3ELBA

Human ctp: phosphoethanolamine cytidylyltransferase in complex with cmp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
333
structure length
302
Chain Sequence
GRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine-phosphate cytidylyltransferase
publication title Human CTP:Phosphoethanolamine Cytidylyltransferase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 302
sequence length 333
ec nomenclature ec 2.7.7.14: Ethanolamine-phosphate cytidylyltransferase.
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3elbA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3elbA01
4MWEA 2EL7A 1NSYA 1NZJA 5TGTA 4MUEA 5DK4A 1J1ZA 5HG0A 3KT0A 1D2RA 4EF6A 3CR8A 3PNBA 2QUJA 2RD2A 1G8FA 4FZJA 1N3LA 2VXOA 1MRZA 1HYBA 3AIIA 3ZIUA 1MBZA 1MJHA 1N2HA 1WKBA 3FNRA 3PNYA 3HGMA 1I2DA 1JZQA 1EFVB 2WB2A 4DDMA 2IP1A 1Q15A 1YIDA 1PG0A 4MWCA 1YI8A 5DB4A 2BYTA 1Q77A 3K9WA 2A84A 3DO8A 3COZA 1MC1A 1JHDA 4MUJA 3MLBA 2CV0A 3DPIA 4J76A 3VGJA 2QJOA 3AG6A 1Y42X 2J08A 2OQ2A 3G59A 3SP1A 1F7VA 1GAXA 4A91A 1K97A 1PG2A 3INNA 1XNHA 4K0RA 1WXHA 4MUNA 3GMIA 1KP2A 3ISJA 3CLRC 1R6XA 2E18A 3GUZA 3H99A 3ND5A 4OUDB 3AKZA 2A7XA 1IRXA 3D6VA 4L2IB 1M8PA 2CSXA 3RBAA 1N2GA 1I6KA 1IQRA 1EE1A 1M1ZA 3LCJA 2DXIA 1IH8A 1EJ2A 4CDNA 3FETA 1QQTA 4R2MA 3ZJTA 4S1OA 3DLAA 1N2OA 2B7LA 1QRSA 1O6BA 1U0BB 4NDAA 1KKUA 2CYBA 1G8HA 3GLVA 3N8HA 1XJQA 4GU5A 1G59A 3IODA 4KR6A 2QTMA 4PBSA 3RJZA 2CT8A 2JANA 4U8HA 2CYCA 5K0TA 3TQOA 2PG3A 3X1KA 3FWKA 3IVGA 3CA8A 1YIAA 3P0JA 1T6YA 3IMEA 2QJTA 4DJAA 1GPMA 1KQPA 2D5BA 2E0IA 4EG3A 4YMIA 3CVUA 4DDKA 3RHSA 1JZSA 3KT6A 3PXUA 3ND6A 3G5AA 4NAUA 4MAFA 2CV1A 4MUKA 4XFDA 3FIUA 4QBTA 1QJCA 3SZ3A 1EUQA 4JXZA 4L2IA 4KR7A 4MW7A 1TYCA 4UZFA 1IVSA 3CLTD 1UFVA 4JYZA 4ARCA 1G8GA 1I6LA 4KPUA 1OWOA 1N75A 1KR2A 2A86A 3C8ZA 1QTQA 2NSYA 1GZUA 1SURA 4MVYA 1KQOA 2QUKA 5LM3A 4MVWA 4EG8A 5HUHA 1FFYA 2DEUA 4PY2A 4ND7A 3F3MA 3N9IA 2XRYA 1M8JA 4HJXA 4CT0A 3CVYA 1XNJA 3MMXA 5TEWA 3RK0A 1K4KA 1O96B 4KR9A 1OWMA 4E1AA 1IFXA 4ZCSA 1EFPA 1O94C 5JBNA 2IELA 5KWVA 2PZAA 1KAMA 4EGAA 1JIJA 4KKVA 1XNGA 4NATA 3KT3A 4MW2A 1J1UA 2X3FA 3OTWA 3L93A 3E27A 4TS1A 1WQ3A 1R6TA 3H05A 4MW9A 4G5FA 1NUPA 2GM3A 1N2BA 1JEEA 5K0SA 2ZUFA 3UMVA 2JAXA 1J21A 2Z3VA 1IQ0A 1A8HA 4MW1A 2NZ2A 1WXEA 2OV4A 3ILVA 3OP1A 3ZJVA 3LE8A 4Q93A 3SEZA 3P0HA 4UZEA 3CLRD 2VTBA 2QTRA 1ZUNA 1MAUA 1NI5A 3HZRA 1JILA 1K4MA 1P7PA 3IDFA 4YP7A 2XRZA 3SDBA 1VBKA 1V8FA 3AFHA 3PRHA 3H9CA 1B6TA 4QREA 4R2LA 4Q16A 3CVXA 3X1MA 4EFKA 1EXDA 4YBRA 1LI5A 3FH0A 4PBTA 4XFJA 1J20A 2CV2A 3G6KA 2YWBA 3QTBA 3COVA 4ZT4A 1QNFA 2A1TR 2WQ6A 3A2KA 3IOEA 1BS2A 1MB9A 4HJRA 1J09A 1JIKA 3U1VA 4MW0A 3UK2A 2RE8A 4MUFA 4MW4A 4JFAA 4MVCA 4MUIA 1N2IA 3KFLA 4GRIA 4U63A 4I6GA 1N2JA 1NP7A 2G36A 4RUKA 4MWDA 1OBCA 3ZGZA 1TFUA 1T9GR 1EFVA 3QTTA 4HPWA 4AS1A 1JECA 3IVCA 1QU2A 1IHOA 1S4MA 1YUNA 5EKDA 1O95D 4DE5A 5TS2A 4J75A 3MLAA 4X0EA 4PBRA 3ZXIA 2D13A 3IMGA 1T6ZA 3FDXA 4MWBA 1OBHA 4MUGA 1M83A 2YY5A 2QJFA 2H2AA 3TZEA 1KH1A 2ZP1A 4MW5A 5J59A 1O97C 5AHWA 1PFYA 3K32A 5TEVA 3IOCA 4OUDA 2A1UB 1JEDA 1N2EA 4I6JA 4DLPA 3A04A 4DDHA 3CVWA 1O0CA 4XSVA 1H3NA 1Q11A 4MW6A 4QRDA 3X1JA 1WXFA 1T6XA 2X1LA 2CUZA 3TQIA 1WXIA 2J09A 2R5WA 3ZUGA 3MUEA 3AL0C 5H16A 1TYBE 2DR2A 4H3SA 3P52A 5FO0A 1LI7A 3QE4A 3TZLA 1YUMA 1RQGA 3HL4A 4YP6A 3N05A 1R6UA 3H9BA 1KQNA 1CT9A 3CLUC 1IQUA 1O94D 3UC5A 3COYA 1QRUA 4R0NA 4DNXA 2A4MA 3LOQA 2WQ7A 1JGTA 2DERA 1QU3A 2C5SA 3P0IA 1KAQA 4CDMA 1VLHA 2AZXA 3FI0A 2PXHA 2WSIA 1F7UA 3NBAA 2PIDA 3FY4A 1F9AA 3FG9A 1V47A 1EUYA 2A1TS 4MULA 1Q19A 2YXNA 4ZT3A 2CFOA 2DETA 3S3TA 1ZH0A 3Q4GA 1JIIA 4EG1A 2A1UA 2HGZA 2O8VA 3MXTA 4JXXA 3FOCA 2IJGX 3IMCA 1I6MA 1OWLA 3RK1A 3CLSC 4MLPA 4F3RA 1OWPA 4CQNA 1ZH6A 2QTNA 3A4IA 1VL2A 2PFSA 1N78A 1T9GS 3NBKA 4G5YA 3HMQA 4ZCPA 3SEQA 3NV7A 3N2YA 1M8FA 5KHAA 1KH3A 5LLTA 4WSOA 1H3EA 2E21A 2X1MA 5J5AA 1LW7A 1O0BA 2H29A 2AG6A 3Q12A 4WNYA 1ILEA 1PFUA 1TYAE 2QUHA 1M8GA 4ZCQA 2BTEA 2I1LA 1COZA 3ELBA 2PZ8A 1WJGA 2DUMA 5IHXA 1GTRA 3AG5A 3UOWA 1TYDE 4HK4A 1O96A 1H1TA 5DEOA 4ZT5A 4G6ZA 1MOPA 4MQ6A 4MUHA 3VU8A 2GOYA 5IJXA 3VRHA 1TEZA 5J58A 1WQ4A 1WXGA 3FHJA 2V0GA 2D54A 1N77A 4YP5A 3A05A 1U7XA 1NURA 3TS1A 1YULA 2DPLA 1TQ8A 3IUBA 1KORA 1GLNA 1K92A 4NX2A 2A88A 2DLCX 2O5RA 2ZUEA 1GTSA 1U7DA 3I05A 2YWCA 4JZYA 1X6VA 4K03A 4EG5A 4ZT6A 4KPUB 4ARIA 5HUJA 3H97A 3M5WA 4I6EA 3IH5A 3CVVA 1OWNA 2Z09A 2JA2A 2QUIA 2X0KA 4NZPA 1ULHA 4F4HA 1O97D 4EG7A 3KT8A 4EG6A 2AKEA 3HV0A 1KP3A 1J70A 1H3FA 2V0CA 1WOYA 4ZCTA 2Z08A 4ZT7A 1KH2A 1OD6A 4MVXA 3SYTA 3ZXSA 1ZJWA 3HFJA 5H7XA 3ZJUA 1EFPB 5BNZA 3IUEA 3Q10A 3IVXA 3ND7A 4BWVA 1NUSA 1GN8A 1U3CA 2HMAA 2PZBA 3PNVA 5F23A 1WZ2A 3COWA 2J5BA 1MB2A 1O95C 1M8KA 5FNZA 1VBNA 3RFFA 3TNJA 1WY5A 4OJMX 4U7JA 1X8XA 3D6UA 2CYAA 2J4DA 4ND6A 1PFWA 4P2BA 5FO1A 3CLUD 1MAWA 3JXEA 5DASA 4AQ7A 2EJCA 4EG4A 2HZ7A 3L92A 1NUQA 1JMVA 2GKSA 5KCMA 2E89A 3UY4A 4ZT2A 1VBMA 3DV2A 4ZCRA 3CLTC 1O5TA 2J07A 3BL5A 2VTBB 4RPIA 5LFAA 1F4LA 1QRTA 1NYLA 1DNPA 4NAHA 3SZGA 1NUTA 1N1DA 2TS1A 1FYDA 1U3DA 3IOBA 1NUUA 3CLSD 1PFVA
chains in the Genus database with same CATH superfamily
