WXYA 1AG1O 1MSSA 3OHIA 1FUYA 2CU0A 3IIVA 1J4EA 3G22A 3FJLA 1LBFA 1G4TA 2GPTA 3QMTA 2I14A 2QJIA 1Z48A 4X2RA 1BWLA 2QDHA 3W7DA 3S5NA 1ZNNA 5IBXC 3KAOA 3ABRA 1QPOA 2EHHA 1TREA 1Z44A 2QCCA 4XKYB 2FJKA 1XDLA 3HQ1A 5FEXA 3RF9A 1I2PA 4POCA 1LBLA 1SW0A 2WPBA 3GNDA 5HMSA 3DH7A 2CLLA 2J27A 1GJPA 1QPQA 3KXQA 1H7PA 4Z08A 1LLWA 2GVLA 2NV2A 1KM2A 4RV8A 1U83A 3SY5A 4UTHA 1TO3A 3CLMA 1A53A 1H7XA 1F76A 3UY7A 1WOBA 1QR7A 4QIUA 3NL3A 2OX1A 4IX2A 5LGXA 1EB3A 2NWSA 3EXSA 1LLZA 2EF9A 1G7VA 4JY8A 4UIOA 4UFJA 1QOPA 3TROA 4JY9A 5HR7A 3B03A 2OT1A 3WJSA 2QCFA 2QAPA 1KBIA 4OU1A 1HTIA 3DFQA 1KW1A 1TTPA 4IUOA 4EF8A 3DBPA 4I7VA 5CSRA 1O5XA 1LM1A 3UXDA 1GWJA 4H6KA 1VR6A 3QW3A 3W1QA 3QSRA 1OFAA 2QCLA 4TIMA 1BWKA 4Z0SA 4K6AA 3L0KA 4KFOA 4KFPA 3VCRA 1G4EA 1OFDA 5AHNA 4BI7A 3TQVA 2V0TA 2XN0A 3QZEA 1KM4A 1P1XA 1VRDA 5LHFA 4WOQA 3BLIA 1XKYA 3FS2A 4UTJA 4LVDA 3LDVA 3S1VA 3W72A 4UTKA 1VYRA 5KINA 2BTMA 4NJJA 2OCZA 3ZS4A 2JGYA 2NXGA 2VFHA 2VEMA 3HGJA 2P10A 5KITA 3M9YA 4LV9A 4JTJA 3FYOA 2H3BA 4LVBA 2NXIA 5D2WA 3EX4A 3RFAA 4NJIA 3BG5A 1H5YA 3LCXA 3GR8A 1HG3A 2R91A 1TPB1 3IIZA 3UZJA 3TCEA 4CNOA 1LP6A 3UWVA 4XTIA 3CM4A 4O1AA 1QDSA 3MO7A 4PC8A 1TTIA 5EBUA 3TUUA 4HSNA 1TV7A 3A21A 1IIHA 4DXVA 1R2SA 3BVJA 3W75A 3W23A 4UCGA 3TW6A 1ONRA 2QCHA 3TMQA 2JBMA 1TTQA 4O1BA 1WX0A 4JTLA 3I68A 2PRMA 4U28A 2PRHA 1K7XA 2A6NA 1F6PA 4GRSA 2ZRXA 4PTNA 3UY8A 4ZZ9A 1FDZA 1OF8A 1GVOA 1H60A 3FIGA 3W1UA 4GUGA 2V2HA 3B05A 3VE9A 3QH2A 1RR2A 4NUWA 5AOUA 3W22A 3NM1A 3NOEA 4JGDA 1YTKA 4IMFA 4N6EA 3M7WA 4EWND 2ZCGA 3PB2A 1W5NA 1X1ZA 3W84A 6TIMA 3LCWA 2NUXA 3NQ7A 3W7LA 2ABAA 4BFAA 2ZRYA 3W07A 3CU2A 3N73A 2F7FA 5I3KA 1L9WA 4IPJA 4BWLA 1KV5A 3GVGA 3W1LA 1XUZA 5MHBA 2DZWA 5FEPA 2NX9A 4K36A 3DHFA 1PCWA 3TXVA 1M5WA 4ORIA 1TPWA 3C4UA 3ZR4A 5C2XA 3CB8A 4PCFA 1WQ5A 2JKPA 1NAL1 1DV7A 1OFPA 5CPNA 1KLYA 3L5MA 4GNJA 3S1WA 3G0XA 3F4WA 5G1YA 3W7IA 5D2TA 1W8SA 2QDGA 4O15A 3DZ1A 1YXCA 3W7KA 2C15A 3OG3A 4CQAA 2RDTA 3NZ1A 5DLCA 1F05A 1I8JA 4UNLA 2HS6A 1YYAA 4GJ1A 3HG3A 2Y62A 4QSHA 1SSGA 1YPIA 1KM5A 1TMHA 3SIZA 3GDKA 1OG0A 3CEPA 5F1VA 1ME8A 3W2MA 4A2RA 1WBJA 2ABBA 4RJEA 4LY8A 4ADUA 1GYLA 3LV6A 5J5DA 1FQ0A 5K4ZA 4LRTA 1KM3A 1P0KA 4O13A 2ZDRA 3BO9A 3ZFHA 2E5DA 4K38A 3VE7A 5CPOA 2FIQA 2VFDA 1MEHA 2YDAA 3PVFA 4LTSA 4J9JA 4OV9A 4AB4A 1LRNA 4UMAA 4FNPA 4GFSA 2AQWA 4O18A 1NSJA 5CZSA 2O7SA 3MP4A 1K7EA 1TRDA 4UFHA 1TPVA 3GK0A 4FNRA 1O95A 4JX6A 3S1UA 2QR6A 5AHLA 2W0UA 3NPUA 4I7WA 3T40A 2B7OA 3W73A 4FNTA 3PBUA 3M5YA 4N9DA 1HO1A 1F74A 1T0OA 4K7YA 1T96A 1AL7A 1W5PA 1TJRA 5BOOA 1QMLA 1H1ZA 1F73A 3BG3A 4JYDA 4IXXA 5D09A 3S0CA 5AC7A 5EL1A 2FPYA 2GJLA 4NNAA 2G97A 4LC8A 1H7OA 5EA9A 2GQ9A 1DL3A 1OFBA 4YCOA 3IIOA 2E68A 3I7SA 2QJGA 3HPZA
chains in the Genus database with same CATH superfamily
1D8WA 4XAYA 1UKOA 2J9XA 3MDWA 3TSBA 4AEFA 3MI6A 3V35A 3ITGA 1US2A 1UPPA 2OSYA 1PYFA 3LD5A 4U5IA 1NQKA 3M0YA 3GNXA 4ZOBA 4W8AA 1Q65A 4OFCA 2A6LA 4FXJA 4JQ2A 3IARA 4MB1A 3MMTA 3USBA 3KBNA 3RCYA 1Z6KA 3PM6A 5HAOA 1UROA 2VD8A 3ZM8A 2DZAA 3QOMA 2YBVA 1S2AA 1AL8A 1KM1A 2OO6A 1TWDA 3HPAA 4M6QA 1M7JA 3RM9A 1QHOA 2Q71A 1NU5A 1E43A 2G3NA 3UWQA 1A5OC 5F2GA 1MDRA 4IIGA 3CQJA 5F7UA 4Z2GA 4TMBA 3U2ZA 2GSJA 3PULA 4FX7A 5M1TA 4NZ1A 1KWGA 2V5JA 3ZT7A 3S6DA 1B54A 2A3BA 3LRMA 4YL2A 4WIWA 4LOCA 4C1NB 4UB9A 3LPGA 4I5UA 3WNPA 4M7TA 4QDPA 3MJYA 2OO0A 1M3UA 2QNEA 1OJXA 1C7SA 3WJWA 5HQEA 3FLUA 1Z41A 2D73A 5A6TC 3WQEA 1P0BA 3DAQA 3SCQA 5CLTA 1QAPA 4KKXA 3LA4A 1W17A 5AYZA 4S3GA 4XK2A 1L0PA 3VKAA 2B7NA 1J01A 4PMJA 1XH0A 4QLJA 2EPMX 2WKGA 1GJUA 1FVPA 3LTPA 4C1KA 2Y5JA 3GH4A 1O68A 2ZA2A 3EEZA 1PIGA 2Q3OA 5JXQA 1WZMA 4JTQA 3PWGA 2WLZA 2C14A 2BHZA 4BK9A 3S5SA 4HU0A 1V7YA 1G01A 