3ELBA

Human ctp: phosphoethanolamine cytidylyltransferase in complex with cmp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
333
structure length
302
Chain Sequence
GRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human CTP:Phosphoethanolamine Cytidylyltransferase
rcsb
molecule keywords Ethanolamine-phosphate cytidylyltransferase
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 302
sequence length 333
ec nomenclature ec 2.7.7.14: Ethanolamine-phosphate cytidylyltransferase.
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3elbA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3elbA01
1WXIA 2YY5A 3HV0A 4XFJA 2CSXA 5LLTA 1LW7A 2H29A 4JXZA 3IDFA 3SYTA 5DK4A 3PRHA 4MUKA 2E89A 4MUIA 3CLTD 4ND7A 5K0SA 5TEWA 4CT0A 2X1MA 3DO8A 2Z09A 1N2JA 2R5WA 3INNA 1JMVA 1TFUA 1OD6A 4MULA 1QU2A 3IOBA 3DLAA 1HYBA 3ZIUA 2GOYA 1H3FA 2IELA 1IVSA 3ILVA 4P2BA 5H7XA 3TQOA 3COWA 4Q93A 1N2GA 2Z3VA 2A1TS 4MW0A 1MJHA 2EJCA 3U1VA 1QNFA 1I6KA 1KP3A 3IODA 1WKBA 1JHDA 1N3LA 4U8HA 4MW1A 2H2AA 4NAUA 3SDBA 3CVWA 2BYTA 1QTQA 3AG6A 3L93A 3MUEA 4F3RA 3UC5A 2A86A 2V0CA 4R2LA 2VTBB 4WNYA 4F4HA 3G6KA 1BS2A 1PFVA 3IOEA 3IVXA 5AHWA 3VU8A 2J5BA 4PBRA 1T9GR 2YWBA 2CYAA 4K03A 3TQIA 3F3MA 1VLHA 1O0CA 2AZXA 1VBNA 4MWEA 3HGMA 3H99A 3GMIA 3FWKA 1MB2A 4HPWA 1O95C 1EFPA 1U7DA 1O6BA 1JIJA 3RFFA 4MW2A 1OWPA 1VBKA 1YIAA 3TS1A 1O97C 4ZT6A 1GN8A 2NSYA 4RUKA 2QTMA 1ZH0A 3VGJA 3SP1A 1EUYA 1K97A 4CDMA 2A1UB 4OUDB 3A04A 3PNVA 1F4LA 1PG0A 3CLTC 3C8ZA 1IRXA 2E21A 3P52A 4KR9A 2X3FA 3IUEA 2J4DA 1J09A 3MLAA 3A2KA 2CV1A 1WY5A 2Z08A 5H16A 4FZJA 4MVWA 3PXUA 4MUFA 1N2IA 2BTEA 1T6XA 3ZXIA 1NUPA 4NAHA 2GM3A 4WSOA 3RK1A 4CDNA 3CVXA 4MVCA 3IMGA 3FOCA 2OQ2A 3A05A 1U3DA 1M8PA 3MMXA 1MBZA 2DERA 2CYCA 2E0IA 3N9IA 4I6EA 2VTBA 3PNBA 2CT8A 3HZRA 1M1ZA 3CLRD 5DB4A 3CLUD 1F7UA 1WOYA 1OWOA 3HMQA 3X1KA 1YIDA 3IMCA 3SEQA 3G5AA 3FG9A 2JANA 2XRYA 4EFKA 1N77A 4MW5A 4Q16A 1JEDA 2QTRA 1MAUA 3P0IA 3JXEA 1U3CA 3VRHA 4HJXA 5F23A 1PFYA 4ZT3A 3SEZA 1J1ZA 2A1UA 4QRDA 1KQOA 2X0KA 1QJCA 5HUHA 1ULHA 1G59A 1VL2A 1KKUA 1Q77A 4MUGA 3X1MA 1EFPB 1QU3A 1T9GS 1WJGA 3UMVA 2IJGX 2DR2A 1NP7A 2ZP1A 1G8HA 1O0BA 2D5BA 4H3SA 1J20A 5DASA 3DPIA 1M8KA 3UOWA 1N2BA 2CYBA 2CV2A 1TYDE 4MW7A 3CA8A 4NX2A 3ND7A 4NATA 3CVYA 1T6YA 4X0EA 3P0JA 1GLNA 1T6ZA 1TYBE 3N8HA 1J21A 1OBHA 4MW4A 2CV0A 3N2YA 3DV2A 1F7VA 1IQUA 1QRSA 2YWCA 3D6VA 1Q11A 3FH0A 3COVA 2B7LA 3QTTA 4L2IA 4MWBA 1YUNA 4PY2A 1KH3A 1ILEA 4ZT5A 4QBTA 3CLRC 3P0HA 3CLUC 1IH8A 5KWVA 1MC1A 3FDXA 1XNHA 4KR6A 1M83A 3S3TA 1X8XA 1WXEA 1KH2A 4I6GA 1U0BB 1EXDA 4QREA 4PBSA 2NZ2A 4DLPA 4G6ZA 4R2MA 2PIDA 3KT6A 1NUQA 4MUJA 3ELBA 2CFOA 4K0RA 5EKDA 5TGTA 4XFDA 4BWVA 2RD2A 1KAQA 4E1AA 4UZFA 1JECA 3AG5A 2CUZA 3G59A 5IJXA 5IHXA 4I6JA 1KORA 3ZJTA 3ND5A 3RBAA 5HG0A 1CT9A 4G5YA 1YI8A 3GLVA 4PBTA 5JBNA 1R6TA 4YBRA 3COYA 4MUEA 1RQGA 2J09A 4MW9A 2QJFA 2QUJA 2QTNA 1P7PA 4J75A 1TEZA 1NZJA 1NYLA 1M8JA 1XNJA 3H97A 1KH1A 3IOCA 4RPIA 3CVVA 2A88A 3AIIA 1LI7A 1TYCA 4HK4A 2J07A 4HJRA 1GTRA 3IVGA 2PFSA 3ZXSA 3IVCA 1I6MA 2DLCX 3FHJA 1J70A 5K0TA 3K9WA 3Q10A 3RJZA 3COZA 1D2RA 2PZAA 3ISJA 3TZEA 3LE8A 3SZ3A 3FI0A 4JZYA 5BNZA 2DPLA 4L2IB 4EG7A 1X6VA 1MAWA 4DE5A 2WB2A 2V0GA 1N2EA 5FO1A 2A4MA 1PFUA 2EL7A 2WSIA 1JZSA 2HZ7A 2QUIA 3X1JA 4ZCQA 2DETA 3H05A 3QE4A 2WQ7A 1JIIA 2WQ6A 3UY4A 4S1OA 4MVYA 1H3EA 3H9CA 2O5RA 3NV7A 3TNJA 1K4KA 3HFJA 3M5WA 3CLSD 1FFYA 3H9BA 4ZT2A 2AG6A 4KPUA 2E18A 4MWDA 4UZEA 