3EKZA

Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
345
structure length
334
Chain Sequence
PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGKLYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase
publication title Structural basis for catalysis of a tetrameric class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 130
structure length 334
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ekzA00
1VR6A 1SFLA 5DXYA 4KKXA 2A7NA 2C3ZA 3CU2A 5CZSA 1LRTA 3MHFA 3C6CA 3H54A 2H90A 4P2VA 3TUUA 2B7NA 1YLVA 4JTUA 3IGSA 1LLWA 2Z6IA 1VCFA 3W7NA 4O1CA 1F74A 1GVRA 2A1YA 2X1SA 1G4TA 4Q4KA 3R13A 1TV5A 1YYAA 4GWEA 3PBUA 2QCNA 2F7FA 3CIWA 1LROA 4TIMA 3QC3A 3STGA 3L5MA 3W87A 4HT3A 3TW6A 2ZZ4A 1G67A 1SZNA 4WD0A 2OJPA 1UJPA 3NQ8A 3JRKA 1PS9A 2QJHA 4CNOA 1TPB1 2Q8LA 3W23A 1B3OA 4FX7A 4PL1A 4O54A 2OT0A 3B0PA 1P1XA 3IIZA 3VE9A 3G8RA 2BLEA 1OYBA 4JS3A 1SU5A 2GPTA 3PSVA 5KZEA 4YL2A 1SQ7A 2X2GA 4UR8A 5HUOA 4BFAA 1KV5A 4DELA 4Z1BA 3N73A 4JNMA 1QDSA 2A85A 3R2GA 4LY8A 4NQ1A 3O15A 1T8XA 4N02A 5FF0A 4AWSA 2CZDA 3PG8A 2WQPA 2GUUA 4JTEA 1TSIA 2F84A 5DY2A 1K3UA 4OE7A 4DO5A 3NQFA 2A5HA 1AW5A 4LUIA 4W9TA 2Y70A 3W2LA 2VFFA 3TE9A 2QCMA 1OX4A 2BWGA 4IXXA 3UWZA 5HUPA 4WUIA 4LNYA 5H91A 4O15A 2WSYA 1SZFA 1TPEA 2JGYA 2ZFAA 4QNWA 2QDHA 4X2RA 5F1VA 2G97A 1R46A 1SZGA 4ZMGA 1H60A 3BARA 3LHTA 5IBXC 1OF6A 3TAOA 3L68A 3EWXA 5KTLA 3Q37A 4O13A 1LLZA 1EP3A 1G4EA 3TQ0A 3G1XA 3KFTA 1SFJA 1WQ5A 3GLCA 1S5WA 4UFLA 3W72A 1DQWA 3DZ1A 3SECA 3P80A 3DI0A 4BR1A 1H7XA 1SZEA 4ALDA 4IMFA 2VELA 3NQGA 4NNAA 2FPYA 3LERA 3LHYA 2ISSA 4NT0A 4TX9A 2C19A 2ZA3A 4KFPA 3OVPA 4U4MA 4ZQOA 4ORMA 4UTTC 1OK4A 1F05A 2DJLA 5HULA 4ONVA 1GJPA 1P0KA 3ATZA 1JRBA 4FIQA 1I2RA 3QF0A 4LRSA 3SFKA 3GZ3A 1W8SA 1YPFA 3W2JA 4K8HA 3SGZA 4IGHA 3N9RA 3SI9A 1JCMP 1YADA 2X1TA 1ML1A 1HO1A 3W6YA 1W1ZA 3NQEA 5AHFA 5DBTA 3TNOA 4K39A 4UIOA 2BX7A 5LNSA 3UZJA 3ABOA 3G1DA 3HG5A 4JTTA 2PRHA 3W86A 2Z6JA 4XWUA 3LTYA 3G3DA 1PE1A 3C2FA 4NZJA 2D73A 4HPJA 1JULA 1FCVA 3R5EA 4FF7A 1H7NA 1PIIA 4ZQCA 4WOQA 1FWTA 5EBUA 1W3NA 3WK3A 1VLIA 1JCYA 2Z2UA 5EYWA 2VKZG 2PURA 2TSYA 4ADUA 3EXSA 1L2UA 2R8WA 1KM5A 5AN7A 1K8YA 3E96A 1ALDA 2Y7DA 2E6FA 2X16A 2EPHA 4O50A 4FX6M 1PCKA 4MY9A 1GVSA 3TXZA 2C6QA 3IVSA 4WX2A 1BTMA 4LVFA 5I3JA 4NX0A 2PC4A 3GXTA 4UC5A 3UWQA 3CIXA 1B57A 3HGRA 1SSGA 2WO5A 2WV8A 3B0VC 3NAVA 4UNLA 5TBOA 2ZZ6A 2P10A 3UZ5A 2PCQA 1WOBA 5DLCA 3KVJA 1ZHAA 2CLIA 3GB6A 1Q45A 4WZHA 3CEPA 2QKFA 4DF0A 1T96A 1ZENA 3PF3A 3LTSA 1J5TA 1IXPA 1KBJA 1A5CA 2YW4A 2W6RA 2UV8G 1HFBA 3M47A 4IMGA 1FDZA 1MEWA 4MZYA 2NXHA 4JDBA 4QNEA 5D05A 3C61A 5AFDA 3IVUA 4P61A 2X30A 2QEZA 1SO4A 3L0KA 1KBIA 4GBUA 3PB2A 1NVMA 4ZQPA 3G1SA 5AB3A 3EWUA 4M7TA 1AL8A 1Q3NA 2ISVA 1KM0A 1XM3A 2H3DA 1TV7A 3LV6A 1M6JA 5CG7A 1LBMA 4RCXA 3MP4A 4XBKA 3KVKA 1S5VA 1SO3A 3IIVA 3IIPA 4XBSA 5EMUA 4ZZ9A 2PE4A 3QSTA 1KM3A 3WK1A 2RHGA 1GPWA 4JR5A 4FNPA 4WXZA 3TV8A 3LM7A 1W56A 1WBJA 1H63A 3GDLA 3G1HA 2CLHA 3W1PA 3OEXA 3HPZA 1Q6LA 3QFEA 5K7JA 1WAUA 3HOJA 3NG3A 5H2ZA 1TO3A 4OHQA 1QCWA 4MVAA 1K02A 2J9YA 4AF0B 1FWSA 3W7IA 4LWWA 3N9SA 3FEMA 3MBFA 2A6NA 4MUZA 3RFAA 2PRMA 5G4EA 5IBXA 4EWND 1V7YA 3W7MA 2TRSA 3RU6A 1HG3A 5D2XA 4JN6A 3W1MA 3W7DA 1YXDA 5EL1A 2Y62A 3GDMA 5FF2A 3F1QA 3UY7A 4GRSA 5FEXA 3BGGA 3S0CA 2JKAA 2A21A 4O1AA 1W3TA 4N2YA 5D03A 4CLMA 1TPVA 2V2HA 4UTTA 1OX6A 1BWLA 2P0OA 4IJBA 2GJLA 3M5ZA 1TPH1 3G22A 3LXCA 4RKAA 4D2JA 1PVNA 3NZRA 3N2MA 3M41A 1UUOA 5FEZA 3T7VA 5FI8A 5AYZA 1PHQA 1JUKA 5HWNA 4PL2A 1RZMA 4HHPA 5F4XA 2E09A 3P62A 2ZRYA 3TQKA 4NZFA 1O4UA 3LHUA 2E77A 3B06A 2CLKA 3NQDA 2DZSA 3TKFA 3GKFA 1FWRA 4O28A 4WXYA 2X1RA 3DAQA 3PY2A 2WNQA 4M6VA 3TC6A 3PR2A 3LI0A 3CB8A 1GG1A 1GTEA 3LCFA 2Q3OA 3CC1A 3TU9A 3CTLA 3OA3A 1TPC1 4X22A 5HNRA 5LGXA 2QCLA 2VFHA 4KFNA 4NUWA 3BV4A 2GOUA 3BLFA 1EP1A 4JTFA 3WJSA 1KW1A 3EX2A 4K7VA 1JUBA 2I9EA 4Y8FA 1H62A 3MP5A 2GVLA 2V2DA 1D3GA 1W5PA 5D32A 3S1WA 2DJXA 2C15A 3DKLA 4JX4A 3SW6A 3WK2A 3VFLA 1R47A 5ABTA 3ABRA 3I68A 3EX6A 5LHEA 2QAFA 5D2TA 1I8JA 5F2GA 1DVJA 3Q58A 3THAA 2ZBTA 4UFIA 1THFD 1JCXA 1DKWA 4HNUA 3UPWA 3EEGA 1QFEA 1E51A 4S2CA 3Q2DA 4PA8A 2VEIA 2RDTA 4POCA 3W73A 1WXJA 1LBFA 1X1OA 3BK0A 1K8ZA 5F2IA 1H61A 3O06A 5F2LA 3W7PA 5MHBA 4O12A 1TV8A 4LRTA 3NPVA 3I7RA 5KMYA 1G4SA 4FB7A 3M0ZA 3P8IA 3LI1A 3LOTA 4O11A 2YYUA 4AHPA 1JCNA 4Z1AA 3C56A 2TYSA 4MYAA 4XTIA 1MSSA 2FPVA 4JYDA 4HKPA 5G2WA 3IV3A 3R12A 4O18A 2TPSA 4Z1CA 1QWGA 3GNDA 3B05A 5FF4A 3SSJA 3W76A 3IVTA 3FKRA 3GX9A 4AVFA 3E02A 1ZNNA 1DV7A 3HPXA 1P4CA 4K6AA 3W1LA 1OF8A 4M19A 4NNCA 4R53A 3GAYA 2V9DA 2VFDA 3NQ7A 1TCDA 4NX5A 4QQ3A 4LT9A 1J4EA 4A21A 1G4PA 4O4VA 2FTPA 2QUVA 3M1ZA 5U7SA 3C4UA 4TR9A 2VOMA 4MIMA 3ELFA 2ZZ3A 1S3HA 3W07A 4UTMA 1RQHA 2ZZ2A 4NVTA 5D33A 3B04A 3MHUA 3CQ0A 1G7UA 4LC8A 1DORA 4HNTA 4UFJA 4X9SA 1FXQA 1XKYA 3BW2A 2AQWA 1X8FA 1QR7A 3NPWA 3W7JA 5LSMA 1HUVA 4QISA 2VXNA 1JQVA 4R34A 3RLVA 3MMTA 3RLUA 3L21A 2WOQA 3S8HA 1Y0EA 4LTSA 5K4ZA 5C5YA 2DZXA 4DO6A 3LCWA 2QR6A 3O16A 2VC6A 3DGRA 3MI6A 4KFOA 3T55A 2ABBA 2V82A 4IUOA 5CPNA 3QJAA 4HNVA 1VH7A 4NJIA 5AHEA 4BF9A 3HMJG 3STEA 1I2OA 