3OIWA 3WWCA 4EL0A 4FEAA 2GK4A 3PNPA 3MINB 3F67A 4CR7A 3M70A 1C2YA 4I1RA 3WFJA 4D98A 1T35A 1Z3CA 1P9WA 1DAEA 2CLLB 1XZKA 2AA3A 1HDCA 2DFTA 4U00A 5DHUA 4E0BA 5KPJA 4C0XA 3DQZA 1N0VC 2V7TA 4RDIA 4OAQA 2E1RA 4JLJA 4YLEA 3RYHA 4CXMA 2VS1A 2AOUA 2AR9A 1MJHA 4PZAA 2R5NA 3LBIA 2I22A 3MWDA 3THWA 1JFSA 2WBLC 3A9UA 5A4MS 4G1FA 1FRZA 3FNBA 4ILEA 1HMYA 4NTZA 2QEQA 4IWXA 2JCGA 4I2VA 1HE5A 4NYJR 4XPZA 1YIDA 5EP3A 1Q92A 4Z49A 5M7EA 3EB9A 2QRVB 3DT8A 2BIFA 2RGWA 2YVUA 2BEUA 1R0ZA 1XJCA 1ZXLA 4S04A 3JQ8A 1RMQA 3LDFA 4YRZA 2GN8A 3SE0A 2E4UA 2WTEA 1EVKA 3D4IA 3WK8A 1AMOA 1ODJA 2Z9BA 1G8YA 4QDOA 3W4IA 5AHKA 2YOHA 3D54D 4RNDB 4MJXA 3ZOZA 2ZVQX 2ERYA 3P4XA 3L1IA 4XSHA 4AW9A 3HMKA 4LQLA 3CLHA 4LYGA 1R74A 3ICEA 2VT3A 2NUPA 3UKJA 3GR6A 4WJZA 3RFTA 1DHRA 2RHBA 2P2NA 2W37A 3PUIA 4N7RA 2JASA 2RGUA 2HNBA 2QTBA 1O3YA 3GUZA 5FIUA 3DKVA 5G3YA 1KYVA 1PV4A 1VOTA 3H2HA 1DAHA 4L1KA 1T0JB 5JPIA 1R8QA 3RNLA 5F7XA 5LKRA 4UMVA 1J25A 1TC2A 2A9PA 1GA1A 1JMYA 3FTPA 3A10A 3NC0C 4K6OA 3T7CA 3DAHA 1XD2A 2VATA 2KSQA 1CF2O 2P6NA 2Q6IA 3CZ5A 5EMJA 2QMHA 5M29A 1QK4A 2JJMA 4JL6A 2FPPB 1XCPA 2JH8A 3MD9A 2XH8A 4EUEA 3TW6A 2BMWA 5AH0A 5AJYA 1UFRA 4O4LF 1XN4A 1Z16A 1WBBA 1KI9A 1XDDA 1CDEA 2Z1MA 2WWVD 1QMGA 4WZBE 1E9AA 1CC1S 3FCXA 1BX3A 2DF8A 4MITA 5G1NA 4GU5A 4IR7A 2XDYA 1Y1TA 1VIDA 5K2MA 1MTZA 2WJIA 2XE7A 2JANA 3KCNA 3VGPA 4HL6A 5CYOA 1NQWA 1WR8A 3L1HA 3QLTA 3LO8A 1CNFA 4NCXA 2WZDA 1IOVA 3G2QA 2ZBVA 1VSVA 2X1HA 5F76A 2BRUC 2ZUTA 3AV0B 1PJ8A 3EXG2 2AX4A 3HXKA 3L4EA 4R54A 4YRJA 1GGFA 1PR4A 1M0WA 4G4SP 3V2HA 3G2KA 1NVEA 4L0QA 1PHRA 1GPDG 4CNBA 2PXXA 5GJWC 3ELYA 4FD2A 2H4YA 4K6GA 4RPHA 1I4TD 2WF8A 3ADCA 2NOAA 1NN5A 1TQ2A 4NOLA 4DLRA 3QW4B 3L4JA 1KETA 3A1FA 5ED0A 4GO1A 2HSJA 5CM9C 5F4BA 2RAFA 4C3OB 2JRLA 1UPAA 1G20E 1KC1A 4TRRA 2P1RA 4D8UA 1I3OA 3KL4A 2AE1A 4L6IA 2FW6A 1UMKA 2X4DA 5TDHA 4B2IA 2CV1A 2I1QA 4GBMA 4Q9HA 4WY2A 2W4QA 2VJMB 3CRVA 5C4GB 5BQXA 4UCXA 5KTPA 1AQYA 2OL4A 2FFRA 5FT9A 1L5FA 3SPXA 2GVDC 1XCLA 5CFNA 4A8TA 1EE2A 4M4SA 1J00A 3UJAA 4DT1B 5BRAA 3H3FA 3ADDA 4DB2A 2GEUA 2Q6VA 1AF7A 1THGA 4H15A 2QLNA 3M4ZA 3MFQA 1WUYA 5JJLA 3AUYA 3H83A 4M7RA 4AF7A 3KQMA 4Z7OB 4ID9A 1T5IA 3UJPA 3RSQA 3ZU6A 2UUOA 4L08A 4QDJA 1BKDR 2EHDA 3N9IA 4YO7A 1MUUA 4J43A 3HRIA 5CLIA 3D0KA 3V00A 1O8BA 4FYXA 4Q3DA 3CVYA 2G5CA 1UBJS 3NM6B 3QHPA 1UZAA 4UMEA 4RE6A 2D7JA 2ECFA 4JLOA 2JGJA 2GGSA 5K01A 4Z9XA 2PH7A 2JJ2A 5DP1A 2GHTA 1A7AA 3ENZA 3THSA 5CB0A 3DZ8A 4ARUA 5KZMB 3T3OA 1FZTA 1V35A 2AFRA 4PTYA 2IWRA 2IELA 1HR0B 5IJ0B 3PF9A 3EN0A 2ZE8A 3GLRA 3MG9A 5E7IA 1LDNA 3GDHA 1G2IA 2BFDB 2D74A 4MS3B 4PRZA 5ARDA 4U2FA 1D4FA 2O23A 4RIEA 4R7GA 2ZBPA 3WZLA 5GZ6A 1GA6A 2XNDA 3PHCA 3W5IA 1TGVA 2ZRFA 3W8EA 4BVFA 4M0KA 1XVVA 4RADA 4JDPA 1CR0A 1T2FA 1E2EA 1XXHA 5K3BA 5C46F 1X8JA 1A8UA 3C43A 2Q29A 2WHQA 4G5FA 3U1TA 1WXXA 4D9HA 1D2NA 2HCJB 3R8XA 1C0KA 3CVJA 5K0SA 2BGUA 4ZU3A 3TLCA 4W5TA 3DMGA 4XUCA 1XGKA 3KWMA 3WDMA 1B8NA 5DX0A 1HZZA 3AR2A 1I7PA 2NZ2A 1O6ZA 3C3EA 2AF3C 3IEKA 4AN4A 1Z5ZA 4AM8A 1MV8A 2GO1A 1XVTA 3QE3A 1HDOA 4MEJA 1PDWA 1FMFA 3IT2A 4L15A 4U9UA 3L04A 4GKVA 2VTBA 3WSTA 2F8TA 1EWQA 2QL6A 2VHEA 3MRSA 4PVCA 1JILA 4RA9A 3S1LA 1E7MA 2R87A 2FI1A 1I1HA 4KXVA 2GJ4A 1DUVG 1VP9A 4TYMA 3ZD9A 4HZUA 4ENSA 2OHJA 5MHTA 3H9CA 2AFHA 2YOFA 3KQWA 5ALLA 5B6IA 1U9YA 3ORRA 5G4KB 1P1CA 3N28A 4DBVO 3JCZA 3IKLA 1V4VA 1NJ2A 4DC0A 2G7MC 3U9TA 4QNNA 4MV6A 1AQJA 2A7QA 1JS1X 2FG6C 4PYLA 4RL6A 4ED9A 2CVOA 4OLAA 2PLWA 4CMEC 4WH0A 4KQHA 3CG4A 3PJRA 3CC8A 3EWSA 2C29D 2A1TR 2Z2KA 2R4TA 2P1DA 3DOJA 4MIKA 3DE6X 4DILA 3M6WA 1Y4UA 4QJ5A 4HUTA 3EGDA 1UJMA 3DVSX 5CVVA 1KJNA 1GGJA 1J8YF 4O29A 5DNUA 4N5HX 2X76A 1MO5A 3JSXA 1E6UA 2WU3A 3HUDA 4UUNA 3CRQA 4E1BA 5BXQC 1QV6A 3UK2A 1VYVA 3U4AA 3KYDB 5EINA 1XB2A 1EQAA 5IX8A 3UGKA 1NBAA 1N2IA 1YV9A 2G0NA 5ALYA 2OHGA 3CNBA 4HDNB 2H07A 2W8BB 2ZPTX 3C5HA 4RUKA 5I7OA 3H5OA 4XWGA 3RQSA 1V2GA 1WPGA 3PVCA 5CEFA 4XDHA 5CCBA 2BFBB 1U7WA 4XH9B 1XK7A 2HJ9A 1DS6A 4KX3A 5A71A 2QWXA 4HXGA 1QKKA 3L05A 3PL1A 3K35A 3A8TA 4GX5A 5TS2A 4FYKA 4Y8VA 3V6LA 1P9OA 3LCUA 5CJJA 3TIIA 1IMJA 1QFZA 2H4WA 3I83A 2FZKA 3FDXA 4PQYA 4MWBA 4QYIA 5EGNA 1K9VF 2IWHA 4RTKA 1RU3A 5E6RA 2VLIA 5LMUB 1QOPB 1YZVA 2G40A 2O57A 3VYSB 1QP4A 3ZJYA 4X1IA 5AKZA 5ITWA 3C1OA 3M3PA 4NBRA 3NDIA 5FPPA 3T3DA 4F12A 1SHUX 3U7FB 4MW5A 2OHOA 4M0FA 5BNFA 3T1YB 3TIVA 4P86A 3RVNA 1MFPA 1N2EA 2HBRA 3FYUB 3H6KA 4JSYA 2G71A 1AS2A 2QPOA 4RABA 4UM5A 2ZOSA 2R48A 4D74A 1Q16A 2WUVA 1BCRB 3PUVA 4EHNA 4Z53A 2CJFA 2QD4A 2GILA 3TGPA 3OE7D 1R9NA 4J90A 1LBSA 2DFKB 4BVGA 2C0PA 4M0UA 4D8VA 1FFAA 2FK7A 1M2EA 4MDFA 4CCYA 4G65A 5CEJA 5JFOA 4HRVA 1TVKA 1AKTA 421PA 3ZY6A 2XDAA 5CVJA 1USVA 4QQNA 4BZXA 3F71A 2QG4A 5FQNA 2AW3A 2B4KA 4L5IA 4ZVQA 1VFPA 2IH5A 2Q1UA 1X7WB 4JCCA 1QOQB 4RK0A 3WKCA 5TV2A 4CIWA 3TRKA 1IQUA 1UC4B 4OQZA 3AT1A 3CCCA 2FOLA 3QV1A 3VZRA 5A9SA 3CEHA 1MORA 4M0DA 3RYCB 2R1VA 1TKBA 2FFJA 5CHEA 3M82A 3MB5A 1H23A 3GCDA 2VP6A 4A82A 2VDKB 3Q2IA 4D5EA 2DERA 4JYAB 1PO7A 4WOCA 3ROKA 1KI7A 2EDAA 4K1XA 3LM8A 3QPCA 3OUZA 2J1LA 3D7LA 5CDSA 2I7DA 1P60A 1X1RA 2AN5A 4IIFA 4KQEA 1VXRA 3BIOA 4JYBA 2ECKA 4PSDA 