3EKZA

Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
345
structure length
334
Chain Sequence
b'PIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKDKLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKAAAAAKIILEIEIGVVGGKLYTSPEDFEKTIEALGAGEHGKYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFVFHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLKVDGEVGVKKVYDPRSYLKKAEASMSQRVVQACNDLHCAGKSLTHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-bisphosphate aldolase
publication title Structural basis for catalysis of a tetrameric class IIa fructose 1,6-bisphosphate aldolase from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 130
structure length 334
sequence length 345
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2008-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ekzA00
3HPXA 3NL5A 4LV4A 5AHEA 4O17A 4IOTA 1XKYA 4O8RA 1AW5A 3P60A 2YW4A 3W2MA 4XKYB 2E5BA 4TMBA 1PIIA 3W7QA 1FWRA 3E12A 1PCWA 3LV6A 1PE1A 1W8SA 2YDAA 3QM3A 4MVAA 4JD4A 1W56A 3T40A 1Q6OA 2ZA3A 5EPDA 1KM0A 1WQ5A 3VNDA 4P2VA 3W1XA 5KZEA 1TCDA 3P8IA 3V75A 1G7VA 2VOMA 4M6PA 2GOUA 4N9EA 4JIPA 3CLMA 5U4NA 3Q58A 5I3HA 3W7MA 5E1QA 3DHFA 2YZRA 4X2RA 1WDWA 2OT0A 3CTLA 4ZVJA 1EIXA 1J5TA 4RZ4A 5C5YA 1YADA 1W5QA 3NZ1A 4UFHA 3UY7A 3TAOA 2AQWA 5FF4A 4OE7A 3EKZA 5D32A 2OZ0A 4HNVA 4JTEA 3C2EA 1KFKA 1B4EA 1UB3A 2XN1A 1SO5A 4DO6A 4ZZ9A 3NYZA 4ADSA 3GXNA 2QAPA 4BWLA 5J5DA 1QPRA 3PULA 2Y62A 3QQ0A 2Z2UA 1NFBA 3NR0A 2WO5A 1KFEA 2ATMA 1SZNA 1SQ7A 4AVFA 3LCIA 4M6VA 3PB0A 2QF7A 1SZEA 3QMRA 4FXSA 1VHNA 3INPA 3LLDA 3G1FA 4PFMA 4TR9A 1IXPA 2FB3A 5E93A 2EF9A 2ZA1A 3ABRA 3L0NA 3L66A 1JQXA 3PC0A 1FX6A 5KMYA 1O60A 2H6RA 2Z6JA 3VKJA 1XUUA 3D0CA 1FCUA 4NJKA 3MWAA 4UMCA 3RFAA 3L0KA 1LLWA 3W1NA 3DI0A 3NQ6A 1NVMA 3MI2A 2NV1A 1WX0A 2CZDA 2BZNA 3C56A 1F2JA 1M7OA 3OVRA 3IGXA 3MYOA 3LCXA 5D09A 2OMAA 3TMLA 2CZEA 2VEMA 2QCHA 1JULA 1F73A 3EXTA 4FHAA 1SPQA 1OFPA 3UZJA 2DZTA 1JUBA 3A23A 2ZRYA 1SSDA 3S42A 3NM1A 3LXBA 4OWGA 4UTLA 1WV2A 1V7YA 4JR5A 3W86A 3UNDA 2DZPA 3A24A 3SFKA 3NQDA 4LVBA 4CCCA 2FDSA 3LHYA 2BXVA 5CSRA 4LT9A 4S2CA 3G1AA 4CNNA 3HQ1A 4JTTA 1OX4A 4L4MA 4FX7A 4BR1A 1YDVA 3PBUA 5BRBA 4IX2A 1XBXA 3WJWA 3O6YX 3USBA 3B03A 2ISSA 1KTBA 3B05A 2CU0A 5F1UA 2DZXA 2OJPA 4W9TA 2DJXA 4UR7A 1BKSA 4JX5A 2A7RA 3UY8A 1ZJIA 4K8HA 5F2LA 3W71A 1I45A 7TIMA 3NQEA 3I7RA 2H3BA 4CNPA 3UWQA 4FNQA 1EPXA 4O12A 4OHQA 4C1LA 3BO9A 5CZSA 3W7RA 4O1DA 2VC6A 4LC6A 4IXXA 2QJIA 3SR7A 2E6DA 1FDYA 4TU1A 3ZWTA 3W7CA 1KM1A 2VELA 3UXDA 5I3GA 2QJGA 2ZZ7A 1X1OA 3NQCA 4KWVA 5CPLA 2Q3OA 4LUIA 3LRKA 2ZZ2A 4KFPA 2ZCGA 3NQGA 4JTUA 3LRMA 4L4LA 4LRSA 1RR2A 1A50A 3H55A 1H7PA 1VYRA 3ZFHA 1I2NA 3M43A 2EHHA 2TMDA 2NZLA 3GDKA 4Y8FA 1QPOA 3UWZA 1YTEA 1G7UA 4JXCA 1SW0A 2RDWA 2YFOA 1EEPA 4PL1A 1W3IA 5F4SA 3LCFA 3W7OA 1LZOA 4E2DA 3NQFA 1DKWA 4NXSA 4MZ8A 1BWKA 4KFOA 1H1ZA 3C61A 5HMSA 1C29A 3KRSA 4BI6A 3W9ZA 3GDRA 1QDSA 3UWYA 1QO2A 3STFA 2QCMA 4AB4A 3VE9A 4N2YA 1SR9A 2E6YA 3S1VA 3PUEA 1MZHA 3SGUA 3C8FA 3TROA 3IVSA 2ZZ6A 4ZQMA 3TK7A 3ELFA 3G0XA 1TRIA 4IWWA 2G95A 3T44A 1ZENA 3TH6A 2Q3RA 2A1YA 3L0GA 4AF0A 5AC8A 2AAMA 5G4EA 1VRDA 1ICPA 2E68A 1W3NA 3W2LA 2HMCA 3PBYA 2H90A 4NZJA 4LVFA 1L9WA 3I6RA 3NPUA 3R13A 2ZZ1A 3IVUA 4Z1BA 3FA5A 4BFAA 3GKFA 2O7SA 2W6RA 4HN4A 1Q6QA 3FJLA 2X1UA 1I2RA 1DJQA 1NEYA 3W22A 1H63A 2RHGA 1RZMA 3M47A 4UNKA 4NNBA 2RKXA 1GQNA 1DL3A 3KX6A 1EUAA 3P8JA 3L9CA 2QCDA 4LS1A 3PSVA 4O52A 1OX4B 4NVTA 3L5MA 2FPVA 3QPYA 4TX9A 4S2BA 4RLIA 4FX6M 1ML1A 3P61A 3TMQA 3UXAA 4K37A 4Q33A 5BW6A 1XBZA 2QDHA 1YXYA 1LM1A 3DI1A 1G67A 4HPXA 4NJHA 1GOXA 3K30A 3MHGA 1BWLA 4TIMA 3TCEA 3KOFA 1JCXA 3C3NA 4MJMA 1G6CA 4WY0F 2ZFAA 3W7EA 3VE7A 1DBTA 4KFNA 2ZA2A 5DCEA 3DZ1A 4A21A 3E9AA 4DF2A 3BW3A 1LLZA 3EWUA 1JRBA 1R47A 4IJBA 1FDJA 4UTWA 3W7JA 1QO5A 1JQVA 1WA3A 4O28A 1MO0A 3FEMA 1JRCA 3EKLA 3TE9A 1M5WA 1FWNA 1IGSA 3ANYA 3W83A 1AG1O 4UFKA 1GJPA 3KVLA 4K7YA 2VFDA 4AWTA 3PM6A 4UC5A 1R46A 3BW2A 3C2OA 3MI3A 3LHVA 3N3MA 3A9IA 2ZRXA 2TPSA 1VH7A 2KZHA 2NV2A 2QUTA 3W88A 1VR6A 3THQA 4MPQA 3TSBA 1OX5A 3O05A 1ZAHA 1FDZA 5HWJA 1H7WA 4NJGA 3F4NA 5DXYA 2Z1BA 2VFFA 1VPXA 4ALDA 4DO4A 3OEXA 3PS7A 2ZBTA 2A5HA 3LERA 1TPEA 1GTEA 4JTLA 2C1HA 3QQ1A 3UPWA 3C2VA 4Q32A 3W1PA 5LZLA 2C14A 3W7LA 3WK3A 6TIMA 3DFQA 3WJSA 4WXZA 5LNSA 2NX1A 1Z42A 1ZFJA 1W37A 4MJZA 1GYNA 3GXPA 3FFSA 2HTMA 2ZRVA 3DENA 3HGSA 1O5KA 3BGJA 1K02A 3UWWA 4AF0B 3M44A 5CZTA 4XTIA 3W7IA 2F7FA 4JTKA 4GNJA 3B8DA 5CPOA 3LXAA 4BWLC 2WPBA 1I2OA 3P82A 4JTFA 2FFCA 4NU7A 2J6XA 2Q8ZA 2LLEA 2QDGA 1YTKA 3GKAA 3STCA 3BG5A 3YPIA 4GE8A 1R2TA 4BI7A 4ADUA 4DXVA 3S5YA 1IXQA 3KFTA 4EOUA 4RK8A 4CCDA 3NNTA 3KVMA 4IUOA 4O50A 3Q94A 1P5BA 3TQKA 3P67A 3QC3A 1O5XA 3NEVA 1QPQA 5GVJA 2QCDB 3OG3A 3A22A 3DH7A 4GBUA 3W1LA 3S1UA 1G4TA 3N2XA 1EX5A 2EAWA 3TW6A 3UYCA 3QEZA 5MHBA 1I2PA 3QSRA 1OK6A 5AHMA 1RQHA 4O53A 4IMGA 4PEKA 4JN6A 5IM51 3L65A 1LOLA 3STEA 4O0KA 2A6NA 3EX1A 2P0OA 2QAFA 3EX4A 1K7EA 4NJJA 3S8HA 2WSQA 1PHWA 3EXRA 3U8GA 2A2IA 5AB3A 2Z6IA 1OFEA 3MMTA 4FF7A 1N55A 3KAOA 2ISVA 3G1DA 3JS3A 2Y85A 1HO1A 1UBSA 4FB7A 5A5WA 4UXDA 1QNVA 3HO8A 3JR2A 4QNWA 2DU2A 3W1RA 2QCNA 