3HO8A 5AHIA 1LDCA 4NXKA 4CNNA 3ABSA 1OFPA 2WPBA 2NUYA 4H3DA 1SR9A 4JYEA 2ZCGA 4QIUA 3E0IA 5TQLA 1OFOA 3PUDA 3O05A 4OU1A 3NQ2A 4L4LA 2NX3A 3M7WA 3LCLA 3V1PA 3UXAA 3QSRA 3W22A 2OZ0A 3QQ1A 1UB3A 1SW3A 3DHFA 3IGXA 1LRQA 3NQ6A 3TK7A 1YXYA 3KAOA 3HF3A 1F6KA 4LUJA 1NF7A 5SWUA 2GJNA 4MFEA 5IM51 3HG2A 2QCDB 3HPSA 5EY5A 1JCLA 1HTIA 4M6QA 5DN1A 1L6YA 1HL2A 4GUGA 4AHOA 3UWYA 2EKCA 2GQAA 3AO0A 1H7RA 5LHFA 4LS2A 4MKNA 4LS1A 1VJIA 4N9DA 1QMLA 3W3OA 3KRZA 3PB0A 2DU2A 4JIPA 4UTHA 3ZFHA 1R2RA 4Z0JA 5K2ZA 1ME7A 3M5YA 3G1AA 2B4GA 3USBA 4O1DA 3IRDA 4ADTA 3ABQA 2RDUA 1EUAA 4N6FA 3E12A 1GTHA 3ATYA 1KLZA 3ZWSA 4S2BA 3MYOA 4RJEA 3C8FA 3P84A 4PH6A 3NVTA 3BG3A 4HSNA 3HGSA 3TJXA 4IQLA 1DBTA 2E6DA 2VFGA 2HS6A 5D30A 4AF0A 3NXFA 2E5CA 1FUYA 1Z48A 2VEMA 1RPXA 3P5YA 1RQBA 3HGOA 2WJZA 3LCIA 5BMXA 4FO4A 5EKYA 1TPDA 2ZRUA 3OVRA 3HG3A 3LCXA 3LGEA 2C0AA 4K8EA 3NL5A 3O6CA 3PAJA 4HNNA 4ZQMA 1XC4A 1T99A 3SGUA 3TMLA 1RQEA 3PWAA 4U28A 3L0GA 1C9DA 1ZAJA 4MPQA 5CPLA 1ME8A 5HWJA 4X3ZA 3F4WA 3LX9A 3OIXA 1MXSA 3NO5A 4XZ9A 2CLOA 1KFEA 3S6DA 2H3BA 3RF9A 3BW4A 1H1YA 2CLMA 1M7PA 1W5QA 1F2JA 4UTKA 3W1RA 2A7RA 2FB2A 4MLRA 4YCOA 4Z1DA 4OBTA 3S5ZA 3G24A 2VENA 3B4UA 3SY5A 5DXXA 1A5SA 4QAIA 4GJ1A 1PV8A 2ZQ0A 5AHMA 1I2QA 4RZ4A 3L66A 1VCVA 4JTIA 4JGDA 3W2MA 5K3VA 4CQ8A 4WOZA 3A5VA 3QW4B 2JGQA 3QMSA 1WV2A 2C1HA 1K8XA 3TR2A 4NJKA 5AHLA 2G96A 3P60A 4O57A 1LORA 5DBUA 4N9BA 3GDTA 3GNNA 3TJLA 1T0OA 2YX0A 4K7YA 1X1ZA 1ZAIA 2E68A 2Y63A 4RXFA 3EX1A 3B03A 4UTJA 1EWDA 3F4NA 4JTLA 5HMSA 5TIMA 2XN2A 2YFOA 4JY8A 2DZTA 3UD6A 3EX3A 4O1BA 1YDNA 3DH7A 3A22A 3S5YA 2E6AA 3C2OA 2V8ZA 2Y6ZA 4UNKA 5AC8A 3QPZA 4GUFA 3W9ZA 1ADOA 1TIMA 1AG1O 1KM4A 1W0MA 3D0CA 4C1KA 1LBLA 2B7OA 2ISWA 3DI1A 3TROA 2ZZ7A 4IX0A 1GQNA 1IIHA 1UUMA 3LRMA 3R8RA 2XN0A 3LHWA 1KA9F 3NL6A 5HR6A 2EHHA 5KINA 3EX4A 1KM2A 2WSQA 3C3NA 3KVLA 1SO6A 3IIOA 5G2HA 4UTUA 2XN1A 4O52A 5LNWA 2A2IA 3PBVA 1AK5A 1KFKA 4IMEA 1TTIA 3W2NA 3FKKA 4A3UA 3L65A 3TQVA 3QEZA 3TFXA 1BKSA 2E5BA 5CZJA 3TCEA 4DPPA 4FNQA 4N6EA 1L9WA 1M5WA 1MEHA 1K03A 3QZEA 3RMJA 2QAPA 4WY0B 2PRLA 2V5BA 5D02A 4RV8A 2C14A 2YZRA 1IXNA 1U5JA 1GEQA 1Q6OA 4JEQA 3W7EA 5HR7A 5G2IA 3LDVA 2CZFA 4GFSA 1KM6A 3PS7A 2NUXA 4DBDA 6TIMA 3N14A 1ZY9A 5KZDA 4XKYB 5C2XA 3DFPA 2ATSA 3W74A 4BWLC 4GUIA 2QCDA 2V30A 2B7PA 1XBXA 1F7BA 3WFAA 3S1VA 3W84A 2RDWA 4IPJA 3DFNA 1OK6A 3BGJA 3TX9A 3W1AA 3MW7A 1ZFJA 3HJZA 3KVMA 2H6RA 1ME9A 1GG0A 4UMAA 3G0SA 4DBEA 3FYPA 4BI5A 1UBSA 1FY6A 5BW6A 2ATMA 3GKAA 3QMTA 1OYCA 4LVGA 4UMCA 3N3MA 1KFBA 4H6KA 2BSLA 3HIJA 4R33A 2NV2A 4AXKA 4A2RA 1O95A 1JR1A 1DJNA 1MO0A 3DBPA 3QPYA 4GE8A 3A5FA 3NQCA 1VRDA 1NFBA 3W7HA 1VYPX 1Z44A 2GQ8A 3EB2A 1YTDA 1LCOA 1JVNA 1TPFA 3KRUA 1OHLA 3BVJA 3W1XA 4LVDA 1EPXA 8TIMA 4N9EA 1QPQA 1TMHA 4JY9A 1BEUA 1KV8A 4K37A 1AL7A 2E6YA 3K30A 1G69A 2CLLA 4PEKA 1FDYA 1LOQA 3W7GA 1VPXA 2YYTA 4GXMA 3PUOA 5I3GA 1KFLA 4QITA 1LRNA 2H8ZA 4A29A 5DCBA 1YTEA 2QDGA 1GOXA 3EWWA 1W37A 3GR8A 5F4SA 1KTNA 3A21A 1XDLA 4LC6A 5FEPA 4MY1A 4FNUA 1VGAA 3KX6A 5CSSA 5K4XA 4JTHA 1TJPA 1F76A 2ZYFA 5F2MA 1SW7A 2I1OA 4KWWA 1TRIA 1C29A 4UTIA 1EIXA 4FXRA 1C8VA 1LOLA 3DFTA 1GZGA 3TSMA 5G4WA 2ALDA 2ABAA 1TPWA 2FJKA 3TDFA 4DO4A 1W5OA 3LHVA 3UWUA 4N4PA 1ZJIA 2YSWA 2V5LA 3EWBX 5L6UA 5GVJA 5CKSA 2Y85A 3G0XA 3LB0A 1YPIA 4M5PA 3S1UA 4AAJA 3W7KA 1H7OA 3VKJA 3NA8A 1TPUA 3B8DA 1QO5A 4IMCA 3MI3A 4OV4A 4FNRA 4K38A 2V0TA 3TXVA 2R94A 1SW0A 3MI2A 1KTBA 5AYYA 4Q32A 4ORIA 3S9YA 3VI2A 3NOEA 1SPQA 5AHNA 4UFMA 4JTGA 3W1TA 1EB3A 6ALDA 2BTMA 2WNZA 3ANYA 4EF9A 3NZ1A 3GAKA 3UWWA 3NPUA 4FNTA 4A2SA 5CPMA 4IMDA 5E0KA 3A9IA 2O7QA 3NR0A 5G1YA 1YDVA 2G95A 4JX6A 4BI6A 3S5NA 1RD5A 1QPOA 1TJRA 3UPBA 3EWZA 1WYIA 3FA5A 1LM1A 2B7QA 2OT1A 1GYNA 4AH7A 4CQAA 5AC6A 1SO5A 2Y61A 4AB4A 2Z0IA 2Y88A 1EX5A 3DHDA 4RX0A 3W7CA 4O0ZA 1OFAA 4H4IA 1N55A 1H50A 4OT7A 1IXQA 1OG0A 3LCGA 4WY0A 5I3KA 3PSWA 1F5ZA 4HIBA 3MYPA 3UQNA 1ZAHA 3T40A 3RNDA 4TO8A 2NXGA 2WNNA 4ZQRA 2CZEA 1FCUA 3BPWA 5KZMA 5I3IA 1MZHA 3DFQA 1L6SA 3G0UA 2EAWA 4XKYA 3R89A 4OV9A 5AYXA 4O19A 3NPXA 2DORA 3N19B 3UNDA 1FDJA 3TA6A 4JICA 3PG9A 1F73A 4UUIA 2NWSA 3TMQA 4UCGA 2QF7A 4XTDA 3QW3A 3QM3A 2NLIA 3PBYA 4Z0SA 1JJKA 1KLYA 5K9DA 2AAMA 4NJHA 4A22A 3CWNA 5KITA 2NWRA 2OCZA 4O17A 1QPRA 5FF3A 2Y7EA 3HB9A 3W7OA 4DF2A 1ICPA 3NGJA 4FHAA 5BRBA 3HBLA 2FDSA 3L5AA 5A8GA 4UFKA 2Z1BA 1I2NA 4R7JA 3ZWTA 2DZVA 3P67A 4PODA 3KRSA 1GVFA 4ZL1A 4I7UA 2ZRXA 1GVOA 1QO2A 3FJLA 5E93A 3WJXA 3MHGA 4JTJA 5K9XA 1EUNA 3MO7A 2ZRZA 1QAPA 4O14A 5CSRA 5L9FA 4NJJA 4JDYA 2OX1A 4LVAA 1VCGA 3OG3A 3STCA 3N34A 1OABA 3TIMA 3G1FA 3IIXA 5A5WA 3TSBA 4CQ9A 3V75A 3DXIA 1OYAA 3A24A 4EF8A 1OFDA 4DF1A 3TSDA 1TREA 3WJZA 2I14A 5BOOA 2YXGA 1V5XA 2C18A 2J27A 1NF0A 2ZA1A 3CM4A 4PC8A 5LNVA 5LKYA 2FLIA 2FFCA 3UYCA 3FFSA 1A53A 2QUUA 2A0NA 1N7KA 2V81A 4MYXA 2CWNA 4FX8A 3NM1A 4MJMA 3LV5A 3CWOX 3CPRA 1XBYA 5I3FA 4MLJA 4YXGA 1QPNA 2CFFA 3L2IA 1D3HA 1XUZA 3HQ1A 4ML9A 5K9CA 3I6RA 3ZR4A 1PCWA 3TW7A 4I7VA 3DU0A 5EA9A 1I45A 1UCWA 1O5KA 3CLMA 1DL3A 1I2PA 5J5DA 1NAL1 3G1VA 3P81A 2CLFA 2WSRA 3LRLA 4LW7A 4NNBA 2G5WA 4UR7A 3P82A 5T26A 1TYGA 3C2RA 