2I6GA 3WBFA 3WIEA 1N25A 5BSWA 3PYMA 2JLXA 2RIRA 1DKUA 3ZGLA 3EFHA 2VZ9A 3T4XA 3C1UA 5DHQA 5B36A 1UFQA 5THKA 3JYQA 4ZT3A 1AS3A 2ODWA 1XTKA 1MAAA 2VTDA 3BD8A 4O1IA 3QKSB 4PZ0A 3I3OA 3X43A 4OJKA 1E5VA 5BRNA 3CH7A 4NPHA 4BNJA 4C2UA 4MTLA 1G5FA 3G0CA 4HQFA 3H5TA 5IJ9A 2I65A 2XXAB 3PWTA 3ZCXA 3G2NA 3BDIA 3VR5H 2QE6A 2EX0A 2JGNA 3KBOA 5AHOA 3WBBA 1W2WB 4RJLA 2FPSA 3UAXA 2AVDA 4CG0A 3HJRA 6PFKA 3WAKA 1RKXA 1U9IA 4HD8A 4WKGA 3U37A 3C41J 3BFXA 5EKXA 2AL7A 1CEYA 3OWXA 4D97A 2JI8A 2ZIWB 4AF6A 1O0BA 2D1YA 4LOLA 1MC5A 3C5CA 4U7FA 4X1YA 4LDNA 1HE8B 5AW1A 1KRWA 3SIWA 4A73A 1ISIA 2RGBA 2ZDGA 4HWRA 1GTRA 2DR0A 3SSMA 1U63A 1ZS9A 4XOIA 1DC8A 4IG4A 2EEZA 1G19A 4FDUA 4HWPA 2EIXA 2YFHA 3VKVA 5C9ZA 1CLUA 4R9NA 1H1TA 2JJ2D 3B1FA 3KO8A 4JR2A 3VC2A 1PKXA 1KO1A 2B8NA 3CUUA 3EG9A 3EXIB 3QVXA 1L5YA 1K7FB 1IUKA 1MOPA 3KLNA 3OZDA 5E0KB 4GOND 3EGIA 2KBFA 3HC7A 1V8DA 4LFCB 5BP7A 4MQBA 4N5DA 1FL9A 4RM2A 3JQPA 3WICA 3G7NA 1BJTA 1QLHA 4EB6A 4LVOA 1N77A 4TSFA 2Y71A 4RDXA 1N1MA 1Z82A 2R68A 2FA9A 1HSZA 2ZSDA 3FE2A 4QOGA 4XW2A 1GV1A 2GVNA 4C6RA 4CJXA 4K6FA 4EKEA 3PD1A 1ZLYA 3WGUA 4ZFNA 1TM1E 1YU6A 3KHTA 4J29A 2C3PA 4I4TB 3ZNNA 4PX3A 4DSZA 1J0CA 3KLBA 2YVAA 1KJ8A 2FE4A 1XD8A 4YAFA 2Q0XA 2XMGA 1FLAA 3C6BA 4I6EA 1D9ZA 1JT9A 3Q3IA 4D7AA 3D7SA 5EJ9A 3L7OA 4XUEA 1CJCA 4N8DA 1OX5A 2JIOA 5C1PA 5K51A 3ZQKA 5KREA 4DPKA 3HO6A 3RVKA 5EE5B 4HNUA 2OHXA 3OZVA 5FOQA 4RD1A 1Y8QB 1IE3A 5EIBC 4CM9A 2XCTB 1M0EA 3WRVA 2E4XA 3IBGA 4FYWA 5AKYA 2M6KA 3ETHA 2CLIB 2AKEA 4IS3A 2ISCA 2MWMA 2F8SA 1KRXA 1B41A 1GSHA 2Y1LA 3FWNA 3BK7A 3PU6A 1DEHA 1HV8A 1VE3A 5H9VA 2Z08A 2WT9A 5KYYA 3GUCA 5IC6A 1P6XA 4NNPA 2P9JA 3TXXA 4KDFA 4BL5A 4F4CA 1Z0DA 1CY0A 2JGEA 3KOXA 2P5SA 1HOXA 3SC6A 5EXTA 2Z9CA 5HCUA 4WKPA 1X0XA 2C4VA 2J85A 3CPHA 4MK4A 1FFXB 4UREA 4EYOA 2WAXA 4WK2B 3KEFA 4JP8A 4U7HA 5CA0B 4NPAA 4F60A 2VJYA 3K70B 1VDMA 2NXWA 1EYZA 2C4HA 4DJTA 5IC4A 1G3IA 4WZZA 2J6CA 1QKIA 2O7NA 1IN6A 3R77A 5FXMA 1WULS 4LGMA 4JLVA 1M76A 4CKBB 1SUEA 5LDDC 1HM5A 3Q11A 5A2GA 2REQB 3A4TA 1N36B 3ZWXA 1RBQA 4FFVA 3B6EA 2WWWA 3JXEA 2PBRA 4AUNA 5J4VA 1ENOA 1GV0A 2ZJBA 3AB3A 1SC3A 3BRQA 4EPYA 4EHLA 2J9RA 1B2RA 1A4UA 1EZ4A 1EIZA 3DR5A 4AG5A 3OOEA 4RAOA 3D3WB 2VBCA 1WCIA 2J6IA 1DU4A 4KXWA 3BQMB 3T7DA 5K7SA 5FL3A 2GFIA 1GTG1 5SV2A 3UY4A 3GMSA 1FU8A 3S2EA 4A1OA 4UJ5A 3W1WA 1KEWA 4QBGB 3WQBA 3DV2A 4D6YA 4W5RA 4ALKA 1R0LA 3PC8A 4A0QA 2DY1A 3VJKA 4TX1A 3W8NA 4LOJA 3R5TA 1JQKA 4J4HA 5LXTA 2O6LA 4U7DA 4B3TB 1EJ0A 5K3DA 4L72A 2W6QA 1T1RA 3BE4A 3N2NA 4BKMA 3EC7A 4ZYXA 1FVXA 5ICEA 1NUTA 2XYVA 3I53A 4L16A 1CR4A 1U5BB 4BRSA 5SZIA 1GTL1 1W5EA 4NCKA 2GSWA 3IOMA 3KXPA 1J33A 4DCMA 16PKA 1B73A 1T2CA 4GC9A 2ZYVX 4JLWA 3RHFA 3OLQA 1B3RA 1ANKA 3EJWA 3I6ZA 3ZD7A 4UULA 2VK1A 1WW2A 3IVAA 4OHPA 5B4TA 1PU2A 4JVSB 1URPA 3RUDA 4BGVA 1EFKA 3A1VA 1BHQ1 5K6AC 3RSOA 2QA5A 4HWOA 2B37A 2YICA 3JSAA 4GYKA 5EIAA 4EI2A 5ED4A 4ILKA 2IBSA 1E2DA 1V43A 1QF9A 2VPXA 2GJ9A 1I5RA 2D1TA 2YV4A 4JELA 1JLLA 5JLAA 1O1YA 1IMOA 1IEVA 2A14A 1AMNA 1N2HA 2IPNA 1Q6ZA 2LTAA 3JVUA 3LUPA 4DV3B 1I2DA 5IARA 1T9KA 1ZGJA 3P0RA 1AT1A 2HXYA 2QX8A 3OPMA 6REQA 1WG8A 2QI9F 2IU6A 5TJ9A 5AK3A 3PDHA 1EFRA 4V38A 5KYUA 3D6MA 1O89A 4CLOB 4KQ2A 1KKMA 1P0IA 4RHEA 4Q9NA 4RM3A 2Y99A 2YV5A 3I2YX 1YHZA 3KTDA 4YCCA 4BGUA 4G0ZA 2E4YA 1MC4A 2OM6A 4B3IA 4YRRA 5JHGB 4DDWA 4EY3A 1P31A 2Z1NA 2COKA 5DW0A 4TWRA 3LDHA 3NBQA 1K0FA 3VXKA 1WB5A 3QKWA 2C4KA 4A6XA 4DCNA 1GNQA 1WBJB 2FSFA 2GN0A 3AI7A 3BTVA 4J0FA 4QARA 4RPLA 5B30A 3WK5A 3M9WA 6LDHA 1NV9A 1KP9A 2E18A 3FSJX 1XJWA 3BE6A 1F8UA 2IRWA 2W6MA 3E23A 1P61B 3QEBZ 5AW3A 4NBSA 2O05A 1PV1A 2PO7A 2ZRQA 1EHYA 1E2NA 4OQ4A 5C7LO 4TS4A 2HJWA 1M1YA 3FZNA 3ZE6A 4XTCS 3Q8XB 2G72A 1GRNA 1RI5A 2IIVA 3EXFB 4EAAA 1CRWG 1U1IA 1VRWA 4AC9A 2IS2A 1W94A 1JHAA 4WOJA 4TMWA 4XB2A 1CQXA 4LHWA 2AVNA 3RH0A 3PDJA 1DKRA 3R5HA 4RPJA 1TCUA 4S1OA 2VPPA 1X2EA 2B7CA 4DRYA 1R6AA 3LBFA 4TXNA 4BRWA 5JY6A 2NSLA 5I5GA 1WUHS 2P7HA 3RT9A 1G59A 3D8NA 1I30A 4M9SA 5ALOA 5ALWA 4AZVA 3BGVA 5B53A 5CMLA 4CM1A 1EJBA 2JJ1A 3RYFA 1IK6A 1NI4B 1K7SN 5T64A 1S7GA 3BGOS 2R7MA 3W4KA 4W9NA 1G9TA 4YJKA 3M4YA 3PEVA 2V7EA 1DVRA 4F93B 3GLIE 4GLFA 4NE9A 2HCBA 3CPSA 4KE7A 3IMEA 4PGFA 4ZJYA 3HFRA 3AUKA 4L95C 2D8AA 2Q49A 2XNSA 3EZ6A 4LMBA 3I8SA 4X54A 2XUQA 4GWKA 5AR1A 3P9QA 2H1CA 1HRKA 3HDTA 4U1RA 3U40A 5IC5A 2RAVA 4MR7A 1D04A 1MMFB 1D3AA 4TSFD 4AROA 1K1EA 1I2AA 1C7FA 4C0BA 1W9HA 5AVRA 4I9NA 5FPYA 2BKXA 3P97A 1U8YA 2ANBA 2P7IA 3TL2A 3PZRA 3SQDA 1RM5A 4YIHA 5LXTF 2GJAA 1I9CA 3CN7A 3QE9Y 1E5TA 3LX6A 4R5MA 5AOVA 3P9IA 4DHEA 2Y2UA 4EKYA 3DEJA 2N9UA 2HO4A 3QA9A 5EIEA 4A9AA 1JT2A 2GYYA 4W9RA 3NRJA 4ZD6A 5JARA 2C77A 4YP0A 4ZAYA 2C7OA 2JAPA 1UM8A 3B6MA 3VNBA 1KJYA 1E2BA 1OI7A 2NSYA 1PT7A 4BMSA 2VA9A 1R9GA 3IP1A 4CM9D 1K5DA 1KI6A 1U0LA 2X0NA 2PA3A 2WMNB 3R7WA 2YRXA 1XKTA 4P38A 5JWHA 3RSGA 3VSCA 5CXQA 5KVVA 3X1YA 1QS0A 4L6AA 5HE9A 1ORTA 4Q02A 4F38A 2PXCA 3K31A 1ISFA 3A36A 2R751 2XOXA 3E9YA 1M8JA 1ZNXA 4PHTA 3WLOA 3QX3A 2QM3A 4KXQA 5DYTA 2ZBGA 3L1KA 4KR9A 3CKMA 3KR9A 2WC1A 5KTOA 1FFCA 2C2HA 2A92A 1TM3E 1A5SB 2JLSA 3AWDA 1Y5RA 4PLWA 3GEMA 2Q3MA 4PX9A 2QLLA 