3L68A 4I3GA 5CJNA 4CD8A 1OZQA 3KOWA 3VKCA 3O15A 3CB3A 1K8CA 4MB4A 1E5JA 3CMGA 4UFKA 4QCEA 1Y5VA 3GLCA 4O14A 4HIBA 3ERPA 5BROA 3LUTA 1PTAA 4G2DA 1XIDA 3G3MA 5E70A 4PL2A 2DH2A 4LAZA 3KDNA 3DG6A 3UG5A 2QF8A 4JFTA 4KCWA 1F6KA 4KS0A 1B90A 1UP2A 1U5HA 1DEDA 2IW0A 2ISWA 3KBMA 3V0TA 5C5YA 4S3FA 3K30A 4Q4QA 3WLTA 1SZFA 1UUQA 1IZCA 4GKTA 1QBAA 3OBAA 4GI4A 4PMZA 5LIWX 1REQA 1QATA 3R10A 3TH6A 3S4TA 4GY7A 3CO8A 4Q8NA 1ZLPA 2FQIA 1UD6A 2TYSA 4L61A 4ACZA 1LBMA 1S46A 2ZIDA 2OGJA 1JCXA 4F66A 8XIAA 1NARA 3BGAA 3CWOX 2CZFA 1CGWA 4LB3A 2GQ8A 2PWVA 3T8QA 3EA2A 3KEHA 2V30A 1XD0A 3IEBA 4FA3A 1YTDA 2XFYA 4ERIA 1K02A 1VBUA 3UWUA 4GXPA 4ZB0A 5REQA 1H50A 4GUFA 3B9EA 2BB0A 3ITOA 2JF6A 4R85A 3KHJA 3KRZA 3PJXA 4J3WA 3DXIA 2UV8G 3LCLA 2Y88A 1I2NA 1WA3A 2NLYA 5FD0A 3URBA 4UMCA 1NJJA 1HN1A 1B3OA 4A3HA 1ZBKA 4DY1A 4FNUA 3WD3A 3IJDA 1W5MA 2QGYA 1OK4A 3U8GA 4CEXC 2O56A 3BLFA 3L7RA 1TPUA 4Z17A 4NX0A 4LUYA 2KX9A 3KBJA 2W3ZA 2GJRA 3OU8A 4WQ6A 1JZ8A 3BG9A 2FGZA 1U5JA 1XIMA 5KMYA 1OC5A 2PTZA 1DBTA 2QIIA 4DN1A 3G1AA 4HZMA 1JCTA 1C8VA 1XHGA 2J78A 4IL2A 3L2LA 4KCVA 4Z2JA 3P14A 4GBUA 3H7UA 2GJNA 4GX8A 1ZAJA 1NEYA 2A0NA 1AQFA 3SQLA 4DYKA 1TPC1 1M9HA 1FCUA 2C19A 3GBDA 2DU2A 3SRDA 3GVVA 3H2EA 4QAWA 1HKWA 1V6WA 3R6IA 4QDMA 3SCTA 2VCBA 3N4FA 7REQA 1UD2A 2QMKA 4X61A 1QXLA 3CPUA 3W9ZA 4RZ4A 4O53A 1R9YA 4NRRA 1DYSA 5F4SA 4PEEA 1Q7QA 1GQNA 3G1SA 4MAZA 2QJMA 1A5SA 4JTSA 1R46A 2FVLA 3FGCA 4F79A 2GQAA 3QKEA 4AY7A 2B7QA 3PAJA 1WPCA 5BYWA 4QE4A 1O60A 2P76A 4WHBA 3WKZA 3U4AA 3S42A 2YW3A 4QHRA 2Y0FA 2YBUA 1AJ0A 1J9YA 2GUUA 3EWBX 4EXQA 3L2IA 1V6TA 2I9EA 4S2BA 4WJEA 1XS2A 3RXZA 4V28A 1R3QA 1JCYA 1Q85A 3N2TA 1S3HA 1IHIA 2AKMA 3ZR5A 1K9FA 5JBFA 4GGHA 1HKIA 5HATA 4NYUA 4WDXA 3HFTA 4OUEA 4JZ5A 3K8LA 2OWXA 3B9OA 3I10A 2FZ9A 1TQJA 4UFLA 1XLIA 2G37A 2AMXA 3W1RA 2XWDA 3WMBA 3C61A 4NVTA 5FIPA 3PAOA 4HYRA 1V0LA 1OCBA 2V2DA 1KCLA 4O1EA 2QT3A 4EACA 2FKPA 5FF0A 4LANA 3GIQA 4S3AA 2QUUA 3RRXA 3TN5A 1CLVA 3NNTA 4DNMA 4DVOA 2XGBA 3AMCA 4KEVA 3M0HA 2A4AA 3T1GA 4TXEA 4AD3A 4V1XA 1B3ZA 2EG7A 2UY4A 5C55A 4GXMA 1UWRA 1LOQA 2NVAA 2J24A 1BWVA 2GGIA 4Q4KA 1R7OA 4QRNA 2JK2A 3PFRA 1V6YA 3OQEA 4JAWA 4P8UA 3ALFA 2WSRA 3AIRA 1XLHA 3KLKA 1XIIA 4Y90A 4NAFA 5EBAA 1KBLA 3OIHA 3QPYA 4UTWA 4IIEA 1JIBA 5I7GA 1WDQA 3M5VA 1K6WA 1PX8A 3LPPA 4BF9A 3ABOA 2FYMA 3M0ZA 1W2VA 1WDDA 1UCWA 1J5SA 3GQYA 1Q6EA 3SY8A 1VLWA 2CW6A 1W3KA 2CBIA 1QK2A 3T2OA 3NR0A 1FCBA 1N82A 4JN8A 1E1EA 3VOCA 1CNVA 5BXSA 4MYAA 3EDFA 2YDRA 5LZLA 4GLEA 3W53A 1WBHA 1H0IA 1UR4A 3FKRA 1JI2A 3ZOAA 4PMVA 1K70A 2ZUMA 1Q45A 1F6YA 3QYSA 4ADSA 4JQ3A 3UQNA 5EFDA 3OEXA 1Q6FA 2F38A 4DWSD 3MWAA 4B5WA 1BTMA 1R30A 3GAKA 2QCNA 5D02A 2V5BA 1Z8AA 3M47A 2PC4A 1TCDA 3PFMA 1D3GA 3ARSA 3RILA 2XVGA 3GDRA 4MNLA 3H8AA 5LHEA 4JKKA 4B5XA 4WF7A 5BMWA 3RHGA 4LUIA 4FX6M 1KR0A 2PB1A 5FSDC 1FWJC 1YBQA 1Z32X 1GOQA 1ONEA 2Y5EA 4R33A 4C60A 4M1RA 2C16A 4X3ZA 4I9TA 5EY5A 1W32A 1UIPA 1FWFC 3NO5A 1QT1A 3W38A 4I90A 3GDBA 4AXNA 5C2CA 2YCEA 2V82A 1YKWA 3PK7A 3F5KA 3UR8A 1J8VA 1OQFA 3T2QA 2FZNA 1BAGA 1GVEA 2OZTA 2FMNA 2W67A 1FBAA 2PBOA 3DHPA 2J7EA 1SJDA 1F3XA 3C56A 3MUCA 4FS9A 1LOSA 2OJPA 4I9MA 3VKDA 3VGEA 2ZADA 3Q37A 1BXNA 6REQA 4MM1A 2F9RA 2YYUA 3SGGA 1B31A 1MFVA 1K8YA 4DRSA 1HT6A 1N8WA 3CHEA 2WANA 1OC6A 2ACRA 3HGSA 2CKRA 3V1PA 1B9BA 1QNRA 5A8GA 1VPXA 5JIWA 4AYSA 3WNLA 1KFCA 2CKSA 1RPXA 3T78A 4CU6A 2WM0A 3B40A 3SN4A 3M5ZA 7XIMA 1Z69A 4JFUA 1I0DA 5J04A 3DBNA 1B3YA 3M46A 3VIJA 4C6IA 3P84A 3WK2A 3DFYA 4GVGA 1EPXA 3RNDA 2QW5A 4B9YA 4D6IA 1V77A 1VEMA 5AHFA 3A13A 1J2BA 2ZXAA 2WC7A 4MDPA 3NZQA 3UCQA 3NEHA 1JDDA 2BNJA 3S1XA 4US5D 1I1XA 1W1IE 5EGRA 3OYZA 2FDSA 3R7MA 2W61A 5C9XA 4PMOA 3YPIA 3R13A 1XGZA 2HJPA 