2NZLA 2Q8ZA 3M44A 4RZ6A 3OHIA 4TMBA 2YDAA 3PC0A 3EKLA 4JTKA 3U6WA 1FWNA 2R14A 1R2SA 4XUGA 2QCCA 3JS3A 4PTNA 3U2OA 4DPQA 1CX9A 1W54A 2A6LA 1Z41A 1AW1A 4ZVJA 1RR2A 5KSWA 1A5AA 2HSAA 1RV8A 2LLEA 1W5MA 4MZ8A 1WDWA 1XL9A 3GXNA 1FWWA 4LS0A 5D2VA 3BW3A 3SR7A 1OVDA 2E5DA 4JXCA 2OMAA 4I7WA 4ADSA 1TTQA 2NV1A 1Q6RA 1DQXA 5C6MA 1VYSX 2RKXA 3T78A 1OFEA 4LV4A 1FX6A 1EP2A 3IEBA 5CZ0A 2JKPA 4YLWA 5FEWA 1IF2A 1W3IA 3C2VA 2A4AA 3QMRA 1R2TA 3AJXA 4UFHA 3FOKA 5D38A 4UTWC 4NJGA 3M43A 3NQAA 2IQTA 4LOCA 2Y7FA 2YCEA 2Y7GA 3G3MA 2ZDRA 4O0KA 3L9CA 1KFCA 3W1QA 4YWIA 2FPTA 4LVBA 1QOQA 1P0NA 2FB3A 4NU7A 3BG5A 4EOUA 4GC4A 1Z42A 2JBMA 1UASA 4N9CA 5D2WA 2QCFA 3P8JA 1J2WA 1OX5A 5D2YA 4B5NA 1NEYA 1EA0A 1QOPA 1H5YA 4RXGA 5FF7A 2NX9A 5HJLA 4I9AA 3QRHA 4E0CA 4TU1A 1B4EA 3EWYA 4IX2A 2BXVA 3L5LA 1GYLA 4MY8A 5F4WA 5C54A 4OQVA 1M7OA 4JX5A 4FEZA 4AWTA 2NUWA 1W5NA 3P7YA 1VZWA 1YXCA 2ZTJA 3PM6A 1LOSA 1TTPA 4Y9AA 4Z08A 2ZZ5A 1WX0A 2HMCA 3NQMA 4JTSA 5LGZA 1ICQA 1H7PA 2QCHA 1PL9A 2NX1A 1XXXA 3LXAA 3UWVA 5J5RA 4DXVA 1HO4A 4K36A 3E9AA 1CI1A 1ZCOA 3IGUA 4Y96A 4QJ1A 1BWKA 2QCGA 3FS2A 3W83A 1G6CA 1VQTA 2J9XA 4DEFA 1XFBA 4Y90A 2Q3RA 3TC7A 1CW2A 3H53A 3U8GA 3LBCA 3NL2A 4RK8A 1I4NA 3DFOA 3QH2A 1JUEA 1OFBA 3W70A 3B0UX 3RK8A 3O07A 5D04C 3NM3A 2ZZ1A 3W7QA 4IPIA 4WY0F 1KTCA 2CLEA 2CW6A 2GVJA 3VE7A 3UY8A 2YW3A 3HG4A 4UXDA 3BG9A 2C13A 1WBHA 3DFSA 3W88A 2W79A 3KHJA 4AEOA 2B0MA 3TFCA 1ONRA 1P5BA 4E2DA 3W71A 1IIGA 1TQXA 3KOFA 1VHCA 3W85A 3M9YA 3O6YX 1IGSA 2X1UA 1D9EA 1WOAA 1FCBA 5DY3A 3M5VA 3W2UA 2HTMA 2VFIA 4EVZA 4QM1A 3THQA 2A7PA 4BK9A 2GVGA 1TRDA 2ZRVA 1FXPA 1GT8A 1U83A 2DZWA 4HN4A 2EGZA 3G8EA 3GDRA 3O8AA 3HGJA 3NQVA 5E1QA 1LZOA 1PHWA 4JD4A 3EKZA 3CHVA 3S1XA 4N4QA 5DELA 3EXRA 4QSHA 4J9JA 4JIQA 3N2XA 1OJXA 1LP6A 3BLEA 4L4MA 3WK0A 4ICNA 1G7VA 4UMBA 4Q33A 1DHPA 1JCJA 4RLIA 3LRKA 3O6DA 4S1FA 1AW2A 2VEPA 3C52A 3INPA 2J88A 3P5ZA 2YFNA 3CT7A 3GYEA 4PFMA 1O5XA 4RR4A 1YTKA 1X6UA 3MBDA 1YDOA 3BLIA 2CU0A 3C2EA 1K7FA 3CEUA 1GVQA 4MFDA 3QQ0A 2DZUA 1TQJA 3P74A 3MWAA 3W1NA 5U4NA 2R91A 3NEVA 3H55A 2XFWA 4MOZA 3GK0A 1L6WA 1XCFA 3W7LA 4AMAA 1FCQA 1F6PA 4MJZA 4UTWA 1SUXA 5I3HA 5G1TA 3WJYA 4CCCA 1ZALA 2J9ZA 3FYOA 3FIGA 1OFRA 2QUTA 3LTPA 4LU0A 4IOTA 1ICSA 3PULA 4E2BA 2DP3A 2J6XA 2RH9A 4O8RA 2VEKA 4HSOA 4MZ1A 4LV9A 3NL3A 1VHNA 3O1NA 3KXQA 3MP3A 1B4KA 3GR7A 3LHZA 4UTLA 3Q94A 1Q6QA 3NDOA 4WJEA 1LYXA 3PVFA 5LZLA 2AGKA 3STFA 1WA3A 3T44A 2FIQA 3MUXA 3VNDA 1XBVA 2RFGA 4NXSA 4RZ5A 1O94A 5EPDA 3FLUA 1RVGA 1FBAA 3I7SA 5DCDA 1H7WA 5LNRA 1TTJA 4O4WA 3G18A 1JRCA 3M5XA 2ZTKA 1XI3A 4HPXA 1EWEA 3GDKA 3I7QA 5HINA 3S42A 5AC7A 1S5TA 4DQWA 2E1DA 2J24A 3ZS4A 1KM1A 1VS1A 2Y89A 2P1FA 2GQ9A 3NYZA 4EIVA 4GUHA 3LCHA 1DJQA 1DOSA 4OWGA 3W75A 5FESA 2O7SA 4O16A 3LBMA 3C0JA 2FQIA 4GNJA 2NXIA 2EF9A 1FQ0A 1NSJA 4AWUA 4IXHA 2H8XA 1A50A 4WQ6A 3TAKA 3QYQA 3P61A 3JR2A 2TMDA 4M7SA 2C16A 2ZA2A 4PCFA 1H1ZA 3FJ6A 4CNPA 4KWVA 3GIYA 3YPIA 3DKJA 1OX4B 1X7FA 3G1YA 1R30A 5HQEA 5LNUA 4O10A 3VCRA 4Y6GA 2BZNA 3E49A 1EEPA 3MJYA 2QJGA 1MEIA 1GWJA 4GUJA 5D09A 4YCPA 2ZRWA 4C1LA 3GVGA 3BO9A 2HS8A 4E38A 1VYRA 5F1UA 3M6YA 1O60A 5HWMA 1OFQA 5CGQA 1W31A 3DENA 7TIMA 4G1KA 3L67A 4TMCA 5BNKA 4BWLA 3O63A 3LLDA 3WJWA 2JK2A 4IWWA 5BMWA 3PUEA 1JQXA 2YGYA 3T4CA 5G5IA 3OBKA 2YR1A 4JYFA 4BI7A 1K7EA 1N8FA 2CZ5A 2QCEA 5CZTA 2YPIA 4ZQNA 5AOUA 1XDMA 3SJ3A 1B9BA 2W0UA 4FXSA 3OVQA 4M6PA 5CPOA 3M16A 1TB3A 3UXDA 2JKEA 3LLFA 3F03K 1H51A 1IXOA 3W7RA 4XQ6A 2QJIA 3A23A 4AHQA 3L0NA 1QNVA 3I65A 2V2CA 3TH6A 2WKJA 5C55A 3EXTA 3PBWA 4CCEA 2VFEA 2DZPA 4OGZA 3W2KA 2KZHA 4O53A 1LTDA 1XUUA 1VLWA 5D37A 4FNSA 3SIZA 1KFJA 1SSDA 4YMZA 3SZ8A 3W1UA 3GXPA 1AMKA 1A5BA 4FIRA 3LXBA 1K7XA 1XBZA 3NNTA 4CCDA 5DCEA 1VC4A 3S5OA
chains in the Genus database with same CATH superfamily
2HRWA 1EF2A 2C3ZA 3CU2A 1V79A 1ITQA 2VCAA 2H90A 4P2VA 1W1B1 2VP8A 3IGSA 1LLWA 1VCFA 4O1CA 3QV6A 1GVRA 2A1YA 3WL1A 1PIFA 1MZRA 4YNGA 5BXTA 3H12A 1E1CB 3QC3A 3W87A 2ZZ4A 3KZSA 2E8YA 3AMLA 3WQWA 4WD0A 2OJPA 4C1NA 3E38A 2AQVA 1PS9A 4H1ZA 4CNOA 1J11A 1TPB1 3DYMA 3N13A 3W23A 2QJMA 1E55A 4XZBA 1B3OA 4PL1A 4O54A 3AHZA 3B0PA 4S3EA 1DIEA 2WVVB 4RUBA 1BRLA 1QBBA 2WSPA 5HUOA 3N73A 1DE5A 1K4HA 1BSIA 2PF8A 3M0HA 3TWBA 4G6CA 4AWSA 2CZDA 3CQHA 4INFA 3PG8A 4JTEA 1UWIA 2F84A 1K3UA 4DO5A 3AXKA 1AW5A 2PP0A 4LUIA 1K9EA 4W9TA 1TG7A 7PTDA 1Y65A 5TF0A 4PCNA 4LH8A 2BWGA 3UWZA 5HUPA 3UNTA 4Q7IA 1TJ2A 1IZJA 4KEZA 3MANA 3HQPA 4NAFB 4O15A 2WSYA 5I79A 1SZFA 4X2RA 5F1VA 3L2LA 5C8BB 1RAKA 1FH9A 2QW5A 1SJDA 1X97A 1UJQA 2NVAA 3LHTA 5IBXC 4FK9A 3TAOA 4CNUA 4A05A 5KTLA 2D22A 1BYBA 3AS0A 3W72A 4BR1A 4GIEA 1H7XA 1UR3M 3LERA 4TX9A 3WQOA 1XH0A 4GQBA 2CYGA 1RY8A 4ZQOA 5BOEA 3N4AA 5HULA 4Q8TA 4ONVA 3ATZA 3WEZA 3QF0A 3R0KA 4X63A 3E6EA 1E6ZA 4LRSA 4QJ3B 3SFKA 3GZ3A 4WKAA 4PRRA 4IG2B 3QZAA 1XRTA 3SGZA 4IGHA 1FHUA 3IPWA 4R3UA 3SI9A 1JCMP 2X1TA 5ABFA 4ML4A 1H49A 1EDGA 3WF1A 1BHGA 4E2OA 1RA5A 1XLBA 1PEZA 1US2A 4MB1A 4M6UA 4XD6A 4AEFA 2OLSA 1XDJA 3ZJ8A 2F9RA 1PE1A 4NILA 4JAWA 2D73A 1JPDX 4BEQA 4Q8OA 1EOMA 3R5EA 4MKVA 3CZKA 3T0AA 2Z2UA 1QU4A 2PCEA 2VKZG 5D8ZA 2R8WA 