3OQ1A 4S1NA 2ZJ0A 4H6PA 2WKWA 1P29A 4JMPA 1KZ1A 4EI7A 2OCDA 5FP0A 2B8EA 2J9ZB 3AJDA 2F48A 1VPTA 2QN3A 2VAXA 3KOMA 4FCVA 1TU4A 4M7OA 4N8EA 4WLEA 1ZYUA 3JD0A 2IUTA 4K3VA 4G5QA 1FDSA 4AYTA 1FYFA 4CM7A 4KN6A 3TZ6A 1MTOA 1VKRA 1Q0PA 3VC3A 4UEKA 5IYZB 3V46A 4YN3A 3BDAA 4BWYA 4QUDA 4R98A 2ZJYA 1UPXA 4C06A 5IT5A 4TMFA 5AI9A 4UTVA 4OGLA 2ZUFA 1AN0A 1GO2A 1S8AA 1G41A 5I4IA 1UH5A 2FPWA 3JWEA 1QZTA 2BTQA 3O95A 4IZIA 4ZAGA 3R0IA 4FFPA 5HF8A 2JJQA 1CUFA 2AC2A 1AUVA 2HIAA 1GG9A 1L7PA 3HP1A 3FMVA 2R62A 4P4NA 5ILQA 3GLGA 1X1BA 5CT9A 5EQTA 1P2DA 4IUBS 5TGDA 2GMWA 2DGDA 4DXDA 1CUBA 2GEBA 3IDFA 1L7AA 2ZSUA 1K4YA 1AZLA 4E5PA 4W5NA 5BN3A 1GADO 2J87A 4UATA 3W7VA 2GESA 3MW8A 1DMRA 2H1FA 4IJ5A 4QREA 5E1OA 1GU0A 3L8YA 3TQCA 5EL0A 1ZI9A 2QYOA 4C2TA 4MQ4A 4B34A 2R6DA 2IZ5A 1QBKC 2EQBA 3PPYA 1YR3A 1IZ0A 3QTBA 4F92B 1G2OA 1DBWA 2YWHA 2I4TA 3G0GA 3L8MA 1GGEA 1BS2A 2V4ZA 5A05A 4UFPA 1YSCA 4WY8A 3BB4A 3FYHA 5L3QA 4HMOA 3KAQA 1TO6A 5EEGA 5JXWA 1T1IA 3MELA 4RW0A 5F21A 1OLXB 5I9BA 4BQSA 3QVOA 2JKYA 3PS9A 4HX9A 1WVIA 5IK2A 3MWYW 4B4VA 1ZKMA 2NVBA 1AUQA 1EK5A 1CP2A 2I7CA 4Q12A 1V3TA 1XLTC 3UK7A 3L8EA 3HHEA 4IQ4A 1Z35A 4HEA1 4MUIA 2O8FA 4WEOA 5AOAA 4UUQA 3PJDA 4CM3A 2CJYA 3RRNA 5LYYA 3ZDBA 1TFUA 1CUUA 2Y6UA 3KSRA 2A5GA 5EE1A 4DC9A 4JBWA 1EFRD 1WS6A 5IH3A 3F8WA 4HPWA 4BZWA 3UMFA 4TVSA 4OHZA 3KRTA 3CCFA 5AJTA 3G2IA 1BTOA 4PO9A 1LH0A 3IHWA 1JR3E 5EKDA 5I4KA 5HZHA 1YJCA 3R23A 2X8BA 2WINI 4DPLA 3HJUA 1BWSA 4J75A 4KMOA 4L8FA 1E8NA 2X77A 4XE5A 3TVDA 4R0VA 3OLWA 5C5EA 4YP1A 1I7NA 3WL8A 4EBFA 3C6QA 3UJNA 1AOXA 5HTOA 3NB0A 1KI8A 3UUGA 4UBLA 3SZLA 3QLVC 4EHAA 1EDEA 4MUGA 2YY5A 2B4QA 1I01A 1D4AA 3CKKA 5CPFA 5I9SA 3ME5A 3RAJA 2YUIA 5AHWA 1RM4A 2QD3A 4JSRA 1RJEA 2G9RA 2QN6A 1Y4ZA 4B81A 1M1XB 3MTEA 4HAXA 4I6JA 3AEYA 4MV3A 1HYGA 4NMLA 2ZXFA 1ZD4A 4GP7A 4ZZ2A 2IYRA 3SGLA 3A9SA 4A0GA 3FOWA 4WLNA 2HC9A 2IV7A 1BKYA 1EG2A 3A6EA 2K4MA 4TLBA 4U39A 2PE5A 1E62A 3ZHOA 4CM8B 1T9DA 1JKJB 1RIIA 4MV9A 4UE6A 3I30X 4ZWNA 2DR2A 3WGGA 4OHYA 4H3SA 2ZXEA 3P52A 4L5CA 4A27A 4AJJA 5JTTA 3J81A 2ACEA 1TLFA 5JQGA 4F2HA 2NUTB 2VSFA 4ENPA 3RLFA 1ECJA 4NMMA 4OSEA 4D3DA 1V8PA 4KWEA 2WAAA 2C82A 4LSZA 3AC0A 2P67A 3RVRA 3PDIA 4ALMA 4JLMA 4A8JB 2JJ1D 2G83A 1R6UA 3I04A 4QULA 3VYWA 3Q2KA 3EYWA 3AIMA 3ORFA 4AKSA 1DJOA 5CBPB 1E9RA 1USWA 3B12A 2J9FA 4FYMA 1TAUA 2CCKA 3QUAA 4E5VA 1G5IA 3AB8A 1NR7A 2M6SA 1ZINA 1EAYA 1S01A 3DHVA 2JZCA 1HT3A 3D3JA 5KVQA 1YWGO 2HWXA 3AF5A 1UBNA 1RZRA 3ONFA 4Y7DA 3ZXUB 6GPBA 1U1EA 2GEJA 3DMYA 2PWAA 3N75A 3UWMA 3AV3A 2P4QA 1ESZA 4R2HA 5TJHA 3THXB 3H1BA 3PA8A 1KIFA 1NVWQ 2WI8A 3FG9A 2GAIA 4PC7A 4Q7LA 3AI3A 5CYFA 3I12A 1Q19A 3TF5A 3N0TA 2IK8A 4HFJA 3HJCA 4RQTA 1K2WA 1YXMA 1JPVA 2PWPA 3KTAB 1VIVA 3Q4GA 1HSOA 1TTHA 5TE9A 2O8VA 1LKZA 1NBEA 1U98A 1YJXA 4V3BA 1PN3A 2J3KA 2PTHA 3B9RA 4LJ5A 4NEGA 4Z9BA 5DU2A 3IMCA 2P2YA 5E3JA 1OXVA 4MXDA 5H82A 2H4JA 3L06A 3M4JA 4BYGA 5HP4A 2ERXA 3GBPA 4X3PA 2DLDA 2OILA 4BLPA 5F1OA 2FSIA 1K6JA 3EPRA 4Z9FA 5SYAA 4XDGA 2XMBA 3FOEC 4KUGA 1Z12A 5C8VA 1HDZA 1DIBA 3LUDA 1N5RA 5KHAA 5M34A 1B16A 4QJBA 4ZV4A 3HKDA 3NORA 1J9GA 4QXRA 1DBPA 2VK4A 4OHUA 2GQ0A 1KEUA 4MV5A 4WNYA 1CUGA 3H9EO 4UAVA 5DTIA 1CETA 1TYAE 1CVRA 2O0JA 1Y1KE 2PD3A 3DL7A 3GNQA 5LBTA 4P5PA 2IZ0A 1ODIA 1P2FA 5JVDA 2VEDA 2XZLA 3GVXA 2XCRB 3RGGA 4DMUB 3I9V1 2FE1A 1RRFA 1XCMA 3ED1A 3UOWA 3FNQA 4GGPA 3QFHA 1Z39A 2XF8A 3MXOA 1VSTA 3L1JA 1WE2A 1QZXA 1XEXA 2IYAA 4MUHA 4NBVA 2EYUA 4OIFA 3UG7A 4GKKB 3GA5A 1GKKA 2O4CA 2GOYA 1F17A 4UPVA 4DANA 2QMUA 4PG5A 4TYQA 3T9DA 3ZX5A 2PUDA 3A3OA 1QRDA 4HDMA 4NIMA 1KPGA 1NURA 4URVR 1IVNA 2M32A 5B55A 3B9QA 4FEYA 3ZV6A 4YQFA 2OLEA 2Z6QA 3IYLW 4KPYA 1G21A 4Y30A 2JL1A 2GERA 4OMCA 1C1XA 1DLJA 1YRBA 2JJYA 3RYTC 4YLYA 1OA0A 1QIMA 4LTNA 5LLSA 1P5JA 4X62B 5JS1A 3RS5A 1E1MA 1ADCA 3MTAA 721PA 5ALEA 3LGAA 3QF4A 3I5UA 4M37A 3GQBB 3K6SB 1N5IA 2HRBA 1ZX1A 4KP7A 1PGQA 4P8RA 3JX9A 3WK4A 2NSJA 1LPBB 2Q2NA 1SQ6A 5ARBA 1NJ5A 2EX4A 3HXQA 2JA2A 1TM5E 3P94A 2IV2X 4OOEA 1IZ9A 1ZUWA 1XMIA 3BWXA 3D0RA 3MGGA 3H5VA 4JLPA 4NFYA 3I09A 4KMMA 4DQUA 2R6HA 3RFUA 3H1FA 5JAHA 3P9NA 5C4IA 1M5UA 2R8RA 3IEPA 2WPNA 1FMCA 1CQPA 4LF9B 1UJ6A 4BLOA 2C4WA 4KO8A 1YACA 3O8NA 3T1QA 1WOYA 4UE3S 4C43A 3H42B 5JQGF 5KPDA 1Z73A 4OKIA 3OHMA 2EXXA 4LHZA 5CX1B 5K3FB 2KQUA 4AN1A 3EZXA 3H5RA 3C14C 3PPVA 1ZJWA 2XYGA 1TQHA 3G13A 1L5OA 1PX0A 1Z4OA 3SC2B 2YZGA 3DH0A 3FIJA 4IEEA 4BWVA 2O7RA 1RP7A 3WDLA 2B25A 2IYUA 4MIYA 1KOJA 1SXJE 3U0BA 2BSAA 3I0ZA 1M8KA 5HFNA 4JASB 5IK2D 5FBQB 2H2FA 3SJZA 1E94E 2QS9A 1DIGA 3GJTA 1F9EA 4IJVA 4NESA 2JGFA 1H4QA 3R9XA 2GB4A 3L8HA 4TV8B 3DW1X 5JCXA 1WSWA 2O2EA 1XTJA 1K8RA 3VVCA 1WIWA 2OFPA 2PT5A 2X5NA 4PAGA 4PYOA 1XTZA 3S27A 4MS4B 3CEMA 2RK6A 4ACBA 4F85A 2WTUA 2FPLA 4GE3A 4TT3A 4LJAA 3RQIA 1LRJA 2JLZA 4LNUB 3ZCRA 1OLSB 4WBNA 5BO5A 4IFIA 2BISA 1RI3A 1QCZA 2P62A 5CFZA 4BX2A 3O73A 1AZWA 2DOKA 2R1TA 4MP8A 4P3NA 2I4LA 4FHZA 3RTAA 4IDPA 3VAYA 5FWXB 1A98A 1I4DD 2H4FA 2GK7A 3KQSA 5A9TA 7ABPA 1X7GA 4LV8B 1CUSA 3OZWA 4MVJM 4RHYA 3DD5A 1XHEA 3QWIA 3D43A 1IY2A 2F90A 1V3QE 2I67A 2ZAMA 5CFLA 5AOCA 2EW8A 5A4FS 1IN4A 1DNPA 2EU8A 5KQRA 1SR8A 