4YL2A 3M5YA 4Y90A 4E38A 4JTGA 3IVTA 2E1DA 1YYAA 2EGZA 3P84A 5D2YA 2R8WA 4KWWA 1KM6A 3NVTA 3ABOA 4LVAA 3P62A 4X22A 1G69A 2WJZA 3SW6A 3N9SA 2CLLA 4EF8A 3HG2A 4B5NA 4UIOA 4A2RA 1OABA 3CWOX 4O4VA 5K9CA 3NGJA 2YR1A 5G4WA 1RVGA 3TUUA 4QIUA 1SZFA 1AMKA 4O1BA 3W1AA 4RKAA 3WK2A 4NX5A 4K6AA 3BG9A 3W3OA 1OFRA 4AH7A 5HWNA 3GVGA 4ZQOA 5LNUA 2BLEA 2ZYFA 2ZRUA 1ZY9A 3TNOA 2GQ8A 3LHWA 3LV5A 4DELA 4Z1CA 3LTYA 1TV8A 1IIGA 1W5NA 3GR8A 8TIMA 3L21A 5I3IA 1OFQA 3C0JA 4AHQA 2TRSA 1IF2A 3G0SA 4R53A 1PHQA 1K7XA 2R91A 1I4NA 4RZ6A 1VYPX 1OFDA 4UTTA 3GNNA 1RD5A 3DFTA 4N02A 5D2XA 4U4MA 4IX0A 2V2HA 2OX1A 2X2GA 2X1RA 1CX9A 2CLKA 3EWZA 4EIVA 3N14A 4G1KA 5G1YA 1KBJA 3KVJA 4XBSA 3ATZA 2WV8A 5IBXA 1A53A 2P10A 2YGYA 3G1YA 3LX9A 4HKPA 5D03A 1YPIA 2WOQA 4O54A 3UD6A 4PA8A 3EXSA 3LCLA 3H53A 1L6WA 1WOAA 3TV8A 3OBKA 1OYCA 1TTQA 1DVJA 1W5PA 3BVJA 2Y7FA 4IXHA 2PURA 1TPUA 3G8EA 4O19A 2V2CA 3IV3A 1XM3A 2B7NA 3S0CA 1ICSA 3C4UA 3O07A 4ZQNA 1TPC1 1FUYA 5K4XA 3S1WA 4OU1A 4RCXA 1SFJA 1XCFA 2Y63A 2C6QA 3W2NA 1EB3A 1KM4A 3T78A 1LROA 5DXXA 3W85A 1O4UA 2HS8A 5DBUA 3MHFA 1QMLA 5TIMA 3TXZA 3T4CA 1C8VA 2NLIA 3R12A 3EX2A 2YYTA 3W2JA 2V5LA 1AW1A 3S5OA 3G18A 4ADTA 2Y7DA 1L2UA 1W54A 2PRHA 4EF9A 3LRLA 3ABQA 3MHUA 2CLOA 2ZZ5A 3B04A 4JTHA 4MY8A 3NXFA 4MY9A 2ALDA 3TSDA 4KKXA 3KRZA 4BI5A 1GPWA 1A5AA 2YPIA 3PB2A 1NF7A 1Y0EA 4EWND 2QCCA 3QH2A 1F6PA 1TPB1 1KFBA 3CEPA 1S5WA 3DGRA 3I68A 3QJAA 4O1AA 1DORA 3I7SA 3W72A 3ABSA 2Y88A 4MKNA 1VCFA 4ZL1A 2H8XA 1SU5A 1YTDA 4GUHA 1VYSX 1S3HA 5BOOA 3BPWA 3OA3A 5HR7A 2J9ZA 1F5ZA 1S5TA 1HFBA 3V1PA 4AXKA 3THAA 1OJXA 1X6UA 3M5XA 4CCEA 4TO8A 4FO4A 4CNOA 1H51A 3S1XA 3QZEA 1PL9A 1TJRA 1L6YA 3SJ3A 1OFAA 1OYAA 1LDCA 4LUJA 3GAYA 5LHFA 2YYUA 4E2BA 2J9XA 5EA9A 3NQAA 5LHEA 5D2TA 1D3HA 3HGOA 2ZRZA 1K7FA 2X30A 3WFAA 1K8ZA 4N4QA 1VS1A 3UQNA 2FLIA 4MLJA 1FCQA 4LC8A 1YXCA 1BTMA 3P5ZA 5BNKA 3CPRA 5D04C 3NPXA 3TFCA 2NXGA 4RZ5A 3W74A 1Z44A 1H50A 4X9SA 2A4AA 1YLVA 5LNVA 1GTHA 1RPXA 1TREA 4FNSA 3PBWA 1LCOA 1O94A 1GVSA 3OIXA 1TB3A 3EEGA 4UFIA 3A5FA 2ZQ0A 3IIXA 3M5VA 1UJPA 5C2XA 4IMEA 3CB8A 3DFNA 1I2QA 3IGUA 4YCPA 2JGYA 3HG5A 2NUWA 5LNWA 2ZRWA 1KTNA 5F1VA 2WQPA 3LCHA 4Z0JA 1LYXA 3M41A 4UFJA 4OV9A 2QCEA 3G1XA 4GUFA 2G97A 1R2SA 4FNTA 2UV8G 4QSHA 1ZAJA 4OT7A 3BW4A 1GG0A 4AAJA 5EBUA 2PRLA 2E6FA 2NXIA 4MZYA 1XBVA 4QITA 3GIYA 4MYAA 2EPHA 3O16A 3W73A 4XWUA 1SW3A 3GAKA 5F2IA 2DP3A 4DO5A 3RLVA 4I7WA 5DBTA 1WBJA 1EWEA 1PS9A 4IPJA 1TQXA 5KINA 4JX6A 4JYFA 3S5NA 1P4CA 4A29A 4AWUA 5EYWA 4JTSA 2C13A 4P61A 1TIMA 3PY2A 1AK5A 2V5BA 5T26A 3LHTA 1QCWA 4HNTA 5SWUA 4ZMGA 3B0UX 5L6UA 3M5ZA 1SZGA 5FEWA 5AYXA 5HULA 3TQ0A 3W2KA 3PR2A 3TXVA 1TRDA 3TQVA 1KM3A 1S5VA 4MUZA 1SO3A 2Q8LA 4LTSA 2B7PA 4PH6A 4K36A 2R14A 2Y89A 4PC8A 4NT0A 3N19B 5C6MA 3NQVA 3IGSA 1TV7A 2BWGA 2NXHA 4BF9A 3MBDA 5HR6A 1DHPA 2BX7A 3GR7A 1VZWA 3L5AA 4ICNA 1XDLA 3UZ5A 1H7OA 1F05A 5BMXA 4DBEA 5AHLA 1EP2A 2ABAA 4Q4KA 3JRKA 1OFOA 1N8FA 1OK4A 3M9YA 3R2GA 3WJZA 3PG9A 5LGXA 5KTLA 1BEUA 4ORIA 3QF0A 3DU0A 2V9DA 1ME9A 1JCNA 1HL2A 5AHNA 5DCBA 3HIJA 5K4ZA 1F74A 2C18A 1FWSA 1UUMA 2YW3A 4UUIA 3WJXA 2I14A 2DZWA 3OVQA 5D33A 5J5RA 1H62A 1DOSA 1V5XA 2X1SA 4JY9A 2NWSA 1JR1A 1T0OA 3F4WA 1SUXA 3RNDA 2I9EA 2R94A 3N2MA 4FX8A 5HUOA 1JCMP 1TTIA 4WOZA 3RF9A 2NUXA 4O18A 2YXGA 2E09A 1QWGA 3C6CA 3EWYA 4MIMA 4M5PA 1KFLA 1TTJA 5G2WA 1HUVA 3NL6A 3BGGA 1J4EA 1K03A 3C2FA 2J24A 3VFLA 3QMTA 1HG3A 2QJHA 2OT1A 4JTIA 1B4KA 3PBVA 3SI9A 4C1KA 3TW7A 2DJLA 3Q2DA 2YSWA 3HBLA 4HIBA 4UTUA 1LORA 2V0TA 4N9DA 3GX9A 1DJNA 3QPZA 1CW2A 4RX0A 1OVDA 1W5OA 1QAPA 2NX3A 2GQ9A 5DY3A 3G24A 5HUPA 3MP5A 4ONVA 3AJXA 4JY8A 1P1XA 5AHIA 4Z1AA 4CQ8A 1OYBA 4DPPA 1GYLA 5HJLA 3W70A 2ZZ3A 1KA9F 2AGKA 3NOEA 5FI8A 3W7NA 5AYZA 3A21A 2WNNA 1DQXA 5G5IA 2V30A 1KM2A 1C9DA 3M6YA 4MFDA 2IQTA 1NF0A 1SO4A 4RXFA 2J88A 4JYEA 4LW7A 5AOUA 4A2SA 5EMUA 1XI3A 1W3TA 1LBFA 3NQ8A 3EB2A 3C52A 3LOTA 1WXJA 5CPMA 1XBYA 4H3DA 3C2RA 3BG3A 4O16A 5CG7A 4UFMA 5IBXC 3DAQA 4NX0A 3EX3A 4IGHA 1OF8A 4O14A 4DQWA 1OHLA 3N9RA 3NZRA 3UWVA 3W84A 4FEZA 3T55A 1H61A 3SZ8A 1HO4A 3FS2A 3NM3A 4HHPA 5F2MA 4Y9AA 2VFIA 2Y70A 5D38A 4OQVA 1T99A 2CLEA 3MJYA 1TJPA 3PVFA 1NAL1 3TIMA 1RV8A 4MLRA 4GUGA 4IMCA 2FB2A 2DZVA 3VI2A 4I9AA 4XBKA 3O8AA 4NJIA 3WK1A 1GZGA 4UMAA 4ZQCA 1EP3A 5DN1A 3MUXA 4LY8A 1LRQA 1ONRA 2QEZA 1AL7A 5U7SA 3CIXA 2EKCA 1GEQA 4D2JA 1FCVA 2ISWA 4K8EA 3PUDA 2Y7EA 2VFEA 5K7JA 4JYDA 3O1NA 4PL2A 3HMJG 4JTJA 1WOBA 5K2ZA 1EUNA 2QUVA 2FJKA 3KRUA 3W75A 1QOPA 1YXDA 1OF6A 1LTDA 1RQBA 1Q6RA 1H60A 3DXIA 4I7UA 3G22A 2Y7GA 2DORA 3CQ0A 3NAVA 5LSMA 1WYIA 3Q37A 4OGZA 3W87A 3T7VA 2GPTA 4R34A 3QSTA 4O57A 4J9JA 3TDFA 3IRDA 2YFNA 1ZALA 1A5CA 2ABBA 2A7PA 3TAKA 3S9YA 2C15A 3LGEA 4I7VA 3HG3A 4K38A 4LS0A 4R33A 3O15A 5FEPA 1GVOA 4FIQA 1YPFA 4OV4A 3LDVA 1U83A 5KSWA 2F84A 3FOKA 3VCRA 6ALDA 4GRSA 3QYQA 1DV7A 1H7NA 5CGQA 5HQEA 4PODA 5BMWA 1FBAA 5K3VA 1TSIA 4ZQRA 4HT3A 1SSGA 4H6KA 3GDMA 3MBFA 3W1TA 1VLWA 3NDOA 2V8ZA 1I8JA 3PF3A 2G96A 5G2IA 4M6QA 4DF0A 3AO0A 1CI1A 1K3UA 5AYYA 1KV5A 4Y6GA 1MEHA 1EP1A 3SIZA 3W76A 3HPSA 4MOZA 2HSAA 3B4UA 3RMJA 3FKRA 3DHDA 2JGQA 3W7DA 1TQJA 3HGJA 2CZFA 5D02A 5DY2A 1LOQA 5FEXA 2FTPA 