4ZCPA 1K4MA 5DEOA 3QTBA 1IHOA 4EG6A 1N2OA 1XNGA 1ZJWA 4AQ7A 3SZGA 1JGTA 1XJQA 2PZBA 2X1LA 3CR8A 1YULA 2PG3A 4ARCA 1PG2A 1TQ8A 1ZH6A 4J76A 1QRUA 1EE1A 2QJTA 5TS2A 1KAMA 3HL4A 1R6UA 4GU5A 1NURA 1JEEA 3AKZA 5FO0A 4XSVA 1KP2A 1A8HA 4EF6A 5J59A 2O8VA 1IQRA 4JFAA 3L92A 2OV4A 1COZA 3KT3A 2IP1A 4OJMX 4YP6A 3MLBA 2D13A 5FNZA 4U63A 3AFHA 1H1TA 1QQTA 1O5TA 4NDAA 1EUQA 1GPMA 2DXIA 1F9AA 4MUNA 2A84A 5TEVA 4ARIA 2D54A 3IUBA 1JIKA 3NBAA 4YP5A 2DEUA 2AKEA 1WZ2A 1O96B 4DDKA 4ZCTA 2GKSA 1TYAE 1WQ3A 1V8FA 1Y42X 4DDMA 3RHSA 3AL0C 1MRZA 2QUHA 4TS1A 4CQNA 1MOPA 1FYDA 3GUZA 4G5FA 1NUSA 4MUHA 1MB9A 3NBKA 2VXOA 3CLSC 1U7XA 1H3NA 4MQ6A 3KT0A 1G8GA 4R0NA 2DUMA 4DDHA 4MWCA 1GZUA 3A4IA 1K92A 4U7JA 1IQ0A 5J58A 4AS1A 4KR7A 1OWLA 1JZQA 4EG8A 2QUKA 4NZPA 1O94D 4KPUB 4JYZA 4EG1A 1OBCA 3FETA 2JAXA 1QRTA 1SURA 3RK0A 2RE8A 4YMIA 3IMEA 5LM3A 1EFVA 4ZCSA 4DNXA 2ZUFA 1JILA 3FIUA 4MVXA 3OTWA 1Q19A 3ZJUA 1NUUA 1KQPA 3BL5A 2JA2A 1N78A 1Q15A 2ZUEA 5KCMA 1IFXA 1V47A 2I1LA 4EGAA 3ND6A 3KT8A 1O96A 4MLPA 2A1TR 3CVUA 1YUMA 2TS1A 3UK2A 3N05A 1R6XA 1EJ2A 3PNYA 4KKVA 3FY4A 3I05A 3Q4GA 1WQ4A 1NI5A 3K32A 1N1DA 1NSYA 4MW6A 4ZCRA 1PFWA 2PXHA 1NUTA 4JXXA 3ZJVA 3LOQA 4GRIA 2HMAA 3LCJA 3ZGZA 3KFLA 1DNPA 1G8FA 5KHAA 2HGZA 4EG3A 2QJOA 4ND6A 4EG4A 5LFAA 1KR2A 3TZLA 1M8FA 3MXTA 4ZT4A 1S4MA 2J08A 4YP7A 2A7XA 3FNRA 1ZUNA 1KQNA 2XRZA 2G36A 1WXFA 1I2DA 4DJAA 1O94C 3IH5A 1J1UA 3OP1A 2C5SA 3Q12A 1LI5A 1B6TA 4ZT7A 1N75A 1UFVA 1WXGA 1M8GA 3ZUGA 1I6LA 5HUJA 1WXHA 5J5AA 4OUDA 2YXNA 1O95D 3D6UA 4A91A 1GTSA 1OWNA 3E27A 4EG5A 4MAFA 1VBMA 1OWMA 2PZ8A 1O97D 1N2HA 1EFVB 1GAXA
chains in the Genus database with same CATH superfamily
1YBHA 4YMGA 3NUGA 3TECE 4DRXB 3ENNA 5KTPA 5EN4A 2QVBA 5IKMA 1X7XB 3N07A 2D1RA 4MYDA 3RVNA 3PJEA 4GDMA 3ZG6A 2C58A 2GPBA 4QUGA 1THTA 2Z8YA 1WNFA 3ET5A 5FAKA 2DY1A 4EHNA 3PJRA 2J3MA 3PC8A 3ZGYA 4XIIA 4I8XA 3IOBA 3EGVA 3MB8A 3MMSA 1SXQA 4G23A 4LA4A 1KWKA 3NCTA 2Z4TA 4PYLA 3LWZA 2IELA 3EULA 1AQUA 2C7GA 2BGKA 2XY4A 3O8OB 3ZDAA 3FOAA 4KQWA 1MIHA 3U26A 4EUFA 3PR1A 4JODA 1L5HB 1NRJB 4JVSB 4JXKA 4Q93A 4BVFA 1DG1G 4FEGA 4N48A 4IXDA 4MW0A 3VR3A 4XQGA 4BZPA 2P90A 3VC1A 4Z4IA 3HI6A 4GO1A 4ADSG 3PBKA 4IEFB 1FP4A 4P5DA 3T4PA 1ULBA 4RF2A 3A58B 3OA2A 1SUIA 1M2WA 2GAJA 1FFAA 1VKOA 2AW5A 3GGOA 4QPCA 3INRA 2JFVA 2WM8A 3M6UA 1LZLA 4HRXA 5E9AA 2PX4A 4UBOA 1UBJS 4K6CA 3TOCA 3Q9SA 3TFQA 3SM3A 4WVLA 4GWKA 1FYEA 3CMMA 4WNYA 3Q40A 5HF8A 4UATA 4IMPA 4XI9A 3EA4A 3L4JA 1HUQA 4O29A 4OX9B 3CX6A 2PH1A 3FYHA 5JPIA 5AXCA 2D4HA 1ELOA 3EXG2 1WLSA 1JFVA 2IP2A 1PWZA 1ZUNB 2OSBA 1R3UA 2QNIA 2AZXA 4X9XA 6CHYA 1YQGA 2YOFA 5I47A 1KK1A 3RIXA 1KZ9A 3OQNA 4KQ6A 2O8EA 4MSUA 3IIIA 1U9ZA 4KIGA 4MW2A 3K4QA 4FYMA 1E6EA 1IUKA 4UUPA 3RSSA 4B82A 4BLVA 6GPBA 3OQOA 1QYWA 1XEFA 1EUZA 1L5ZA 2ZK7A 4KGVA 4QUEA 4LTMA 5FPPA 1O57A 2I3GA 1VHDA 1VCOA 1TL7C 1GEGA 5I01A 2WF7A 4DXDA 4EZBA 2H06A 1ECBA 2NV6A 2DWPA 3Q88A 2FW8A 2PV0A 2VNIA 3K9QO 1E3DA 4MPDA 4RHFA 1DC8A 1JSCA 5AOAA 4C05A 1L7BA 1YZ3A 3QHAA 2FFJA 3F67A 2CV1A 1U90A 3CX4A 1XU7A 1A5BB 2C9DA 3LPCA 1N36B 4U7HA 3NIGB 2AG8A 4CFZA 3TIVA 5F2NA 4UPDA 2X5NA 3O8DA 4PS0A 1JFRA 5DXFA 3UMGA 5JS1A 4B3DA 4ND4A 3IMGA 2OXEA 1BXRA 4FKMA 4DLYA 2EW2A 3SDZA 1HORA 2D2EA 4EELA 5CFRA 4IF6A 1E69A 1RLTA 3RHTA 4WBNA 1N0UA 1YVPA 5HIAA 4AZSA 1USVA 1UAGA 3GHHA 2GNAA 4TMYA 1YZUA 3BF8A 1Y98A 3T1OA 4BC1A 1J4AA 4Y8VA 3OCWA 2LXNA 1K63A 3UK6A 4DJJA 4HLUA 5CH3A 5KVVA 1DO8A 1U7WA 3GJ4A 1AKTA 