1UUOA 1YNYA 2PD5A 4ZB5A 3U5YA 3WD4A 2A1YA 4D8LA 1X6NA 5C7VA 1KV8A 1DJHA 2HE5A 2V9DA 4S3CA 4YLWA 3XINA 1QHZA 1E0XA 2Y70A 1CXKA 5D8WA 4LU0A 2CZEA 2ICSA 4IICA 3AIWA 4ZQOA 1G6CA 2EEXA 3WLMA 4ENLA 3R43A 3VFLA 1F4HA 4ATLA 1HUVA 5DXXA 3AXHA 3RMJA 1E40A 2CZVA 1XICA 2P0OA 2G5WA 4KW2A 5D33A 1GVFA 3WUEA 3K13A 1SFJA 2FFCA 3CMFA 3PNUA 2WLYA 4OIFA 1AD4A 4NSBA 1D3CA 2I5GA 1EP2A 4DF0A 2G41A 2F84A 3BLDA 4W5UA 2CWNA 1TV4A 1AW2A 3BAYA 5M17A 2Y8VA 5CZ0A 1N55A 4GQQA 1AA1B 3KBVA 3SBFA 1G67A 3HZ3A 4WSHA 4BWLC 1CZ1A 1G4SA 1HP5A 3QC0A 5XIAA 1R0MA 2BGQA 1XV8A 4LJ3A 1LT7A 2NX1A 1UWIA 3ZZ1A 2J74A 1EJ7L 1BF6A 4DF2A 1G1YA 3PBWA 5D9MA 2RGMA 3HG2A 2QCDA 4UTUA 2PLKA 6ALDA 5E0FA 5LIKX 4H2HA 2RUSA 1R3SA 4IGSA 3PWIA 4HJFA 3EPOA 4XBJA 2DH3A 5CG0A 2A7RA 1U5VA 3U9IA 5B7ZA 2BOFX 4KGJA 1P5BA 4NI8A 2E9BA 4F8XA 2E1WA 3BTNA 4PMDA 3OTRA 4C6DA 3DFPA 4X22A 5H8PA 1R3RA 3JR2A 1RD6A 2PAJA 4XX6A 1IGWA 4LBSA 3GU9A 1L2UA 2V68A 4EIVA 3S2JA 4ATWA 1XCWA 2C6QA 4NP7A 1MQQA 2GK1B 5CZTA 3V36A 3GDTA 2E9LA 3SCPA 4AZ5A 4DI8A 4D6JA 3ID7A 1IXOA 1QI5A 4FXRA 3T7VA 4P7NA 2OZ0A 2JIEA 1D2KA 4WJXA 4WEVX 1PSCA 2A85A 4AC7C 1R3VA 5F2MA 5B7YA 3HGRA 5DMMA 3WX7A 2INZA 3T55A 2W27A 3NVDA 1VYSX 3M0KA 1F5ZA 2ZTJA 3FHQA 4P8VA 1W3NA 2PZNA 2QVHA 1DORA 2YCKX 3H4XA 2G8ZA 3FFSA 3HQOA 4RZ6A 4CD6A 1DJIA 4CQDA 2I56A 1VGAA 1U2YA 2I7GA 3R11A 1DHPA 2E25A 1SFTA 4ZQPA 3ZIZA 3H55A 3DG7A 1SGJA 4NJGA 3FXYA 1DQWA 2HCVA 2FH6A 1XJBA 2X42A 3HO8A 2FZDA 2FPVA 2VENA 3E2QA 3ARTA 3VABA 3AICA 3BV7A 3OLDA 4N2YA 2JEQA 4PTVA 4QCFA 1X98A 2PDKA 2E8ZA 1WUFA 2BVWA 3QMRA 4JIQA 3WQ6A 2BDQA 3BH4A 3H4WA 2ZQ0A 1TJ0A 2R94A 5CZJA 3SO7A 4DBDA 1FXQA 1XGDA 3WK0A 5CAKA 1KRMA 4DBWA 1HP4A 1W9VA 5H8UA 1BXCA 1QI2A 5G2HA 4IOTA 1UQYA 4Z2KA 4XVDA 5KEZA 2CLPA 2PDXA 1SW7A 2VQTA 4ERGA 1KTBA 2CHNA 3N25A 5D04C 4XISA 3WJZA 1EF3A 1DWAM 1RY8A 3GNNA 1TVNA 1MEIA 2A79A 1QNOA 1KFWA 2BY1A 2XJ7A 3MZNA 4C7GA 1KM6A 4QE5A 3NCOA 2GJXB 4FIRA 2GSHA 4N7QA 1KCXA 4K1WA 4UXDA 4H01A 2PZ0A 4W7WA 1RP9A 4ICNA 1ZQ5A 1BVZA 3SRKA 1Y65A 4NAFB 4RE3A 4B16A 3O0KA 3D46A 1CXFA 2DPEA 3SFKA 2XN1A 5AYBA 3STPA 4R88A 5DMYA 3O6DA 2XINA 4H3DA 4PCSA 3VDGA 4RXGA 1G94A 1XQKA 4GC4A 2NQHA 5E9XA 4O54A 3N1AA 5DN1A 3GYEA 2O9OA 1L6WA 2XIIA 3FYYA 4QS6A 2J88A 1I6NA 3VD7A 4B3LA 3WF3A 2TMDA 4H8VA 1T8XA 1UW9A 1UJPA 3G6LA 2FVMA 3U57A 4YMZA 3BDKA 1BRLA 5C8BB 3D6NA 1WKDA 1OYBA 2GFTA 4JTHA 2A3CA 2WCAA 1EO7A 1BFNA 1ZCOA 3KM8A 1P0DA 3RX2A 2HDJA 4DWDA 2EPHA 1ECQA 7PTDA 1FWCC 2R8WA 4S3JA 2VHLA 3E5PA 2W9MA 1OGSA 3R94A 1IWAA 3G24A 3M5XA 1J12A 2RJGA 4IG2B 4AH7A 1H51A 4KRUA 4JDYA 4R9XA 1CW2A 1TVLA 3W7PA 3AROA 3A47A 1LROA 3F2CA 5GNXA 3MVTA 4JTTA 2WZTA 1EX1A 3SDOA 4YN5A 3GDLA 3HJEA 3S2LA 5HNTA 2OLHA 1H4PA 1ISZA 3VC5A 5CC3A 3T44A 2R9RA 1HKKA 3F4DA 4FZIA 4GOAA 3M41A 5FSEC 5HMFA 3W0KA 2WMJA 2YZ5A 1L2QA 1GGOA 2DUXA 3OGRA 4L4MA 2WSPA 3UG8A 3OYXA 1T5AA 1KFLA 3VZYA 4FMVA 1V3HA 3I4KA 3SECA 3GKFA 4PMXA 1VENA 2ZRZA 4IZGA 3WNMA 3QV6A 4S39A 4WUIA 3VKBA 5ECUA 1WV2A 3R8GA 3UR7A 1CXEA 1HKMA 5K3VA 2CNCA 1OF6A 3MBDA 3MTWA 3AMLA 1KLZA 2WWCA 3UERA 1JDCA 4HU3A 2VJXA 1H1NA 1NOUA 2BXZA 3M6YA 4NZFA 1KQZA 4BZYA 4DYEA 4US5A 3E2RA 3C8NA 4TVDA 1Q6DA 3THDA 2WSQA 4BEQA 1E9LA 1K9TA 4L4OA 3GZ3A 2XIBA 3KS6A 4D6EA 2REQB 5PTDA 2Z7GA 1A3XA 2E0PA 1ODUA 3W26A 1PWMA 3PZVA 3MHFA 2CBVA 1RBLA 3AC0A 4GHRA 3GVQA 4UQBA 2VEPA 4EP8C 3LCIA 3HU7A 3BLKA 3NQEA 4TU1A 3PC0A 3CZEA 3PZQA 4MJMA 3UWWA 3VDAA 4JKLA 3M43A 1TTJA 2EKGA 1R87A 2PF0A 3GUWA 1QW7A 1HL2A 3A9IA 3LPFA 3PS7A 3H4GA 4DJDA 1ISYA 1XPYA 4G7FA 1IXPA 4DM2A 4IH3A 4WDWA 1V3KA 2Y63A 4JTGA 3TOYA 2GDQA 3T0TA 1W54A 1ITQA 3CHVA 5FOOA 3IUIA 1PV8A 3TC3A 4TX9A 2PDFA 3PR2A 3CO4A 3M1ZA 3FJ6A 2RDUA 3U6WA 2XTKA 4DUVA 3MS8A 3LHYA 