3QEJA 3HCDA 2DSNA 4PLTA 5HOQA 5AJZA 3KVYA 2FWAA 5JV5A 2I62A 1ZH8A 4KXLA 1UKZA 5G1OA 2DXIA 1NUUA 3R3UA 4Z7QB 1JZQA 1MOQA 3BMOA 4ZOLA 1BA2A 2INGX 1UEIA 4QJ4A 2B0CA 2YINC 4Z5XA 2Y1KA 4A0SA 1JHPA 1NZJA 1UK6A 5JVDF 1DO8A 3O91A 4OFXA 2C3OA 1FTWA 3DWGA 4HGPA 5HG0A 3TNDA 3UPDA 5JNLA 3ANNA 2MSEB 3K9HA 3LL7A 2FSVC 2EFEB 1KDYA 3U2QA 2P2SA 4KKXB 3R76A 4YDRA 3UBMA 3DE7X 4BO8A 3ECAA 5K45A 1YRYE 4JX9A 1N3LA 1QVRA 2LXNA 1MRZA 4IINA 5JYBA 3TE7A 1ZI6A 1DRWA 1ESEA 4GVLA 5BPFA 5CA1A 2RBKA 1YFLA 2X6QA 3FNRA 4NVRA 4W5OA 1BE6A 1W47A 3IX7A 3U62A 3IALA 3X1XA 1LNSA 1VL0A 3ZXXA 4AS2A 4MKZA 1JH9A 2HWWA 4E08A 1FTSA 2XA9A 3CB4A 1YI8A 2Z2ZA 3DQQA 2W4IA 3R3SA 2BP7B 4N4AA 1QYIA 4NCIA 4M8NE 5DCYA 4RIFA 2ZPUA 3A14A 2QK4A 4NCNA 2XX3A 2ADFA 2ORED 4MTCA 1RZRD 2WM2A 4W9MC 5EHQA 4PRYA 1QORA 2BKEA 2HK6A 3B82A 1MABA 3JVIA 5B3LA 4BVLA 2GK6A 2V8BA 4FQ5A 1ND5A 3B6ZA 3PEEA 2LP4Y 1IJKA 2FQWA 4TL7A 4UARA 4P36A 5T4FA 4ITUA 1K89A 4DVJA 3HDYA 5LMCA 3TLKA 4I14A 5IDYA 2PL1A 3GMIA 2Q7OE 1H2ZA 1XZCA 4DIEA 2G5TA 2ZR9A 3MUNA 5B7QA 1EDBA 2BY4A 2ETVA 2JHAA 3H99A 3V8RA 5K8IA 2CVFA 4ZQEA 1YOVA 4PNEA 3PNSA 1AY0A 4OEHA 3G2OA 3ETDA 3BGIA 2XUHA 3KZXA 1G5HA 3LD9A 3PB3A 1POXA 4IUYA 5CB4B 5EJEA 3IEUA 3EZ9A 5EMMA 4B6FA 4R1MA 3RBAA 2BV3A 1UBSB 1M1ZA 3DCJA 3MINA 2JEZA 3NHFA 4OMUA 2ZR7A 4RMIA 3RG8A 1FUEA 4DYHA 3O4RA 5HFJA 2CMDA 2D5AA 3GHHA 1Z9BA 3N1UA 1OFVA 4MPTA 2V96A 3SQLA 3TYXA 4DR7B 3L8CA 2JGKA 2WJGA 1N2OA 3KNZA 1M34E 4RDHA 1U0BB 1E7YA 4TQGA 3PX7A 3NW9A 1A7JA 5T6BA 1D2AA 5CUQA 1C2TA 2GEDA 3B5EA 2OKGA 3CLVA 1SXPA 3OIUA 4NE7A 4XQ0A 4GEKA 4Y6RA 1RZVA 4HHEA 3PCTA 3HJGA 3IVGA 1VFNA 5L3ZA 2Y8EA 2ONJA 3RBXA 2QRVA 4BNUA 4CYMA 4CKZA 4PQRA 2C31A 3EXG1 3RC1A 3QPVA 4PXYA 1RWOA 1A0OA 3QX7A 1I14A 3VPCA 4B40A 1FDRA 1KL7A 1Q0RA 1T36B 4R6XA 4LYYA 1EGVB 2VT6A 5BSUA 3HEMA 4PZLA 1IATA 4C21A 1F2DA 2WRZA 4AZ0B 4FSHA 5BR4A 2J3HA 4YO8A 3WVNA 4OBEA 4AKEA 2OC9A 5D5HA 4XR4A 1O9BA 4R3WA 1TVCA 4AMZA 4PHGA 1PT6A 1S02A 4D3SA 1JPJA 1O9GA 2B9VA 3TQRA 4RD2A 4JI3B 1EVZA 3VM6A 1WZIA 2VAPA 2H5EA 3HRKA 4NYIQ 3N8DA 3WL6A 2HV9A 4DNOA 1KF0A 4GI1A 1C80A 5AUOB 4UQOA 2Q8PA 4OXQA 4W5QA 1WCXA 1P3JA 3FRIA 3FUCA 3TTXA 1TYCA 3V80A 5COAA 3U60B 1AQIA 1X19A 1ESDA 2NPOA 1PJ4A 3L0DA 1JQDA 1Y4AE 3QMMA 3WLPA 4DSUA 4Z4EA 2FG7C 3AXSA 5ENVA 1U1CA 1FU4A 1VCMA 2W8ZA 3KEMA 5DDIP 4MRVA 3NUGA 1EVQA 1RRPA 2ZJ4A 2FPPA 4ZOLF 3RWMB 2FYTA 4AJ9A 1QQBA 1Z45A 2P65A 1SURA 3L6CA 2WF6A 1QGDA 1JQAA 1D9XA 1Z4NA 1NE7A 3B1XA 3FPJA 2CEKA 3BXPA 4TN5A 3WIBA 3C5VA 5LA6B 3ZIAA 4AMGA 4JIMA 1COWA 5FWDA 4ECEA 4YHHB 4HDSB 1AUOA 2OECA 3HI4A 1P4GA 2DEUA 1DC6A 4ND3A 2PJDA 5DSTA 3ER6A 4JQCA 4U2GA 4JA0A 3BN3A 2TMKA 4W8HA 2QX4A 4ON9A 2ZUDA 3KJFA 1LD3A 2GN1A 3IV9A 7MHTA 3TSWA 5CA1F 2N0SA 4NDNE 4KMRA 4UUMA 1L5QA 4UOQA 3MB8A 2ZIGA 1NA5A 1ZM7A 2Q1YA 2XZDA 2BH2A 4LJ9A 4XUDA 2I7VA 4IG9A 2EZ8A 4QWMA 4RGQA 5ALJA 4OL0A 2VPIA 4D4KA 3PGLA 3I72A 3FR8A 4PG7A 1N8NA 4PAWA 4M98A 1GKUB 1GPH1 2AG5A 3RI3A 1RW4A 3KFXA 3QWAA 1ZBDA 2P9CA 1O4VA 2Z9DA 3H7IA 3O2NA 4R2KA 3ZDCA 5FBKA 1TK9A 1VHJA 4GZ3A 4AXXA 3QM1A 1A1VA 1E5DA 2ZJOA 4KGXA 3CZ4A 5T3YA 5TVKA 4QELA 4PGAA 1E3QA 5HM6A 1RXSA 2H1LA 3E27A 3K4PA 3KC2A 2A33A 4J07A 1DWOA 1M3SA 5ECWA 4DCSA 3G0DA 5AVSA 3RKUA 1ZFNA 3U17A 1JEEA 2VJMA 5JIBA 4AY6A 1KMIY 1W88B 3L18A 3OFNA 3SHTA 1SJ9A 2I29A 4LXXA 2P77A 5JT1A 4E15A 5B6JA 1QHEA 3IBFA 2Q6LA 3BHJA 2TSYB 3LHKA 1KSHA 2YHIB 3T4PA 4LZJA 1Z0AA 1KRHA 5BW8A 1G20B 4DT1A 1Z0UA 3P0HA 4OPMA 2HGSA 2V7QA 2VVTA 2ZB2A 3RU9A 5HGXA 2ONYA 2ZCUA 4UDOA 5F64A 3ZHBA 4E4RA 1J23A 3F1LA 4FS3A 1WNFA 1H8HA 4RFVA 3NEAA 4TXHA 4U9IS 5J5CA 5TVGA 1F3OA 3WB2A 1SC1A 4ENRA 5C32A 1GU7A 1JHVA 1GD1O 5LDGA 4D1YA 2QRJA 2DULA 3K2BA 4B6EA 1E1YA 4AIIA 2PS1A 3U81A 4UQLA 4Q6BA 1ZCAA 3TKLA 3W2EA 1L7OA 2YWBA 1GZSA 1PNQA 3FW1A 1MW9X 2FN8A 2WJWA 3D8TA 3F9RA 1LV7A 2I6QA 4ZICA 1VI6A 3Q7RA 3HP4A 1NW6A 2PX3A 5IJ0A 3HY6A 4B6RA 3I2GA 2WR8A 1FJGB 1HDIA 2BFNA 3DEYX 3HKCA 5HF6A 5AK5A 3FI9A 2K2WA 4DR3B 2BFDA 4XJTA 1C9KA 3AL3A 4KQJA 4O6VA 4WOPA 3RC3A 5B1YA 2PU5A 3ETLA 1IWPB 5H68A 3ROFA 1JLMA 4ZAXA 4FZVA 5JHHB 1ODLA 3DV9A 5J47A 1NPYA 2PSDA 1E4VA 3DYIA 1C1YA 4YRIA 5K4GA 1UMBB 2ZI9A 3BGDA 4LMRA 4FK8A 4OJYA 5JZSA 2LGJA 4LZWA 2EKPA 2VPTA 5C8YB 2RGGA 4B76A 2CLSA 4EHIA 4F5DA 2WVGA 4NV3A 2P2DA 2PKXA 4BLRA 4DIDA 4RK1A 4LXHA 4HWTA 1GL6A 3RREA 4C7JA 3V9PA 1S4MA 2HF9A 1NZFA 3EFOB 4CGYA 4DE5A 5KMGB 2FW9A 4L5YA 2NZYA 4E3ZA 2HA6A 3E81A 2O19A 4E12A 1GR1A 2D0OB 1CZLA 3KAJA 1HLDA 4GLOA 2A9JA 4Q1BA 4Q4LA 1KAOA 1U0NA 4LWQA 1E3TA 3BH6A 1W48A 4MIEA 5IYZF 1TJYA 1X94A 2ZB3A 3F46A 4Z4FA 4MOWA 3WGHA 3URMA 2NZJA 1PFYA 3LLUA 1Q7GA 2CMGA 5G4KA 1LK0A 3RSHA 3SI7A 3C7AA 4HYEA 3T5TA 5LQJA 4DLPA 2GZRA 2WAYA 2J5KA 3WFIA 1TCAA 2HB6A 3B2QA 2O5VA 5K0GA 1XKLA 1JQEA 5K4AA 1KOFA 2FSHA 3K0SA 4DA4A 2V3CC 1DOAA 1NBOA 3OQOA 2Y1OA 2GNAA 2XEDA 1I4WA 1Q84A 4FI3C 3P5BA 2EV9A 4JC8A 1IBMB 1DPGA 1DZ3A 5IS2A 5KYWB 3KYDA 1Q0QA 2VTVA 2G9VA 3SZRA 4XI9A 1T6NA 1LQUA 5E9JA 4Y2UA 2PMWB 3T4EA 1YMUA 2XE4A 3L79A 4FX5A 4HDNA 3M83A 2W8BA 4WNAB 5TF0A 5ADHA 2IS6A 3L2OB 3VV2A 4CMEA 2R65A 1RTKA 2RHCA 1GUBA 2BFBA 1O94D 4TROA 4R0NA 1CJBA 3V1UA 1EQ2A 3ZE0B 