3N8GA 4MKZA 4FQ7A 4DA0A 1SXJE 2HRBA 1N6IA 2GILA 2XITA 3DFIA 4A8TA 5JCPA 3IMCA 2XCQA 3COSA 3U60B 2EX0A 4E5DA 2YUTA 5IJ9B 2DGDA 1VM6A 4WIAA 3NAQA 1MCZA 3BHJA 4R3WA 4V2UA 3OLQA 5H4HA 2MR6A 1IJFA 4FSXA 1IDN1 3HKDA 2BFOA 1MO4A 5B1SA 1H0KA 3P0IA 4QOJA 2B9VA 4YLYA 3JYHA 1ZQ9A 4NAVA 3DWIA 2HSWA 4ZKDA 1RMYA 3Q41A 3WGQA 3OWXA 4DIEA 1YZTA 3SZLA 3ER8A 3B6KA 1J1ZA 4WECA 3TPZA 2IHYA 3QUCA 3Q5DA 1E8MA 4JKIA 4KV9A 3F6PA 3IURA 2RG7A 4FUTA 1H42A 4EITA 3R7DA 1VA5A 1ZK1A 2GAAA 5EMJA 1B6RA 2FCRA 4XCQA 2B36A 3HUFA 5FWYB 3X1MA 3JQRA 5EIHA 2C7RA 1LBIA 4M98A 3AF3A 3EQ2A 3TG8A 4PGFA 4AJPA 2OHHA 4CIDA 4ALIA 3AM1A 2W2LD 2O7RA 4Z9YA 1NT2A 2FF7A 4ER6A 4PRYA 2ZRCA 3ND7A 2HQSA 4A6PA 3E23A 4TV8A 4ZWNA 4TL6A 4UM9D 1SBTA 2I55A 4HQOA 4RKYA 4Z99A 1UF9A 2GO7A 1R5OA 1R88A 2H54A 4Z7NB 1GGFA 5TPZA 1VLZA 3TWOA 5ESWA 3RU9A 1LK5A 4PX3A 2GVNA 2VQSA 3DQPA 4Q02A 3DXXA 3N2YA 1OZHA 1XZAA 1ZR2A 3T1TA 1JFSA 3EK2A 4FOLA 5IYZF 4L4XA 3ROGA 1TUGA 1VIYA 2WUGA 3QVVA 1WBJB 4R5HA 1KRXA 2OZVA 1KH3A 1ST3A 3FA2A 3IP6A 4JDUA 4BLQA 4JBIA 5U4XA 3WRYC 3OZGA 5IABA 2J0EA 2QD1A 3JQCA 2GKOA 1TEVA 1CZNA 1E60A 3IBSA 1SOUA 4WJZA 1F3OA 1SXJC 3A06A 5I48A 1FLDA 4EA7A 1GPLA 4FDVA 2EJVA 4Q9JA 1X8XA 2G7ZA 3L4SO 4L8FA 3MBOA 5ICSA 4MINA 5KOHA 5DNCA 1U0EA 1U65A 3CF2A 2WYHA 4MVJM 3RLFA 1FXWF 3FFXA 1O6CA 5AM2A 1KH2A 3V8BA 2WV9A 1BX3A 1SCBA 2BCEA 1NU6A 1B8NA 2R5FA 3D8RA 4FGWA 721PA 1PU2A 3WYEA 2VBFA 4BQIA 3GRZA 4NBKA 1NLFA 2PIDA 3KHTA 2G6TA 4ID9A 3V34A 5SZHB 1H4VB 3KYCA 5HIIA 5A2QA 1OLUA 2Q5FA 1P4HA 2TYSB 2O8FB 1IWBB 1WKVA 3WMEA 1U63A 3R5FA 4HPXB 2ZBPA 5FPTA 3CR3C 3BXHA 4XX0B 1O89A 5KTOA 2REQB 1NV9A 3C1UA 1U9YA 1HEIA 2BKEA 3DDZX 1CFJA 2F1IA 5DHUA 4IRUB 1RXCA 3VR2A 4YT5A 1AS2A 4W63A 4XVQA 5KC9A 3I0ZA 4BLWA 3TD2A 4EMBA 3RVKA 4URXR 4JYMA 4Z9AA 4PQGA 4D4MA 5EHZA 1H23A 3JZMA 3P2MA 5I7RA 1YS6A 2B3DA 2J0QA 1R0BA 4GLJA 5ARCA 4A4DA 2R66A 1DJQA 3BMCA 2GZ1A 2X42A 4IVNA 4PLZA 4ZQFA 1P7PA 3CKKA 3LPLA 2J3IA 4FYIA 4R8RA 1UMDA 2C8LA 3SS9X 2QVLA 1ZLXA 3QUSA 4L6AA 2W37A 1MTZA 2BISA 2Q8PA 1XMQB 3PQ7A 4ZYTA 2YIMA 1N78A 5C7OO 1QC5A 4UQLA 1KH1A 4AWBA 1ST2A 2AJDA 4P34A 4EMUA 1JBEA 3RT9A 1CIJA 3SJZA 3M3PA 2IXTA 1QKIA 4N18A 1EESA 1SUWA 3TFWA 1ZRMA 2QUAA 2QL7A 2WHYA 2EF1A 4O0LA 1KEVA 5BWNA 1TT7A 2HA3A 3CF4A 1J06A 1V1RB 4GW3A 4GR4A 4GH5A 2DLCX 2QTVB 3IBFA 4UNPA 3SM9A 4DDTA 2WYWA 4XRGA 4MI3A 1J70A 1HE1C 1QWOA 2FTKE 2X4LA 4JAVC 3DAGA 5DHRA 5IASA 2XBUA 2CZQA 5TSDA 3OJWA 4R3NA 4YMLA 1K6MA 2Z3WA 3GFBA 4GMXA 3CUKA 3WHLA 3TG2A 1PK7A 1QK5A 3HLYA 2XXAA 1VI5A 1TJNA 1S2LA 3UVEA 2A6PA 3EIEA 3HVRA 5FO1A 2JG3A 3EUWA 2JHAA 3N2KB 1QH9A 3EF1A 4N7MA 3PFIA 1V2HE 4O2AA 2QUIA 2MSEB 1I4TD 1REQB 2H7VA 1FVOA 3OLZA 4ENRA 3E84A 1XYYA 2ZROA 4OL9A 4XD7A 1TF2A 4S1OA 5E7IA 4BB5A 4C1BA 5AW3A 4E30A 4P5PA 4GNKA 2W2OA 4MGZR 5AKZA 3A6LA 4B48A 2EQBA 4JJ8A 3M5WA 4P3PA 2OZKA 4ZT2A 4E12A 3FPJA 1PS0A 3FN4A 4KPUA 5LQUA 2DHDA 4PX9A 3SWWA 3FTFA 2BRUA 3EIHA 1GGJA 3DEIA 1AZLA 1Y80A 1Q2UA 3L7KA 3HYLA 3LS2A 4XWTA 3TRKA 3H2SA 3O82A 4EG6A 1T1IA 2AN5A 1YMQA 5AWFC 3E70C 3WFJA 1I3OA 1ESZA 3LPNA 4ARUA 1TDJA 1E92A 1RBZA 3HCDA 5TLSA 4RSMA 3LGXA 1YULA 2OO5A 5DNDA 2C5BA 1JDPA 4ER3A 2FR8C 2P40A 1N7GA 1M9NA 1H05A 2PBRA 2VDNB 4C06A 1I2ZA 4UVDA 2V9ZA 5M3BA 3STWA 1AQ6A 1XTVA 3H8JA 4I8DA 4LAFA 4RK1A 4WY8A 5TS2A 3OE7A 5JUWA 1OZ0A 1YQXA 1JA9A 2Y0CA 4HBGA 1JEEA 4RK4A 1XTZA 4FYHA 3BMOA 3GEPA 4EHDA 1M5TA 1SD5A 2XTNA 3M6LA 1PJRA 1M0TA 2ZW9A 5BV2P 2XNKA 1S2MA 3O90A 5IH7A 2ET6A 4ZVOA 