1TTPA 3MYPA 3L68A 3QMSA 3O63A 2J9YA 3NA8A 4UMBA 3DFPA 4WXYA 1ALDA 2QCGA 2JBMA 5I3FA 4EVZA 4E0CA 2TYSA 2QCFA 1YDOA 1A5SA 1FQ0A 4Z08A 3L67A 3O6CA 4MZ1A 2VFGA 3FJ6A 2RDUA 5FEZA 2PCQA 1VC4A 5D05A 3CC1A 3G8RA 3HPZA 4N9BA 2FQIA 3BV4A 3QW3A 4YCOA 5A8GA 1FXPA 2O7QA 5TBOA 1YDNA 4JDYA 5D2VA 5HNRA 1ICQA 3F03K 1NSJA 3G0UA 4K7VA 1W1ZA 4OBTA 3BLFA 3KVKA 5LNRA 2VENA 1O95A 4LNYA 4IMFA 4FNUA 2E77A 1WBHA 5TQLA 1F7BA 2A0NA 2E5CA 4FNRA 4LV9A 1TMHA 2CLHA 4DBDA 2I1OA 2W0UA 3HOJA 5DCDA 3B0VC 2J27A 1JCJA 1VCGA 1D9EA 2FPYA 3PG8A 3RK8A 2WSRA 3PUOA 3CM4A 4WZHA 1FY6A 1JUEA 3NPWA 3W23A 2A6LA 1H1YA 2V82A 3B06A 1JCYA 4RXGA 3PSWA 3W07A 5F2GA 3R89A 4O0ZA 4GWEA 4NQ1A 1KW1A 5K9XA 3NPVA 1G4PA 1Z48A 1ME7A 3SSJA 4UTMA 1H5YA 5CSSA 4HPJA 5D37A 2E5DA 2P1FA 1GT8A 3WJYA 4JDBA 4A22A 3BLEA 2Y6ZA 4H4IA 1W0MA 1THFD 4WUIA 1T96A 3DBPA 3LBCA 3IEBA 3O06A 3E02A 1KTCA 1VJIA 4MY1A 3WK0A 1R30A 1LOSA 1OG0A 3FYPA 2XN2A 3GLCA 5F4WA 4MYXA 1HTIA 3NO5A 2H8ZA 2WNZA 1XDMA 4NNCA 1VQTA 1EWDA 3ZWSA 3TKFA 3W7GA 5L9FA 4PCFA 2DZUA 3W1QA 2X16A 3GYEA 4POCA 3L5LA 1F76A 3NL2A 3ZS4A 1FCBA 4Z0SA 4UTWC 5I3KA 3TC6A 3NQ2A 3FIGA 3CU2A 3NQ7A 2NWRA 3EWBX 4LS2A 4YLWA 4JICA 3W1MA 3PAJA 3I65A 3LBMA 1P0KA 2VXNA 3EWWA 4CQ9A 2C19A 3E0IA 4WJEA 3GDLA 3TU9A 2PE4A 4UFLA 3MW7A 1E51A 2GUUA 3P74A 4R7JA 1P0NA 3W1UA 4GXMA 1VHCA 3BARA 5FF0A 3CT7A 3TR2A 3F1QA 3PWAA 1Q3NA 1TPH1 1QOQA 1PV8A 3TX9A 3HJZA 3R5EA 4TMCA 3HGRA 3HF3A 4JIQA 3QW4B 4LWWA 3ZR4A 1IXOA 3FYOA 1X1ZA 2RH9A 2BSLA 3A5VA 1X7FA 3GDTA 4M7TA 3B0PA 4JGDA 1Q45A 3E49A 4GJ1A 1GG1A 3NQMA 1G4EA 1TPVA 1ZCOA 3LCWA 4NZFA 2VEKA 3U6WA 5AFDA 4U28A 1VCVA 4N9CA 3TSMA 3LXCA 3CIWA 1GVQA 2XFWA 4ORMA 4XTDA 2CLFA 3M1ZA 1SO6A 4CQAA 1W5MA 5CZ0A 4AHOA 1LRTA 4O1CA 2V81A 2CFFA 3MP4A 2B0MA 1K8YA 1A5BA 3MP3A 3N73A 1IXNA 4LVDA 1ZAIA 2PC4A 3LHUA 2CLIA 2GVGA 3CEUA 3IIPA 4ML9A 4M19A 1UCWA 3LCGA 1FWTA 4JS3A 5CKSA 1VLIA 4HNNA 1JCLA 4CLMA 1H7XA 1KBIA 3KHJA 1IIHA 1ZHAA 3QRHA 3N34A 1XXXA 4Y96A 3IIVA 3CHVA 1MEIA 4ZQPA 5DLCA 2QR6A 1H7RA 3W7KA 4MFEA 4RJEA 5AHFA 1TYGA 5I3JA 4FNPA 4UTKA 2D73A 2ZDRA 1R2RA 5D2WA 4AEOA 1ME8A 2H3DA 2OCZA 1LRNA 3QFEA 5EL1A 5HINA 4AMAA 3LB0A 1GVFA 2XN0A 1KV8A 3P5YA 4DPQA 5KITA 4GFSA 1TPDA 2VFHA 4O4WA 3P81A 3W2UA 1PCKA 4AWSA 4WY0A 1F6KA 3M7WA 2B4GA 5EY5A 1B3OA 2HS6A 3TJXA 4BK9A 5AN7A 1TV5A 2QUUA 2C16A 4QM1A 5LGZA 2VEPA 5KZDA 1N7KA 3IIOA 1XC4A 1FWWA 2GJNA 1PVNA 4DF1A 4O10A 1D3GA 1LP6A 5HWMA 2GVJA 4DEFA 1U5JA 3GB6A 4NUWA 2C3ZA 3GZ3A 1B57A 3OVPA 1DQWA 3LM7A 3FKKA 3NG3A 1QPNA 4IQLA 4LU0A 3OHIA 4N6FA 3SY5A 4FIRA 4N6EA 4Z1DA 3LLFA 1UASA 2GVLA 2WSYA 3GK0A 4A3UA 3LHZA 2ZTKA 1JJKA 2JKAA 1MXSA 2GQAA 4YWIA 3DKJA 5K9DA 1UUOA 4WQ6A 4UTJA 3GNDA 4RR4A 5LKYA 1QR7A 3BLIA 1XUZA 4IPIA 1T8XA 1ADOA 4XKYA 1SFLA 5FESA 4HSNA 2CLMA 5D30A 2RFGA 3FLUA 2V2DA 1L6SA 1LBLA 3R8RA 5C54A 3KXQA 1B9BA 1LBMA 4HNUA 2BTMA 2NUYA 2ZZ4A 4UCGA 1KFCA 2C0AA 4HSOA 2A7NA 3HB9A 4XZ9A 3TFXA 4LOCA 5F4XA 5FF3A 4UTTC 2GJLA 3HG4A 4UTHA 5DELA 2CW6A 4AHPA 4UR8A 5CZJA 3STGA 3EX6A 4YMZA 5EKYA 2A21A 4O11A 3P80A 1K8XA 1OX6A 3RU6A 1Z41A 1GVRA 2JK2A 1QFEA 3SGZA 4QAIA 4GUIA 2QKFA 3SECA 1KLYA 1OFBA 4K39A 5H91A 3UWUA 2YCEA 4QISA 5AC7A 3LI0A 2DZSA 4M7SA 4RV8A 5H2ZA 5C55A 3TC7A 4UTIA 3W6YA 4JEQA 1SW7A 4GC4A 3E96A 1X8FA 1EA0A 3IIZA 5ABTA 2Y61A 3M16A 1XL9A 3LTSA 4O15A 3G3MA 4QNEA 5CPNA 3W7HA 3I7QA 1KLZA 2TSYA 3UPBA 1Q6LA 1VGAA 4YXGA 2FPTA 2NX9A 1AL8A 3LI1A 1M7PA 5FF2A 4N4PA 5FF7A 1KM5A 1AW2A 1JVNA 2VKZG 3L2IA 1W31A 4WOQA 2CZ5A 1XFBA 3NL3A 1TO3A 3DFSA 5G2HA 1JUKA 5KZMA 3TJLA 4WX2A 3TA6A 2VEIA 1KFJA 3GXTA 4XUGA 3BK0A 3G1SA 3G1HA 1M6JA 2E6AA 5E0KA 2W79A 4WY0B 2B7OA 1TPWA 2A85A 3MO7A 4S1FA 2PRMA 1ZNNA 1TPFA 4GUJA 1G4SA 3S5ZA 3EWXA 3G3DA 2G5WA 4UNLA 4QJ1A 3LTPA 5AC6A 2RDTA 3ATYA 4WD0A 2Z0IA 2CWNA 3U2OA 1WAUA 3P7YA 4NXKA 2JKEA 3W7PA 2WNQA 3DFOA 4O13A 4XQ6A 1MEWA 3M0ZA 4LRTA 2YX0A 1RQEA 4PTNA 4JX4A 2B7QA 1J2WA 2JKPA 5G1TA 3MI6A 1GWJA 2QCLA 3H54A 2ZTJA 3DKLA 4NNAA 3CWNA 4JNMA 2ATSA 3S6DA 4IMDA 2X1TA 3RLUA 4X3ZA 2FIQA 4FXRA 1MSSA 3O6DA 3G1VA 2WKJA 4QQ3A 4LVGA 1FXQA
chains in the Genus database with same CATH superfamily
3H24A 5LA0A 3NL5A 1IV8A 2J78A 3EGJA 4O17A 2O9OA 2VZTA 2F6KA 1PTGA 1VEPA 2XVKA 4XKYB 2BP1A 2BXYA 3W7QA 1HJSA 1PCWA 1W8SA 3SUWA 1A0CA 2OR2A 3T07A 5DO8A 1EO7A 2NW0A 1W56A 4XX6A 2AL1A 1Q6OA 1N2VA 1BYBA 1HF6A 1UC4A 4H9ZA 5A6BA 4M6PA 1WUEA 4N9EA 3EYPA 2Y8UA 4KT2A 2V69A 3CLMA 2O4MA 5U4NA 2AMXA 3BCDA 5E1QA 3DHFA 4X2RA 1A5LC 3R43A 1WDWA 3UF9A 5JH2A 1GKRA 3UY7A 3WLIA 2J66A 2QJJA 1KCXA 2Z1VA 3TAOA 3RMEA 4OE7A 3EKZA 4PCPA 5D32A 4QROA 1JXKA 1KFKA 1JI1A 4DO6A 1P0EA 3GXNA 4YTTA 2OXNA 4BWLA 3F7JA 5J5DA 2Y62A 3QQ0A 4MWAA 3CHCA 3NR0A 1A5UA 1PKMA 5B80A 4XZHA 2VEGA 2IMRA 1J11A 1IXPA 2FB3A 4OBRA 3GFYA 4C6MA 3ABRA 2DQWA 1XLAA 1OCQA 3PC0A 2DDXA 1O60A 3WD2A 3L4UA 1JPDX 3TN3A 2BVWA 4I5UA 4WVXA 1FCUA 3MWAA 1XYZA 1QNSA 3RFAA 3N4AA 4FOUA 2NQ9A 3U2CA 1WX0A 1JZ2A 1UUQA 2D22A 2BOEX 1F73A 4WGXA 3OHMB 1DWFM 1OFPA 4C6CA 4LX4A 4H9XA 1C7TA 3SY1A 1E4NA 3GFZA 4PRRA 2PDYA 3UNDA 3VZXA 3NDZA 2GGGA 2Z28A 1G0CA 4QJ5B 3QTPA 5BU9A 4JTTA 1OX4A 1BGAA 1SYTA 3GR4A 4FX7A 4L4MA 1P6CA 1Z69A 1YDVA 4NASA 5CJMA 3R0DA 3DHPA 3UEQA 