3ZXWA 4RDZA 1GHRA 1K8YA 1ALDA 1E6PA 3LBOA 1BXNA 3N2BA 2PDLA 4H2HA 1XYAA 2NSXA 3LA4A 1RHCA 3B97A 5C9UA 4PEEA 4O50A 1WKYA 2Y8KA 1PCKA 4MY9A 2YL9A 4WX2A 5ECVA 4LVFA 1ZBCA 1VFUA 3ITYA 2J8GA 3SB0A 2INFA 4GLEA 4NZ5A 5EBAA 2WV8A 3RG6A 4CN6A 7A3HA 2ZZ6A 4PB4A 3LPOA 5DLCA 1YW1A 3KVJA 3TLLA 1Q45A 3CZGA 3VOCA 3LTSA 2YW4A 3UEQA 3M47A 1E5JA 3PJTA 1FDZA 1MEWA 4QNEA 4S38A 1Q65A 5D05A 2Q02A 4PUNA 1M9HA 1WO2A 4YVXA 3UG5A 2HROA 4CKQA 1FWBC 4MWAB 4PMOA 4GBUA 4AEEA 3G1SA 3EWUA 3WG6A 2ISVA 1KM0A 1XM3A 3GVQA 1UHVA 1TV7A 4Q4SA 4NHVA 2OG9A 5CG7A 2EG7A 4XUYA 3T0TA 3TONA 1SO3A 4XBSA 5KETA 4KGLA 1VF8A 4ZZ9A 5GJNA 1IEWA 4ERIA 2ZX9A 3WQ6A 2Y24A 3TV8A 3FCPA 1WBJA 1PAMA 1H63A 1PXGA 2CLHA 4QRNA 1QNQA 3HPZA 2CWXA 4QBXA 3OG2A 4HCLA 5K7JA 3WMBA 1OT1A 1TO3A 1QCWA 3IK2A 4AF0B 2ALRA 3CQJA 3MBFA 3VILA 2DT1A 2PDFA 3RFAA 5EU9A 4GY7A 2DUXA 3MCOA 4V1XA 4K68A 4JN6A 1TVNA 3IJ7A 3GVVA 3GDMA 2OB3A 4HPGA 4F0RA 3F1QA 3UY7A 3K46A 4GRSA 5JMUA 2Y5EA 3BGGA 1KR1A 1WP6A 3S6OA 5BOFA 3S0CA 4ROPA 2A21A 5FA5A 1A0CA 1OX6A 4FLRA 1WUFA 4IJBA 2I5IA 1HP4A 3WSUA 4F66A 5FSEC 1XWYA 3LXCA 4D2JA 1H09A 1PVNA 3TYAA 4WSJA 5FEZA 3V35A 3W53A 5AYZA 1G1YA 2VM8A 5HWNA 1B31A 1OQFA 1CGUA 4PL2A 4HHPA 2E09A 5AC4A 6REQA 3P62A 4C60A 1Q7QA 3RM9A 2BOEX 1AD1A 3ITGA 5FJJA 3NQDA 1GQJA 3TN3A 4C6IA 1NDWA 1UOKA 4WXYA 5HANA 2NQ5A 1QI2A 5JH1A 2XIMA 3S2MA 3CTLA 3OA3A 3M07A 5HNRA 2IMRA 2BVWA 5C70A 5IHSA 4NUWA 3BV4A 1EP1A 4JTFA 5I06A 2XVPA 1VFOA 2PC8A 4AISA 1W5PA 3ENLA 4FA3A 3WH9A 3R11A 2FH6A 3GFXA 3SW6A 3VFLA 2A3CA 3EX6A 1BVWA 5LHEA 5D2TA 1I8JA 4DLFA 5JVLA 3R0UA 5F2GA 4M81A 3Q58A 3DHPA 4AZ7A 9XIMA 4HNUA 3ANVA 3WNKA 3JVAA 3EOSA 1RVKA 2RDTA 3W73A 2VEFA 1XGZA 3GXMA 5F2IA 3O06A 1R9XA 3TZFA 4XO6A 1TV8A 5FJRA 2W27A 5KMYA 2GLKA 1G4SA 2GJXB 2AL1A 2Y5JA 1E6NA 3AIVA 4IIFA 3C8NA 4Z1AA 2WZIA 1EEXA 3L2MA 1MSSA 2FPVA 4JYDA 4DVOA 4Z2LA 5G2WA 5JXQA 2OSYA 3CUXA 1ZP3A 3D6NA 5D9MA 5FF4A 4DUXA 4W85A 1YNQA 1OIMA 5AYIA 3VGHA 3EA3A 4LJ3A 1YX1A 2EKGA 1ZNNA 2PDNA 1R85A 3TVAA 4NNCA 1TVPA 1I75A 1KXVA 4QP0A 3FGCA 4GKTA 4XSMA 5AKQA 2ACSA 1G4PA 3NTYA 4O4VA 2QUVA 2OYMA 4TR9A 3IK4A 1NFPA 4XAYA 2ZZ3A 1S3HA 1RQHA 2ZZ2A 5GNZA 3B04A 3MZ2A 4LC8A 1DORA 1IT7A 3BW2A 3W7JA 4QX4A 3UESA 1JQVA 2IW0A 3L21A 4LAUA 3S8HA 5C5YA 2R24A 2E4TA 3KM8A 1XLFA 4ZOEA 1W91A 3MI6A 3T55A 1GOOA 1KXQA 2V82A 1DYSA 1AD4A 2OGJA 3QJAA 4NJIA 5BWAA 5ABHA 3LK6A 5FSDC 4JYEA 3K8MA 1GOWA 1NARA 3P0XA 3AHXA 4LX4A 2V3FA 4OU1A 4L4LA 3GSMA 3M7WA 3V1PA 4Z42C 4PZVA 4AIOA 1O1HA 2GL5A 3SCWA 4L9YA 4W7WA 2DT3A 1V6WA 1LRQA 1V6YA 4AYGA 3NQ6A 1YXYA 3KAOA 5CC6A 1F6KA 1KBBA 5CC5A 3KBWA 2GJNA 1W1YA 4AIUA 3WELA 3HPSA 1HTIA 4M6QA 1C8YA 4RW3A 3KLKA 1HL2A 2J8TA 4MNMA 1H7RA 1UMYA 5LHFA 4LS2A 1UKPA 2BHYA 4NAEB 1MVYA 4AX7A 1VJIA 2FJUB 1EBHA 1JZ2A 3NZPA 3KRZA 4C7FA 3FSUA 4Z0JA 3M5YA 2DUZA 2B4GA 3USBA 3NSMA 2X41A 4AC7C 3IRDA 3ABQA 3ERPA 2VQUA 1XYZA 4N6FA 2KAUC 3HV9A 1GTHA 3L4XA 3AOFA 3ZWSA 3OOQA 4LUTB 3NVTA 1RCXB 3TJXA 3S83A 5D30A 3FYYA 2E5CA 3ZJ7A 4R7WA 1C90A 4XZNX 4UQAA 4A8LA 3V16A 1B5TA 1RJQA 3LCXA 2IPGA 2IUZA 2C0AA 3PAJA 2JF6A 5BWFA 1T99A 2OKTA 3SGUA 3TMLA 3UJSA 3HU7A 3IARA 1XICA 4DYEA 2DIKA 4Y7EA 3WO8A 5HWJA 4GABA 3F4WA 2PWEA 5TD4A 2PTXA 3SRHA 1MXSA 3RCMA 3LSBA 4XZ9A 3N18A 5HATA 3S6DA 3QLDA 3RF9A 4WJXA 3WF4A 1S2AA 1W5QA 1F2JA 1VB9A 3W1RA 1FH8A 3CHFA 4MLRA 2VL4A 4W7VA 4A8NA 4Z1DA 2OOGA 3FXYA 3AJ7A 3MA8A 5DMYA 4PMYA 1VCVA 3W2MA 3N17A 3VMOA 3QPEA 4CQ8A 3A5VA 3DBNA 5AHLA 1R3SA 1XIMA 2QUNA 4L1XA 5A6KA 4N9BA 3GDTA 2PDHA 4KRZA 4GIYA 1V93A 1X1ZA 4DXKA 1V7AA 3B03A 5HMSA 1KCZA 4BKNA 1DJHA 2DZTA 3GW0A 3UD6A 3VA8A 4TTGA 4B4HA 3C2OA 2Q6ZA 1TJ0A 2V8ZA 1K6WA 2VDIA 3QPZA 4R5EA 1ADOA 1GK8A 3A4AA 2VX4A 3AZRA 1IIHA 4EAYA 7XIMA 3R8RA 2WMIB 1KRCC 2W92A 5KINA 4M24A 2OO6A 3E0FA 5G2HA 4UTUA 2XN1A 5LNWA 1YRRA 4IMEA 1PDZA 3QEZA 2WNWA 1L9WA 1MEHA 3D3AA 3QZEA 2QAPA 4G9PA 1OGBA 2V5BA 3NZQA 2C14A 3VC6A 2YL5A 3UR8A 3W7EA 5HR7A 5G2IA 4YTTA 3BE7A 3GXIA 3LDVA 3WUFA 2NUXA 4WR3A 3IUHA 5C2XA 4B15A 1ENUA 2QCDA 1XBXA 3SUWA 3S1VA 3CMGA 3TX9A 3BL3A 3WQ5A 3KVMA 1ME9A 4LANA 2D3LA 1UBSA 1FY6A 3KLLA 1O5RA 2BV9A 1L6GA 3GBEA 1JL8A 1UQYA 3N3MA 1KFBA 2J8FA 4G7EA 2GUBA 1SVDA 2FMOA 3WD1A 3GVRA 5E5CA 4HJWA 1O95A 2Z24A 3URAA 2QV5A 1DJNA 4E3VA 1XIHA 3T1GA 3MC5A 3RYSA 3EBVA 3A5FA 3NQCA 1Z44A 2GQ8A 3EB2A 4K1GA 2ZDSA 3KRUA 3BVJA 2FGZA 3W1XA 4JFWA 4Q4RA 1NH6A 1ONWA 3WLQA 1JCTA 4N9EA 2F2KA 4JY9A 4IIHA 4K37A 1VBRA 2PTDA 1OD0A 1FDYA 1VPXA 1NQKA 4H9XA 3SAZA 4AZIA 1FTXA 1JIBA 3QTGA 1OCJA 1S39A 1US0A 4LF2A 3GR8A 1EGZA 1IT0A 3A21A 4LC6A 1M01A 1NOFA 4FNUA 5CSSA 5K4XA 1GZJA 3T05A 1AQHA 3CT2A 2ANUA 4J3XA 1F76A 2ZYFA 1SW7A 3TLQA 1C29A 2WANA 4TQTA 3OLIA 2ABAA 4IGMA 1Q2RA 1H0GA 5L6UA 5GVJA 4ZO6A 5CKSA 4I6KA 4M5PA 1H7OA 1TPUA 3MI3A 4K38A 2V0TA 3TXVA 2PDMA 1MW1A 2W66A 1BF2A 8A3HA 4ORIA 3S9YA 3NOEA 4AY1A 3E3HA 3Q4DA 2PMQA 4H6EA 3JU2A 3ANYA 1Q6GA 3UWWA 4CCZA 1E4IA 1XIIA 5CPMA 3F4CA 1V6XA 2O7QA 1UH4A 3WN6A 3QKEA 2G95A 1YBQA 1CNVA 1R0MA 3CUZA 4X2PA 3UJEA 1LM1A 3NOYA 4ZSUA 4Q7BA 2OT1A 1QBAA 5AC6A 4WK9A 1SO5A 2VGBA 3GFYA 2HVOA 4AC1X 3DHDA 3SRDA 4GGBA 4O0ZA 1VFSA 3Q67A 2PDQA 