4FNOA 3F3YA 1EUQA 3PA8A 4QXAA 4D9FA 2Z8ZA 1BVYF 1EK0A 2VPIA 4FFNA 2VYFA 3OG9A 1LLDA 3HBAA 3DPSA 1YAJA 5AK3A 5JSHA 2XEDA 1FS5A 1B6SA 2CL7X 2RB4A 4QPDA 1XRMA 3DE1X 3MJDA 3N6VA 3BRSA 1NG1A 1R74A 4S1VA 3I30X 4LJKA 4DUGD 4A03A 1B6GA 2XVAA 2XUPA 4PAOA 1YZVA 3OCJA 3O4JA 3DLHA 4WXMA 3DOOA 1TZCA 1VIVA 2XW6A 2Z1DA 3OMXA 3I0NA 3K5IA 4MV3A 3VZCA 4KQMA 3RVDA 2OAP1 2I2CA 3O4VA 5ALEA 2XTAA 1ZBDA 2QMYA 1QH8B 2J3JA 4MI9A 2IYLD 4KAFA 1Q0UA 1EAYA 4X63A 5U4QA 2GXUA 1W0CA 4WNCA 4MPJA 4BJ5A 2YJGA 3C70A 4EJMA 4YR7A 1X9HA 5B57C 1XN4A 3N7AA 1RR6A 3AOEA 4UM7A 4U7JA 2QENA 4S0ZA 3LDGA 1BEUB 4EPYA 4O8CA 2OBYA 2QG9A 2AHOA 1LDEA 2C7VA 2GWHA 2CNBA 3LHIA 4LXGA 1VG8A 4R69A 1UJ4A 1YT5A 2GJSA 3IIMA 5CM2Z 5I7UA 2O2YA 5ITSA 1A9XA 1G7CA 1O94D 4JK3A 4R0VA 1MQ9A 2XUAA 2HCTA 4OCZA 4IHQA 4KIFA 5AT1A 1GNLA 4CL0A 3UW3A 5JIBA 2VL7A 1U2DA 4HC4A 4M1WA 3TAUA 4JDPA 3O4RA 2H2GA 4XQ0A 4TRNA 2WIAA 2PLAA 2Q29A 3BD6A 3KL2A 2FEKA 1RZVA 3FIUA 2JLRA 1DC4A 1JA1A 3KR0A 4U2KA 3ZJ4A 4HH3C 1XE3A 4C6SA 5K8JB 4MUXA 1OT5A 3LLMA 2GDJA 2XBLA 4DSUA 2P2SA 1XNQB 4O2RA 1FS6A 1Y37A 1VOTA 3DPUA 4RFSA 4P0PB 1DC3A 5IUNC 2JD2A 2X1HA 4TV9A 4H3KB 1N2CE 1RQXA 1XUOA 3QVLA 3KT8A 2DPMA 5DGHA 1V8ZA 3P9XA 4LJ8A 4NENB 1VDZA 1VCNA 3UXEA 4F3KA 5HIKA 1M5RA 1RWWA 2WFLB 3WBBA 3PTZA 4B6PA 4NOMA 1M6NA 2NXJA 4URUR 1GG5A 1H9CA 5TPWA 1ATZA 1B0ZA 4QDKA 1MD9A 1G8YA 4ALMA 1E4YA 1PEDA 3ZIDA 4CTOA 1ZK2A 2IYPA 4I7EA 3NHSA 4O63O 3K32A 4BFTA 1PR5A 1ZITA 2WYVA 4JIMA 4L6CA 4WN9A 1QUEA 2WYUA 5E2BA 5H1YA 1N8NA 1IEXA 2HM7A 4MKFA 3K20A 4WDRA 3U3XA 4RKRA 5ALPA 1CRLA 3LOQA 4UUOA 3AHIA 3WL8A 4BBZA 3MT0A 3ZGZA 2FPRA 4UBLA 1WB6A 1EDDA 1ZIPA 3JZAA 3MPOA 2XADA 4KSCA 1L3CA 3AGQA 4KBYA 1UH5A 2GEFA 2ZI4A 3STTA 4WZ6A 3WGTA 1V45E 4J3NA 4ALNA 3PPYA 4K28A 1M8FA 4PLGA 4TKVB 1MA3A 3OLXA 3L5OA 3P71T 2OFWA 4K1XA 5HDBB 3S2YA 3EPHA 2QIOA 3RNLA 3ADCA 1FZQA 2AEFA 1XK6A 4R1MA 5C5EA 3V6LA 3JALA 3I2IA 4LVNA 1FUKA 3NIBA 1NC3A 1N5LA 4YUWA 1UUFA 3L41A 4PFSA 4D92A 3ED5A 5G1PA 1LI5A 1OI3A 2QKYA 1SQ5A 3H04A 3C5VA 4KIUA 2CJXA 1Z8HA 2I7TA 2Z5FA 4J0FA 5CX1B 1KSJA 3PSAA 5HKKA 2V6BA 2VWPA 4BFVA 1E9FA 4BJ1A 2YQZA 3BWYA 5K20A 4BVLA 4KITB 1ARZA 2NO4A 3U81A 4AYWA 4Z86A 4BECA 2IYSA 3QYJA 4N0DA 4RDHA 1SXJB 2ZATA 3FF1A 4TT8A 1PQWA 5EZ6B 4RTSA 1FP2A 3PZRA 4FFBB 1GYPA 2XZDA 3GYGA 4ETIA 1EM8B 3O21A 1A50B 3NBXX 1HK7A 1WXIA 3DLPX 1TGVA 3S5UA 5KX5A 1EGMB 1LW7A 1SQ0A 4J07A 1M6YA 1PR9A 1CY6A 3NT4A 2CXQA 2NIPA 2E89A 1J0CA 4ND7A 1QBKC 1QO0D 3OZBA 3E9ZA 5DOVA 5KHLB 1IHDA 3T8YA 5DBHX 4K9QA 3PGLA 1U2TA 1QBGA 3CXRA 1RQPA 3INNA 1JMVA 4HMOA 4PEVA 4AJJA 4C4YA 4ESHA 2RBKA 2EDAA 2HK9A 2QI9C 3LY8A 3HYTA 3R41A 3P4UA 3K1AA 2YJ4A 3RS5A 1FDIA 2GOYA 1FSZA 1G0OA 2PGAA 4ZCIA 1MN6A 1O54A 4KBGA 3O3CA 4B9AA 3FMPB 3VHQA 4NESA 3WLMA 4EG0A 4HLDA 5KO2A 5EMMA 5AI9A 3EPJA 1PNRA 3KEOA 3G8DA 3IAS1 5EJIA 1VKHA 1DJMA 5C37A 4IXTA 2C59A 2FSHA 5CUQA 5K4HA 2EKDA 4D0SA 2O8BA 2W2MA 2PQMA 4LDQA 1TMKA 3OHMA 4LWOA 1XCOA 2OCIA 4MW1A 4OLFA 4X54A 3CKMA 5IXJA 1P9NA 2HJRA 4RY0A 3QYAA 2Z6AA 1YQTA 3A3YA 2WWFA 1JR2A 2V0NA 1BXGB 4C7MA 4WESA 1ZM2A 3MUEA 3USCS 3EW7A 4NABA 2A86A 3BXEA 1KZ7B 1NMSA 1RABA 4JMPA 3AM3A 4L5AA 4XLZA 1KYXA 3JQ7B 3VQTA 3OKFA 1FW6A 4ZAVA 3HWX1 2X8BA 4PNHA 1DX6A 4O2BB 1T3GA 3A4MA 3ZBUA 3AUAA 4M76B 4CE6A 1EFTA 4F84A 1GR1A 1SVUA 4UPEA 3IUYA 2IYUA 4ZU6X 4Q7JB 1XR3A 2HMUA 3M82A 4ZO6A 2CD7A 3H1AA 4M1OA 4A2PA 5PGMA 4QTUB 4DIKA 4YRGA 4KB5A 4LBWA 4EFMA 2RGAA 4F2DA 2I67A 4DNQA 1YFLA 4YJGA 3LPMA 