4DO7A 2PZ0A 1J6PA 2E4TA 3SRHA 4OUEA 3WLNA 3B03A 1RD6A 2HDJA 3BCJA 5M5DA 3B9DA 2DJXA 5I2UA 4UR7A 1BKSA 2A7RA 1GOWA 4K8HA 4G56A 7TIMA 3NQEA 2GDUA 1EPXA 4L64A 3T09A 1FHUA 1D7FA 4GD0A 4FOKA 2NLYA 4O1DA 4LC6A 4CEUC 2YB4A 4IXXA 4R85A 2PFHA 2QJIA 2XGIA 1GK8A 1FDYA 1JNEA 4TU1A 3EAUA 2VELA 3UXDA 2INEA 1X1OA 4KWVA 2Q3OA 4IM4A 1R9XA 4KFPA 3CWHA 3NQGA 1LWIA 3H55A 2P5NA 2QUMA 2PA6A 3QY8A 3M43A 2TMDA 2PTZA 1NP0A 1TWZA 2NZLA 2ODOA 1QPOA 2YFOA 1W3IA 5F4SA 3LCFA 3NQFA 1DKWA 2Z7KA 3C61A 5KETA 3GDRA 1QO2A 1KFWA 3EOEA 3VE9A 4AY1A 4PTMA 2E6YA 1DJHA 3PN8A 3S4TA 3SGUA 3GM8A 2QIWA 1KBBA 3C8FA 2AL2B 4HTYA 1JYNA 4ZQMA 3AAMA 3UXKA 1TRIA 1V08A 3WQFA 4CNSA 1UJQA 3RLGA 3NDYA 3UJEA 2ZVRA 2YZ5A 5AC8A 1FHLA 5G4EA 3E5PA 4EKJA 1VEMA 1VRDA 3C0SA 3W2LA 4ICCX 3KCLA 3PBYA 3GUWA 2WCGA 4YPJA 2IQDA 1V3LA 3IVUA 1DIEA 1NDVA 3GKFA 1Q6QA 4KEVA 1OC5A 1RZMA 4UNKA 1CGVA 2WCSA 1EUAA 4F0HA 1R3YA 3PSVA 4O52A 4W5ZA 4NVTA 3L5MA 1P7TB 1EZ2A 4S2BA 1PDYA 3BOFA 3P61A 1S2VA 3UXAA 2OU4A 4CVWA 3ALGA 1TZ7A 1W3HA 3SRKA 1G67A 4HB7A 2WVTA 1GOXA 3GW0A 3K30A 4TTGA 1BWLA 4IL0A 5I3DA 4XZWA 1E6QM 1JCXA 3WF0A 1G6CA 3OVGA 3WDRA 2JIWA 3IJLA 4MAVA 2AOSA 1AODA 1B0IA 3ERPA 4LF1A 5DCEA 4A21A 4I90A 4GLEA 4K1GA 1AQ0A 4DF2A 3COTA 3U5YA 4HA0A 3B8TA 2GLKA 2ZWYA 3VKDA 2YA2A 3GU2A 4F0MA 1UR0A 2Z2AA 3EWUA 4NIRA 3OLIA 5I06A 4IJBA 1FDJA 3RHGA 3W7JA 2XIBA 4M24A 1JQVA 3GNRA 3VCNA 1LQAA 2NVDA 4W7UA 1IT7A 4HMNA 2CXEA 3W83A 1TR9A 1GJPA 3KVLA 4K7YA 4C6QA 4WSJA 4ML4A 3PM6A 5LIXX 1R46A 3BW2A 2KZHA 2NV2A 5FSDC 4R7OA 4Z2GA 3THQA 2PDGA 4PUKA 3O05A 5DXYA 4NRRA 3GQYA 4ALDA 4ZE5A 4DO4A 1ZU8A 4P8VA 1EBGA 4JIEA 3LERA 2QS8A 2JALA 3QQ1A 2XM1A 3L23A 4Q32A 3W1PA 5LZLA 4DWDA 3MB9A 2C14A 1RBOB 2FZDA 4IPLA 3WJSA 5HDRA 5LNSA 1DWAM 1ZFJA 2OO0A 3WQ8A 3KS5A 2ZRVA 1EHAA 3WF4A 1FH9A 3AU6A 1CXKA 3UWWA 1K02A 3GO2A 5BOEA 1LF1A 4XKMA 5CAKA 4XTIA 3W7IA 4XVEA 3JZEA 1BQGA 3B8DA 1GHRA 5CPOA 4C6LA 1TWWA 4BWLC 3P82A 3UBPC 2FFCA 4IL2A 4JHMA 3HJEA 4AIUA 3GKAA 3BG5A 3YPIA 1R2TA 2WB5A 4DWSA 4GX8A 4J7RA 2HXUA 3SCNA 3TQKA 4AU0A 4MGGA 3T1GA 3OG3A 5D4YA 5E0CA 1PYFA 2XIIA 3AYTA 3W1LA 1G4TA 3ARXA 3UW6A 5HMFA 3QEZA 1TMQA 1UIOA 4V1YA 3N3TA 1KRCC 4GGBA 1I2PA 3QSRA 1Q66A 3WLQA 1FKXA 4J4KA 2PGFA 2INFA 4K68A 1ZP4A 1O1HA 5CPSA 5AY7A 3VNYA 3VKKA 3W4RA 1RQHA 4O53A 3IANA 4PEKA 5IM51 2VL4A 1DJYA 3A13A 3WSUA 3LBOA 1KXHA 3L2MA 3EX4A 1K7EA 4NJJA 2WSQA 1UPPA 3U8GA 3P6LA 3ZVHB 1V3MA 2DIJA 2Z6IA 1OFEA 3MMTA 1OCBA 1RJPA 1HP5A 1ZCCA 1F3WA 3KAOA 1FH7A 2VD9A 1EOMA 3K1DA 3SO7A 2WKGA 3UETA 3WNLA 1UH3A 3URNA 1V6UA 5IRPA 3IVTA 1YYAA 3P84A 1XDJA 4F9JA 4M82A 2GUYA 4LVAA 1BG4A 3N9SA 4GO8A 3CWOX 3CUZA 3A12A 4QIUA 1SZFA 4O1BA 3W1AA 4RKAA 4LNCA 1Y65A 3BG9A 3W3OA 4A6GA 1OFRA 1FOBA 4AH7A 4HU4A 4OOZA 2I7GA 2ZYFA 1D7KA 3C8NA 5ABFA 3R58A 1NWSA 2GQ8A 4KEUA 4QLLA 4UCFA 3LHWA 4F48A 2Z2BA 2YDRA 2XPKA 3LTYA 3VOFA 1VIZA 1W5NA 8TIMA 5H1WA 4IFRA 2VR2A 4DZIA 4CUCA 3ABZA 2ZWZA 5DQPA 3C0JA 2D20A 3E6EA 1JYVA 4F79A 1ZJBA 2TRSA 3G0SA 2Q01A 4RZ6A 4UTTA 1ONXA 4MHBA 1RD5A 3DFTA 3LPGA 5D2XA 4U4MA 3EMZA 4IX0A 2V2HA 4MM1A 5C7HA 3VUSA 2X2GA 2J7CA 1UWQA 2X1RA 1UKSA 3TYCA 2CLKA 1TZ9A 1VJSA 1KBJA 2XVLA 4XBSA 1OD8A 2WV8A 1A53A 3G1YA 2EG6A 1M9HA 2DVTA 3MANA 4O0QA 2PTXA 3WQ6A 3KTSA 3PHAA 2PU0A 1WOAA 2NT1A 1F8MA 1EOKA 2A3CA 2DUAA 3NYDA 1TTQA 1DVJA 3VAVA 1WKYA 3BVJA 4IXHA 3D3AA 4O19A 2V2CA 1DXFA 1XM3A 4A8IA 1ICSA 3C4UA 3O07A 4D8ZA 1FFQA 2PDIA 5K4XA 3S1WA 1DEDA 1UW9A 4RCXA 1SFJA 1XYBA 3TCSA 1RK5A 3ZT5A 1EB3A 3T78A 3W85A 3MHFA 2VMFA 3R12A 1RSCA 3F5JA 3EX2A 4GO9A 5E5CA 2XVGA 3E2VA 4ADTA 3G18A 1KO0A 4Z2KA 2E9BA 3TQPA 4Q8QA 3DC8A 2CLOA 1OC6A 3I10A 1CLXA 1NWUA 4Q8UA 3NXFA 4ZENA 4GIAA 4QE4A 2BG5A 4KKXA 1GPWA 2DVUA 1VJZA 3PB2A 2CERA 3CT2A 3LK6A 5CG0A 3MDUA 3LEPA 4GI4A 3RPDA 4QE5A 1M1BA 5ECUA 1DPMA 4RNFA 3W72A 3Q65A 4AX6A 2OG9A 5BOOA 3BPWA 4P7LA 2J9ZA 5JQ9A 1S5TA 5T9BG 2XH2A 2VR4A 3THAA 3M5XA 1XF0A 3EMCA 2E8YA 2QVHA 4JFUA 4HTBA 1W9UA 2PDUA 3OB8A 3QR3A 1QNRA 1SVDA 4LUJA 3M0XA 3G1RA 4A05A 3TWAA 5LHFA 2O56A 1LUCA 2D2OA 3HGOA 1R6WA 4A35A 1B3WA 3UQNA 2A3BA 2VO5A 4UQEA 1XCWA 3P5ZA 2F61A 3CPRA 3VGFA 2HNHA 2EPLX 2XDFA 4AYSA 2O92A 1YKWA 4EWJA 1IQ8A 1GTHA 2WK2A 1WZMA 4B3ZA 3MUY1 2VUYA 2W61A 3CUGA 2W4XA 4YVXA 3WNOA 3GTXA 1UJPA 3GVVA 9CGTA 1R3QA 1RLDA 5HANA 2VR5A 2YCKX 2OGJA 6A3HA 4FXJA 4YCPA 2PSNA 3ICJA 2JGYA 3ARPA 2NUWA 5LNWA 4R88A 4RE4A 3LCHA 4Z0JA 2BHYA 4OV9A 2QCEA 3GBEA 4KIEA 3SCRA 1TUXA 2UV8G 4QSHA 3T0DA 3MZNA 3WDQA 4D6IA 4JTAA 1QW9A 2WM1A 1GG0A 1O5QA 4C6KA 1V8EA 3MQTA 3S2MA 3N11A 4OFCA 2DP3A 4RDVA 4DO5A 3RLVA 3RILA 1EWEA 1PS9A 3MKCA 1TQXA 3H70A 3T4WA 2DSUA 5DMMA 5KINA 4JX6A 1EPVA 3S5NA 1P4CA 4A29A 4JTSA 3S83A 1BF6A 4W8LA 5T26A 2WC4A 4ES4A 4HNTA 4IFOA 1A5KC 5AYXA 5HULA 3FYYA 1H4PA 4Q8PA 3TQVA 5DRIA 4LF2A 1J0JA 1RJRA 4F2TA 5C6MA 2WVVB 2W63A 3SFWA 2VI0A 4KEMA 3NQVA 2NXHA 5EGRA 2YLLA 5HNTA 1PUDA 1B90A 1DHPA 2BX7A 3GR7A 2PLCA 5MF5A 4ICNA 3UXLA 1XDLA 1WZKA 5H8MA 4ZBCA 1SZRA 1VFSA 4DBEA 5DRCA 1EP2A 3NSXA 3JRKA 5AVHA 2Z24A 3KOXA 1OK4A 3RCNA 1P0DA 4XG1A 2PS2A 3WJZA 2RGLA 5LGXA 3HM7A 1BEUA 2NQLA 3EKGA 3QF0A 1HKKA 3DU0A 4S3EA 2V9DA 3SUVA 4HU0A 3H2CA 1HL2A 3KBWA 5DCBA 3HIJA 3KCOA 