4OHVA 1Z6ZA 1CX9B 2A4MA 4LXQA 4IH4A 2BGRA 3TD2A 1V16A 1ZVJA 2FMHA 3QWFA 4P0TA 4CFZA 3HJFA 2H0QA 5FB3A 3UOGA 4RPKA 2FUG1 5K0BA 3RUFA 1WCV1 1MH1A 3DBOB 3OEED 1APBA 1IDN1 1ZLXA 1EUYA 1N57A 4DDTA 4Z0HO 3DTVB 1LPAB 3HKBA 1DAOA 2KE5A 3V8MA 3S8YA 1Z75A 4RKFA 3DZGA 5D3KA 1AHHA 2YXPX 3D8HA 1RRKA 4MRPA 2OCKA 3TG2A 4DMKA 3P20A 3TI9A 1I10A 4D42A 5BY2A 5JR3A 4CQNA 2DFVA 3NGXA 3BEDA 3MTDA 2YHBA 2NYUA 5ER6A 2FCRA 1BCRA 1OYOA 3A6GA 3EGWA 4OHXA 1QM5A 2RHDA 1VG0B 1TVMA 2Z56A 3I4CA 4F3RA 5JAUA 4EB8A 3ZIAD 1BWPA 1G6OA 5FLXA 1ADJA 1BD4A 1COWD 1KEZA 2QMQA 4UBIA 5ALMA 3EIQA 4LZPA 4COOA 3FZEA 3ZOKA 4TV9B 5LJIA 2FX5A 1T4BA 4WFIA 2E87A 3AFIA 3K94A 4S0ZA 3VO9A 1X7WA 1J8QA 1XXHE 4C2AA 2HOQA 1VJDA 1M6YA 1WB4A 3EJ6A 3Q3EA 4CF6A 3LC0A 3U3OA 4KMSA 2XGMA 1RWXA 3U7QA 3BWBA 3RYCA 3RTGA 3P45A 1VL6A 1PVDA 2E82A 4ZT5A 2OSVA 3RUAA 5JZ9A 2VO1A 2YJ6A 4QYMA 2K7FA 4H77A 3HYCA 5HHTA 2H2IA 3RODA 2UVPB 3IQEA 4TL8A 3MLEA 4QYTA 4R7ZA 4BU0A 2GF0A 3B85A 1TMOA 3LPAA 4TQ9A 5D7BA 3PEYA 5AT1A 4DC1A 1CRPA 2GBLC 4F3TA 1Z0KA 3L6UA 3N74A 2ZWOA 1XPJA 3CG0A 2IITA 1T3ZA 2HQRA 4HKTA 4NQRA 3KHSA 4LDZA 4BB9A 3QKSA 2XA1A 4BNTA 2AFHE 3W77A 5J4YA 3OFND 4IIBA 2CXNA 3QEKA 1FX0B 2VSYA 3ED5A 1YR1A 4WLUA 5JCZA 4BO4A 3VA7A 2XXAA 3PC3A 1NX9A 5LCXA 1G1AA 2A5FA 3TRJA 2IUFA 5AK4A 2H8GA 1WMEA 4ERNA 1LSJA 2ZVDA 5FD8A 2V1UA 3WA6A 4LGYA 2ZJ5A 2ORYA 3D7KA 1K5GA 3II6X 4O4HB 4R83A 4EG6A 3MD0A 2GCIA 4UNQA 3TBKA 4B71A 4JNKA 1Z8NA 1P0PA 3V3TA 3UYKA 4KFRA 2YJ4A 1AUPA 1E8DA 2FWMX 4J0EA 4ZT7A 2XCSB 4W1RA 1VMAA 4A2CA 3JWHA 2WT4A 1QP0A 3H1AA 3AZPA 3PC2A 1CG6A 2QJWA 3IQWA 3C87A 5TF4A 5HQ3B 1JNXX 3T7EA 4X6XA 2B35A 5DPMA 1X7XB 1U3CA 3EGXA 3EXIA 4PCUA 2B3TA 3K1JA 1BQEA 2R6FA 1P7ZA 4JKIA 3RUIA 3T9FA 3K0HA 3IUSA 2AMLA 1ZOIA 3G5TA 1WY5A 2BWJA 4MI1A 4OJMX 4XVRA 5AO9A 4ZVOA 4E11A 1EXVA 4MVJP 2ZWVA 5AUNB 2NYAA 3TZKA 4KYVA 3PGKA 1IBCA 3D81A 5B37A 1HH4A 3HA2A 3NNNA 3R74A 1USGA 3K1AB 5JYDA 1RAGA 2AQHA 1OX6A 2DQ4A 1ZCBA 4I4TA 2FV8A 2XV1A 5TPWA 4EGSA 4LAFA 2AEJA 2G5PA 2QBYB 5HS6A 2WU1A 3HCBA 3VKWA 1SK8A 4GZMA 2CLOB 1N6NA 2RGNA 1JHYA 2V6GA 3RYIA 4C7MA 1RTTA 2Y1EA 4I1OA 3UA3A 1J8DA 5CLGA 4QGGA 1UBHS 4M1KA 3T61A 5DZSA 5DISB 2GBFA 4RQBA 3CLKA 1TPYA 1CJUC 1VMKA 1JHUA 3D4OA 3DPSA 3HPRA 4RPIA 5AJWA 2PFKA 5A2QA 2GEFA 3TSAA 4FYPA 1KY3A 4JEIA 5LPNA 1DV2A 2W6JA 2BBTA 5KHOC 1E5QA 4A5SA 1YNOA 3OM8A 4Z3KA 5BPHA 3I3SR 4D4GA 5HX7A 2R44A 1R4NB 4N9QA 3KETA 1DBIA 2HLHA 2OFXA 1T3GA 1U9JA 3KJZA 2O6HA 4LXTA 1S6YA 2RI0A 2QZSA 3F9CA 3IS3A 3UVEA 4B84A 1T4CB 5KJ6A 4OXYA 4IIJB 4C20A 3KSZO 3ORHA 4BE9A 1GPNA 1GVNB 3AYZB 3ND9A 4PIPA 2ZI4A 2GS9A 1FFXA 2B98A 3F90A 3PQFA 4ZVVA 4I1IA 4ZPXA 1P1JA 4RJKA 1KO7A 3LC2O 4G1MB 2H31A 2CN1A 5CA0A 3QBDA 3GCWA 2BBSA 1UDRA 6YASA 3FCCA 4FZJA 1F8GA 4IH1A 1KQGA 1NC3A 3UIEA 2FSSA 1NOJA 5CFQA 3OT4A 1ZY2A 4FNAA 1RBZA 4OMDA 1I36A 2PL9A 1QHHB 2GA9A 5E7JA 4KO4S 2Q3FA 4CKBA 2RHOA 1IZZA 2JEOA 3MWFA 4ZQHA 2CNNA 2IYWA 1Q15A 1GY8A 1WMDA 4TL9A 4QGBA 4AJ1A 3WGQA 4MWCA 3WYCA 2D1FA 3O8RA 2PRZA 2KI5A 1FYWA 2Q5EA 3OPNA 4FHCA 4MI6A 2L19A 3D3WA 2HMTA 4D46A 4G84A 5LZ8A 4EABA 1XV5A 2AJCA 3C3CA 3H2KA 2CLKB 3GB9A 1KMCA 1ODCA 3MJRA 4N5MA 5AKXA 3UQZA 4F1WA 4J76A 3VGJA 4F2GA 1EX6A 1S96A 1JMKC 4KWIA 3DLPX 3MJ4A 4Y2VA 2G9UA 2NO1A 4Y0NA 5FULA 3S2FA 3UYLA 3I01A 1PAUA 1YOBA 3H4VA 1SUFA 2CJWB 1SELA 3SX2A 3ORQA 4J3JA 3INNA 3JQBA 4KK3A 3LTEA 3VO1A 4BO2A 1XAHA 3A7EA 1KP2A 4BVEA 4MKXA 3PHBE 4FZ5A 1U5BA 2FW7A 2AFVA 2PGNA 3K5PA 4IDDA 4QDKA 3WO1A 3TLYA 2V6BA 4DCPA 3Q3CA 3BIFA 1LW6E 2IKQA 2NU8B 1OBFO 4RVDA 2BKAA 1YA8A 4JSTA 2HJHA 2QQ5A 1I6KA 3KZMA 4PLYA 2V7WA 3R6DA 4EKIA 5KJCA 3C6KA 2UYQA 2VDMB 2PWZA 4N7BA 4EIWA 1BHO1 5I5EA 2BDEA 3BWEA 3ZI0A 1JDSA 4R2MA 2HAEA 2XQFA 3AL2A 4NICA 3QGMA 3N8NA 4GLJA 5KWEA 1CVLA 4DBZA 4EHKA 2VQEB 3HM9A 4JYMA 2XMSA 3AF6A 3GBSA 5JROA 1QRSA 1YE5A 2FVYA 3LK6A 4YJHB 1Y8CA 5IKMA 1DKOA 3IODA 2XPCA 3ICWA 3W1EA 5HWSA 3WP0A 5KQGA 2XB4A 2JGDB 1SEVA 1Z88A 2CYCA 2X4LA 3AQIA 1J56A 4RWEA 5FQOA 1N3BA 1FNMA 3TQOA 1MEEA 1QP8A 2PWYA 3PFCA 1ISJA 1WSBA 3E9NA 4EF5A 2BSXA 1NVKA 5LD2B 1QRAA 1JWAB 2WNSA 2ZUWA 3LHIA 2ADOA 4I4TF 5JD4A 3ONEA 1U02A 1H05A 4TMKA 4FNOA 1R4MA 5F52A 2B61A 4U7GA 2RGXA 3PF8A 3CZPA 3DGFC 5FWYB 1IEQA 5KWSA 1SHZA 1U6KA 3HR7A 4Q0MA 4KBGA 5L4SA 4DAEA 4E1VA 1P33A 3PIDA 3SU8A 1AK2A 2ZAGA 2ZK7A 3HNOA 2BGTA 3JRWA 3R3JA 5H0IA 4MVJG 3Q7SA 1JIQA 3ROGA 3NTOA 4C5CA 1G3RA 5JPCA 1U7PA 5AM5A 1P74A 4LNHA 1RADA 2D2FA 5CAEA 3LCMA 1MKYA 4FKMA 5FBLB 4BCDA 3BD7A 1UADA 3FDIA 4CL0A 3QVTA 7ADHA 2G5GX 4CIVA 1P75A 2WG2A 3A31A 4J2HA 1E60A 1A69A 1UFVA 2DPYA 2GD2A 2XB6A 3KPUA 5LQCA 1HOTA 3QKTA 1E89A 4DS3A 5I01A 1EM6A 1JJ7A 4ISBA 2VHXA 2J48A 2QYTA 1H2RS 4B4UA 1LBIA 3UUFA 2O2CA 3NNSA 2RDMA 4BYMA 4NHOA 3KLPX 4MVWA 1TKCA 4Z9YA 3WTCA 3X1WA 3LA6A 1GGVA 5I7AA 1J6UA 1STOA 4A92A 1QXSA 5ENDA 4KO1S 4J2TA 2B6NA 2RJOA 3STUA 3W90A 4B3JA 1NI4A 3EXEB 4INJA 3NWPA 1QAMA 2HMVA 2VXBA 2WU8A 1MPTA 4IS2A 5KYTA 4L8GA 1O96B 4C6TB 5JUWA 1CYDA 2VWQA 4KR2A 4GICA 3GGGA 1P18A 2F9FA 1QLJA 1XO1A 4GI7A 1IXYA 4Z7JA 4ZEVA 3DBRB 1R8YA 3OC6A 5KWVA 1Q22A 1M2WA 3ZLUA 4Q5IA 3C48A 1XMVA 3NRBA 3H9UA 1AKRA 4HPJB 4DLNA 4E2ZA 