2HOQA 4G81A 4KXYA 1QGAA 4Q24A 2FSPA 2DSNA 4QDXA 4BNGA 1CR0A 2QZPA 1HL7A 1IZ0A 3R9XA 521PA 3UJBA 2A9KA 2VJQA 1GSAA 3EGXB 2PKCA 5BW4A 1SWVA 4X5OA 1CY8A 3PNVA 1C4WA 1BAPA 3VSDA 2GN0A 5ULLA 2VDUE 3EF0A 5AM4A 5KWSA 4FNAA 4QUJA 1ANKA 2AQIA 2XBMA 4WK6A 4OK5A 3S0JA 2Q7DA 1WY5A 1TQHA 4AMUA 3O8RA 3HBJA 4PANA 5BSTA 3PXUA 1XZJA 3IEKA 4YRIA 5KYXA 3GDHA 3EOZA 2GM3A 3JASB 4WSOA 2HT1A 2JLAA 4NK4A 2JKYA 3TB4A 3TQCA 1T0IA 1MABB 3K9BA 4RVDA 2NPOA 1ZR4A 1RWBA 2HDWA 4BMSA 1XZKA 4H6XA 3U7EB 2AFIE 1I24A 2CVQA 1K1EA 1Q1GA 2PO5A 3LQYA 3RANA 5FR2A 3QBEA 1X1TA 3RVBA 3E7FA 2I0FA 2WUFA 4PIPA 5TQVA 4D6PA 4FU0A 2P9QA 3V8NA 4RKQA 4AZ0A 1K6EA 1C3JA 4GXNA 4ZAYA 1AGPA 1TCVA 3NCHA 3IB3A 2GN2A 4S1NA 1P91A 4D9BA 1ZG3A 1P33A 1EX6A 2CT8A 1QQAA 1XQWA 2GESA 4EM6A 1IE3A 3GRPA 1NVAA 2H9AA 4JSTA 3D5TA 4LZAA 5CK4A 3DOEA 3MCWA 1XRJA 3D3NA 3AKYA 2QT9A 5CRIA 2Z5GA 5I7FA 1FRFS 3HO8A 5JZVA 3MQFA 1KMQA 2ETVA 1TVCA 2G70A 1XOIA 2I6GA 2IHKA 1EFDN 1OW3B 2QSUA 5E6UA 3QX7A 1Z2PX 4BRWA 1FU7A 4Q3BA 4G97A 2ZIFA 1BOFA 4NNOA 2P91A 3AUUA 1Y9ZA 1WTCA 2HL6A 4M21A 5IBQA 3SJUA 3WK4A 4A7PA 3TLGB 4EPVA 3I76A 3FYUA 4I9FA 3ZHVA 3FW1A 4HWGA 1UC5B 3ZDYB 4MRVA 3SEZA 3NXKA 2A1UA 4P4NA 2X0KA 2GPAA 3PWTA 4RHEA 1K7YA 3ETCA 1NX9A 1SA0A 1R8JA 1VL8A 1LC0A 2X6RA 4W1SA 1M1YE 1AS0A 3WP1B 3A11A 2OXIA 1XYVA 3A37A 4UHFA 2DTDA 2QL5A 5HZMA 3AVWA 3W5HA 2P0YA 1WD5A 3MIIA 3UFXA 1YE5A 2V7TA 2ZT8A 1ZAYA 5K3CA 2CBZA 1G8HA 1N6RA 1BS9A 2H7CA 1BCSA 1IZ9A 4JLBA 3WP0A 4KQXA 1T9BA 2IUYA 4ZALA 2Y1DA 4UU0A 1HOTA 3D02A 3T52A 2E2WA 2WTEA 1LFAA 1I7PA 4HFRA 1EWQA 4KQCA 1ISMA 2OM6A 4FOOA 3VZBA 2V7VA 3RSHA 5DHAA 2VATA 1AO3A 1R9GA 5EI5A 1KY4A 3ZZUA 1U3UA 5EUBA 4EMTA 2CZGA 3I9LA 3GD5A 1WG8A 1TYZA 1HV8A 3CRW1 4INZA 3T7DA 4JELA 5F1YA 1H2YA 1ZKDA 4C4XA 1W36D 2O7NA 1U81A 1Z75A 3KDAA 3REQB 1N7IA 2IDJA 3ETNA 5D8DA 5CD9A 3ONNA 2WY2D 2X4IA 2H08A 3RRZA 1VCIA 4ZQIA 3N70A 1Z29A 4BO3A 2YWCA 2FEPA 3L0OA 4OMUA 2QTLA 2AD1A 5H70A 1N1MA 3ROEA 1KO8A 2GPYA 3QVGA 3LY7A 3R3ZA 3ZIAD 4FX5A 1JEJA 5EUCA 3RRJA 1V16B 4EUHA 4C2UA 5CT6A 3N5CA 3EJ6A 1U8CB 2QN8A 4MQ5A 2HDOA 3V4FA 1E79A 1AXRA 2B6HA 2QXYA 3KWMA 1XCLA 4KODA 1GNTA 4MVJH 1F6WA 1TF5A 5ITZB 3KD2A 2HLDA 1ZICA 1B1CA 2P30A 3TVTA 4O4IA 2ODNA 2I22A 3IJEB 1A9OA 4PNEA 3EGDB 3HKCB 4CKEB 1E3MA 1NPYA 1ZGJA 4OH7A 1SOAA 4TT3A 5DH9A 2IU0A 1P61B 4ZVRA 2PD4A 2SHKA 1G6Q1 5JDIC 5F35A 4DIFA 2JJQA 3IV6A 1GUYA 3KXDA 1LNZA 5LLDA 3U3MA 3LNCA 4PYRA 1I0IA 1RPTA 3ZQUA 3Q72A 4GX1A 4AIRA 4ZI2A 4DTIA 1UAAA 4H17A 4TTPA 2OB2A 3QU9A 3M4JA 3LECA 2NPIA 3PQCA 3JWPA 4AZTA 1YJXA 2OBLA 2F7SA 2CXHA 3GGDA 3LHSA 4KXMA 2OB1A 4YMTA 1YU9A 3GGSA 2NXEA 3K31A 4M8IA 4UAJA 1YC5A 1NBAA 3C3BA 1IG3A 2W0SA 4BQPA 1CDDA 4PBTA 1ULTA 2Y4OA 1M33A 4HDQB 5JBNA 3BICA 3FAKA 3P4YA 1J2EA 3Q0TA 1W4LA 4F5WA 4C78A 1RQGA 4MW9A 5DIZA 2XNHA 2P11A 4BBAA 4KU4A 5JATA 1VHLA 3QI7A 4A6DA 4ACAA 4QU9A 5JI3E 4J1SA 3HO1A 4ZOQI 1DRWA 2IVFA 3QFTA 2J0UA 1VJ5A 4J4HA 4KYIB 1Z0SA 4IIDA 3KWJA 4YH1A 1TADA 3A9TA 3DMDA 5CK5A 5ECDA 2FPLA 2PO7A 4JX8A 2FQWA 2BFPA 5I8ZA 4LCBA 4MS1B 1I7DA 3EMBA 1P4JA 1XMPA 3MTBA 4S24A 2BPOA 4EAAA 3GIWA 4O3FA 2NXNA 2OFPA 2ZJ4A 3BL8A 1TFRA 3OLCX 4X1IA 1MW9X 3M70A 4EJ6A 3NZEA 5DRTA 2WWGA 3WYDA 2WAAA 3N2GA 3FPCA 2XT6A 4W82A 2P2YA 3II6X 1U5BB 1Y6QA 1H94A 3M89A 1CEXA 3PP8A 3TCXB 2B78A 3R6WA 3UUFA 1N5OX 2XWSA 3DR3A 2X7HA 1NVEA 1ZIYA 3MRXA 4HRYA 4I3FA 4AD8A 3RPEA 4RL4A 4RDXA 1ZQ1A 2GDZA 1E7SA 4XJSA 1N6HA 2B4YA 2ZVDA 1SC9A 3QOFA 4DA8A 1MAWA 3DMTC 