2XFYA 3HN3A 5CSUA 2VJXA 2PF8A 1MUCA 1Q7ZA 2I14A 3AS2A 1H62A 1FWJC 4JY9A 4F0RA 2NWSA 3RNDA 3MSYA 2IKGA 3N2MA 3Q67A 5G1MA 3CNYA 5HUOA 1JZ3A 4LAKA 2XTKA 2PTDA 2NUXA 4O18A 1US0A 1QWGA 3C6CA 3NIYA 1RJQA 1J18A 3NJ3A 3NL6A 4HZ7A 3QMTA 2OT1A 1SFSA 2JEQA 1B4KA 3PBVA 3TW7A 3PUGA 5HPOA 4QCEA 2V5DA 2ZX6A 4GG9A 1CBGA 4N9DA 4NZ1A 3ZO9A 1OVDA 2NX3A 1QAPA 3N13A 4I3GA 3G24A 3MP5A 3WLTA 4ONVA 1P1XA 1AQMA 5MKGA 3E0LA 5HJLA 1REQA 2ZZ3A 5DT5A 5FI8A 3RXZA 3OODA 2HPIA 4QE1A 3RX2A 1W1VA 4MFDA 3T8LA 2IQTA 1NF0A 1NM9A 1SO4A 5AOUA 4LW7A 4A2SA 5EMUA 6ENLA 1WXJA 4LALA 3BG3A 3DAQA 4RNHA 3MMWA 4W8AA 3QGAC 1JYXA 4NZ5A 1OHLA 2XVNA 3UWVA 5AKQA 1H61A 4AZGA 2ZUTA 1MW1A 1JPKA 4Y9AA 1XKJA 3C0QA 2VFIA 2WSPA 2W67A 1TJPA 1KQZA 5BXTA 1Y8BA 1UZDA 1MW3A 2FB2A 2OX4A 3QHNA 3L12A 3PTMA 1HJUA 1EJVC 5AVNA 3TNBA 3URAA 3WK1A 3I6EA 4LUSB 1GZGA 1EP3A 4BQ2A 2W66A 4LY8A 2R24A 2DFAA 1LRQA 1CGYA 2EKCA 2QPSA 1MDRA 1DE6A 2Y7EA 3PUDA 5ABEA 4JYDA 1HX0A 3T81A 1HGWA 2QUVA 3KRUA 1NJJA 1QOPA 2G4JA 1I6NA 4XAPA 1K8CA 1H60A 3LGGA 3VDHA 3Q37A 4OGZA 1NOUA 3SCVA 2GWGA 1BPLB 1MW2A 1WNOA 3PZ9A 3EMQA 3CUHA 3SCQA 2ABBA 2A7PA 4AW7A 4OTKA 1GZ1A 3LGEA 4MJ2A 4IJCA 4K38A 4G8TA 2EPKX 3UG3A 3OYXA 3CS2A 4HOXA 5FEPA 3AROA 3LDVA 1U83A 1MXGA 4GRSA 1H7NA 4PODA 1XH1A 5EFDA 4Q8OA 1A5OC 4DUOA 4EE9A 1VLWA 3GHUA 3NDOA 2XISA 3BH4A 4YIWA 1Z9AA 3UYIA 4PYSA 1QBBA 3TJ4A 1J5SA 3SGGA 3EOLA 5AYYA 1EP1A 4DUXA 3AS0A 3GVRA 2HSAA 3B4UA 3FKRA 3WNKA 4IP5A 2ZX8A 4L9ZA 5D02A 4FLRA 3GIQA 4GGHA 2J9YA 1K6WA 4UMBA 3VIIA 3W53A 2UWFA 2JBMA 4JPGA 2QCFA 2PWUA 3GHRA 2PDMA 1QHZA 2RDUA 5FEZA 1BVNP 4GOAA 1A47A 2WMFA 5AECA 5CLTA 4C6EA 4KWUA 5FAGA 5FL1A 2Q8XA 2VQTA 4JDYA 2BDQA 3CL6A 3G0UA 3MPGA 1W1ZA 2PWHA 4OBTA 1FVPA 2WSKA 4IMFA 1V02E 3RU8X 1F7BA 2E5CA 4LV9A 2VZUA 2W0UA 5H8PA 1O12A 2BGQA 3ARYA 1F6YA 5EB8A 2J27A 1JCJA 1X7IA 5LXEA 3KDNA 2FPYA 1GOIA 4JN7A 3PUOA 1ISWA 3CMGA 3OPSA 3SSZA 4NAFB 1FY6A 2AAAA 3DECA 1OM0A 3SM0A 1H1YA 1JCYA 4RXGA 2QGHA 5F2GA 4US6A 3ZM8A 4HU3A 3DBNA 3DGBA 3MY9A 1G4PA 1CENA 4HPJA 2E5DA 2PDQA 3GH5A 3WFZA 1WP6A 1BYAA 4ZOEA 1TWIA 3WJYA 2J7HA 2Y6ZA 1HT6A 1PX3A 5A6KA 5EMKA 1THFD 5A6SA 1VPYA 2C71A 3CH0A 3DBPA 3KBMA 3HZ3A 1FWDC 3O06A 1UP2A 3E02A 1VJIA 5I79A 1BLIA 1U30A 1GHSA 2ZE0A 3WK0A 1R30A 3PZTA 1OG0A 1EC7A 1HTIA 3VD9A 3NZQA 1EWDA 4GZIA 4YJ5A 1BFNA 1R86A 4BJHA 3NSNA 4Z2LA 4FLOA 2X16A 1KC7A 3SQLA 4PMYA 2AQVA 5HATA 3NL2A 1RVKA 1FCBA 4J40A 4Z0SA 2IUZA 2WXDM 1FHDA 4X60A 4W88A 3MT1A 3FIGA 3QOKA 2H9AB 4JICA 1XIFA 2DW6A 4E8GA 3ARTA 2NT0A 4ZA0A 4IUGA 1W9BM 3EWWA 4CQ9A 1UA7A 4WJEA 2PE4A 4UFLA 3MW7A 1E51A 3P74A 4R7JA 5G4HC 1I60A 2HQAA 4CD8A 3W1UA 2O9RA 1VHCA 3UG8A 5FF0A 1HGYA 3CT7A 3F1QA 5GNYA 1Q3NA 3REQA 1PV8A 1JEZA 4M56A 4I6VA 3PZGA 3BAWA 4LWWA 4DJEC 1IXOA 4UTFA 2BSLA 4M7TA 1LG1A 2NQHA 4NL1A 5I78A 1C9WA 3N1AA 3ONCA 1G4EA 1TPVA 3UVIA 4NZFA 3QY6A 4UB9A 1KXVA 1IWAA 4L7ZA 4U28A 1VCVA 3AXKA 3HU7A 1GVQA 1PZ3A 2XFWA 2QT3A 1V0LA 2VX5A 4KETA 3VO0A 4AHOA 3PZIA 1M7JA 1MFVA 1F3TA 3MP4A 1A5BA 4LVDA 3RG6A 1E1FA 1TWDA 4M19A 3N18A 1OBAA 3LCGA 4DIAA 1US3A 4DJFA 1GONA 3OZYA 1GW9A 5FCZA 1H7XA 1KBIA 3KHJA 3ITLA 3UVAA 1V51A 5I00A 3W6LA 1MEIA 1ISYA 3N2TA 3K4WA 4XZNX 2QXWA 4LUTB 2OLSA 1QI2A 4RJEA 1ZLPA 3W25A 3GG0A 5CC6A 3IPWA 2VGFA 4H6RA 4F8XA 4UTKA 2D73A 4AEOA 1R2RA 5D2WA 3JZUA 4BQ5A 2H3DA 2VOTA 3WLJA 4Y8EA 2O9PA 3Q45A 4QTGA 2VC9A 4PTVA 3LB0A 2J8GA 1GVFA 4GFSA 1TPDA 2VFHA 4AXNA 2PMQA 4H01A 1Q4WA 1DWIM 3W38A 1F6KA 1B3OA 2HS6A 4H83A 4BEQA 2C16A 5D8ZA 3QVQA 1W32A 5FACA 2ZC8A 2CKSA 3IWPA 4PB3A 3VMNA 1XLCA 3LPPA 4DEFA 3ARZA 4NILA 4LYPA 4YTUA 1R3RA 2OSXA 1B57A 3LM7A 3VD4A 3CPGA 4LU0A 3W24A 4Z17A 4N6FA 3SY5A 5B7ZA 2E3ZA 4N6EA 4Z1DA 3FJNA 1AUSL 2DW7A 2WVSA 4ZEPA 4A3UA 7ENLA 1BSIA 3LHZA 3H2MA 2GOKA 4GY0A 4BS0A 4JIIX 4H1ZA 4ZOCA 3GRIA 4UTJA 4RR4A 5LKYA 1E3XA 4TVCA 4XKYA 1XG4A 3TTYA 7ODCA 3ABXA 3U3HA 2VT0A 1LBMA 4P8UA 4HNUA 1XQKA 2F6XA 3WF2A 2ZZ4A 2MANA 4QX4A 7CGTA 3HB9A 4XZ9A 4A3HA 5FF3A 1BTCA 5C8BB 4Y9OA 5DELA 2CW6A 2AKMA 1U33A 1M03A 5C2GA 3R94A 5JIWA 5EKYA 1EA9C 2CIPA 2A21A 4O11A 3RU6A 1GVRA 3SGZA 4DXKA 1JXJA 1J2BA 4JCLA 3QLLA 3K1GA 2R1PA 1PJ9A 4M7SA 5H2ZA 3TC7A 4IIGA 3E96A 3R0UA 2IXUA 3LTSA 1X6NA 4DVOA 5A94A 5CPNA 4MNKA 4H9TA 2QUNA 3UPBA 2TSYA 1Q6LA 1H0GA 3LI1A 1W1TA 3TYDA 1W3KA 4N4PA 5PTDA 1KQYA 1W31A 2XGBA 1AZ1A 4GNVA 1TO3A 1BKHA 3TJLA 4JTQA 3TA6A 1JG9A 3G1HA 1M6JA 2IPFA 1KB3A 1E0XA 4W93A 3BLOA 1ZB5A 2B7OA 4S1FA 1OCNA 1ZNNA 3EWXA 4D8LA 1UR8A 1V4YA 1UOZA 4H9MA 2ISFA 4UNLA 1VFHA 3LTPA 1S2TA 4PRTA 2ALRA 2CWNA 2ZUMA 2JKEA 3W7PA 3H23A 3OZMA 1OGSA 3BLLA 3DFOA 1E6PA 1KNWA 4IZGA 2O55A 3EPOA 3CZ8A 1QUMA 4BKNA 4PTNA 4JX4A 2B7QA 1TE1A 3ORWA 4M6UA 1B3ZA 2G3FA 3UERA 3MC5A 2ZTJA 4ENLA 3DKLA 4NNAA 3ZLFA 3CWNA 4XAGA 3OZPA 2ATSA 3S6DA 1LL7A 3LZ3A 1UWRA 1NQ6A 5ENLA 3RLUA 4X3ZA 4DJDA 3O6DA 1PXGA 4MADA 4IIEA 2VCCA 4LVGA 4IQEA 1LZOA 3TW9A 2VNCA 3WQOA 1FHVA 3CPUA 1AW5A 3VGBA 5A6BD 3BAIA 2YW4A 4G7EB 4TMBA 2E9MA 4TX6A 3QM3A 3BJSA 3NO1A 4JQ4A 4EX4A 3FSTA 3T40A 1FFRA 4JTDA 3AIRA 2VRQA 4S3BA 4XO7A 4J3ZA 1WQ5A 4FP1A 2RJHA 1RA5A 4P2VA 4E3VA 2ASHA 3P8IA 5J04A 2XIJA 2WZEA 4AZ7A 3BZJA 3SIMA 4MWAD 2YJQA 3Q58A 3W7MA 1H49A 2OT0A 3CTLA 