1UIRA 3GLQA 5K6TA 2UU9B 2VJPA 3AEXA 3PKJA 4MW2A 2FQXA 4PFKA 1D2CA 2HQ1A 4B87A 2P27A 5IXJA 3SKYA 4KIWA 5G53C 4J0QA 2JIPA 4B82A 4TS1A 3BMNA 1A50B 3LWBA 1YL7A 3PCXA 3UK1A 4PM4A 1N0HA 3U61B 3LU1A 4TVBA 3KM0A 4GI2A 1P1BA 1NYTA 2GN6A 3CR3C 1W7AA 1JEQA 1AKUA 4P84A 1A76A 2BR4A 2PCLA 2WVAA 3L4BA 1XDBA 1CJTC 2CKMA 2A9VA 2XBUA 3PFHA 1ULSA 3ZJVA 4IV8A 1RAFA 4ROSA 4WXHA 3G9UA 2DUJA 5DTQA 2ZIEA 4EJ6A 3F7TA 2QTRA 2C97A 3U7EB 4BNKA 2W6JD 4LRXA 3UAZA 1CYEA 4JT8A 5KQSA 3LLVA 1JR2A 3BMCA 5C7OO 3OFKA 1B6TA 3V7FA 5JRZA 4RTSA 3HNRA 2H6EA 3MCZA 1EXDA 3LKDA 3LT4A 3HJNA 2AMFA 1C3EA 2I6FA 2FMKA 4YBRA 3FH0A 3V34A 4EELA 1AQNA 1Y7LA 4HFRA 4FYIA 2CHEA 4OH1A 5JPDA 3ZHYA 2QD5A 3PC4A 5E2BA 1QNFA 2C2WA 4A7PA 5GONF 4NFLA 3OG9A 1OKKA 3LH5A 4Z0NA 1EJ6A 1ZM4A 4OKNA 3SDSA 3K70D 1AS0A 3QUTA 1YZUA 3J7AC 1W5FA 3A26A 3VR4H 2GPNA 5IMBA 5ITVA 3MVEA 3GJRA 2ZUUA 3G1UA 3Q9SA 5DNAA 5HZKA 3E22B 4LKOA 1P3Y1 1B7GO 3DAFA 4CIXA 2O7SA 5A5GA 1C9YA 2P75A 3PL5A 4F21A 2WSMA 2QUAA 3GRZA 4TTJA 1Q57A 1FP4B 3LZDA 1DC3A 1JDVA 1SFRA 2FTKE 3HU1A 4H4DA 3IE2A 4X3OA 3JQAB 1RNLA 1YRAA 3HCNA 4K6MA 2FWIA 4DLVA 1EPUA 3OQPA 3IDSA 3KVRA 5JO9A 5B64A 2DYKA 3ACDA 3FVVA 3G68A 4TSRA 5GY7A 2W2OA 4BV8A 3N0RA 1T6ZA 2ZIUB 1K8QA 2PH5A 3GFRA 4O5OA 3CU5A 1IZ7A 1N5MA 1RXWA 2H5LA 1XZHA 2CMHA 3GRVA 3KHKA 3TBFA 1Z83A 5E38A 2QNRA 1TYEB 4TRJA 3OD5A 5H02A 2FEAA 4BV9A 1FS5A 1WXQA 3OQIA 2ZSFA 1R64A 2UUPA 2FWJA 4HWSA 5KBYA 2ZP1A 4AZWA 4FFMA 4ERXA 5DMHA 3RDPA 1IULA 1JEDA 4YASA 1XC7A 2O20A 3NONA 3NVKI 1W44A 1GTZA 5CDUA 3SEAA 2QDKA 1H3NA 2OORC 2FQ1A 5BMVF 3T5GA 4FONA 3PHIA 3JARB 1PSZA 2EFCB 4BQPA 1V4BA 3AL0C 1ULAA 1HDEA 4B7XA 1N2XA 3AW8A 4I2NA 4MUYA 1OLXA 2H18A 4RF2A 5DOZA 1PS8A 3PEFA 1L8OA 1QJ4A 3Q3HA 3CRNA 4HUQB 4KQIA 2OQVA 1JEJA 3TZLA 1WXWA 2OXEA 3KLOA 4KQ9A 1YBFA 1UC9A 1DE0A 1RQGA 4QFCA 2HLPA 3EIFA 5K0CA 2AXPA 1QRRA 5JXHA 1QK3A 1N5LA 3UMSA 4R01A 5F3RA 3DONA 1YE8A 1OJ7A 1SQ5A 1PJAA 2P30A 2DUNA 4V0NA 3ZWKA 3CUWA 4BX3A 2HA0A 1KK0A 2Y6VA 3R3VA 1M2NA 4PINA 1QRUA 4DUGA 1LRKA 4AMVA 3BWCA 1X80A 4F46A 3FTFA 2XDQB 3DNFA 1RMTA 1TCCA 4NFHA 3RB8A 4KFSA 4DJFC 3IAHA 4HH3C 4UVGA 4XPIA 4CDMA 4XAQA 4UBNA 1XLTA 4JC5A 1QGYA 1GYPA 2PIDA 5THQA 2VP4A 4E03A 4KFUA 5DTJA 3RC9A 4PNZA 4KTTE 2X9VA 1R15A 3QU9A 5IAAA 3NIDB 4LE0A 3RSFA 5CFMA 5KTTA 4IOJA 4G5RA 2A9QA 1KIAA 1H6AA 2VDNB 1JIIA 3JAKB 2DRIA 4URUR 3WE7A 4BRUA 4Q34A 1H0RA 5CXSA 2DZDA 1ISHA 1SOMA 3CB2A 4HNSA 4LBYA 2BM0A 1GDHA 3OETA 5K3OA 1BX0A 3L1VA 1SU6A 4B80A 4MLPA 4WVLA 4X7MA 1ZQ1A 2QTNA 3BXEA 4RYDA 1JV2B 3LT2A 4URWR 5FEMA 4V03A 1Y3AA 5BVHB 3QLVA 3WGJA 3L7KA 4G5YA 3HMQA 3N3BC 5BN5A 5JNWA 1RMYA 4GYYA 5AXDA 1MA3A 1SAYA 2EG5A 5SZJA 4AXBA 3SXJA 1DO0A 1PGJA 1HTWA 2WJZB 4XB1A 1M7GA 2IUUA 1C8BA 1UBMS 1X1CA 2BMJA 3TBHA 1R8JA 4F5EA 4YJ2B 2J8ZA 2PZEA 3UV3A 1NMYA 2R47A 2VZLA 2XVYA 4Q1CA 4AZTA 3RKSA 4YRTA 3K5WA 1H5NA 3EH2A 1V3UA 3W9BA 4JB8A 1CU1A 4TQUS 1WDWB 5KDLA 3QH4A 3WYGA 1GIAA 2MDTA 4P58A 3RIXA 3THRA 5BR1A 2R1ZA 1O5OA 1G55A 1WV0A 4EZIA 1M0TA 5LZ2A 4HGNA 4LY6A 4XQEA 2A30A 1UDCA 3BZBA 4UMFA 3P8ZA 4TXJA 2XUIA 5DBOA 4GR9A 4JXKA 2FSGA 3ZHVA 1WQ4A 1UUFA 4KG7A 2V0GA 7YASA 2P3OA 4CF5A 1BW9B 1NNI1 3JQFC 4ER0A 4DR5B 3THXA 2Q6TA 5KAPA 4TLLB 1C0PA 2ZRPA 4UCWA 1ZW6A 3GLGE 4NF2A 1VJTA 3NJ4A 4TLDA 1FRFS 4KB5A 2QSUA 3OO1A 3VKGA 4XRRA 2IPAB 3DLIA 3O82A 4W6ZA 1RVDA 3ICQB 5JW6A 4RXMA 4AMBA 2BGMA 2VP5A 3C3YA 4FM9A 4JZYA 2B1GA 4LA4A 4DQKA 2A1IA 1R3DA 2DVMA 4TLCA 2AJDA 3OMWA 1UZNA 2GZMA 3BA1A 4RLHA 3R3YA 5HCNA 4Y9UA 1Z4MA 3RVBA 1EVYA 2SECE 3BCHA 4GGOA 4R05A 3M6IA 2PMFA 3MWJA 3R7NA 8ATCA 9GPBA 3OX1A 3HTXA 4UDYX 2OV1A 3O5AA 4IVNA 2ZU6A 4L4RA 2VJKA 4PAQA 3OLCX 4QNRA 4Z86A 4CIBA 5EP2A 5JJKA 4CF4A 2EWVA 4FFOA 3AINA 3KT8A 1WB9A 3L6DA 4B5LA 3DMHA 4ME6A 1JQLB 4OJQA 4E5NA 3E7WA 5AJVB 1NXSA 4ZCTA 3WWZA 4Z4HA 4EO4A 4N0MA 5EJ5A 2QX9A 2UVQA 3A58B 2C03A 1J8FA 4AO8A 2VH5R 3DO5A 1X86B 1W0KA 1ZN8A 3F4KA 2CDBA 3GJXC 3H04A 4GIBA 1ZMXA 3E9CA 1AU9A 3WAGA 3VZCA 4BO1A 3ZJUA 5TQ0B 3BBLA 4EY4A 4PWZA 8MHTA 1GN8A 3PNVA 1OKKD 1W87A 2BFCB 2O1XA 4MUXA 1E59A 4DPMA 121PA 1WZ2A 3TR5A 1SXHA 3DFMA 1EXWA 1QV9A 2DHRA 1CKEA 4NWIA 1RC8A 5ES3A 3MMZA 3SXPA 1JE0A 1BH6A 3F97A 2XSZD 5IM4A 1TF2A 3C4QA 3NTUA 4AQDA 1G17A 3MPOA 3FWHA 1F8FA 3NWEA 3DTNA 2YMQA 4ZQFA 3D4PA 5DKFA 1Q21A 3N6VA 5U4QA 1UOEA 2X8AA 1HI9A 1NKTA 1JSCA 5J4LA 1A5TA 4DN6A 4WY5A 2HIGA 1KSFX 4KHPB 1PFQA 3E15A 1UDAA 1FFGA 4FMDF 4FDAA 1U99A 4S05A 3GQBA 3EMVA 3ZLTA 2I2WA 3U4IA 4WECA 3G3EA 3K6SA 1TX4B 2B8WA 1Z28A 1SUWA 1FP6A 4KZPA 5TARA 3TQHA 2BFWA 2P6RA 3IDAA 3SS7X 2XDWA 3M34A 1P8AA 2NNWB 1W5BA 4HGOA 3OQNA 2DPXA 3HI6A 5JJBA 1PLKA 1U28C 1S3FA 2N1BA 2Y1FA 4Q3NA 1B93A 4XIJA 1GCGA 3T7IA 5KINB 2G70A 2TS1A 3EUEA 1PJSA 4Y2TA 2F1JA 5AHRA 3Q0TA 3RANA 1CY6A 1MQ9A 4EBBA 1TEHA 5CX1A 4KDEA 3K6JA 2PYIA 5K3FA 3VU0A 5FI5A 1RJFA 5IVPA 2PGLA 4ZVKA 4FE4A 1S8NA 1JBKA 3T9AA 1IC6A 4D56A 4M6WA 4ZRMA 5AWFC 3HXMA 4JJGA 2CHVA 1NL3A 4N6GA 4XX0A 5AI5A 1K2VN 1NNLA 3A6FA 2CFSA 1A2KC 1NHGA 3ABRB 4EMSA 1JW9B 4R1NA 3JTEA 2OLJA 3AIIA 3K16A 3OKAA 4G0YA 1ZNZA 4PLPA 3TINA 5JH7A 5AUPB 3AJ9A 2WICA 3HU3A 4FC7A 3GLFE 4TV8A 1CR6A 3OCCA 5BNWA 4G4IA 4B09A 4IX1A 