2NACA 3G02A 3U19A 2ES4A 1LPPA 2BJWA 2YIVX 1NVKA 4MKXA 1AKYA 1AB5A 2EL7A 2JI9A 1SO8A 3ZDXB 3WIBA 4B5KA 2F1OA 1OAAA 5C4MA 2DETA 2P7HA 1A7JA 3FCEA 3GNTA 4BMZA 4ILKA 3RIHA 2R8OA 3HABA 4OHFA 5AW7A 5L6MB 4E1VA 5GPBA 3E3MA 2ZZMA 3BQNB 1I14A 2IGTA 1P5HA 3BZWA 3W7BA 2HKIA 3WSVA 5I4KA 5G4KA 1FFYA 3IKLA 4EHFA 4TRRA 2C54A 4TUYB 3EXFB 3A1CA 2OENG 3AL2A 1BDJA 4AMYA 4TTIA 3ZWQA 1CU1A 4FXPA 3IYLW 4N9QA 2VHWA 4M1SA 5GMOA 1LD3A 2PX6A 1L4UA 1Z47A 1JGTA 2QE7A 4JUCA 1U2GC 2IDMA 3E5NA 1Y3IA 4W9NC 4CG2A 1Z6AA 3KUKA 2HBZA 1P5JA 4US0R 2ZUCA 5EPOA 4AUNA 1KEUA 2PG3A 5KJCA 4TYQA 1ISRA 2EFEB 1WZUA 4ZIRB 3QPCA 4H0NA 3NC0C 3URMA 1SOMA 3TLBA 4O2BF 4FFVA 3QEAZ 1D6MA 5ALRA 4Y18A 3RU3A 5DGXA 4ZZ1A 1C5KA 4ZXPA 1P0PA 3X2SA 4RVSA 1ODJA 3EMKA 1IB6A 2C92A 5LQKA 1QTRA 3TLXA 3VPSA 3AKZA 3GO4A 5LBTA 1A8HA 2BFFB 3WGZA 4OF4A 1RYFA 1RZRA 2FPSA 2ZBRA 4IZ6A 3FTNA 2WD7A 3C45A 1OX4A 1PD1A 1J5XA 4O8ZA 4JB2A 1YZHA 3CX8A 4Q9IA 3WWZA 1Q3TA 1R27A 3M9WA 3X2EA 2XVZA 3QF4B 3BWVA 4YJDA 2RC5A 3SAJA 1JIKA 1NT4A 4LE0A 4YROA 3ESAA 1O96B 2Z30A 4GPEA 5GVRA 4TN5A 1M1XB 2V59A 2ZTUA 4G5RA 2ADMA 1KDRA 3QG5A 1L4EA 5D5PA 2VZEA 1YVRA 1S6YA 1Q5PA 3IQFA 1VMAA 4H0CA 4UCXA 4B6FA 5EIBD 1KMHB 1XWWA 1EQAA 5JAZA 1G38A 1HBJA 1DGQA 1C0EA 3D3WA 3H3FA 4UD6A 2FNAA 3TTVA 4ND3A 3KWLA 1M54A 3FZNA 4M0DA 2IHUA 4INOA 1ZOPA 2VYCA 2ZWAA 5CNMA 4B80A 1NX6A 5JZOA 2GEUA 4RTJA 2XMSA 3DZ8A 5CP8A 4KK4A 4X7PA 2H1FA 2OWDA 2ZRGA 4CIVA 3DCIA 1LDMA 3GGPA 3E7WA 1WZCA 4LHZA 5AHKA 2K4MA 3CSSA 1YK0A 1I80A 4PW0A 2G9QA 5KYUB 5MDHA 1P0IA 1QX3A 2I4RA 5A71A 1P2UA 3T5MA 3RYHA 1V2GA 3UQZA 2AMJA 5ARDA 2XA1A 4ERNA 4CR6A 2IZ0A 3LQQA 3R7WA 4N7BA 4TLBA 1P0MA 2JBWA 1M67A 1CZOA 1SZPA 4RNCA 1UFRA 4Z4FA 4Q47A 1SZJG 3OEHD 5IC6A 1QONA 2ANBA 2QT0A 4PC1A 4RORA 4DEVA 3M34A 1GL6A 4ZVLA 1UKBA 3DW3X 5LKAA 5HTOA 2E1PA 3MLEA 4AC9A 1B8VA 3GOHA 3RK0A 2YOHA 3UB3A 2E5FA 3GLGE 3BN3A 1E9BA 2B8JA 3OE4A 3TR6A 5EJ4A 1OH7A 1P73A 2IYNA 5IT9A 2VP3A 3FPBA 3V7FA 1JILA 3QQ5A 5IEBA 2W6PA 2OKCA 2PZKA 3A4VA 2AYZA 1NJSA 4Y0NA 1K7EB 3OTWA 4I5EA 1TCBA 3ZJUA 1KQPA 2PDAA 1US8B 3ESBA 3GRYA 3OOHA 4U1RA 4D3YA 4HDAA 2IA5A 2GRAA 2NYAA 2MT9A 3IELA 3PNKA 2XB2A 1IY2A 2W2VA 3SD7A 3Q3IA 1S0UA 3FCYA 3O4FA 3VOTA 4D3DA 1UPTA 2PS9A 3L6OO 4J0JA 2QN2A 5DV9A 1X42A 3I2GA 3LQKA 2FPKA 1F4PA 1ZJYA 4UREA 5FT9A 5K8VA 2EKPA 3CVUA 1ISGA 2TS1A 2GHIA 2ZKLA 1HYEA 4FMBB 4H1TA 4IGFA 3ROKA 1QZXA 3AY6A 3L49A 3MZ0A 1A95A 1EHIA 1X2EA 3C6QA 1SU6A 2R62A 4MP6A 1JYEA 1T4BA 2VHTA 5BPHA 1TVKA 3T15A 1GZ4A 2ZJ5A 4GI1A 3MCAA 1D2NA 3IAEA 1LVHA 1S4QA 1Y48E 1QZ3A 2WF9A 4GI2A 2EHDA 3WJ7A 5B4UA 3VNVA 2APJA 5C1OA 1L5MA 4JXXA 3ZJVA 3L9XA 4B3RB 1MH1A 3EZ6A 4DR7B 2OLEA 4IS2A 1EVEA 3OSUA 4V1CB 2IE8A 5J23A 2OM2A 5KHAA 1UODA 3NIWA 3AFMA 1BO6A 3FYCA 3G0HA 2J4CA 4DLUA 1GV0A 4NTZA 5B1IA 2C03A 2Z6UA 1AO0A 5CM8B 3DZBA 1J9GA 5CR9A 3GEGA 2J08A 5ALSA 3RFTA 2Y9MB 2QRVA 1JKFA 3GT4A 2BTQA 2IH5A 2ZJ6A 5EJ8A 1U1IA 1Y9EA 2EFJA 1DZ3A 1EI9A 2D0OB 3KZNA 5KNCH 2ZBVA 5FOWA 1H93A 4DIDA 2AFIB 5M7EA 2CLEB 4GC5A 1B0UA 2OCBA 3GMDA 2AJ8A 3SFTA 3IUPA 1ZMRA 2RH9B 4H3HB 2VRWA 4CNBA 2V5AA 4C01A 4F8YA 2EV9A 5IYZA 1RI3A 4EUEA 1DBQA 4BXOB 2VSXA 2A9JA 1WXGA 3IIKA 4QELA 2ZSDA 2IUUA 3HKBA 4OUDA 2YKGA 5DYWA 1BG6A 1X7DA 3G7SA 1XXHE 2I3AA 3GCXA 1MV8A 2P4EA 3K92A 2F1JA 4D0NA 1V7CA 2WE8A 1HL3A 4AI6A 1KYQA 4BP8A 1FXWA 1VYUA 2E49A 1UBNA 1S1MA 1T1EA 3GUYA 5BN1A 2QSZA 3UYLA 1J0DA 2XD4A 2OGSA 2ZAGA 1MJNA 2LWIA 3SHTA 4JT9A 3CLTD 4AJ2A 3EGWA 5I45A 4JBHA 