4ZVJA 2OVLA 3ECQA 4HYWA 4RZ4A 4ILSA 1J96A 1YADA 1W5QA 3NZ1A 3UCDA 2J77A 4B5VA 1R5YA 1B4EA 1UB3A 2TODA 4ZZ9A 5BYWA 4ADSA 3M7SA 2QAPA 4HHLA 1QPRA 3M0MA 2I5GA 4WEVX 4RE0A 2OYLA 4F2BA 2ATMA 1SZNA 3LCIA 2QF7A 3ZVIA 1ODUA 1T40A 3GHTA 1ZTVA 3G1FA 1EJSC 2BY1A 4HZMA 3NFUA 2Y2WA 3L66A 1JQXA 2H6RA 3VIFA 2Z6JA 1XUUA 4FS9A 3KUMA 2AL2A 3F5LA 3W1NA 3NQ6A 1YNPA 1KCZA 1CT5A 4PUUA 1OSEA 2NV1A 2CZDA 2XH0A 3NO3A 2BZNA 4JL2A 3POCA 1QHOA 1FH8A 4GPNA 4L9YA 5D09A 2CZEA 1EYWA 4QJ4B 5CGMA 1XQLA 1JULA 2YB1A 3CHFA 3SCSA 3FAXA 3EXTA 3U7VA 4DI9A 1SPQA 1U1UA 4LEFA 3UZJA 3UZYA 2ZRYA 4GVGA 3S42A 1E72M 4PSRA 1HJXA 3GTFA 1R38A 4LSBA 3K4AA 3W86A 3T05A 1R85A 1QNQA 3SFKA 3NQDA 1W2PA 4CCCA 4JKMA 1JZ6A 1K4GA 4LT9A 3IRSA 4AD2A 1A3HA 1E0WA 1YPXA 2PWVA 1MVYA 3HFTA 3W26A 1P7TA 1B30A 1W9XA 3WH6A 5GQBA 5BRBA 4D71A 3TYAA 3USBA 2ISSA 1KTBA 3KL5A 4D6FA 2CU0A 4DX3A 4WK9A 1M68A 3WEZA 3IK2A 1YX1A 5DMLA 3VPLA 2HROA 3RYSA 3DFHA 3GHSA 3W71A 1I45A 1V3HA 2DT3A 3UWQA 3K2GA 4FNQA 3FN9A 4YNGA 4OHQA 4D6DA 1ECEA 3BO9A 1MYRA 3QBUA 3DYPA 3PFMA 3W7RA 2GDQA 3ZYZA 1GOKA 4ZCWA 5JUVA 3ZWTA 2ZZ7A 4XUYA 3BLDA 4I9JA 3NZPA 3TZFA 3NQCA 3RCYA 3LRKA 4NF7A 5FD0A 2EO7A 1GQLA 1YW1A 2BGSA 3LRMA 4L4LA 4LRSA 2VRKA 1UKOA 3NQBA 2EHHA 2WHKA 1YIXA 3BAKA 4DZAA 4XB3A 3OTRA 1FWCC 4E2DA 2REQB 1XGDA 7TAAA 1H1ZA 3SUUA 4BI6A 2X42A 3UWYA 1MRAA 3STFA 4CU7A 2WKLA 4HK5A 1UQZA 1SR9A 1S46A 3TROA 5FJTA 2RAGA 3AMCA 1EBHA 3SUSA 4S3GA 1A3XA 3T44A 1GCYA 3H4XA 1POJA 3M46A 5CCZA 2AAMA 4H8VA 4EPBC 4DI8A 2E68A 3WDIA 3AXXA 2H90A 3UR8A 3FA3A 3PPGA 4NZJA 4GX9A 3RAOA 1NARA 5A8PA 1L9WA 2DT0A 4Q4PA 3I6RA 3NPUA 1A0EA 1TV2A 2OLHA 4QS5A 5E9XA 4QLKA 1NEYA 3W22A 1GQJA 3M47A 3BTNA 4NNBA 4WDWA 4AYGA 2XH4A 4L6HA 3QPYA 4TX9A 4RLIA 1ML1A 2X2YA 2QDHA 4Q8NA 1LM1A 1XLLA 4NJHA 3MHGA 3AMDA 1GVIA 4WSHA 4ZO8A 3C5QA 3KOFA 4RDZA 3VILA 3W7EA 3GD6A 3VE7A 1DBTA 4EXBA 3DZ1A 6REQB 3ZVHA 1WDDA 1AA1B 2RDXA 2ZDSA 4DJDC 4DHGA 4I9TA 1Z3NA 4LBRA 4H04A 2ZICA 4P7NA 2ZE3A 4UTWA 4IP4A 4H7CA 1MO0A 3ANVA 3FEMA 3VUPA 3EKLA 1CXLA 1FWNA 1IGSA 1CLVA 4LYRA 3T0AA 1AG1O 3I3EA 2PTWA 4EXAA 4U31A 1FWGC 3M64A 3LHVA 1S5NA 2ZRXA 3W88A 2V3EA 2CBUA 1VR6A 3CV7A 4P5UA 1KD0A 3P0XA 5DX7A 1FDZA 1PWMA 5HWJA 3L2LA 3V0SA 2Z1BA 2DIEA 3RUBL 2CBJA 1WKDA 1TV3A 2WM0A 2A5HA 3FEQA 3WDJA 1HZYA 1J0ZA 3W7LA 6TIMA 1E70M 3DFQA 4KRTA 3V0TA 1XR2A 1E4IA 1O7AA 3EOOA 4DWSD 1W37A 4IIBA 1GYNA 1CZ1A 3GXPA 2HTMA 1MNZA 3BGJA 1X96A 4W87A 1CCWB 2WZIA 4GY7A 4I8YA 4UNIA 5D9NA 1DJXA 4AD0A 2YL5A 3FGCB 3GXDA 2QW5A 4RL3A 2J6XA 5IOBA 4UQCA 3EA2A 2QDGA 1YTKA 4LGXA 4AIEA 1PX4A 4ADUA 4DXVA 1QASA 3S5YA 3KFTA 4EOUA 3ID7A 1F07A 1QU4A 4OOUA 1FWHC 3KVMA 3NNTA 1P5BA 3P67A 3QC3A 3CQHA 3NEVA 3P2VA 2PLJA 5A95A 3DH7A 2EQDA 1J8VA 4LANA 2QV4A 2YXOA 3S1UA 1YBQB 1EX5A 2EAWA 1ISZA 3A6OA 1NOWA 1H1NA 3UJRA 5MHBA 4MJ4A 3LMZA 4QG9A 5AHMA 2A3LA 3E2QA 2HVOA 2GWNA 1TX0A 1LOLA 1EGMA 1HKIA 2A6NA 5A2BA 1KCLA 2ZIDA 5T8GA 3U0HA 3VD3A 1PHWA 1X97A 2BOGX 1XH0A 2A2IA 1ZQ5A 3M0JA 5AB3A 4O1FA 2HWGA 4FF7A 3QHOA 1VFTA 1N55A 1CXHA 1WXYA 1TKKA 1B2YA 2Y85A 4R27A 3TOYA 4UXDA 2VRJA 4G9PA 4QNWA 2PDJA 1V3IA 2QCNA 4E4UA 3MDWA 2FMOA 4E38A 1S5MA 1TJ2A 4JTGA 3QTGA 4ZSTA 2R8WA 4KWWA 4MTVA 1CYGA 3TN6A 3T6CA 3SW6A 2CLLA 3CJPA 4UIOA 4O4VA 5G4WA 2BOFX 4NX5A 5BWAA 4JZ5A 3U7BA 1EJRC 2BLEA 3OW1A 2ZRUA 5JH1A 3TNOA 1A49A 1UIPA 3V5OA 1DJZA 3LV5A 4FPSA 1OINA 1IIGA 3GR8A 4I6KA 3L21A 3HA1A 4EPDC 4GISA 4NG3A 1OFQA 1UBPC 3ITOA 2F2HA 1WKEA 1AH4A 1WAWA 2V68A 1IF2A 4JQ3A 1K7XA 1JDAA 1I4NA 1VYPX 1UD2A 4YS1A 1WXZA 3B8IA 4N02A 4AC7C 3BMVA 1J9YA 2VDHA 1PTAA 3MUCA 4G1KA 4AY8A 3KDOA 5H8UA 3ATZA 4ZB2A 2P10A 4HKPA 4GYFA 1UA3A 2J7FA 2MUCA 2WOQA 4AZ6A 4O54A 3UD6A 4PA8A 3KLKA 3UU0A 3RR1A 5T91A 1JDFA 3QGVA 1W5PA 3M0HA 3G8EA 3SCTA 1XLDA 5GNZA 3IV3A 1DJGA 4ZQNA 1FUYA 1Q7QA 4OU1A 4ZSUA 4GXPA 2C6QA 1PEZA 5C9WA 3W2NA 1KM4A 4PMZA 5DXXA 3W6MA 5LYRA 5TIMA 3T4CA 1KWKA 3N25A 1I9CB 4W7WA 1UR3M 3W2JA 3K4DA 2Y7DA 2FH8A 1L2UA 2XIOA 2Z1XA 4AD3A 3LRLA 1L6FA 3VGEA 1HKMA 1FWIC 3TSDA 4FLQA 1A5AA 3F2CA 1NWRA 1TPB1 1JGMA 3CEPA 4UQBA 3KOWA 1S5WA 4MG4A 3I4EA 1XSKA 3WUEA 1LQ2A 3QJAA 4O1AA 3RIKA 3I7SA 2OB3A 5RUBA 1ITUA 1W9DM 4CU8A 3RR4A 4J2PA 2WVVA 1KCKA 1VYSX 4Q6XA 5HR7A 2PDKA 4US5A 2UY2A 4AXKA 2PDLA 1KKOA 3TN4A 3SJ3A 1OFAA 1VIWA 2OEKA 1OYAA 4UZUA 3RO8A 4ATLA 1J12A 1LDCA 1QWKA 2YYUA 1XG3A 3HV9A 7PTDA 1XIJA 2ZOXA 1LJYA 4QP0A 3NQAA 2ZRZA 3VC5A 2X30A 4N4QA 1VS1A 2FLIA 4ROPA 4C90A 3UXIA 1BTMA 4IT1A 5BNKA 1QI3A 5D04C 4GQBA 3TFCA 3J7HA 4URIA 5CLWA 2XU2A 4RZ5A 1Z44A 1H50A 4LEQA 3DCPA 2PAJA 2IQ0A 1E3ZA 4EPKA 1EJWC 2HK1A 4FNSA 1KBLA 2VURA 3MS8A 2HZGA 3GTIA 3OIXA 3VZZA 1XYCA 3UCCA 1POKA 1V02A 3M5VA 5C2XA 1M7XA 1C8XA 4GH3A 4E8CA 1DIKA 4LCQA 3CB8A 3CASA 4V27A 2IPJA 1BXCA 4YTSA 2DZBA 2R1MA 1HJVA 1R3WA 3VIOA 1KTNA 5LIKX 4AISA 3M41A 3G1XA 3U4FA 2X7WA 1XCXA 1EO5A 2OQYA 1ZAJA 3BW4A 2Y5JA 4AAJA 5EBUA 2PRLA 2E6FA 4DN1A 1HW6A 4H9UA 5LXXA 4QITA 5D8WA 5A8NA 3W73A 3PZMA 3QXBA 1SW3A 3GAKA 3FY1A 2VVNA 4I7WA 1E0TA 2VP8A 4HYVA 4B91A 3OGRA 1V3JA 2VM8A 1XFCA 2DT1A 5EYWA 3S46A 3EDJA 1CTNA 3LHTA 1D8WA 3F4DA 1QCWA 4ZMGA 3B0UX 5L6UA 3M5ZA 4GZ7A 4WJXA 1SZGA 5FEWA 1XH2A 1BSLA 2E28A 4DAFA 3W2KA 4G5DA 