4YVPA 4B16A 3U2ZA 2C1IA 1Q5MA 3PAOA 8CGTA 3KWSA 2VD8A 4WY0A 3ICJA 4NG3A 1DXFA 3VVGA 3PSWA 3ARPA 3SUTA 2NXGA 1WPCA 5KZMA 4HBKA 2ZKMX 1UR1A 2EG6A 1L6SA 2EAWA 3CHDA 3LM3A 2VO5A 3OZYA 2A79A 4OV9A 5AYXA 3CUJA 2DORA 3ANUA 2QV4A 4OJYA 3PG9A 4UUIA 1QXLA 3ZO9A 3CUHA 1J18A 4TXEA 5I5RA 4CU6A 3F2DA 3VXGA 3PBYA 1JJKA 4JIRA 1Q63A 4A3HA 5K9DA 2AAMA 1NOUA 4A22A 4C6BA 3U4AA 2Y7EA 2CPUA 3I3BA 3W7OA 4KMQA 5BRBA 3B9EA 1DWHM 1J0HA 1EZ2A 1XX1A 4L6HA 4UFKA 3WMLA 3ZWTA 3RLGA 4DI8A 5HMDA 5AY7A 4MNKA 1V08A 3MS8A 3GD6A 4ZL1A 4I7UA 1GVOA 3FJLA 1H5VA 1XINA 3AIWA 5K9XA 2VC9A 2IQDA 3H2AA 2ZRZA 1QAPA 3CH9A 4F0KA 1H41A 4AZ5A 1OABA 4PB3A 3B0XA 2J74A 2CESA 3QY8A 3IIXA 3VCCA 1WKEA 1BPLB 1A3HA 3RX3A 2W5FA 2QF8A 4DF1A 2WHMA 2I14A 4XV0A 5A3HA 4U2YA 1NF0A 1N82A 3H22A 5LKYA 2FLIA 1P0BA 2FFCA 2QUUA 3DUGA 3OGVA 2QMKA 4FX8A 4MJMA 3LV5A 4JHMA 4HNLA 2MUCA 4FI4A 1XBYA 5I3FA 4YXGA 1A3XA 3L2IA 4BHYA 3I6RA 4FLOA 1LWIA 4NI8A 2ZC8A 3TW7A 4XKMA 4I7VA 3MZNA 1TWWA 4EACA 2VWSA 4ATWA 1UCWA 2CEQA 1FA2A 3CLMA 2ON3A 1E9LA 1I2PA 3QV9A 3P81A 2FVLA 3F7JA 2O56A 2QJNA 3WUGA 3DERA 2G5WA 3POCA 5CG0A 2QYGA 3C2RA 3RR1A 2Q8ZA 4LCSA 1R9YA 2RGLA 3M44A 1XPGA 1XH1A 3VNLA 3OHIA 2DSZA 2YDAA 1CGVA 3NDZA 4JTKA 4NZ1A 3B9NA 1S2CA 2R14A 4BS0A 2WMGA 4DPQA 3U2OA 4OBRA 4IT1A 2A6LA 3EGJA 1Z41A 3URNA 4FPSA 3WDQA 3BW3A 4ZGYA 2XHYA 3BJSA 2DVTA 2VRQA 5CAKA 4ADSA 1D8CA 3WD0A 3XIMA 3QR3A 1UPMB 4XVEA 1EBGA 4AZ6A 4Y9MA 4F2UA 1W3IA 2VQTA 4X61A 1EC9A 3AJXA 3I6EA 4V1YA 1YE6A 3GXFA 3M43A 3MSRA 4RDYA 4LOCA 4LAMA 2V5DA 2YCEA 1R5YA 4HN8A 4O0KA 5I07A 2W63A 3CHEA 3VKBA 1X98A 1JZ7A 3K4AA 4AW7A 1I60A 1P0NA 3T6CA 2GSEA 4NU7A 2P3ZA 1X6LA 5BXRA 1M7JA 2NQLA 3AU6A 4K3ZA 4W5UA 2JBMA 1MNSA 2QCFA 4XG1A 2XIIA 1J2WA 4QXIA 1NEYA 3PZNA 3S9IA 1QOPA 3IANA 3MPGA 3AQUA 5H8MA 4NL1A 2NX9A 5HJLA 4I9AA 2WLYA 1OSEA 3V1HA 3N15A 4NZ3A 2BXVA 1CXEA 5C54A 4MY8A 2CXGA 4MJ2A 2Z1WA 4S3BA 3PFMA 3KBNA 1V0KA 4AWTA 1W5NA 2ZTJA 5A6LA 2HMCA 3GBDA 1A5LC 1H7PA 4ZENA 1PL9A 4QDPA 8RUCA 1TUXA 3CS2A 2F8QA 3GC5A 1B3YA 1XLCA 1JYVA 2WBKA 2O9OA 2PP1A 3VINA 2XWEA 3WZ0E 3UERA 2OTDA 1LLOA 4WCJA 2HV5A 2G8ZA 1VBGA 1PKLA 1OCNA 3LBCA 1JUEA 1OFBA 3OYZA 1GONA 1JFHA 3DOPA 1ZUAX 3H4WA 5D04C 3G2GA 1DE6A 1UWSA 1UZHA 1KWKA 4WRHA 2VX7A 1UD2A 2VC5A 4E8GA 3UY8A 3UCCA 2PDUA 4E8DA 2XFYA 1EQCA 1KNWA 2W79A 3H6OA 3GTIA 2B0MA 1ONRA 2OLHA 3MKKA 1P5BA 1E1CA 3U2EA 3T42A 3KOFA 1VHCA 3W85A 4QCFA 4PBEA 3W2UA 2HTMA 2JQXA 4J5NA 3T0DA 1KCKA 4EVZA 1ISZA 3A64A 4NF7A 2HWGA 4QM1A 1JYXA 2A7PA 4AD4A 4BK9A 2GVGA 1TRDA 4BF5A 2ZRVA 2YLAA 1U83A 2XVKA 1FHLA 3K8LA 1Z32X 2EBNA 3O8AA 3MJMA 5E1QA 1IGWA 4JD4A 4JPGA 4NIRA 4ZE5A 3T07A 4KCTA 2ZX5A 1V4YA 5DELA 3EXRA 4QHRA 4QSHA 3N2XA 1LWJA 1FWFC 4UMBA 4EX4A 3IUIA 4MB3A 1DHPA 1JCJA 1EC8A 4S1FA 2VEPA 2O0TA 4FSAA 1UBPC 3ZJ6A 1U33A 3GYEA 2CHOA 3E0VA 4EXQA 2ISDA 3D5HA 4FP1A 2C7FA 3BLIA 3OHMB 1K7FA 3CEUA 1GVQA 4GISA 4M51A 1HJXA 4A3QA 3QQ0A 3P74A 3U4FA 2EO7A 3GY1A 4XZLX 3SQMA 5DQPA 4JEJA 1TE6A 4MOZA 3GK0A 1XCFA 3W7LA 1F6PA 2KX9A 1MFUA 4UTWA 4CCCA 3FYOA 2PEVA 1BD0A 1PDYA 2CNCA 4IOTA 3OTRA 3PBMA 4JL1A 3LENA 2RH9A 4O8RA 3WF2A 4L4OA 3VKKA 3NL3A 9CGTA 3VNYA 4UTLA 4H9VA 1Q6QA 3NDOA 4WGXA 1LYXA 3RX4A 1IEXA 1V6TA 4JHOA 4IG2A 4GVIA 3SCPA 2UWFA 3KOZA 4ZTXA 2IPFA 4HP5A 3MUIA 3QR0A 1TJ1A 4DJFD 3I7SA 2BMBA 1ECQA 3G1RA 3M5XA 2ZTKA 4K1WA 1XI3A 3GH5A 3H2NA 1G01A 2QS8A 2XGZA 2A3AA 4PUUA 3VKAA 1KM1A 1VS1A 2Y89A 1SMAA 3BURA 1HJQA 1DOSA 3B8UA 1K77A 5FESA 4JTDA 4O16A 2R6OA 2FQIA 4G1NA 4J3ZA 4C6CA 1XLMA 4AD1A 4G8TA 1MW0A 3QYQA 3P61A 2PODA 3T2OA 2C16A 4PCFA 1H1ZA 3FJ6A 2X7WA 1X7FA 1R30A 4O10A 4JTCA 1AJZA 2Z1SA 3CBWA 3EA2A 3LPFA 2YDRA 4E4UA 1MEIA 5D09A 3BZJA 3U2CA 4YCPA 4HZ8A 2ZRWA 3CV2A 5HA7A 3LZ5A 5XIMA 4C1LA 3FHAA 3P14A 1UZ4A 2OO0A 4QDWA 1VYRA 4CVWA 3U7VA 2QGYA 3AROA 5CGTA 1UKTA 3PZMA 1F8IA 5CGQA 4D8ZA 1E5NA 4L9ZA 3PPHA 3B8IA 3N3TA 4M8UA 4TMCA 4R7OA 6CGTA 2ASHA 1KRMA 3GO2A 2JK2A 3VIFA 5BMWA 2VCCA 4U33A 3PUEA 1GVIA 4BI7A 4V15A 5AOUA 2VHLA 2W0UA 4W8AA 3SBFA 3OVQA 4M6PA 5CPOA 2OEMA 4TOQA 1E56A 3UXDA 5ABFB 2GGJA 3LLFA 1JDDA 3MWCA 1K6AA 1H51A 4JQ2A 3DN5A 4F0HA 4PMXA 3NEHA 3A3HA 3L12A 5ABGA 4TVDA 1UD8A 5D37A 2GUYA 3T9PA 4FNSA 3WQFA 4MNJA 1XISA 3VGFA 1AMKA 3WDPP 4FIRA 1XBZA 4WDUA 1UZDA 4AF0A 1SFLA 3B8VA 2A7NA 2EPKX 1LRTA 2QQ6A 3C6CA 1QTWA 4DBSA 4ATDA 2GJRA 4LEQA 1TELA 1GZ1A 2B7NA 3PNZA 1NWRA 1YLVA 4JTUA 1CCWB 4IM4A 2OZTA 2X1SA 5BXPA 3DESA 1C8XA 3M0YA 3TR9A 1G4TA 3R13A 1TV5A 5XINA 3EKGA 4GWEA 3PBUA 3WMSA 1DHKA 3CIWA 3S3GA 2J75A 3TW6A 4H7CA 3E1F1 2FVKA 3GZAA 4GQGA 1D7KA 2OEKA 1G67A 1SZNA 1DWGM 5DFAA 3NQ8A 2QJHA 2DH3A 2YBTA 4UNIA 2OT0A 4HK5A 1IR1A 1UP3A 2BY3A 4RDVA 3VE9A 3KTXA 2BLEA 1QW9A 4IH3A 4J40A 4MF4A 3ZR5A 4REQA 4PMDA 3PSVA 3U7BA 3OLEA 2AL2B 2NSOA 1F8MA 4DELA 4P8XA 4D1JA 3WBAA 1QDSA 2A85A 3LMZA 5M17A 3O15A 3RLHA 4N02A 1MRAA 2L5HA 3C2YA 2VT0A 3A3XA 1EJVC 2OFJA 4Q8PA 3TYZA 3U9IA 3UWEA 3VIJA 5DY2A 4OE7A 2OSWA 2VFFA 1Q6EA 2HVMA 1UR2A 4NYYA 2VUNA 3MO4A 1HKKA 3H2CA 4RPQA 1CB7B 4LNYA 3EWCA 1W1A1 5H91A 3VMPA 5A2BA 3WQ8A 4QNWA 1AH4A 3GVWA 2F6XA 5EMJA 3L4TA 2DY3A 1H60A 3BARA 2EG8A 5E6ZA 4ACYA 2D0HA 3Q37A 