5KDDA 4XGKA 1CJMA 4JGIA 8LDHA 3ZW7A 1QVAA 3HDYA 4HWTA 2R84A 3ICWA 1PTKA 1XRSB 4LYAA 3EH2A 4UUNA 3COJA 3MCTA 1E5VA 4UDXX 1PJTA 4LXYA 5ALYA 1XDUA 5DI9A 2GR9A 2KE5A 3CWZA 2C1XA 3LRTA 3AQIA 1ZD8A 1M1YB 3BAZA 1J33A 3U7QB 1OGYA 3C6ZA 1JKXA 2TMYA 2VUHB 5H7XA 4LE1A 2ETXA 3DUWA 2Z3VA 2BH2A 1SRQA 1QP7A 1EAMA 3L7YA 5EJGA 1BKSB 4WTOA 5H9WA 2YWJA 1JI3A 3A25A 3OT5A 1WKBA 2O57A 2YFQA 4Y3UA 2E5WA 1J8DA 1JQBA 2FZEA 2WNHA 4DCGA 2OHJA 3ABOB 5SICE 1Z0UA 4BE4A 5TF0A 5K03A 1TTTA 1P1CA 5KNDD 4J43A 3P9RA 4GECA 1XCBA 4EEKA 1R8XA 3FB4A 3ND8A 1X7YA 3NPAA 3WIEA 2BZ1A 4PRLA 1OMOA 5KIAA 1NSFA 3D0QA 1FUEA 2REOA 3UC5A 4EPTA 1RYBA 5EIAA 3G6KA 5I3ZA 5E9JA 1UC9A 3UPUA 3V1UA 2FOXA 2UVQA 4RLFA 4D4HA 3RUAA 4QDOA 4BMYA 2ZRNA 4YP1A 1U02A 1CJBA 3WGOA 2LBPA 1SELA 1UXOA 2IGBA 3C5CA 3H99A 4WA7A 4IS3A 3Q2OA 1JHAA 1LRLA 3OJCA 1FFCA 1A2KC 1O95C 1YJQA 3M6AA 3MT7A 4BQFA 4DSNA 4US1R 3T34A 5C8XA 1RP7A 5KMGB 1C3OA 3EC1A 2FZVA 4PYMA 1EPUA 3THOA 1VBKA 3DXYA 4BNMA 5CYGA 1RJEA 3HN6A 4MCIA 2RJOA 4OH1A 3ASZA 4LBYA 4HVAA 2YR0A 4OB6A 4OD0A 1OC2A 4NU0A 1D1TA 3CZ5A 2QI9F 1KS2A 1M3SA 3FNGA 4I2VA 1TCUA 2FXVA 1QB7A 2HWKA 1P2BA 4JLKA 3EPRA 4TUYF 5DBEX 3U09A 5K6TA 5ALMA 2JEZA 2QX7A 2DT8A 2JHPA 3I9V1 3A2KA 3WOHA 3G0OA 4JX9A 4WCVA 1W2HA 1F14A 5E6SB 1QLWA 5DYYA 5H16A 3YASA 1E3WA 2JCGA 2QQGA 2FOIA 5B1DA 3RFUA 3TQSA 3HYSA 1OIVA 1FFEA 1TIBA 3HJAA 4NEGA 4MHOA 4URYR 1CQIA 1VJCA 1ZPDA 1JFFA 4G26A 1QHGA 1X86B 2OHVA 2EATA 4V0OA 5F5XA 5KNBA 2FHSA 2PSFA 2BEWB 1Y7HA 1WWKA 3GB9A 4QECA 3FNHA 4EHLA 1NAIA 3CNNA 1VIDA 2NWQA 3G2OA 1YS7A 2C2GA 3JQEA 2HK8A 5CD1A 1OAKA 2CXRA 2ZTSA 4FGZA 3STXA 4BTEA 1HA3A 1IJKA 1SU8A 2H4WA 1HURA 1CJKC 3VGPA 2WR8A 1YFZA 1H8HD 1ZY2A 1IBLB 1QYXA 3NBMA 1MOZA 3TF5A 1PT7A 1Q1ZA 2Z9BA 4RC9A 4FX2A 3HU5A 2DWUA 2OP1A 2WHXA 1XGKA 3GFRA 4NBVA 4RMGA 4RPHA 3KKPA 3RS0A 3RI3A 3W4KA 1Z0JA 4ZV9A 1T24A 3OA0A 4IX1A 3QV2A 1C4OA 3O3NB 4XTRA 3K8ZA 4Y2XA 1ZMXA 5B2EA 5K3OA 3IPAA 2JANA 3ML1A 3KQPA 4D6YA 3NVAA 1D04A 4FZ3A 1Q16A 5HIMA 3RC7A 3ZQ6A 1RFGE 1NDUA 1C8VB 6LDHA 5JFOA 1JEDA 2P9GA 2WF5A 3NRBA 2Q3FA 1WHSB 4URHA 2ONJA 5CFQA 3EZXA 2PZGA 2ZUWA 2C2XA 5FPYA 4I14A 1PN3A 1QDEA 5CDFA 5C32A 1OX6A 1ACJA 3FKJA 3DMNA 4EW6A 1KKLA 2HCJB 1WRBA 5D1NA 4CLHA 3TTSA 4ENWA 4N5MA 4IGKA 4IJMA 2PMDA 3TR0A 4C07A 2DTEA 4R1QA 1SKQA 4WCDA 1NW7A 5KWJA 1SCDA 3BMQB 5HK9A 2ADFA 4RVCA 1ECLA 2I80A 3C98A 4LZPA 4Y1GA 5JCJD 3DBRB 3AUSA 1GFSA 1CUIA 4N39A 3B1FA 2W48A 3C8MA 3L46A 4RK6A 4YVFA 3WLTA 5DNYB 3ECSA 3FCUB 2VOJA 2OSVA 1KRWA 1TLTA 2WZCA 1NTRA 2O3SA 1CIVA 3LLUA 1HZJA 4Y9SA 1U11A 1PNTA 1QB8A 2BBSA 3DTVB 1J20A 2FEWB 4IUCS 4NBWA 4PWYA 5L3QB 2R6DA 5LDGA 1F51E 2EL9A 4MQFA 3TDMA 4IMRA 1IEVA 1PFGA 2OBBA 2VHQA 4FW9A 4NBNA 2BD0A 4OM8A 2D0IA 4ZHQF 1JQEA 4EYKA 1G3RA 1T6YA 3DE4X 4OP2A 2H5JA 2PR7A 2YHIA 3P0JA 4B6OA 5AVVA 1QJ4A 2GCPA 3AW8A 5FBHA 1TYBE 1MXFA 4AF7A 4WDQA 1VGVA 1SBYA 5ITVA 4RZIA 3IL2A 1CVRA 3HO6A 2F8TA 4L4SA 4BV8A 1P45A 1Z39A 1F8FA 3M1LA 1KPHA 5F2OA 5HGXA 2CWDA 1Z4MA 4ICIA 4J7AA 3WB1A 2H0RA 1UK9A 3MQ2A 3IHKA 3C15C 3K1YA 4JLPA 4Q4JA 4HNSA 3OURA 2XOXA 2PX5A 3KHUA 3RRNA 1ONPA 1VLJA 4G63A 2PUVA 4DQDA 3KU1A 5PNTA 1FFXB 1U3FA 3MVEA 4BFZA 4OHKA 2GFHA 3I83A 1DRJA 1ABFA 1P72A 2Y6VA 1IXRC 3PD7A 2J1LA 4LHXA 5AW5A 3WI7A 3PICA 3UMMA 2M1ZA 3L07A 3TGWA 2HJHA 1E9EA 4DJDC 1W75A 5JNWA 1U0OC 1SC1A 4GPD1 3WTCA 4R2WA 1Y5LA 4GZMA 4UUMA 3LC7O 1MORA 1NUQA 1SCUB 4BFWA 2J41A 2VJAA 2Z2YA 2A3NA 3DBIA 2WPDA 4QVGA 4RHTA 1CETA 3K0KA 5GGYA 