3GFXA 4FI4A 3TXVA 4A8RA 4XAYA 4MUZA 1LT8A 2B7PA 3AUJA 4D1JA 4K36A 1FTXA 4PC8A 2YA1A 1J93A 3WQGA 1V6VA 4LUSA 1VZWA 1H7OA 1JAEA 4KWSA 3LYEA 4GIYA 2ABAA 4NYUA 1JL8A 1OFOA 5HJXA 4C6BA 1N8FA 3F4CA 2G50A 1CGTA 3M9YA 3NCOA 2X41A 3USZA 1KRBC 5KTLA 4IIHA 3T2QA 5ABHA 3S2JA 4C65A 1CB2A 1JCNA 3IJ7A 3UR2A 1P1MA 3SCOA 3OLEA 3AS1A 4UUIA 3WJXA 2F9RA 3I6TA 2WJFA 9RUBA 3OVQA 4OKDA 2OO6A 5D33A 3BAYA 5JVLA 2D69A 1G9HA 4IPNB 2D23A 2VQUA 3F4WA 1SUXA 1CGUA 4EAMA 3ARUA 1VBJA 1JCMP 2ZKMX 2DT2A 2VDIA 4WOZA 3RF9A 4ZXLA 2UZ9A 2GGJA 4M5PA 4L1GA 1FWEC 2I17A 5G2WA 5LA1A 5DMYA 3DYMA 1RA0A 2Z27A 2GSHA 3C2FA 1DIOA 3THDA 4FLSA 2QJHA 4LJ3A 3B97A 4JTIA 3SI9A 3R8GA 2QYGA 3BC9A 3HBLA 4UTUA 2V0TA 1DJNA 4NHVA 4RX0A 1W5OA 2GQ9A 5DY3A 3K8LA 4UBPC 1EX1A 4IJRA 3AJXA 3CUIA 5AHIA 1OYBA 4PULA 1GOQA 1GQKA 2AGKA 4AMCA 3AXHA 5AYZA 2WNNA 1DQXA 1H11A 5G5IA 4E6MA 1T7LA 1KM2A 2BODX 1C9DA 3AFBA 1OC7A 4RXFA 4NI8A 2V3FA 1G5AA 6XIMA 4JYEA 2QQ6A 4Q4OA 3NQ8A 3LN3A 3EB2A 3C52A 3LOTA 5CPMA 4TX8A 2HVMA 4O16A 4DM2A 4QS6A 4UFMA 2D2JA 4IGHA 4ACYA 4O14A 4ZXOA 3AIBA 4B90A 4AEFA 3WF1A 4H8UA 2KAUC 3NZRA 3ARQA 4GC3A 3W84A 4FEZA 2L5HA 3SZ8A 4DAIA 4DBUA 1E6ZA 3FS2A 1RY0A 5F2MA 4GVHA 2V3GA 4OQVA 1T99A 3MJYA 4HJWA 1M41A 4MLRA 4IMCA 4HZ8A 4ZFCA 5FOOA 4GA8A 3VI2A 3IUIA 4I9AA 3O8AA 4F40A 3UG4A 2QF8A 3MZ2A 1QOXA 4MWAE 5XIMA 3GU9A 3GXIA 5GJNA 2YDSA 1UOKA 3GXMA 2QEZA 3CIXA 1GEQA 1Q6CA 1WDQA 2VVSA 4S3KA 1SGJA 3OO2A 2OOGA 3KOZA 1DTUA 1HIZA 1RPKA 1TWSA 5K2ZA 4BEUA 1EUNA 1XIMA 3QR1A 1YXDA 2YOCA 4TTUA 4V2XA 1UWIA 4IF2A 3DXIA 3VFCA 1JNDA 5LIWX 3WQ4A 2FVKA 4F66A 3WBAA 4CD7A 1W1PA 1DTNA 4AIOA 4S3CA 3VTRA 1IT0A 3H8AA 3AIVA 4O57A 4J9JA 1ZALA 1A5CA 4AC1X 3TAKA 2J62A 2C15A 3IUDA 3UT0A 4I7VA 3HG3A 3PZUA 4HNLA 4R33A 1NWTA 3O15A 2CHRA 5D9OA 4OV4A 2F84A 6ALDA 4WIWA 3B40A 1DV7A 5BMWA 3MCOA 3VGHA 1EC8A 1TSIA 4HT3A 4TQTA 1SSGA 4H6KA 3KW3A 5FKYA 4M1BA 1I8JA 4XO6A 4B4HA 3FV9A 3PF3A 4M6QA 2YCIX 3U5UA 1CIUA 4DF0A 4TXEA 3W01A 1W1IE 1ELSA 3VDGA 3CHDA 1MEHA 3BE7A 4S38A 3SIZA 1OY0A 3APYA 3HPSA 1XYFA 1SMDA 3FAWA 3N2OA 4AZCB 3O9NA 3HGJA 5DY2A 1LOQA 4MB4A 5FEXA 1TTPA 3QMSA 4C6PA 2PWDA 3DFPA 4WXYA 1ALDA 1HNYA 1D2KA 4EVZA 2XYLA 1US2A 2FHFA 1A5SA 1IHIA 2VFGA 4TV6A 1ZRQA 3FJ6A 3CV2A 2PCQA 4LBUA 3CC1A 3R10A 2ZX9A 2FQIA 3BV4A 4IQDA 4YCOA 4DZ5A 1YDNA 3ITCA 4LAUA 1XLIA 5AC4A 5EMJA 1W3LA 1F61A 3W02A 1YRRA 4DYKA 4L9XA 1WBHA 5TQLA 4FNRA 1LL4A 2CLHA 5M1TA 4DBDA 2I1OA 1O1ZA 4ZB0A 3B0VC 4JOMA 4GI6A 2A3HA 3VOJA 1VCGA 1ITQA 1D9EA 2PDFA 3ZT7A 2MNRA 4WZHA 1H41A 1GVEA 4U10A 1JUEA 3S5SA 2XM2A 3PTQA 3B06A 3WIJA 1G94A 3WLPA 4QSFA 3R89A 4O0ZA 4GWEA 1KW1A 1YEYA 4F4RA 1Z48A 1UWUA 2J6VA 3WFLA 4LUTA 3URQA 4UTMA 1F3XA 5D37A 3E74A 4QJ3B 5CBIA 1UKQA 2XSAA 3EDFA 1W0MA 4QDWA 4M51A 1FWAC 1Z32X 4KWOA 3GU1A 1L8PA 3IEBA 1KTCA 2NVCA 5CQ1A 1LOSA 1MDLA 3FYPA 3ARWA 1UWSA 4QG8A 4KF1A 1TZZA 2WNZA 3FX4A 4IPPA 1J0IA 2CETA 1VQTA 2BV9A 5HNUA 2RGMA 1NDZA 1UZ4A 3BAXA 3BJTA 3OLDA 2PDNA 2P76A 2Z4GA 3BZGA 4POCA 3L5LA 1XLEA 3AHZA 3TC6A 3V36A 1A3WA 2GSEA 2NWRA 4LS2A 1AVAA 3ZR5A 3II1A 4YLWA 1KKRA 5GJMA 4U2YA 4BF7A 4KBXA 3LBMA 3GC2A 1YQ2A 2VXNA 3AMKA 3E0IA 3AZSA 3TU9A 3MV11 3VNZA 3C3UA 1Q85A 2GUUA 3TOPA 3BARA 1Q2SA 3TR2A 4HU8A 3WLRA 5HJYA 4A3YA 3PWAA 5A6JA 4ZTXA 3TX9A 5D9PA 5DANA 4HPNA 3SCUA 3HGRA 4JIQA 4D9PA 3QW4B 4CD4A 4JGDA 3UCQA 3QZAA 3W00A 1GG1A 3BSMA 3NQMA 4DJFD 3DESA 2EPOA 2VEKA 2P50A 2ZUSA 1S1PA 1OQFA 2VX4A 3LXCA 1IWBA 1F4HA 5BWFA 4ORMA 4XTDA 2CLFA 4CQAA 1W1B1 2V81A 1ECQA 2B0MA 1K8YA 4ZR8A 2PC4A 3LHUA 3ES7A 2CLIA 1E6XM 4GJIA 3CEUA 4ML9A 3IIPA 4H2CA 3A4JA 5CH9A 5CKSA 1VLIA 4HNNA 1JCLA 4PMVA 3GS6A 1DE5A 3N29A 1XLBA 1TJ1A 1ZHAA 4NP7A 3L4ZA 1XXXA 1NFGA 4Y96A 1OGBA 2HEJA 4Z2IA 2P88A 3R8HA 1XYAA 2OTDA 5ECVA 3TP4A 4PE8A 1VBRA 5AHFA 1TYGA 2IPGA 4I8DA 2ZDRA 1Q6FA 1ME8A 1MXDA 2DSVA 1LRNA 3CIVA 4R9XA 1KXQA 4PUEA 3QFEA 2YKKA 4JQ2A 4AMAA 4ICMA 5KITA 2PEVA 1I1XA 2QIIA 4Q4MA 3M7WA 2P53A 4IICA 4C7DA 3VGGA 2OKTA 4BK9A 5AN7A 5BOFA 2BY2A 4DBSA 5LGZA 2VEPA 4E4FA 1RAKA 2GJNA 4DF1A 4XD5A 2WZMA 1PX8A 1X6LA 4NUWA 5TF0A 3MA8A 2C3ZA 3ARRA 3PPFA 4P7RA 4MF4A 3GG8A 2DGAA 3OVPA 4JFVA 1JPIA 3FKKA 3NG3A 1OIFA 3QV8A 3DG3A 4E8DA 3SCWA 3LLFA 1UASA 5FJPA 1AJ0A 1NFPA 5EMLA 2WLYA 3SRDA 1JZ8A 4Q6JA 2E1WA 2R6OA 3M4HA 1IR2A 2ZTKA 3AWNA 3GZAA 3BOXA 3VDAA 1UUOA 4B16A 2OKOA 1T8XA 1ADOA 4G7EA 2UBPC 3SN1A 1SFLA 2PC8A 4JHZA 1EF3A 4MNLA 4RUBA 1LBLA 1UPMB 4PUDA 1B9BA 3MVTA 2GZXA 4PMXA 1R3VA 1XIBA 1VD6A 4PTXA 4MB3A 2Q71A 2C0AA 4HSOA 4E4PA 1XD1A 1K77A 5XINA 2GJLA 4JIRA 4GNKB 2PP0A 3O0KA 2PGRA 3AJ7A 4INFA 2I5QA 3LGDA 3N17A 1K8XA 1OX6A 2JK2A 4QAIA 2VGBA 3VIKA 1AH3A 2QKFA 5H91A 3UWUA 4QISA 2DZSA 4RV8A 5C55A 4G7FA 3VNIA 2FKPA 1JFHA 4JEQA 3CLWA 1SW7A 3QLDA 3NSMA 1SM9A 2PLMA 2ZX7A 3IIZA 3WUGA 3QQWA 2Y61A 3M16A 5TD4A 3CQIA 4O15A 3G3MA 3W7HA 1BRLB 1BXBA 1S3TC 3V16A 4DBWA 4C91A 1VGAA 2DVXA 2DQXA 4YXGA 2FPTA 1AL8A 5CJ5A 2X7VA 1KM5A 1AW2A 1JVNA 3L2IA 3AIUA 1XX1A 1SR0A 3WEOA 3EOUA 3QY7A 5AC5A 3NL3A 3DFSA 5G2HA 1JUKA 2BB0A 4C60A 4WX2A 2ZVIA 2IPWA 4XUGA 1ITXA 2E6AA 2B81A 2I5IA 4S3AA 4WY0B 1PDZA 2A85A 3MO7A 3R0KA 4GUJA 3S5ZA 3G3DA 4HCDA 1MRQA 9XIMA 1DJWA 4DJDD 4ZODA 2PD9A 1WAUA 