1LLZA 2WKGA 3QBUA 3TQ0A 3KFTA 1DWJM 1S5WA 1Q2SA 3P80A 3VDCA 2F6UA 1SZEA 3W6LA 2VELA 4NNAA 3FY1A 1EYWA 3SY1A 4U5IA 3LHYA 1M04A 4NT0A 3AUOA 1UC5A 2CHNA 3PPCA 4ORMA 4IFOA 3PZVA 1P7TB 1JZ5A 2GJXA 1JRBA 4FIQA 5HMFA 3MCNA 1I2RA 2XZ7A 4KRUA 4IP7A 2NQ9A 1UD4A 3N9RA 1VJZA 5C2GA 4RPPA 3ABXA 3CZJA 5BROA 4I90A 6REQB 1NWUA 3ARYA 3UZJA 3ABOA 4S3JA 4PUWA 3DGBA 4JTTA 3W86A 1XH2A 2Z6JA 3LTYA 1XLHA 2PLKA 3RCNA 3LLXA 3C2FA 4M82A 3O0KA 1XR2A 2QMJA 2VGIA 5CJMA 4HPJA 1FCVA 1J0JA 2R82A 4XVDA 1CXLA 2IPWA 4WOQA 1FWTA 3L4YA 4TV5A 5EBUA 2QT3A 1ZLPA 2WCGA 1VLIA 2E25A 5EYWA 3PPGA 4ADUA 1L2UA 2P88A 4O1FA 1ONEA 3E96A 2Y7DA 2EQDA 4UZUA 3IVSA 2GYIA 1IEQA 3GXTA 1E73M 4PUKA 1B57A 3T8QA 3HGRA 3NO1A 1E15A 4JQAA 1GOIA 3H23A 4Q8QA 4MWAD 1J8VA 3OU8A 4LYPA 5IDZA 1F6YA 3FSTA 1JAKA 4L61A 2B81A 1BLIA 3GB6A 4H8HA 4OOUA 3OBEA 1CGYA 4WZHA 4D6GA 3CEPA 4IGSA 3SUUA 1T96A 3PF3A 1IXPA 1GKPA 1Y8BA 2DDXA 2W6RA 2P8BA 1U5VA 3PJUA 4R88A 4MZYA 5LYRA 2NXHA 3WEMA 1XQLA 4RL3A 2POTA 3C61A 3IVUA 1OC7A 5T91A 3H7VA 4P61A 2X30A 3HN3A 3BOXA 3L0KA 3OZOA 3PB2A 4B3KA 2E67A 1J79A 4M7TA 2ZX8A 3HQNA 4ZO9A 2H3DA 1XD0A 3DCPA 4QS6A 4D6JA 5CGMA 1Y5XA 3WDIA 1LBMA 4RCXA 1EO7A 3UJ2A 4XBKA 4GCXA 2J7EA 3V18A 2PAJA 4AIBA 1V6UA 1XIBA 4E5TA 2VYOA 3E74A 5CPQA 2RHGA 1GPWA 4JR5A 4FNPA 2DIJA 4GI6A 3UPMA 3G1HA 5LIYX 3FGCB 2PGRA 3OEXA 3M0JA 1S2UA 4C5ZA 1DIOA 3EOOA 3QFEA 3HOJA 3NG3A 4JNYA 4RNJA 4YTSA 3DHUA 3M7SA 4J4KA 1FWSA 3W7IA 2J25A 3FEMA 1HP5A 2PRMA 3KRBA 3WLRA 1M53A 4B5WA 1X7IA 3RCYA 7CGTA 4BF7A 1HG3A 5GJMA 3W1MA 4A4AA 1YXDA 3LZ3A 2DEPA 2V69A 5CBJA 3RHGA 1YNPA 1Z3NA 1UWAA 2O9TA 3II1A 3M4HA 2JKAA 4O1AA 5D03A 2RDXA 1J0YA 4CLMA 1TPVA 2V2HA 3AMDA 1BWLA 2P0OA 2GJLA 3M5ZA 4JZ5A 4WDTA 1DJIA 1MUCA 3VIGA 3R1ZA 4HZ7A 1NQ6A 3NZRA 3T7VA 5FI8A 2PP3A 1PHQA 2IXUA 1RZMA 3MUCA 3F4DA 2VRJA 3AZSA 1KCLA 1BXBA 4TX8A 1XQKA 2XPKA 1SJBA 1GYMA 1WAWA 4ROQA 3NDYA 2E77A 3B06A 3MUY1 1BGAA 1WKDA 3WFLA 3UR7A 4IIDA 3GKFA 1FWRA 3ITTA 3NURA 3QYSA 4DJED 2X1RA 4ZOAA 3M0KA 1NM9A 3PY2A 4M6VA 3LI0A 3CB8A 3LCFA 2Q3OA 4HU0A 4R27A 1W3HA 2HEJA 4MWAE 4ZFMA 2J66A 3WDHA 3ARSA 4X22A 5LGXA 4ZEPA 5C0QA 4C6NA 3WJSA 3EDJA 1JUBA 1VPQA 2WC7A 5AC5A 1H62A 4CUCA 3MP5A 1SFTA 2GVLA 2V2DA 3RXZA 1R38A 1D3GA 3GC4A 5D32A 4ECLA 3WK2A 1R47A 4KERA 1FKWA 2WZTA 2X40A 3THAA 1ZJAA 1THFD 1JCXA 3PBGA 3UPWA 2WCAA 3E2QA 3Q2DA 2IXVA 5JBDA 3IV8A 4WJ8A 1WXJA 3MTWA 2YCLB 3FDGA 4KRTA 5B80A 3VNKA 1U1JA 1S3TC 3NPVA 1J0KA 2XIOA 1J0ZA 2Q8XA 3A4XA 3GTNA 2E8ZA 3A6OA 3LOTA 1Q8AA 3TQPA 1JCNA 4U5KA 4MYAA 4XTIA 4DLMA 3L4ZA 4KEMA 1Q6CA 3LPGA 3KP0A 3BJFA 4A35A 4HPHA 3B05A 4QS5A 3FKRA 1S1RA 4AVFA 4IJCA 1DV7A 1GW9A 3W1LA 4GVHA 4M19A 3T09A 3FN9A 5FJOA 4LT9A 3BCDA 3QY7A 1QHPA 3TTOA 3AI0A 4F0LA 4CD7A 1XRVA 4L56A 1MXGA 3LEPA 2AQWA 3AIQA 2FDMA 2J4GA 4X0NA 4GK8A 1HUVA 1UKOA 3CAQA 3KBJA 1KRBC 3RLUA 3SRKA 1Y0EA 4LTSA 5K4ZA 2DZXA 3LCWA 3O16A 1PPIA 2VC6A 3DGRA 4L65A 4KFOA 2ABBA 2BGSA 3H26A 3V5FA 2OODA 3QOMA 5MKGA 3KHDA 3JZEA 4HNOA 3IJLA 2WZEA 2JEQA 4YYCA 5AHEA 3TCSA 4BF9A 1I2OA 3HO8A 5AHIA 1LDCA 2FZ8A 4NXKA 1ZJHA 4CNNA 1OCQA 3ABSA 3GTHA 1OFPA 1Y7VA 2PI6A 4H3DA 3L4VA 5TQLA 1ZRQA 3PUDA 1ZB5A 3NQ2A 3W22A 1UB3A 4JBRA 4KBXA 2ZUVA 4KPLA 4AZGA 1T41A 1WUEA 1EDTA 3GIPA 4GKLA 4LALA 3I6TA 3HG2A 2QCDB 5EY5A 3DG6A 1VBJA 3VOJA 4AHOA 1W8GA 3GU1A 4WDWA 1UD3A 1Q7MA 1BQCA 2PBOA 4MKNA 2QVHA 1QMLA 3PTDA 2VNCA 4JIPA 4UTHA 1R2RA 1CZ1A 1UW9A 3CGTA 3S9ZA 3G1AA 5HPCA 4ADTA 5CLTA 2WVSA 1GJUA 4D6HA 3E12A 4RJEA 4H9YA 4HSNA 4PBGA 2OQHA 1EX1A 3CJPA 4GYPA 1Z48A 3EMQA 1RPXA 1E9IA 5IHRA 4GXPA 4Z2HA 5C7VA 3WLHA 3OVRA 1O7AA 4ZQMA 2IQ0A 4PBFA 3MCMA 4R9OA 2Z28A 1OCBA 1C9DA 2FZDA 4GY1A 4MPQA 2WHKA 4XZIA 4X3ZA 3NZGA 3LX9A 4J3TA 3G5EA 4HVXA 2IKIA 3MB9A 3VZZA 1KFEA 3WF0A 3TN5A 3QLLA 1M7PA 3BLDA 3N04A 2OR2A 1SJCA 1PYMA 3S5ZA 1EA9C 1W2VA 4ACZA 5DXXA 4GJ1A 1PTDA 4LUSA 2WZHA 1QNSA 4RE2A 1PV8A 1C9WA 1EJ7L 2ZQ0A 3L66A 4WOZA 3QMSA 4ZE4A 2ZVIA 2C1HA 3TR2A 2I5QA 2J7DA 1LORA 3EWDA 4FAMA 3GNNA 4K7YA 2Y63A 3EX1A 4I3GA 2DSVA 1EWDA 1M3UA 3B8TA 4JTLA 3WQVA 1EFZA 1XLLA 4PUMA 2YFOA 4HYWA 4J2PA 2FHCA 1QVBA 3DH7A 3HPAA 4KGJA 1W9VA 1ODUA 2E6AA 3F5LA 2Y6ZA 4D8AA 4HHHA 4HMNA 1AG1O 1W0MA 4C1KA 1MI3A 1QI0A 1TMLA 5HQMA 5HNTA 2XN0A 5HR6A 3NL6A 4EP8C 2EHHA 4LEFA 4J28A 1P48A 4ICMA 3C3NA 1L8PA 2HBVA 4KIEA 3O6AA 3IIOA 4HK7A 4Q7NA 1RLCL 1AK5A 1KFKA 1KC7A 3PZTA 3W2NA 5A94A 2GWGA 3TQVA 4PMNA 1OC6A 4DPPA 4N6EA 3LUTA 2JEPA 4ICCX 2I16A 4G56A 3RMJA 3MT1A 1EJTC 4WY0B 5D02A 1A49A 3VO0A 1IXNA 1V0NA 1Q6OA 2VDGA 1NIUA 3MKVA 1UD5A 4GFSA 1KGUA 1XYCA 1QUMA 1E0VA 5CXPA 4DBDA 1ZY9A 3N14A 4QCEA 2ATSA 3W74A 2PSNA 2PD5A 3NIYA 2B7PA 3WFAA 5A8OA 4LUYA 2RDWA 3DFNA 2PWVA 4JIIX 3W1AA 3MW7A 2C1GA 4WSKA 3WUBA 1ZFJA 4M1RA 4EKJA 3FYPA 2PPGA 3FJNA 5BW6A 3TYBA 3WUEA 2SFPA 3M0LA 4LVGA 3ALGA 4IJRA 2G37A 2BSLA 5I0DA 2CETA 2NV2A 2I7GA 4A2RA 2ZUTA 2BOFX 4BCEA 4BQ2A 1WXZA 3CQKA 3QPYA 3VOHA 1ADDA 1VRDA 1NFBA 1MMFA 3MY9A 1VYPX 3BMXA 1HJUA 1YTDA 3G77A 3PZUA 4UQ9A 2G0WA 1OHLA 4S3AA 5DEZA 3RGTA 5FCZA 4TUFA 4LVDA 2D1ZA 3PTQA 1MFVA 2ZVRA 1UA3A 1EGMA 1KV8A 4GH3A 1NDZA 1LOQA 3W7GA 1NY1A 2CXEA 2YYTA 4GXMA 3PUOA 