1PKMA 1TPFA 1VBRA 3B9NA 1Z9AA 2ZZ7A 1AJ2A 4MWAE 4CD7A 1MEWA 5D2YA 3GR7A 1VHNA 3MKCA 1XRTA 1KQYA 3KX6A 1G4PA 1OX4A 2ZUWA 3HN3A 4DAIA 3KWXA 3WQVA 1RCQA 3R8HA 3QHNA 4DLFA 1UOKA 4GH1A 3IJ6A 3ZVHB 3GFYA 2ZE0A 4JTCA 2CPUA 5AC5A 2CCRA 4OT7A 2VVSA 2VR5A 2ALRA 4IX0A 5CGTA 3KL3A 1RD5A 1K4HA 4WVXA 4J27A 3VIHA 1O4UA 2PUZA 3I7RA 1TPEA 1KKOA 3LOTA 3AI0A 1FA2A 3B8DA 1ME7A 4E2DA 4M1BA 2JEPA 2VUNA 1OHLA 1OM0A 4CNNA 4WLCA 2FB3A 2E40A 2NSOA 1R47A 4C6LA 1H1YA 2ZC8A 1MW1A 3SFWA 2TSYA 4X2PA 4KFNA 3N6QA 5DO8A 1MRAA 3SSJA 4O0ZA 4G7EB 2GSEA 1F4AA 3U2EA 5SWUA 1TZZA 1ZFJA 1BYDA 2G3MA 3UYIA 2QVNA 3HV8A 4TX8A 5LIXX 1GVIA 4MUZA 2ATSA 2OR2A 1QUMA 3R58A 3TN6A 1TMLA 1E0VA 1I2RA 1TJ2A 3LBMA 1OGBA 1T41A 1E6XM 3MY9A 3UZ5A 3ENLA 4IXHA 4LBRA 3BJTA 5LNSA 3MKVA 2CLFA 3BOFA 1DP0A 3DYMA 1SFSA 3QC3A 1PX3A 4Q8WA 1EWDA 1AG1O 1MSSA 2VM8A 5JBEA 3UA3A 2FTWA 3VNJA 4GY0A 4HK6A 1FWEC 3FJLA 3S3GA 3URAA 4CCZA 1LLOA 3GU1A 2GPTA 2I14A 3VKKA 1DIDA 3V3WA 3WF1A 1OINA 1IZKA 2DV0A 1RJRA 3SCOA 1QPOA 3PZMA 2BASA 1LBLA 1SW0A 5CQ1A 2X40A 2CLLA 2J27A 3WO8A 1P0EA 3PJTA 4PUJA 4B5UA 3ZT5A 3GYCA 4KERA 2PLCA 1KM2A 3ZLGA 4RV8A 3SY5A 3MWCA 2DT0A 1H7XA 1F76A 1QWKA 4QIUA 3GVWA 1EB3A 3EXSA 3K8MA 2VGFA 3TROA 1W9BM 3AYSA 1PKLA 1AH3A 4JN7A 2VQUA 3B03A 2OT1A 2QCFA 4OU1A 2QGHA 1UWTA 3BLPX 1HTIA 2WHKA 4IUOA 3IUHA 4H8NA 1J96A 1V08A 1Z3NA 1BTCA 4IQEA 3UXDA 4UNIA 1GWJA 4H6KA 2BGNE 2WHMA 4L6HA 3W1QA 1ISVA 3UJSA 3GRIA 1OFAA 4YS1A 4Z0SA 1EQCA 4KFOA 4OKDA 1P43A 4KFPA 4BI7A 4M3PA 1VRDA 1E1CA 4GCAA 4RNJA 4LVDA 3LDVA 3VX1A 4NJJA 4WKAA 2VEMA 1JXJA 1DWGM 1HNYA 2IKHA 1V79A 3HGJA 5AYIA 5KITA 3IJ7A 3RX3A 3M9YA 3OOQA 4JTJA 3FYOA 1EYEA 4GINA 2DW7A 3WLSA 3EX4A 3AHXA 1V0NA 2YB1A 2R91A 2WYSA 3IK4A 2DT1A 3MCOA 4A4AA 2XSBA 5MKGB 4CNOA 1LP6A 4GZEA 1V93A 3CJPA 3WLOA 4XTIA 3BSHA 4O1AA 1BVNP 1BF2A 5BZAA 5C7HA 4JL2A 3TUUA 3JVAA 2PLMA 1UH4A 3W75A 5DT5A 3MDUA 2JBMA 3WL0A 1WX0A 4GK8A 3I68A 4I9JA 2PRHA 4PUDA 4G5DA 4PUEA 2E8YA 4GRSA 4PTNA 1K6AA 1O66A 1FDZA 1OF8A 3W1UA 3B05A 1RR2A 5CPTA 3W22A 1IT0A 1VF8A 2VDIA 1E6RA 4Y9PA 3EDEA 2ZCGA 2VT0A 3W84A 1E4MM 1ZJHA 3LCWA 4FOJA 6TIMA 2CERA 3HPFA 3ZQ9A 1GZ1A 2G0WA 4BY3A 3U0HA 3WMSA 4HVXA 1KV5A 1YEYA 1G5AA 1PCWA 2D23A 5DQPA 4EPBC 5C2XA 3AIVA 3CB8A 2JKPA 1NAL1 1OFPA 5CPNA 3KTXA 5I02A 1KLYA 4GNJA 1ITCA 3G0XA 1J6PA 1W8SA 1S2WA 2PFHA 3WQCA 2A3LA 1HKJA 4UNLA 3WDHA 1P6BA 4LQ1A 1LWIA 4RZBA 4C91A 2Y62A 4R7OA 2IKIA 2O55A 1YPIA 4LCRA 4A6GA 5BRQA 4IPLA 3CQIA 4PN2A 1WBJA 3M7SA 1GOIA 2VGGA 4LY8A 3K1GA 3BCJA 3CS2A 4J3UA 4J3SA 3ABXA 3FN9A 5I23A 2YCJA 2PC8A 4YIWA 1P0KA 1EZWA 3ZFHA 2XIQA 3GHSA 2OSWA 1AMYA 5CPOA 3RO8A 1XIEA 4OV9A 4GFSA 1NSJA 4UOJA 1J0ZA 5T8GA 2DW6A 1K7EA 5ABFB 4UCFA 1E6QM 2QV5A 5GPRA 1UH2A 3KS5A 2C1GA 4FNTA 4O1FA 1U1UA 2BG5A 1T0OA 3AS2A 5D4YA 5FJIA 1AL7A 1W5PA 4MMWA 4WKFA 1F73A 3BG3A 5BRPA 3S0CA 3AOFA 2FPYA 2GJLA 4EANA 4UQCA 2G97A 4PYSA 3GG8A 4YCOA 1EEXA 2J77A 3FV9A 1V02E 3OBEA 2VR2A 3I7SA 2R82A 4H7ZA 3CMJA 4ZODA 4IP5A 4HA1A 1SJCA 4XD6A 3S5YA 2X09A 4AVOA 3MUAA 1RJQA 4BQ2A 4F0HA 5JUVA 3VGFA 1C9WA 1WYIA 5FKYA 4RE4A 1YNQA 1TE6A 4RK8A 1X7FA 3WN6A 3DENA 3CZ8A 1C90A 1JYWA 3URQA 4E2OA 3DGBA 3QJAA 3WK3A 3GNPA 1NP0A 4WY0B 5DCDA 2PDYA 2VO5A 3O16A 1FWBC 1O1ZA 2PDNA 1TQXA 4MHBA 4TO8A 4RCXA 3BMVA 2YL6A 1A80A 3HQNA 3I7QA 4CNTA 1VAHA 3QKZA 5CXPA 3QF0A 5CJ5A 3L66A 4KH2A 2GDVA 1DXIA 4PRWA 1Q6OA 3ARZA 5D9OA 3CTLA 2ZC1A 5J5RA 4JTUA 2BVYA 5EMMA 4NZ3A 2GWGA 1QI3A 5HUPA 4A8IA 2J62A 4RZ5A 4GI6A 3REQA 2WZHA 3TC6A 1OT2A 4Q8OA 4CD5A 3OLGA 3H2MA 1FFRA 4O17A 1SFLA 3POCA 1M1BA 3HGOA 3C2VA 4DELA 2Z28A 4REQB 4B4FA 2HISA 4G8TA 2QUMA 3QGAC 1F7BA 4RX0A 2AOSA 4QNWA 5KZEA 3A4WA 2VEGA 3B0VC 3VZXA 2OQHA 4Z1AA 1OT1A 3UWYA 3W1PA 