3OZUA 2D0DA 4N5IX 1LDBA 2OTCA 4MS4A 2P0EA 4ZCMA 3SVLA 1QDLB 3O84A 2QGFA 3KCQA 2EKQA 2FW0A 1OLSA 3BERA 1HA3A 3DDSA 4LNUA 4QUHA 5JS2A 4DUGD 4IXTA 1XHFA 3IGFA 2MR5A 2O48X 2ZR8A 3QYJA 3R0XA 1XTVA 4WRRA 1QO0A 2H1VA 2EX1A 1XMSA 2Q5CA 2VF8A 1NU6A 2XW6A 3EGOA 3O75A 4MV1A 3T41A 4EJMA 1VLZA 2R66A 1HNZB 4UU8A 1U8FO 4Y98A 4A2WA 4IZ6A 3W5HA 4DBLE 1KWKA 4AWXA 4YRSA 2YHAA 1R0KA 1DBVO 4N0PA 4COKA 1FJXA 2Y1GA 1D2GA 4MQMA 2ZLBA 3U56A 4BP9A 3ISJA 4MQ5A 2R7NA 5JCPA 4YDHB 3CY6A 1L5ZA 1HF3A 4E32A 5T7BA 4JI2B 3RFCA 1L4FA 1YFKA 2IFTA 2RHGB 4G37A 5JDCC 3AO0B 4ND1A 3RIHA 5KYXA 1JDZA 4HWGA 2AWOA 2A0UA 2NU9A 1QFSA 3DMRA 2FN9A 4MGHA 3RC7A 4DVGA 1OFUX 2IEBA 4TRMA 1N2GA 3HCRA 5IAOA 4D4IA 2Y9MB 3NO4A 2ZIVB 3JQEA 2OAQ1 2D4HA 3TLJA 4DLYA 1DZIA 4KAXA 2QHXA 4OKSA 3VX4A 3ZJTA 5K2OA 4MCIA 4HNAB 3CUYA 3EQ7A 3ABIA 4M83A 1XFAA 2ZANA 2QZPA 2ZWAA 1O6BA 4CCSA 2PX0A 3DHWC 4BLWA 1EG7A 1Y8ZA 1FP2A 3OLYA 4H7IA 4QJ3A 2PKWA 5I47A 2XVXA 1U1FA 4FR2A 2BELA 4KAJA 2I6UA 5IM4F 2KWIA 1NULA 2Q0HA 5AM4A 1U6IA 4K40A 2OBYA 5LQRA 3GY0A 4P3PA 2VUTA 3E6AA 2BP7A 3OICA 1G21E 3OJLA 2X7XA 1IIBA 2OB2A 2FSVA 3DAOA 1MEJA 2WVHA 3K4HA 2NV6A 1BN7A 3U3JA 2QB5A 3FB1A 2A5JA 4WZAA 1OVGA 1C8KA 1QAQA 1X39A 2XMCA 1K3UB 1NRXA 3BL6A 3K9NA 3ZR4B 4DEVA 3PQ7A 3FWYA 2FJ0A 1CY2A 4KSYA 4F3CA 3AERB 3NS7A 3UAYA 3ZWAA 3W0LB 3OZGA 4MHSA 1NN0A 1Q2XA 3PXUA 4I5IA 3TCKA 4NAUA 4NCBA 2XVZA 4X44A 3CGWA 3GV0A 1JU3A 2FPIB 4B1FA 2YJGA 1UANA 1XQYA 1ZM3A 2HWYA 1UWKA 3BA6A 4L5AA 1JHRA 5AHXA 1F2TA 1M67A 4XWOA 4YAKA 4FGJA 5CB4A 3E0QA 2DBRA 3HE3A 3EODA 4ZU1X 2H16A 4QDZA 3GFPA 4GYJA 2DJIA 3E18A 2OQIA 3HJHA 4DM4A 3EEYA 3CE6A 5G02A 1KBQA 3N2IA 4WGGA 4KFCA 1N75A 3BM5A 1SG0A 2V6FA 3ENNA 3PPWA 1E6KA 4IKPA 3TAXA 4EW2A 4HEA6 2EQAA 3OBIA 4OAPA 5FI3A 5IJZA 4D26A 3S7TA 5BSMA 3T06B 1UJ4A 5BWNA 1J2TA 2I2FA 3MTJA 4QDXA 4DUPA 2I33A 5AKHA 3Q1KA 4MV4A 4FP9A 2D2EA 1AGRA 1NMXA 3QQ5A 1X74A 1XRNA 4TTAA 2RG1A 5TQ2B 5AFSA 5F3WB 5G0SA 4WVFA 2C99A 4N9WA 4BO0A 4CT0A 1JP7A 2QVXX 1FFWA 1W0KD 4JI6B 4E6EA 4RD4A 3PT5A 1K7XB 1R1DA 8GPBA 3E3OA 1N5OX 1PSDA 4Y6LA 2YXBA 2YZ7A 4YJGB 5M2QA 3AUFA 2HSZA 3SQWA 1CJMA 221PA 4TMVA 3T0IA 4EVQA 1WD7A 1H5QA 4M88A 5JBNA 2I7TA 1OH8A 4Q66C 1KJWA 4S2EA 2C96A 1DFIA 1XZPA 2XUOA 1LNQA 1UL1X 3A0RB 4AZ0A 3G2HA 4C0AC 3DVQX 4ZVPA 2B94A 3CO0S 4GP6A 4RJJA 3OFSA 2YQ4A 3ZDAA 1UOOA 4RD0A 2BCGY 1XU9A 2E6UX 3EA0A 1N34B 1BYUA 1WV1A 3QUCA 2C9YA 4LJKA 1GLVA 2EF0A 2HCRA 4AY4A 4JU8A 5AKJA 4YBZA 1U2RA 4ZN6A 2IZ6A 1ZMOA 1ODFA 1KY2A 3LO5A 3SOPA 3SX0A 3W5AA 4RF5A 2CWWA 1N2BA 3N07A 2V45A 3SNKA 1EHCA 1E5XA 1TJ4A 2OMKA 1C14A 2X58A 3GZNB 2C9ZA 1T0PA 1W1UA 2CLMB 3LF1A 4LHYA 3MAGA 4S1WA 4OTZA 2XMPA 5JY1A 1O4WA 3M49A 1RLOA 1SQFA 2GYUA 3O3MB 4YLGA 1WBDA 3ILHA 1TRHA 3DFFA 3K0CC 4NBNA 4X8MA 5CLHA 4BTVA 1OIVA 1XEWX 1GT91 1SO8A 4F71A 5JSUA 5L4NA 1GKIA 2FGKA 3F96A 3PR1A 3V7WA 4NZYA 3DOEA 5LA6A 3H7AA 2GRUA 2QT0A 4F4JA 3ZDDA 1PR6A 3HZRA 1CY1A 3B5JA 1P7PA 3MT0A 3P4YA 3ZHXA 4YMGA 1KOLA 3PX2A 3KJNA 3SDBA 4B31A 1X70A 2G8NA 4V02A 4EWLA 2PKRA 1L6RA 4TXMA 3G9XA 3CMCO 1SOWA 5SY6A 4C76A 4JNCA 3C70A 4NPCA 3L1UA 3SKXA 3UCXA 1KEKA 5BR8B 1LI5A 3F6RA 1GFZA 1SG6A 3K8QA 4O4LB 3F6YA 1Q7EA 3DMFA 3D5QA 3KQTA 5IYZA 3KB1A 3A9VA 3A1EA 2YXDA 4ZT4A 5PGMA 3DS8A 3RU3A 2PSJA 3HJAA 1PWYE 3U9SA 4HWKA 3UXMA 3CH5A 1JI0A 3NAQA 5DX8A 5CYGA 3FJYA 1TZCA 4RVNA 1MC8A 2LCIA 4N6NA 4A0RA 4K9QA 1ZBQA 4FB5A 4EKDA 4JJZA 1W35A 4R9UC 4O0LA 3CEPB 4FOLA 3E2PA 4UXHA 5E6SA 3Q5EA 5JI3E 1AD2A 3R40A 4PC3A 4ZP1A 2TECE 4EYEA 3KFLA 2YVQA 4R69A 3GCGA 3SQNA 3AFNA 4LRSB 4HGQA 1T24A 4LEIA 1EFVA 3S8MA 1EE9A 3E2IA 3N0XA 1RAAA 3F3YA 4KJZA 1NWHA 5F1YA 3HYNA 2CE7A 2V7GA 4JUCA 3LG2A 2J3MA 1JH8A 2N3ZA 3HVJA 1O9HA 2B1IA 5BOVA 2G82A 5GTDA 3H1GA 3C2QA 2YHIA 4M76B 1FW6A 5CB4F 4Y2JA 2HT1A 4O2BA 2D13A 4KN5A 4MCAA 2Y76A 3OKCA 5BT8A 1CXZA 2F64A 1EB9A 1U0EA 4UPEA 5K8LA 4FEGA 1ORHA 3L8ZA 1W5TA 1M83A 4U7TB 1IDOA 3VZPA 4EG0A 2H2AA 2B8JA 3TZEA 1OXKB 2BUAA 4QFBA 3FTCA 4F6RB 3M3HA 1TU3A 1M2KA 4YUXA 2AT1A 5JALA 2P69A 1Q95A 3HBMA 4UE2A 1DOZA 2WYWA 5AMXA 5E1DA 2M1ZA 3A04A 3PXEA 1X1AA 1DRVA 3VOAA 3FUTA 2R7KA 4XSVA 1YZNA 2FW1A 4MW6A 4QBHA 1XAJA 2L2QA 5DRYA 1Z2OX 1CJSA 3EVNA 4EA8A 2IIQA 4JHLA 3STWA 4RXTA 5T4EA 3KQQA 3QOWA 2R5WA 3AILA 2EEPA 2XUPA 1SOVA 1CY8A 4K9KA 4CODB 4G1EB 1R0SA 2BVNA 3AM4A 3UMGA 4G4SO 2ZKLA 5EMLA 3LV8A 3VZDA 1YBVA 4TLMB 2XR1A 3GN1A 2XVAA 2ISQA 4AB1A 4N03A 2E4AA 1ECGA 2Z8XA 3NCTA 1O77A 4UCQA 2ZUSA 1Q1GA 4YP6A 1ONPA 1LFAA 4MGYR 4LHSA 2QE7A 4HAWA 3LKBA 4Y1RA 3V1TC 3BUSA 5A04A 5IM5A 3SD7A 4WZ6A 4RC9A 2X8LA 3M1LA 1YVPA 4NS4A 3OZEA 5DLEA 3RBVA 4RHXA 4ZVTA 4JGGA 3VH4A 1ZIXA 2VCHA 2I80A 3LOQA 1YS7A 4IGFA 2OT3B 3LHSA 4WXPA 1G2QA 5KU1A 4GM1A 3T15A 5KMGA 3WL5A 1Y9AA 1JTVA 3ECCA 3EOZA 1W4LA 1DQNA 1ZGAA 3N0VA 1I32A 3H2BA 3I45A 1RR6A 3LBHA 4LYAA 3USCS 2YYSA 3O26A 3C6XA 5TT0A 1WHSA 4KVAA 4L9SA 2HX1A 2GJSA 4EKGA 2CHFA 1WEHA 2D0PB 1H6DA 5FA5A 2DTEA 4GRDA 5THXA 3NYIA 5DBGA 5LA6F 1DX6A 2YZNA 1J8MF 1PTJC 3EDCA 1U3UA 3O1IC 5KYVA 5IVHA 4BNWA 1NDUA 3AF2A 1NVGA 3DCNA 1V1RB 4L8LA 4RFSB 1WHTB 1E7SA 2CK3A 3PDCA 1H2BA 3N76A 4QOFA 4BLTA 1NPDA 1GKYA 1RWMA 1Q7CA 3IPRA 4N0DA