2VWTA 3T8LA 4IUGA 1KFLA 4US5A 3RO6A 3KBMA 5DCBA 3GTXA 1K70A 2G3MA 1GOXA 3WLOA 4F3HA 6TAAA 5F4SA 3N25A 2AGTA 1BYDA 1XDLA 1VEOA 1HW6A 4EPBC 4MY1A 1E6QM 4JKLA 4PMJA 1XG4A 1QI5A 3SURA 3BAXA 1EIXA 4FXRA 1C8VA 1LOLA 2IKHA 3TSMA 2WKLA 3VDGA 4AD3A 5JU6A 2AMGA 1TPWA 5FL1A 1L0PA 5AZ0A 4GNVA 6A3HA 1W5OA 3H4XA 2PA6A 3TP4A 2XDFA 3G0XA 3LB0A 5GNXA 4HOXA 1YPIA 3S1UA 2GOKA 3RM8A 3VKJA 3NA8A 1JYWA 2GFTA 3OO2A 1QO5A 4FNRA 2VGGA 1RK5A 1MQPA 2DVUA 1XHGA 2XZ9A 1A0DA 1ISVA 1KTBA 2HQAA 1IQ8A 1V0LA 1SPQA 4UFMA 3ZIZA 4F2BA 6ALDA 4DJFC 3VDBA 3BAJA 3NZ1A 3GAKA 1ZPTA 4EF9A 4RDWA 1V0MA 1AJ0A 4FNTA 1VD6A 4A2SA 4MHBA 4IMDA 3NR0A 5G1YA 2PTWA 2J62A 2HBXA 4L6OA 4JX6A 2BP1A 1HVQA 1RD5A 3FA5A 3D47A 1RA0A 2PDWA 3IGHX 3V3WA 3PK7A 1TR1A 1JGIA 1PKNA 4C6EA 3IJ6A 2E9BA 4RX0A 3RUBL 3W7CA 1OFAA 4NSBA 3DG3A 4NYUA 1N55A 4U3CA 1H50A 4NP7A 4O8AA 1OGGA 3W28A 4I9JA 5C9XA 1OG0A 3LCGA 1JZ8A 1Z9AA 4Z2IA 3G6LA 1F5ZA 4HIBA 3UQNA 3T40A 3RNDA 2CZEA 3CUFA 5EB8A 2Z1VA 4DN1A 5I3IA 1MZHA 5E70A 1T8QA 3DFQA 2VCBA 4JFVA 2VOTA 4O19A 3ONBA 4HMCA 1W9BM 4QFUA 1F73A 1H2JA 1W1VA 2NT1A 4UCGA 4LBRA 1AA1B 1OBAA 2E28A 3QM3A 3BMVA 4Z0SA 1YHTA 1KFWA 1KLYA 3V5CA 1VBUA 3TN4A 1NELA 4DYKA 1QPRA 1RALA 4DF2A 2FDSA 5JQ9A 2Z00A 4XIMA 4YS1A 1JXJA 3LGDA 1EHAA 5FL0A 2DZVA 1Z6KA 3P67A 2WBGA 1V51A 4PODA 1UKQA 2ZRXA 5E93A 3WJXA 1WDSA 2NT0A 3POHA 2Z1XA 4H7VA 3H4GA 1S1PA 1XLAA 1BVZA 5D9OA 2VZOA 4PCSA 2OX1A 1JDCA 1VCGA 4GHRA 4HJFA 2C79A 3STCA 3N34A 3M6DA 3VABA 3TSBA 5A6BD 4PGLA 2GWNA 3TWAA 5BRQA 4N7QA 1JYNA 4EF8A 1OFDA 2G3JA 1NP0A 1TREA 1TR9A 4GIRA 2YXGA 2CERA 4MDPA 1V5XA 4PCTA 2V67A 2D69A 3LS9A 3CM4A 5LNVA 1JZ4A 1JNEA 4AYSA 4F9JA 3PN8A 3FFSA 4RNFA 1N7KA 2V81A 4IFKB 4S39A 4XZMX 1Z69A 4JQ4A 1PTAA 2CFFA 3AXMA 3CYJA 3HQ1A 4H9UA 3ZR4A 1NJJA 4P8UA 3GUWA 2PFHA 1ADSA 4U3AA 2WSRA 3HURA 3RM4A 1XIJA 2P5NA 3D3FA 4QLKA 3QGVA 4UR7A 4DJDD 3P82A 1WZAA 2WM1A 5EMKA 1U22A 5T26A 3O0FA 1DJZA 5D8WA 3PC0A 3EKLA 1YIXA 4HMEA 3VYLA 4IIBA 4PCPA 5C2CA 4H6QA 5FIPA 4PTNA 1W54A 2PGFA 2WLZA 3V0TA 2Y0FA 2HSAA 1LG1A 1RV8A 1K4GA 4W8LA 1IE7C 1V03A 4TX6A 2NV1A 4EE9A 1Q6RA 1DQXA 5C6MA 1VYSX 3T0CA 2RKXA 3BV7A 4E2VA 2XSXA 1DJXA 1EP2A 5CZ0A 2JKPA 3VK5A 1FH7A 5A6SA 1GNXA 1W32A 1L2QA 5FEWA 4QTGA 3GFZA 1IF2A 4H2CA 2A4AA 3MQTA 3GDBA 4DZAA 3FOKA 3QHOA 3L4WA 3KS5A 4UTWC 3NQAA 1JPHA 2IQTA 3N12A 2WYSA 2WVTA 3M0VA 2Y7FA 2ZDRA 4JIHA 1F4AA 1E70M 1H4PA 4L4PA 1KFCA 9RUBA 1JDFA 4BA0A 1TZ9A 3UCDA 2YDQA 1C7TA 3AYVA 3VIMA 5EFDA 4EOUA 5D2WA 4N9CA 2QZRA 3P8JA 4GZEA 3KDNA 3ARQA 5LXEA 1V3JA 3DG7A 1M03A 3QRHA 1DXIA 4TU1A 3RDKA 5CH9A 3H2FA 1A5NC 3L5LA 4K8GA 5F4WA 3HZ3A 4OQVA 4D8LA 2BXYA 1SZRA 4JX5A 2FVMA 5HBFA 5DT7A 3FW6A 4EANA 2NUWA 3UVIA 3E0WA 3PM6A 3GC2A 5HNUA 2QVNA 4Y9AA 2BDQA 2Z1KA 1QHZA 1DWFM 1ICQA 3AWNA 2PU0A 1EJRC 1JI1A 5J5RA 3MKCA 4H8VA 4MAZA 3E9AA 3IGUA 3ITCA 4QJ1A 5C9RA 3EPOA 4Y90A 1CW2A 3PZOA 3NL2A 4IZGA 2WHJA 2C71A 2AKZA 3W70A 3B0UX 3TOPA 4NZ4A 1OWQA 3W7QA 3CIVA 3ZLFA 1E4MM 1K1DA 1S2VA 2CLEA 2GVJA 3DEQA 3R8HA 3OLGA 4Y2WA 2YW3A 3GS6A 2I9UA 3BG9A 1A47A 1BKHA 4LCRA 4N0RA 2WMHA 3DFSA 1AFSA 4MTVA 4AEOA 4L5ZA 3TFCA 2DUAA 1J96A 5I24A 1IIGA 1TX0A 5CCZA 4AFYA 1PZ2A 3M9YA 3PZQA 4L80A 1WOAA 3VIKA 4YTQA 4WF7A 3GG8A 3M5VA 4E6MA 3THQA 3M0XA 2XIBA 4E3TA 3W81A 2PBGA 3BSMA 2DSWA 2ZE3A 1GT8A 4PTVA 3G8EA 2XFFA 3HGJA 4P5UA 5BRPA 5IFTA 5HPOA 3EKZA 4MWAC 1RCQA 1E9ZB 1NFGA 1ZQ5A 2AL2A 4I8YA 3S1XA 4S3GA 4N4QA 4J9JA 3EA1A 1OJXA 3BLEA 5E09A 4HHLA 1R7AA 4IL2A 4ICNA 3WK0A 3CUIA 2CCRA 4HQVA 4Q33A 4YN5A 3A4JA 1GQLA 3SY8A 3LRKA 3CQIA 5E0CA 1ODZA 2FFIA 4GG9A 1RUSA 3INPA 3P5ZA 2YFNA 2XGIA 1IEVA 4RR4A 1YTKA 3P0WA 3MBDA 5TAOA 4Q8WA 3IS4A 3V7PA 4B90A 1OGSA 3K4DA 5FJUA 1PX4A 2DZUA 1DIKA 3GNOA 3W1NA 3QC0A 5U4NA 3NEVA 3H55A 1Z7AA 2XFWA 1OC5A 4LB3A 2ZWYA 3I3DA 1Z89A 1ISWA 2G4FA 4MJZA 4DY1A 3V5OA 1SUXA 2VVNA 5I3HA 1ZALA 3FIGA 4Z2GA 2BFGA 3PZIA 4MB5A 1P6WA 1YEYA 2ZX7A 4UBPC 4LAOA 4ZSTA 3U5YA 2DP3A 2BNJA 2VEKA 4HSOA 2XH7A 3EZ4A 3WLLA 4LV9A 3GYCA 3K1GA 2X1IA 3O1NA 4WSHA 2G50A 3ZLGA 3SM0A 1P7TA 3LHZA 3WL0A 2GJPA 4HOZA 4HOWA 3UZYA 4BY3A 1O5QA 1MRQA 2AGKA 3T44A 2FIQA 2EJAA 4ERAA 4NXSA 4RZ5A 1REQA 3IJDA 1RJRA 1TVLA 5EPDA 1RP8A 1DWIM 4GQ0A 3NFUA 4YPJA 5DCDA 5I6SA 5LNRA 4QSFA 1TTJA 3AHVA 1JRCA 3ID7A 4MGGA 4HPXA 2BVDA 4REQB 4LFYA 5AC7A 1S5TA 2E1DA 1PWMA 1K9FA 3I4KA 3NYZA 4CEUC 4LCQA 4EIVA 4GUHA 2PLMA 5CPSA 4DHGA 1DJQA 4OWGA 1CGWA 1S2WA 3W75A 3O2LA 4PRTA 3LBMA 3C0JA 4C7GA 5M03A 1KBKA 4GNJA 2NXIA 2EF9A 3VGDA 1SR0A 3CHCA 5A6MA 4G7FA 1A50A 3TAKA 3WBXA 3JR2A 3B9OA 2ZA2A 4B9YA 4CNPA 1A5MC 3WBYA 4GMEA 1LL7A 4GO9A 3YPIA 1UKSA 5E9AA 2VTFA 5HQEA 4DJEC 1OD8A 3Q65A 5CLWA 3MV11 4GUJA 1U30A 1T7LA 4A8IA 3UYIA 2HS8A 2OZ8A 1V3HA 2AOSA 1QNPA 3M6YA 3VNJA 5C71A 1TV3A 1MNZA 4DZ5A 2HNEA 4AY7A 1XS2A 1W31A 3RIKA 1FP9A 3DENA 1BWVA 3ARRA 3BLPX 4V28A 2XG9A 3WNOA 3E5PA 4BJHA 3FAWA 2ZXQA 3STPA 9XIAA 1UPPA 3PWIA 1FVPA 2ZICA 3BXWA 3MVTA 1VFFA 4KS0A 1UH3A 1R3YA 4X9YA 1N8FA 2CZ5A 2I17A 5KZ6A 4QG8A 1XDMA 4QEEA 3SJ3A 4MPKA 3OYXA 3BMWA 1KB3A 4WVXA 1X1NA 1WXYA 2P8CA 2YBVA 5IRPA 1IXOA 4QGCA 4LNCA 4PTDA 4XQ6A 3UJRA 4GJJA 4GIAA 3VD5A 3EXTA 