3TYEA 1GHRA 1L6SA 4DX3A 3OZMA 1FWRA 1EJUC 1WKFA 4W84A 3RR1A 1DJQA 1E51A 4XZ9A 5CPQA 1YXDA 4Y9MA 5C9UA 3CIXA 3SN0A 3XIMA 5AZ1A 4LWWA 4QAIA 4UFIA 4MZ8A 3RLUA 4LH8A 5BOFA 4MKNA 5GNYA 3ZSTA 2OU4A 3AIQA 4LF2A 4P7OA 3ECQA 3V7PA 2X0SA 3A4XA 2DJXA 1OYAA 1CGVA 3EOSA 3L21A 3L5LA 4FOKA 4GH3A 3CL6A 3EMZA 3Q67A 2E77A 4IISA 3ZJKA 3IAQA 3RU6A 1EUNA 4P7RA 1RSCA 7REQB 2ATMA 3TLLA 3FOKA 3MI2A 4CKQA 2TAAA 2DIEA 5EMUA 1UR9A 1M03A 4LAKA 5BXRA 1GG1A 1GOOA 1TE1A 1DE5A 3HG5A 4MLJA 1Q8JA 4D72A 3MPGA 2XISA 3GIYA 1IGSA 1OWQA 3S2MA 2EQDA 1BSLA 5A69A 1TUFA 1AW1A 1AODA 3K4AA 4K7VA 2RDXA 3ANYA 4NX5A 3F5LA 4DLMA 1GOKA 3W6MA 3NYZA 5HDRA 1DVJA 4UTWC 4Q8MA 3WBWA 5CBJA 1QK0A 3BOLA 4CNUA 5GQBA 5A6MA 5CSSA 1KCZA 1V6UA 3WD0A 4MOZA 1PZ1A 1UH3A 1B3VA 1T8QA 1JQXA 1DQXA 1C8XA 1FWSA 2NX3A 1CT5A 1LUCA 3THCA 3M0LA 3W2UA 5LSMA 5H2ZA 4PUUA 1CX9A 3EDDA 2WK2A 1HJVA 2X1RA 3A9BA 4IFKA 1SJBA 1EC7A 4MNJA 2RDWA 1BD0A 3A12A 4HTBA 1H11A 4ZQCA 2VFFA 2DQWA 4OOZA 1E0UA 4IL0A 2YL8A 1MYRA 1RQEA 1AUSL 3FEQA 2ZUTA 1RH9A 4YYCA 1BYBA 4DPPA 1YPXA 1JPHA 1WKEA 1X96A 3RRAA 1E6PA 1AFSA 2VC9A 3NQMA 4J4KA 2XUCA 3T0DA 4LVAA 4FLOA 1PCKA 1EL3A 3ABSA 4DZHA 4XBSA 4IMDA 1CLKA 3WJYA 3CUHA 4F40A 2F8QA 3LBCA 3VC6A 1HKVA 2F61A 3L23A 4AUBA 1TV8A 5C2GA 1VCVA 5CLWA 1BEUA 3ZXWA 3BGJA 1GOWA 1AH4A 2D2GA 3DG3A 3I6RA 1G69A 3WLJA 3AWOA 4QXIA 3U2OA 3BGGA 3E12A 3AUJA 1QFEA 2Y8KA 4TOQA 1ONXA 4LCQA 4J35A 3WQDA 2BOEX 3HPXA 1U1JA 3J7HA 3CC1A 4PB3A 1VP5A 4C1NA 2WJDA 2HVMA 4HPNA 2WMIB 3QTGA 2CFFA 5HMEA 3ZMRA 4HPHA 2X7VA 3VD3A 3WG6A 3WLQA 1EDQA 2AL1A 3R1ZA 2IS7A 3VIPA 3A23A 4D6GA 1O5KA 3NPWA 5AHEA 3VIKA 4B4HA 5XINA 5LXEA 3N13A 4Q8PA 2VOMA 2R1MA 3QYQA 2KAUC 4AG0A 4JHMA 4NASA 5D8ZA 3AXIA 2JE8A 2OGYA 4Y9OA 2DZVA 3AZRA 1NTHA 4UTTA 1XBYA 3F03K 1I75A 1Q4WA 2WKJA 3CV6A 4XAGA 1EOMA 3W71A 3QTPA 3PBYA 5CAHA 2Z1WA 1GYNA 3S5ZA 4N9CA 1J0KA 3VOGA 3WDPP 1PHQA 5D32A 1HL8A 4XUYA 2J8FA 2X8RA 4OUIA 3IVSA 2GJXA 3TAOA 1H3GA 1AD1A 3WEZA 1MUCA 5BCAA 2PCQA 2GUYA 3WDIA 4E8GA 3NJ3A 3HB9A 3BANA 4QP0A 3W7RA 4XO6A 2OZ3A 1V8EA 1UR0A 3RLHA 1EH9A 3G8RA 4CN4A 3Q94A 1FDJA 4LXFA 3T6CA 4HB7A 4HA3A 3W76A 2PS2A 1E0WA 3DC0A 1FWHC 4M6VA 3E49A 3CQ0A 3QPZA 4Q4MA 3EXRA 3CUFA 4K39A 2JALA 3VGBA 3C2RA 1GEQA 2PRLA 2DP3A 2CHOA 3MP3A 2R1NA 1P6WA 1V3MA 4XUGA 4JDBA 5D30A 2DEPA 3LENA 4JTFA 8TIMA 4QM1A 3CNYA 5HJYA 2XIJA 4DJDC 1VPYA 5XIMA 2HNEA 3WF4A 1EJVC 1FH9A 2ESCA 1LQ2A 4UQAA 5IBXA 1Y7VA 4GIYA 1H7NA 5KTLA 3AS1A 5D37A 5TBOA 1XPGA 3CPGA 4JBRA 1Y0EA 4H7CA 3AU2A 4D8AA 1AQHA 1XLMA 3W74A 2J6VA 3FJ4A 1KD0A 5REQB 5A8OA 2I1OA 4HHPA 2XFRA 2EJAA 4GUJA 4JX4A 4HJWA 3W1XA 3DI1A 3QMSA 3BZJA 3TYZA 3HJZA 4H4IA 1SO3A 1TWWA 4UTIA 2VXNA 3PN8A 1CWYA 1XC6A 3WJXA 1RCOB 4DF1A 1HVXA 3L0GA 3A24A 2WAGA 3ABZA 1WCGA 3FEMA 4MGGA 2X1IA 4U31A 3MP5A 1A49A 1UC4A 1RY0A 2FB2A 4E8DA 2EAWA 1RA5A 3ZYZA 1EJWC 3VD4A 1RLDA 4HMCA 1XYZA 2MANA 2PTXA 3EB4A 3TFXA 4FXFA 3EKZA 3V18A 1A4LA 2ZX8A 3EPMA 4A3QA 4Z2LA 4WD0A 1EJXC 3GO2A 1R9ZA 2WMIA 4KEUA 2VZSA 3TTOA 2VFEA 1DOSA 2FLIA 2WB5A 4ZO9A 4ZOAA 3EEGA 3LB0A 4LYQA 1XLLA 1B3XA 1VEPA 1TMQA 2CLEA 1P1MA 1SZRA 1XH2A 1YW1A 4HU8A 2C0AA 4DJDD 4CD4A 3T4CA 3CBWA 4EK7A 5EMKA 2UY3A 1W3IA 1IEQA 4MJZA 2Z25A 2J7FA 3B8VA 3CUJA 4ZSUA 2VFIA 1XLDA 1J93A 1X6LA 1UZ4A 3TONA 3GG0A 1T7LA 3VNYA 4ROPA 3AZTA 4ONVA 2ACQA 1F2JA 3WCZA 4E2VA 1QPRA 4PRTA 4R27A 4DPQA 1RZMA 2J66A 4JIIX 5HOSA 2VZOA 4W89A 1XM3A 1JUBA 4Q4OA 1M41A 1PTGA 4NAEA 3AZSA 5JIPA 2ZA1A 3MV11 3IGHX 1YRRA 4GQRA 3SUTA 2DZXA 3WLHA 1XYMA 2BV9A 1A5LC 1KGXA 1ZPTA 4F0KA 3GXDA 3P5YA 5AN7A 3RPTA 4TMCA 1ZJIA 2ISVA 4LUSA 2WNZA 5EMYA 1KXQA 3F1QA 2H9AA 3UWZA 1ADSA 4Y7EA 1I2QA 1BVWA 1JZ7A 3ES8A 2R6OA 3P0XA 4QQ3A 3WFZA 4MTVA 1U33A 1IR1A 1GHSA 1NFBA 