3AXIA 5C9UA 4LUYA 4J1OA 1MEWA 3BGAA 3ZJ7A 1RQEA 4PBEA 3AQUA 3MI6A 2QCLA 4GZJA 4B2DA 4JNMA 1FRBA 2WLZA 2O0TA 2X1TA 5C71A 4FXRA 3E2SA 2WKJA 4FSAA 2AMGA 3B3DA 2VD8A 3CAWA 3HPXA 4GYPA 4LV4A 2Q02A 4PBFA 1WE5A 4IOTA 4P8XA 3S2CA 2ACSA 3LUTA 3W2MA 1EJ7L 2E5BA 4K2SA 1GYMA 1R7AA 1FWRA 3LV6A 1PE1A 2F8QA 1NY1A 1I0DA 5C9RA 3V18A 3N12A 1GW1A 1DJIA 3WMBA 2YBVA 3WD1A 5KZEA 1QNPA 1G7VA 2F38A 5IXEA 3DIPA 3XISA 4JIPA 1WDPA 4DNMA 3B9NA 1L8NA 2D0HA 5I3HA 3VIGA 3WQPA 3ZT6A 3MJMA 1Q8JA 3EBVA 1ONEA 5C5YA 4UFHA 2AQWA 5FF4A 3PANA 2OZ0A 4HNVA 1IYXA 3EDEA 3C2EA 2XN1A 1K9EA 3A4WA 5FA5A 1ZUAX 1LG2A 3PULA 1RCQA 2EJAA 3WL0A 4BHYA 2Z2UA 5REQB 4IIDA 2WO5A 1KFEA 3MU7A 2EJ1A 1SQ7A 1YHTA 3PB0A 2JFEX 1EDGA 3PNZA 4FXSA 1I75A 3BMWA 2XUCA 4TR9A 2REQA 1LT7A 3WO8A 5E93A 1MFUA 2EF9A 3L0NA 4DRSA 1W17A 2D0GA 5A1AA 3VKJA 1U2YA 1GQIA 4A3RA 4U5KA 4UMCA 2HV5A 3L0KA 3TEVA 3ARVA 4TVDA 3DI0A 4RE2A 3SCPA 3CHEA 3FNDA 2DIKA 2J7BA 2UY4A 3C56A 1F2JA 1M7OA 3IGXA 3MYOA 3LCXA 3O2LA 3TMLA 2VEMA 3VNJA 1CGXA 2Y5SA 4LAOA 1GJWA 3VNMA 4H7ZA 1TCMA 2QMKA 2DZTA 1JUBA 2I57A 4EACA 3VM5A 3VIMA 3LXBA 4OWGA 4UTLA 3VMOA 1K70A 1V7YA 4JR5A 4BQ4A 1Y7VA 2PCEA 1LQ0A 2BVTA 4B5SA 2YL6A 3N6HA 5CSRA 3PJWA 3BANA 4JBRA 3EDKA 4J3TA 4CNNA 3UPMA 1J01A 3VDBA 4UQAA 1KWGA 4ACZB 4BR1A 4XZIA 3HURA 3DHUA 3FVMA 1VBHA 3PZQA 2PPGA 2BFGA 2ZXBA 4HMEA 1MMFA 4FALA 1XBXA 3VD5A 3LY0A 3WQVA 4XD6A 3B05A 2PDXA 5BU6A 2V6AA 3SJNA 4Q7IA 3KZSA 4Q7BA 5C7VA 2DZXA 2OJPA 4HOZA 1TR1A 3ONBA 4N7QA 3ZMRA 4ZO7A 1P0BA 4J5NA 3I7RA 2H3BA 4WSKA 5DT7A 4CNPA 6REQA 4O12A 4C1LA 3UA4A 3AWOA 2HPMA 5CZSA 3SR7A 3TJIA 3UA3A 4S39A 5TNVA 5I3GA 2QJGA 3S9ZA 3S1GA 3VOIA 1DXIA 4J35A 2ZCGA 4Y9NA 4JTUA 1RR2A 3KE0A 1R7OA 2CC0A 2W5FA 3ZFHA 2WW5A 4L4PA 1I2NA 1XSIA 1AMYA 3V1HA 1JI2A 2BNJA 3GDKA 3IGHX 4Y8FA 3UWZA 4JXCA 1G7UA 1SW0A 4PL1A 1EEPA 1UZHA 2YBTA 3RGTA 1ZP3A 3FJ4A 1BWKA 1CLKA 4KFOA 3KRSA 3U48A 2GGHA 1IGWA 2FVMA 2QCMA 2BVYA 4ATWA 4B5UA 3S1VA 5HA7A 2VCBA 2POTA 4FR6A 3B8UA 3IVSA 1OGGA 5EU9A 3ELFA 2W3ZA 3G0XA 4IWWA 2G95A 1ZENA 1EL3A 1TVPA 2A1YA 3L0GA 4WF7A 1RUSA 1ICPA 2J75A 1AQFA 2VYOA 2FMNA 5LIUX 3VU2A 3FGCA 3KM8A 4C6FA 6TAAA 1XLHA 3BDKA 4C6OA 4JKLA 3HTWA 1JAKA 2O7SA 3LENA 3PBMA 4MDPA 4PTDA 1I2RA 1DJQA 1Q63A 1H63A 2RHGA 1EDQA 2RKXA 1GQNA 1DL3A 5FAJA 3KX6A 3U2ZA 3P8JA 3L9CA 4JHOA 3HPFA 2OQHA 3LMYA 3AYRA 2CYGA 1N82A 1YBQA 1XLMA 1I0BA 3TMQA 4K37A 5BW6A 1BD0A 1XBZA 3GNOA 1YXYA 2G3IA 4HPXA 3H22A 3LM3A 4RPQA 4TIMA 3TCEA 4MJMA 4WY0F 2ZFAA 2WAGA 3O0FA 1TMLA 2JEPA 1U22A 3H4WA 1TUFA 2CHOA 3KWSA 4HHMA 3BW3A 2BASA 4DZHA 3PBGA 3V3WA 1S2AA 1JRBA 1R47A 4GYPC 2PDWA 5I24A 1QO5A 1WA3A 4O28A 1JRCA 3TE9A 4Y7EA 3CAVA 3WCZA 1B3YA 2Y8VA 5IDIA 4J3WA 3NTYA 3C2OA 3MI3A 1J6OA 3A9IA 2CESA 2TPSA 1VH7A 3TWBA 4H9VA 2QUTA 3NGFA 2FHCA 5E09A 4MPQA 1ZAHA 4GYKA 1GUVA 1H7WA 3P3BA 3CTTA 4NJGA 3WBWA 2VFFA 1VPXA 3OEXA 3PS7A 4AIBA 4UQ9A 1F3EA 4GY1A 4CU6A 3CB3A 3QOMA 3BUVA 3CYVA 3E0WA 1GTEA 3P14A 5A8MA 4JTLA 3NXLA 2C1HA 3UPWA 2YLAA 4DJEA 4F0SA 3MVIA 3WK3A 1CPUA 2X0YA 3A64A 3NUKA 2BGNE 2XZ9A 4WXZA 2Z29A 4PRWA 1Z42A 2PUZA 3VNKA 3FFSA 1PKYA 2ZADA 1VFMA 1JDEA 4AF0B 2BHZA 2F7FA 2OZTA 2XINA 3GTHA 4GNJA 3GXFA 3DFYA 2WPBA 1I2OA 3FHAA 3KP0A 4NU7A 3WLKX 2QULA 2Q8ZA 4PMDA 2LLEA 3LD5A 3STCA 2I9UA 4BI7A 4DY1A 3MUAA 1HN1A 1OD0A 4CCDA 4EK7A 4IUOA 4C6NA 5HMEA 3Q94A 3WQ5A 1O5XA 5LIYX 4OECA 3N6JA 1QPQA 5GVJA 2QCDB 3A22A 1GZJA 5CBJA 3R6IA 1TE6A 3ANUA 2WMIB 5BROA 1MNSA 4C5ZA 1QTWA 4GXWA 5CXPA 2UY3A 2HNEA 3UYCA 2VCAA 1JPMA 1KRMA 5HXMA 1B31A 2GGEA 3W82A 4CQCA 4IMGA 4AVNA 3L65A 4OIFA 4ZB5A 1L0PA 3MUIA 4O0KA 2YL9A 1W2VA 3EXRA 3IJDA 1RCOB 3SUTA 3NVDA 1L2QA 3ZJKA 1K9FA 2ISVA 3MSGA 4IH3A 3JS3A 4EXQA 1HO1A 3KBSA 1UBSA 5A5WA 4D6HA 4JQAA 4QR6A 3OA5A 1V77A 4D6EA 1QNVA 3OZOA 3HO8A 1X39A 4GACA 1NELA 4REQA 3W1RA 4YL2A 5BXRA 1ENUA 3PK7A 2E1DA 2EGZA 1UQYA 3NVTA 4G1NA 4X22A 4GVFA 1ISXA 2E40A 3WKZA 1VF8A 5IFTA 1OABA 1S38A 2YR1A 3TUUA 4XZMX 4QHRA 2F6UA 3A3XA 2W62A 1XIIA 3BAJA 5HWNA 3K5XA 3GVGA 3WZ0E 4J28A 4ZQOA 5C0QA 4WLCA 5LNUA 1BHGA 1KR1A 1UMYA 3A4AA 3M6DA 1TVLA 1NIUA 4MMWA 1L6GA 4J3SA 1EJTC 4Z1CA 1TV8A 2D2GA 2D3NA 1EHNA 3GSMA 4KS0A 3ZSTA 1Z7AA 2Y0FA 3UR7A 1OFDA 4UOJA 3GNNA 4Z2HA 4CCZA 1IE7C 1B5TA 2XZ7A 1CX9A 3EWZA 3HFYA 4EIVA 1WZAA 1YNQA 3GH7A 3AALA 1JFXA 3KVJA 4M29A 5IBXA 1QJWA 2ANUA 2YGYA 5D03A 1MQPA 3VVGA 5A8OA 1YPIA 3IJ6A 3EXSA 2GVYA 2PWFA 1XHGA 3LCLA 1HKVA 5D9MA 2XWDA 1OYCA 3MCNA 3DOPA 2CITA 2HJPA 1TPUA 2PURA 3W37A 3UG5A 4WJ8A 3S0CA 1TPC1 5EMMA 1DHKA 5F7UA 1XCFA 2Y63A 1NOFA 3AYSA 1M53A 2ZXDA 1LROA 3WH7A 2EG7A 1O4UA 2HS8A 5DBUA 2C1IA 4YVVA 1E5NA 1QMLA 2D0FA 3TXZA 1C8VA 4FF5A 2NLIA 2YYTA 2V5LA 1AW1A 2PRHA 4EF9A 2PWGA 3ABQA 4U3CA 3TLLA 4HZ6A 4MY8A 2P0IA 4MY9A 5I0DA 2ALDA 4TVUA 1JZ7A 4US5D 3KRZA 3N15A 4DUWA 5I6SA 2YPIA 4C5YA 1C3FA 1NF7A 3QH2A 3S9IA 3QR0A 4DLFA 1K9DA 4FZIA 2WYSA 1DORA 2QDEA 4AD5A 3ABSA 2Y88A 1JZ5A 4ZL1A 1VCFA 1YTDA 2YCLB 2PGWA 1XRFA 4WDXA 5E0FA 1F5ZA 1T5AA 3CZKA 4PCNA 3V1PA 3ES8A 1OJXA 4TO8A 1KR0A 1B1YA 3N4EA 2ISDA 1L6YA 4PMRA 4MNMA 1HJQA 7REQB 3D6NA 1PAMA 4N42A 1P6WA 4E2BA 3OBAA 4ERIA 2J7EA 4B5XA 3U9IA 2J9XA 2V5CA 1BVZA 2EXOA 5EA9A 5CZKA 1D3HA 1K7FA 1K8ZA 1N8WA