4CCEA 4PMRA 4OGZA 2BBFA 1LTDA 1XUUA 1A5KC 1JPIA 3IWPA 4YMZA 1MDLA 6PTDA 3JW7A 2A3HA 3N4EA 3GXPA 3WLJA 3SJNA 3EMZA 1K7XA 1VEPA 3VKDA 1EC7A 1VR6A 5DXYA 4KKXA 2ZXBA 2IS7A 3MHFA 2MNRA 5JIPA 5TNVA 5CJNA 3BTNA 1EKOA 4I5XA 3H54A 4GACA 3CL8A 5HDRA 4Q4MA 1WZMA 3TUUA 2YL6A 1J93A 3W7NA 2XVGA 3U57A 3PJWA 1H1NA 1HQTA 1T5AA 4CQCA 2QCNA 2F7FA 1LROA 4H41A 1JDAA 3EDEA 3NQBA 3FVMA 3QGAC 3L5MA 4DWSB 3H7UA 3TYUA 4W88A 4PULA 4GBDA 2DW6A 1ONXA 8XIAA 4HK6A 2Q8LA 4H7ZA 2WMJA 4FX7A 1BFNA 3QTPA 4Z2KA 3G8RA 1UR4A 4JS3A 3K2GA 1W9DM 1WKFA 2OXNA 1SQ7A 4UR8A 3F5JA 4G5DA 4Z1BA 4DYJA 2DZAA 1W9UA 3GNPA 1FHVA 3R2GA 1FWIC 4NQ1A 4A8RA 1T8XA 1IT8A 1E4LA 1PZ0A 2DZBA 5FF0A 2DV0A 1G0CA 5I00A 2WQPA 4GYJA 2XIQA 4LBSA 3KWXA 3VCNA 3MUAA 3H8AA 1TIWA 4F4RA 4GX9A 5D9NA 1GHSA 1JPKA 5HJXA 2QCMA 3COTA 1VEMA 2WMFA 3BQ6A 4B5SA 3AUJA 2JGYA 1TPEA 3R7MA 1EIBA 2VX6A 1W3LA 1V3LA 3TJ4A 1D3CA 4GI9A 3SRFA 1JPMA 5FD0A 3SN0A 3EWXA 3UZXA 4FMVA 4O13A 1HKMA 1VAHA 1SFJA 3GLCA 1CWYA 2C0HA 4PB5A 3W0KA 1DQWA 3T2PA 3FDKA 4B3ZA 4DI9A 3DI0A 1I1WA 2YCLA 3BLKA 3NQGA 2FPYA 3QHNA 5FAJA 4DNMA 2ISSA 2OZ3A 4X60A 3DFYA 4MJ4A 2ZA3A 3QOKA 4KFPA 4U4MA 1OK4A 4UCFA 1AH0A 3LSCA 4J2MA 1GJPA 2H9AA 4RNHA 2WQDA 2A3EA 3CPUA 2P0IA 3CV1A 4XAFA 4Q4OA 4ZTYA 3DC0A 1HL9A 1W8SA 2GK1A 3TYCA 3W2JA 2HXTA 4K8HA 3UVAA 3N6JA 5HJYA 3O9NA 1YADA 2VZSA 4A6GA 2YL8A 1B3XA 3C0SA 5M5DA 4K39A 4XO7A 2YOCA 2WZMA 3SO7A 4HYVA 3G1DA 5CAHA 1D8WA 4XWUA 1VKFA 3EOEA 3DC8A 2V5CA 3MDWA 4KQNA 1KWGA 2DT2A 4NZJA 1WB0A 3FAXA 2XFRA 2NVCA 3THDA 4NASA 4EWJA 4JQ3A 1IWAA 1H7NA 2XUCA 4ZQCA 4F9DA 4JCMA 3B8SA 2PURA 5E6YA 3EXSA 1IWBA 5DRCA 5AN7A 1S38A 2Z4GA 3ZQ9A 2E6FA 1B9ZA 2CIPA 2EPHA 3RJYA 4FX6M 4KWSA 3TXZA 3GRIA 1BTMA 4MSSA 5I3JA 2PC4A 4ZO8A 4UC5A 3UWQA 1SSGA 2WO5A 1UROA 3CMJA 1KKRA 4UNLA 5TBOA 3SQSA 2XJ7A 2V38A 3UZ5A 1WOBA 1ZHAA 1ZU8A 5I03A 4EPDC 3VOGA 2QKFA 4DF0A 2PF0A 1J5TA 1KBJA 1VFLA 2O4QA 5I3DA 1A5CA 4MNLA 4S3DA 4IMGA 4M1BA 4C6LA 2O55A 4JDBA 2D24A 2GDVA 1V6VA 1DQUA 2QEZA 1KBIA 1FWEC 4ZQPA 1NVMA 1ELSA 1QW8A 4PTXA 3BOFA 5A2AA 5AB3A 2OGYA 1XIEA 4ZXOA 1OY0A 1Q3NA 4GX8A 1XPYA 4IMAA 1M6JA 1O66A 1XD1A 3H2MA 3KVKA 3IIVA 2FGBA 2HJPA 3IIPA 5E0FA 2OKOA 2XWDA 3IUDA 4WXZA 4UQBA 1W56A 3UT0A 1QW7A 4DX3A 3B0YA 4OECA 2HE8A 1Q6LA 3TA9A 2FH8A 2E9LA 5HAOA 4ZB5A 1K02A 2J9YA 2X09A 2PU1A 4LWWA 1W9XA 2OLAA 2QPXA 2YCIX 4FXFA 1W3KA 2A6NA 5M1TA 1GVEA 2CKRA 2JE8A 3ES8A 4EWND 3W7MA 2DSUA 2DSKA 4IQEA 5D2XA 1BSLA 1EHNA 5I78A 2ZXAA 5AYBA 3RRAA 4A3YA 5EL1A 4ZO7A 5FF2A 3H21A 4CEXC 4OFCA 4Z1YA 1KGWA 1B0IA 5GJPA 1P1MA 4ZR8A 3PJXA 3TC3A 1W3TA 5MKGB 5BU6A 1BAGA 4UTTA 2OWXA 4P8WA 4RW5A 2ZADA 4RKAA 3WEOA 4QJ4B 1UUOA 3VNIA 3ZYZA 4D1IA 1JUKA 1ZGDA 1MQQA 4XX6A 3FA4A 4AIEA 5F4XA 4W84A 2ZRYA 2R1MA 3RN6A 1EGVA 2IKGA 3PWGA 1DJGA 1WDDA 4XIAA 1I6NA 4LYRA 2CLKA 3SSZA 2X0YA 3TKFA 4I6VA 2ZXDA 5EMYA 4O28A 2WNQA 3PR2A 3XISA 3WLSA 3WH6A 1GG1A 3AALA 3CC1A 4C5YA 3TU9A 1TPC1 1ZBKA 2ESCA 4HPNA 4IPNB 4JL2A 3I4EA 2QCLA 2DW7A 4KFNA 2D20A 3GG0A 1KW1A 3EX2A 1OM0A 4K7VA 2OWWA 1Z8AA 4Y8FA 4LAKA 1UR9A 1WNOA 5C9WA 1CIUA 3T08A 4CD5A 3SUVA 3SCUA 1JAEA 3DKLA 4A3RA 3ABRA 2QAFA 1DVJA 4UFIA 3V0UA 1E51A 4S2CA 1SJAA 4FLQA 4GOAA 3HQOA 2VEIA 1NOWA 4C91A 3KL3A 4LYQA 1LBFA 3BK0A 1K8ZA 3CNYA 5F2LA 5MHBA 5T8GA 1RD6A 4O12A 3F2CA 1FWJC 5A2CA 1R3QA 3I7RA 4K2SA 4LXFA 1PYFA 1UWQA 1E40A 1Q8JA 3P8IA 4AVOA 4O11A 2YYUA 4AHPA 4HSHA 3C56A 2TYSA 2CHRA 1UIOA 4JFSA 3IV3A 3R12A 4O18A 2CBVA 3TZNA 1HGWA 4Z1CA 4XISA 1ZP4A 4ACZB 3UP8A 2I5GA 4LUSB 3SSJA 5I7GA 7REQA 2UY2A 3GX9A 3BCJA 3E02A 4JCLA 2YBUA 3HPXA 4C6KA 2DIEA 1OF8A 4R53A 4KCVA 2VFDA 2GDQA 3NQ7A 5D4YA 4AU0A 4NX5A 4QQ3A 1FWDC 2YJQA 1J4EA 3GG1A 1Q7ZA 2FTPA 3TYDA 1FWCC 5U7SA 2WJEA 3C4UA 2J13A 2NVDA 4MIMA 3W07A 1B90A 4NVTA 3V36A 5D33A 2VR5A 3MHUA 3CQ0A 1G7UA 2HK1A 4PSPA 4UFJA 1X39A 3AIUA 4X9SA 1XKYA 2EPMX 1X8FA 3NPWA 5LSMA 4QISA 3OLDA 2VXNA 4LYKA 3MMTA 3RLVA 2WOQA 3OQ8A 2X05A 4YYFA 4XD4A 3NVDA 4DO6A 1ZSXA 1RBAA 3GU2A 3R8GA 3XINA 3ONCA 4IUOA 2WJDA 4LSBA 1IV8A 4HNVA 4I5RA 3A13A 3STEA 4OIFA 2FYMA 2WM0A 4D6EA 3TW9A 2NUYA 5LIKX 4C7DA 2PWDA 4QIUA 3E0IA 3RILA 1OT2A 1OFOA 3O05A 4B91A 3LCLA 3UXAA 2OPJA 3QQ1A 5BYWA 4KWOA 3R10A 3IGXA 3RPMA 4EPKA 2JIEA 5IFPA 2V5JA 3HF3A 2E40A 4LUJA 1EXPA 5SWUA 2X2YA 5B7YA 1JCLA 1VBHA 1L6YA 1RLDA 4IGNA 2VURA 3GHRA 5T9CE 4WEVX 1NU5A 3SUSA 1G5AA 2VJXA 3EOUA 4LS1A 1KQYA 3W3OA 3FK4A 2Y1HA 2DU2A 3PB0A 3WD3A 5T9BG 4TTUA 5K2ZA 4DJDC 1PX8A 3ISIX 4GQRA 4O1DA 4NZCA 2O92A 3ATYA 1DJYA 4S2BA 3MYOA 3P84A 3BG3A 3HGSA 2EXOA 4IQLA 4CVUA 1DBTA 2VFGA 4D9PA 3GHSA 2AQOA 2YCJA 3NXFA 1FUYA 4UQCA 2WJZA 3LCIA 2PWFA 4DZIA 5AVHA 1TPDA 2ZRUA 5AECA 3H2EA 1CLXA 3LGEA 4K8EA 4CD8A 4HNNA 1JD9A 2VI0A 4AWEA 1FRBA 3PWAA 4UOQA 3CWHA 3L0GA 1ZZMA 1ZAJA 2AMXA 2INZA 3WD2A 2ACRA 1ME8A 1QNRA 3RPTA 3WQEA 3AZTA 2GVEA 4Q8MA 3GW3A 1H1YA 4HNCA 4UTKA 1LL6A 1VJSA 5H1WA 2A7RA 2FB2A 3FJ4A 4H9TA 4OBTA 1XIFA 3SY5A 3BLOA 2FZMA 2XGBA 2PB1A 1I2QA 4RZ4A 5GNYA 4JTIA 4U2ZA 3QW4B 1XJBA 4JKMA 3Q45A 4NJKA 3P60A 1ESWA 3K1DA 4PTWA 4PN2A 5DBUA 2YX0A 2POZA 3WQ4A 1ZAIA 4JKKA 4YWSA 3UGRA 3H2OA 1AZ2A 1J5SA 4L6DA 1J01A 2DPEA 5CSUA 2Q09A