1HFBA 1UP0A 5HA7A 3NL2A 3NQ8A 1MW3A 3PSVA 1ZJBA 1E72M 4Q8UA 2J8GA 1W1B1 4F2TA 2ZVRA 5H91A 5BNKA 4DWSB 1FOBA 2DDXA 3PWAA 1PEZA 3W24A 2C8NA 2Q01A 3UGRA 4ZOCA 2B7PA 4UMBA 3W2LA 3BC9A 3NQAA 4NYYA 1PTDA 8CGTA 3WD2A 1V3JA 3M44A 3FDGA 3HF3A 1UWAA 1WDPA 5G4HC 3L4ZA 1QI4A 2C13A 3AHVA 4AWEA 4OZOA 1IXQA 4JQ4A 3GKAA 3ARXA 1Y5WA 3PJWA 1DWJM 3PUOA 1Q6LA 1NDVA 3JUGA 1FY6A 2W4XA 2DUAA 1XRFA 4Y6GA 4RE0A 4KETA 6ENLA 1SUXA 3GNRA 4W4QA 5A1AA 1E56A 3P5ZA 3WQ4A 1MMFA 5HJLA 3T42A 1HX0A 2AL2A 3IGXA 3ME3A 4DXXA 2OKTA 4EOUA 3EX2A 4QG6A 3EWWA 1ONWA 1K3UA 1MZHA 2BX7A 5HPCA 3IIPA 1LWJA 4O10A 4JX5A 1HGWA 1JZ2A 2GGHA 2PTYA 1WZAA 4NRSA 3NZGA 3G1FA 3FXGA 4PB5A 5AB3A 3ANVA 1EC9A 1ZAIA 2PD9A 4NZJA 4QEHA 1BG4A 4MLRA 2YLAA 3SCWA 3HBLA 4Q7NA 6CGTA 1SPQA 3OQ8A 1W1ZA 4HT3A 3RMEA 2YA0A 3R5EA 4K8HA 4Y9AA 1XLGA 3N2OA 5I03A 2XSXA 5I3GA 5CEWA 4BHYA 2Z2UA 4XD4A 2CLKA 2CBJA 3APYA 3G2GA 3LV5A 5K9DA 3WQWA 1P0NA 4RKAA 5IHRA 3PZIA 1MUMA 4C6CA 2VEFA 3PSWA 2EPKX 4DZIA 4MZYA 5G1MA 4TQTA 2YOCA 1LYXA 4FK9A 4O28A 3QOKA 1JYVA 1ZGDA 1VC4A 3R0KA 3NO3A 4B90A 3C8FA 3EGJA 3U3HA 6REQB 2XH7A 2VZUA 3AU6A 3GG7A 3UYCA 3P93A 2PGFA 3QZ6A 3A5VA 3AXKA 2OLSA 3UNDA 2ZVIA 1XH1A 1G0CA 4BCEA 1JR1A 2DSWA 3CUIA 1UD3A 5DF0A 2VZTA 1JZ6A 3AYVA 4AX6A 1P7TA 2TPSA 4JQ1A 4ZQMA 4KQNA 1EKOA 2XM1A 5G2WA 3UCCA 4HSHA 4MZ1A 3STGA 3E1F1 4ZMGA 1HGYA 1HJSA 3OVQA 1JDEA 3FKKA 1BG9A 3L65A 1W1YA 1WP6A 1V0KA 3AIUA 1H49A 2NUYA 1BSIA 4ML9A 2Z1BA 1IZJA 1W1PA 5FAJA 3ATYA 4Q7BA 2YL5A 2X2GA 3QQ0A 1TPH1 5LA0A 1DJZA 2PODA 4XZNX 3O63A 1LG2A 3G0SA 3B9DA 3H23A 2DSZA 4X0NA 1ZP4A 1D8CA 2ZXBA 1IT8A 2X1UA 5D03A 1EIXA 4BI6A 1KGWA 3R2GA 3CXOA 2OOGA 1EO5A 3WEMA 1JGMA 1RALA 3WH9A 3IWPA 3IJ8A 1HJWA 1JAEA 1E3XA 2PSNA 1VIWA 3LHWA 4KMQA 2Q3RA 4AHQA 2YDQA 5CC6A 1S2CA 3KVLA 1IYXA 4Q4PA 4UTLA 1H63A 2AMGA 1W3LA 1E4LA 3DFOA 1TRIA 4HCDA 3BLEA 4TX6A 3WLNA 5JVLA 1C8YA 4JIHA 5DBTA 4PB4A 2BFGA 1OABA 4A3YA 4X60A 1ME9A 3L4UA 2BWGA 1UWSA 4G7EA 1Q63A 1TR1A 3W7HA 3HM7A 3AXXA 5DXYA 4KGLA 1NH6A 5F2LA 1KC7A 1YDOA 2EJ1A 2OX4A 4NT0A 5JU6A 3H2FA 3TN4A 5BXTA 4IFOA 3U7VA 3DFHA 4XD5A 2Z0IA 1GVQA 3N9RA 4IJCA 3W88A 2J25A 3NQGA 4WY0A 1LOLA 1JCMP 3UWEA 2DSUA 3M4HA 1XCFA 1GVYA 3IJIA 1IWPA 3WYZA 1OGGA 5AYYA 4FXSA 3IV3A 3OIXA 3BAJA 4Y8FA 2PCEA 2QPUA 2QV4A 1MRQA 1F3WA 3CYVA 1MO0A 1XLEA 2XHYA 4PUWA 4LPCA 3TCSA 3NXFA 3OA3A 2YL9A 3F4CA 1K4GA 4WXZA 2ZRWA 4IT1A 3OBKA 3GW3A 3QR3A 4L4LA 5LNVA 3I3EA 1RUSA 4LT9A 4AFYA 4WOZA 1TVPA 3CLWA 2E9MA 5M3WA 4C6BA 2BZNA 1EGZA 3EOLA 4MY9A 3W7NA 4HPGA 3AYTA 2VR4A 4W8LA 3WLKX 5K2ZA 1CCWB 1TFVA 3KOZA 1AZ1A 2EXOA 3EX3A 2FVKA 4MWAC 3W83A 2G95A 3P2VA 1IF2A 1C93A 2WNNA 3LU2A 2V2CA 1XX1A 2HVOA 3NM3A 5CPMA 5ABHA 4LALA 1ZHAA 4UBPC 3Q65A 3UJEA 3LZ5A 3CUGA 1SSDA 3V5CA 5TNVA 1PHWA 1J0IA 5FF4A 3OLIA 4HOZA 3GXIA 1YX1A 4LS2A 3MUY1 1SR0A 2C0HA 5IM51 1YDNA 4K8GA 3IVUA 2ZE3A 4I9AA 4UOQA 1OFOA 1LF1A 3GIPA 3MZ2A 1X7IA 2RH9A 4M82A 4ZGYA 4LUJA 3G1DA 2VZVA 4UUIA 2WHJA 3W82A 1QO2A 4OJYA 1RBAA 2VP8A 3EB2A 3LG3A 3UESA 1E71M 2XYLA 1KCKA 3CIVA 2HVNA 3D3FA 4JHZA 1JFXA 1NM9A 5DMNA 3B9AA 1DTNA 2XFFA 5J8LA 4PFMA 4HNCA 1Q6QA 4UTFA 3WEOA 1ALDA 1FTXA 2NWRA 2PTDA 2VTFA 4ASTA 4DWSA 4HN8A 2W62A 2W92A 3PUGA 1REQB 1S2VA 4E8CA 4BF7A 4ZB2A 3QHMA 3SAZA 3JS3A 1DIOA 2W91A 1TV3A 4Z1DA 2H90A 4UR9A 3CQKA 4M8UA 2FZ8A 2HXUA 3CT2A 1UKTA 1A5UA 3TSDA 3NXLA 4U4MA 4RR4A 3A22A 2AAMA 4AEEA 4ZL1A 3NO1A 3ITCA 5FF3A 3KZSA 1ZBCA 1L8PA 1S38A 1CYGA 3WMCA 5A6LA 3F7JA 1LQ0A 4C6MA 3ZWSA 5HR6A 2X1SA 4GVFA 4BS0A 1J0HA 3EWDA 4L80A 4C6KA 4LEQA 3RK8A 2E6FA 4OOUA 1S5VA 1VFMA 1T40A 4FR1A 3PZOA 1Q6RA 3EKGA 1ITXA 4FNQA 2X30A 3A64A 4ACZB 4X9SA 4NXSA 3BMWA 3KCLA 3QEZA 1WZKA 3E0IA 5C6MA 1B5TA 1NWUA 3STFA 1UUMA 5RUBA 1BKSA 3LRLA 4WCJA 2R14A 5I0DA 5MKGA 3STEA 2HK1A 2QUVA 4ES4A 4N9BA 2C71A 5D2VA 4AEOA 1R3WA 2W79A 1A3WA 3CWHA 4HNLA 2Y85A 3LMZA 5E6YA 2J8TA 4CNSA 1K1DA 5H6HA 3C0QA 1MI3A 2WMGA 2Z29A 3MSGA 4YVVA 3TYAA 4WXYA 1DHKA 3OHIA 2ZXDA 5I6SA 1HJXA 2ZX7A 2VURA 3IRSA 1LBFA 2GYIA 1YIXA 1WE5A 2PWHA 4C6QA 3WELA 5ENLA 4F9JA 9CGTA 5DANA 1X97A 1BWLA 2QDHA 3VMNA 3W7DA 2OXNA 3GH5A 1ZNNA 3APTA 4KWUA 3RDKA 3PTMA 1V6XA 3ABRA 1TREA 2QCCA 3VMPA 5FEXA 3HQ1A 3QY6A 1XDLA 2FJKA 3C0SA 4AIBA 4BQ3A 3AS3A 4TV6A 3PP7A 2WPBA 3UGVA 3GNDA 2VCCA 2V3FA 3NFUA 1GJPA 3KXQA 1H7PA 5LYRA 4Z08A 2WZIA 2XH2A 3PZTA 1Y5XA 2OEKA 1BPLB 2GVLA 2NV2A 1TO3A 1A53A 1WOBA 1QR7A 4L6OA 5M5DA 3SRFA 2OX1A 4XKMA 1Y8BA 2EF9A 2HBXA 5A6SA 2O9TA 4UFJA 3ARUA 4PBGA 4U3CA 3JZUA 1FHLA 1ZZMA 2PF8A 4JY9A 1NWTA 3LSBA 3SCRA 5A6BA 1KB3A 3DFQA 2NV9A 1KW1A 1TTPA 4I7VA 4HOXA 1O5XA 1PUDA 2HXTA 4PZVA 4W87A 1VR6A 4J3XA 2C79A 3QSRA 1ZBWA 3SIMA 4RL3A 4DXKA 4ERAA 4J7RA 3VCRA 1EQPA 1BGAA 3TQVA 2V0TA 2XN0A 3B8IA 1XKYA 3FS2A 1C92A 5KINA 3LMYA 3ZS4A 3EA1A 1HQTA 5T9CE 2NXGA 3CYJA 2VFHA 3QR0A 2JIWA 2WZEA 2VL4A 5I78A 3KL5A 1KRAC 5FJTA 4GVHA 3KOXA 1S2TA 4NJIA 3BG5A 1H5YA 3GR8A 1ELSA 1HG3A 1TPB1 3P6LA 1DQUA 2MNRA 4GIAA 4YNGA 4F0SA 2A3HA 3VGGA 2IPWA 2Y8UA 3BAKA 3ZLFA 1QDSA 3MO7A 1TTIA 3F2BA 3FGCB 4G1NA 3MSRA 3BVJA 4UCGA 4O1BA 1F3EA 1I9CB 4US6A 2J7CA 2XSAA 1KRCC 3BAIA 4U28A 2IPGA 4GCXA 1E9ZB 2A6NA 4EAYA 5HBFA 2ZRXA 4CVUA 3GC5A 2I16A 2YXXA 2EBNA 3MB9A 1KGUA 4RW5A 1H60A 3RX4A 2V2HA 3ANUA 3VE9A 4NUWA 5AOUA 4KWOA 3NOEA 4IMFA 1OB0A 4HMEA 1U30A 4TVCA 2NUXA 2Z7KA 3R25A 5A8MA 1XLFA 4JFVA 3VZZA 5AZ0A 3JW7A 4J5NA 2NSXA 2ZRYA 3W07A 3CU2A 2F7FA 4AZGA 2IXUA 1L9WA 4BWLA 3Q4DA 2PPGA 3GVGA 2PDJA 4GD0A 1DWIM 5FEPA 2NX9A 2PDCA 4K36A 2B81A 1H09A 5ABGA 4ZR8A 4B15A 4ZFCA 4XVEA 3GTIA 1L6GA 1DV7A 3L5MA 3MMWA 5G1YA 2DSKA 3DHUA 2QDGA 4O15A 3DZ1A 1JPKA 3T08A 3ITTA 2C15A 4CQAA 2X0YA 3VMOA 2Y5SA 1I8JA 2HS6A 1YYAA 3TZFA 4QSHA 1SSGA 1HJQA 4GFIA 1UKQA 2PBGA 1ME8A 4A2RA 2ABBA 4MWAB 4HP5A 5AY7A 1F8IA 1TJ1A 3LV6A 1OG6A 3IUDA 5J5DA 1FQ0A 5K4ZA 4LRTA 5M03A 3B0YA 2ZDRA 4K38A 3VE7A 2DUZA 2FIQA 4LUTA 1MEHA 2Z1VA 5EB8A 4J9JA 4GYKA 1S1PA 4AB4A 1R3TA 3MP4A 1BYCA 4UFHA 2HWGA 1TPVA 4D71A 4FNRA 3S83A 1IEVA 5AVNA 3CUXA 4I7WA 2D0HA 1HO1A 1F74A 4Z2HA 4GNVA 3UVAA 1T96A 1TJRA 1QMLA 5ABFA 4GJJA 4P8WA 2IQDA 3QLLA 3FCPA 5EL1A 4NILA 2PWEA 4JTDA 4CU8A 2GQ9A 1YDYA 3WLLA 4RPPA 3B8UA 1FUYA 1PZ0A 1I60A 3DUGA 4N4QA 3W85A 3N9KA 5F4XA 4QLKA 4DYJA 2PDGA 4WJ8A 1CXIA 5CPLA 1KXVA 3NEVA 1WB0A 4O11A 1J0YA 3P8IA 4OQVA 1TA3A 4LYRA 1VLIA 4H8HA 4LF1A 3VOFA 5ABTA 1QWGA 4P7LA 4JR5A 2ZKMX 5I24A 2L5HA 4QG8A 4XSMA 1OD8A 1AW5A 2XZ9A 1Q66A 1IIGA 4HZ6A 1JCLA 2E1DA 5CGMA 4G1KA 4CUCA 1FCQA 3WLPA 3UW6A 3NSMA 1W0MA 4O50A 1P4CA 4YXGA 3TJ4A 2V6AA 3VOIA 4E5TA 2FHBA 4YJ5A 3TN3A 2ZZ5A 3NZPA 1M7PA 4HNOA 3UXIA 4CN1A 2G3IA 3OJGA 3MU7A 2YB4A 2HEJA 1M01A 4N6FA 3ONBA 3T8LA 4QLLA 4F0MA 3VIOA 2VVNA 2X7WA 3IIXA 1O7AA 2OYLA 1ZL1A 1GJWA 4LV4A 3WDRA 4Q32A 3KBSA 3N4EA 4AWSA 1OD0A 4PCNA 4H2CA 3B8SA 3BUVA 1UWQA 4X63A 3OZYA 1VZWA 1J11A 1GQKA 3SCUA 1D3HA 3NPXA 4FO4A 4O4VA 5AC4A 4GMEA 1QASA 1KTNA 3IGUA 5GJPA 4ECLA 3P81A 2RJHA 2D2OA 4OV4A 4GKLA 3V75A 3H54A 4UZSA 3T0BA 1R8LA 4JQAA 3AIEA 2J7GA 5FL0A 4UQDA 4G56A 3PG8A 1FCVA 1UD4A 5I3JA 2ZWZA 3GWQA 3ZR6A 2ADAA 4DM1A 3LRKA 4QTGA 2OMAA 3CHFA 4DBEA 2GGEA 7CGTA 3LERA 1YE4A 5HQLA 4NL1A 4HMNA 1RPKA 4HNTA 1VIZA 5L6UA 4ZE5A 4DQWA 8A3HA 4CCDA 3RIKA 2QPSA 3QN3A 4DJFD 5G4EA 1PE1A 2JKEA 1OIMA 7ENLA 1EJRC 3WBEA 3SGZA 2VMFA 4ZENA 3PUEA 2A5HA 2HTMA 3SUSA 3SSZA 1FP9A 3CAQA 3I6EA 5C54A 4Q6JA 3FA4A 1ADDA 1XYCA 5A94A 3UXAA 3N18A 4KWWA 4AWUA 5LIYX 4IMGA 4JOMA 4S1FA 5I06A 1HW6A 3SJ3A 4F2UA 4RPQA 4V27A 2POTA 4FF5A 2DT3A 5U7SA 4QR6A 2DIJA 3OA5A 5HQMA 5HXMA 5AYXA 5DT7A 1PX4A 2DZBA 4ALDA 2CBUA 3HG4A 3RJXA 1UBSA 4GQ0A 4DJED 4C6NA 5F2IA 4Z0JA 4AHOA 4TTGA 4KPLA 2NLIA 2V3DA 4Z42C 2HE8A 4OGZA 1VBGA 3V5FA 3N2MA 4BKNA 4JL1A 3KDOA 4E4FA 2IQTA 4H6RA 2D69A 3HURA 1UP3A 4QSFA 3SM0A 3GM8A 4EWJA 2VWSA 5IDZA 4BF5A 4L9YA 3CZKA 2VCAA 5GJNA 3ONCA 1P6CA 3M64A 3O1NA 2PMQA 2VX5A 3GW0A 2Q8LA 1RK5A 4O1DA 5AHIA 5FA5A 3AHTA 1ZJAA 1ADOA 4DO4A 2YCLB 3BAXA 1KWKA 5HMDA 3N14A 1NFGA 2XDFA 4C6OA 1MNZA 1BQGA 1VFFA 2XVPA 3RLVA 3QQ1A 3I3BA 4A05A 1GW9A 1NF7A 1W5OA 3LXAA 1FH7A 3WUGA 1IEIA 4DZ5A 2OT0A 4H9VA 1JRCA 4B2DA 1Q2SA 2WC4A 4P2VA 2V3EA 4QROA 5I3DA 2Z1KA 1QNVA 1SZNA 2F6KA 4WKHA 4N02A 3LBOA 3IACA 4MB3A 2VNCA 3A3XA 4L65A 3EWUA 4JNMA 1UIOA 2G3JA 5IFTA 3T2PA 7TIMA 4WX2A 1NOFA 2R1LA 3H7RA 3AWNA 1KKRA 3TMLA 2H6RA 2VGIA 4ICCX 3AYRA 1W1TA 1XBXA 4M19A 4PMUA 5C70A 3REQB 4KESA 4L9ZA 4YWIA 3NL5A 3P60A 2Z24A 3VCCA 2I5QA 3PPCA 3RJYA 1TX0A 1JGIA 3M16A 1OC7A 3FAXA 3TJIA 4D1IA 2A7NA 2PA6A 3O9NA 1VBJA 3WBYA 4PSPA 4MADA 3IRDA 1PWLA 3SJNA 3EDKA 3WNOA 4CGTA 4FIQA 5DCBA 3G1RA 3DEQA 2PU0A 1DIKA 3TX9A 3C0JA 5KZDA 2D1ZA 5CSUA 4V1YA 4HSOA 5G5IA 3ALGA 1A5BA 4V15A 4EXAA 1W1VA 2Y7FA 3FAWA 1DWHM 5D9NA 5HULA 1DE6A 3OPSA 3N2XA 1BQCA 4H41A 3ITXA 4JTKA 2EPOA 1UMYA 1V0MA 3FHAA 4M29A 3KVKA 5CC5A 2PWDA 3M0MA 4XG1A 3GR4A 3MC5A 4PBFA 4JHOA 3WFLA 1VPQA 3LNPA 4AAJA 4Z1YA 1VFTA 3MSDA 4MDOA 5DFAA 3VOJA 4LBUA 5E93A 3B0PA 4RLIA 3WQOA 4NG3A 1EP3A 3C86A 3PPGA 4WK9A 4N42A 4O8RA 2FPTA 5HNNA 3STCA 1GQJA 3VNZA 4YCPA 2BSLA 5EKYA 3B8WA 2A2IA 2QPXA 5A3HA 3G18A 2O7QA 1L6FA 2ZZ2A 1RQHA 1X1OA 3ARRA 1OCJA 5DX7A 1DTUA 1VJZA 3NWRA 1MQRA 3W81A 5F1UA 4F0RA 3QW4B 4R9OA 3GS6A 5BOEA 2J13A 1NFPA 3MYPA 3IANA 3PJUA 4DZAA 5A5WA 4L1GA 4L64A 2NZLA 1JFHA 2QCDB 5TAOA 1J6OA 2KZHA 3A4JA 3GFZA 3LLXA 2XH4A 4LEFA 1CIUA 4MFDA 2H8ZA 1WXZA 2ODOA 4DNHA 5FJRA 4IQLA 2WCSA 3CV1A 3WZ0E 4HZ8A 2GVYA 3O05A 3VGDA 4BR1A 4ZQNA 3GFXA 2OB3A 1MXGA 4E2BA 1ZAHA 1VD6A 2NQZA 1B4KA 3P61A 2YA2A 1PVNA 4JNZA 3LHTA 4PULA 2XN2A 1W5QA 1JD9A 1XDMA 3BW3A 1M7OA 4EKJA 2ACUA 4HPJA 1IT7A 3NDOA 4MSSA 2AL2B 4D2JA 1R2TA 1B30A 3LM3A 5DRCA 1GTHA 1IV8A 1EBGA 3WNNA 3E9AA 2QHAA 2VUYA 3UXKA 2YXOA 2Y6ZA 2ALDA 4AIUA 3AHYA 3DFSA 4HBKA 1JI1A 4H9YA 5A2CA 1D9EA 2VKZG 3BW2A 3SUUA 5BMXA 2QDEA 4UC5A 3DX5A 4YVXA 4XBKA 1QOQA 3VO0A 1YDVA 4HD5A 6XIAA 4K2SA 4O16A 4UZUA 4NI3A 3FSUA 3VDHA 3N2CA 2YX0A 4GNKB 1EHAA 1EA9C 4JCMA 5AVHA 2NT1A 1QI0A 3L0NA 5JBDA 4AD1A 4GZJA 3N19B 3ITLA 3TLQA 2DT2A 5EPDA 2VYOA 2VOTA 5KSWA 1ZU8A 2UBPC 4URIA 4AZBA 2Z6IA 4ZCWA 1GVRA 4JTAA 5BWAA 2RKXA 3OZPA 3VIFA 3EOOA 4OECA 6XIMA 3TOPA 2HV5A 3BCDA 5EMJA 1XFCA 3VU2A 2TODA 4H9XA 1R2RA 5FI8A 2CITA 4QX4A 4L7ZA 4HZ7A 4NNCA 1X38A 3VIMA 2EKCA 1KBJA 4LAUA 1E6ZA 5FESA 4AMCA 2YKKA 1OFRA 5IRPA 1AH0A 4FI4A 3TQ0A 2Q02A 1QHPA 3QFEA 4JXCA 1VEOA 2PLJA 5A2AA 1N8FA 1I0BA 2O9PA 4B5NA 1A3HA 3XISA 5BWFA 3DECA 4HCLA 4RV3A 5AC8A 1W91A 3LQLA 2TRSA 4Z1CA 3EX1A 4KF1A 3NOYA 4IM4A 4XAFA 1GPFA 4INFA 3B06A 1E0TA 2P3ZA 4UOZA 1V02A 3D3AA 5G1TA 3R12A 2QCMA 2JGQA 1QPKA 2AGTA 3P80A 3GVRA 3H22A 1XIBA 4MYXA 5HJXA 4XZIA 4F4RA 1FWTA 2XH0A 1EP1A 3II1A 3MI3A 4DUOA 3SZ8A 4J28A 3W01A 1O5RA 1TWIA 2PDQA 4IMAA 3GU2A 3VA8A 4W9TA 4OBSA 4WY0F 4GA8A 1JJKA 1EZ2A 1YXYA 5CCZA 1K8XA 2Y24A 4DJFA 4JTEA 1TV2A 2NQ5A 3ZT6A 1W1A1 2WBGA 3BAWA 4R53A 3VK5A 1MUWA 3TFCA 2CHRA 4IPNB 4AC1X 1LJYA 2DZSA 4M51A 1PPIA 2EGZA 1XIHA 3RCMA 1X6UA 1US3A 4DJFC 3TVAA 1SMAA 4XSLA 2WMHA 1XG3A 4P7QA 1DJWA 5FEWA 1CECA 1VCFA 3BPWA 3VD9A 4YWSA 2PP1A 3AJ7A 4E6MA 4E3TA 4DJEC 5M2FX 3GTHA 4Y2WA 1E5NA 3PF3A 3H26A 4PR4A 3W2KA 3E38A 3NGFA 1JG9A 1JQVA 5GJMA 4Q8VA 2AAAA 5A6BD 1XD1A 2YSWA 3IVTA 4LS0A 3N4AA 2DVUA