4DGQA 1KVRA 3ZHOA 1Z2DA 1E9CA 4HKTA 5FWXB 5FWYA 4BVKA 2PUTA 3E4CA 3RUCA 2NG1A 2HSGA 1PR2A 3KLMX 3QIAA 4BLRA 4Y2QA 5C0OE 3LJKA 1V7QA 2B0CA 1AOXA 4REOA 3WDKA 4RVOA 1Z6GA 4I6JA 4ZU1X 3S68A 1NR1A 1EVKA 1FXUA 1H2ZA 5IBPA 3U17A 3VSCA 4UTRA 2B20A 2I54A 3FNIA 3FX2A 1T8UA 2R79A 2LNDA 2OCKA 5TVGA 4ZOBA 3VMFA 4N01A 1RKXA 4HNTA 3I04M 1TEHA 2BEUA 3ZWMA 3W5IA 2ZR0A 4NHEA 5TVKA 3VR6H 3UFBA 1PX0A 2JI7A 3V6MA 1GQFA 1WP4A 5K2OA 2Z6VA 4PS1A 4W8GA 2GTPA 4O33A 2FUG6 1UXHA 1JG3A 3IJRA 2BEKA 1EHYA 4N40A 5LP6C 1GL9B 2XWPA 3JVIA 1M8JA 4YQYA 3KXLA 1MF7A 2G04A 1DRKA 1E0KA 4RDIA 3QI2A 4EB8A 4PLHA 1JH8A 1KFBB 1YQDA 1HDXA 1T36A 2H00A 1QS0B 1M10A 3E9CA 3H5RA 3UWDA 2HQ1A 5I7VA 1JS1X 4P83A 4CJXA 4QLBA 3G8BA 3ZXSA 2QLBA 1GNPA 5KSZA 4JLDA 1KSHA 3EIFA 1OH6A 1YZNA 3KUXA 3IGFA 3AHEA 2WTAA 4PGAA 4WFIA 2IS6A 3K71B 4LNUB 5DN9A 4FGLA 2ZXEA 4ZN6A 3UH1A 2TSYB 3HNRA 3GLGB 3SYMA 1A5AB 1A9SA 1TT5B 4IOMA 4O4JA 4QGHA 4OM7A 2H3HA 4X8LA 3ZDEA 4U6QA 4E08A 4YV2A 4CTMA 2Y1LA 1F38A 4A10A 4RK7A 1P19A 4I1IA 5M04A 5JROA 3EYAA 3IUSA 5DI3B 3FI0A 5JZSA 5BXQC 4G1VA 4OXNA 2DPLA 2JZCA 2EOAA 1ZNXA 2V6JA 3OQ6A 1U8AA 4KVGA 4Q66C 2MR5A 4OVKA 1Q0ZA 3GP3A 2ZVQX 1AUVA 3VPFA 4ZYWA 1RIFA 1OI4A 1UBUS 3B7PA 1AXGA 2WSIA 3VR4D 3DO5A 3CRZA 4TYNA 2ORYA 5K0CA 1LC3A 3PI6A 4BATA 2C07A 2ICAA 2XI4A 2YY6A 4URZR 5ED0A 1E2FA 4F3YA 4IOKA 5D1HA 5E2IA 5BMVB 2CCJA 5KJ1A 4QYMA 5EXSA 2NMVA 1WMAA 1WU8A 4Q03A 4U2GA 4JP2A 2R7NA 3ZVLA 4XYLA 3E2IA 4S2EA 4QZVA 1ZHOA 2WM9B 4I36A 1D2EA 1JXQA 2PAFA 3CT4A 2CD9A 4RLHA 2JJ1D 4N49A 5DSZA 3UENA 1HT1E 2FWJA 3EBLA 3RO7A 4MTCA 5JSZB 4EF5A 2P9JA 5CW1A 3DEFA 5REQA 2W00A 4DTCA 3O0DA 2QMQA 3LVRE 1G21E 1U0SY 4GXQA 2B4QA 3MEQA 4RZUA 3BJMA 1S7GA 5DULA 1TO1E 1A76A 4L7QA 2ONZA 4YT4A 2HXSA 2Y66A 1GPUA 2EERA 1AHIA 1I3LA 1U8XX 3A0RB 5FYQA 1JLKA 1XF9A 4M9QA 1XALA 1RS0A 4RABA 2HYDA 2QVYX 2QLNA 4IJUA 4X90A 3ESQA 3C74A 3HCNA 1MX1A 3V1YA 1OLXA 4II2A 4OAOA 2XR1A 2ZIVB 3HE3A 2HT6A 3ZXYA 2QTVA 4RENA 3FE2A 3CX7A 4CIBA 5AVXA 2EAUA 4EF6A 3P5SA 4GYWA 1W4RA 1AK1A 2RGRA 2CMDA 3WYAA 2OV4A 3BWEA 3WHPA 3WKBA 1YCHA 3KT3A 1WUHS 1ZOOA 2UZIR 3MELA 4MVJF 2GGSA 3K6SA 1UQRA 3RS9A 3V80A 3IV9A 4OFBA 1DFIA 3JQDA 2HMYB 3IEIA 3W3AD 3EPPA 2VAVA 2JAOA 5JADA 3N2KA 4D9HA 4YP5A 5FJIA 1ZL2A 4NR0A 1RAFA 2F6RA 3DR5A 5D3MA 2IPLA 2LIVA 3LIPA 1M2OB 4CTJA 1P17A 1XXHB 4MP3A 4IOLA 4Z1MD 1DC6A 4NZZA 1JUDA 5BV8A 1F5NA 1J2YA 1HE8B 1U1GA 1FYDA 1KQ3A 1UM9B 2IX9A 3CZ4A 3DMGA 3UJ8A 2PUDA 2GHQA 4CIWA 3BRCA 2CDRA 3RRBA 1ZI8A 4DV7B 3AR9A 2H2WA 4GD3Q 4R2XA 1AK9A 3D2BA 4URVR 2FMKA 3FNBA 1DCMA 3KKEA 1GGHA 3K30A 3NBKA 4K9DA 3O03A 1T1SA 4HP8A 1EP9A 3LP6A 3W6NA 1FK8A 1H3NA 1PE0A 3NHUA 3BF7A 1T4CA 1P6QA 2R1TB 5E38A 5GZ1A 1UPUA 2KPOA 1AB6A 4POOA 4MIOA 4EI9A 2QG4A 5C7YA 5L3SB 1NUAA 2DHEA 1EUDB 1EBFA 1J9ZA 2C97A 5F7JA 2A5LA 3ACDA 1FL9A 3PSHA 1IIBA 1GVHA 1RAAA 4L28A 2JAXA 4I9GA 1SURA 5AIAA 5K0LA 2A92A 2QD5A 1DUVG 3NM5A 3SKVA 3ZCTA 1DMSA 3OX3A 4KDRA 2G07A 1J97A 3V8PA 4FLFA 1VE7A 4TLDA 3A4YA 4AO8A 1XIVA 4MVXA 3TOSA 2GVZC 5AUQA 3UHJA 1G19A 1KXJA 3KO8A 1QDLB 3KZCA 2EGGA 3GAFA 3ZPXA 2G8NA 5DHSA 4ALKA 2QP9X 4PIMA 4F4JA 1F48A 1MENA 5BR1A 2UXBB 1N2XA 2QD3A 4MIKA 4ZRNA 4IV8A 4PLTA 3VJRA 3PVSA 4GL2A 2NU9A 4IO0A 2Z8YM 2EFCB 4UCQA 2OOKA 4L7VA 1NVFA 1SN7A 3TXXA 4ZAFA 1AKNA 3EARA 1NR7A 1MX5A 4J9VA 4PVDA 1PSZA 5HSGA 3BXOA 3B12A 2VEOA 1J8FA 1PJBA 2AFRA 2O1EA 5ERXA 4PO3X 2OBNA 1E9VA 3KQQA 1D8AA 4YCBA 3QKRA 2QV7A 5ALGA 4LYHA 3C3WA 4TMXA 2WAXA 1JWLA 5D5HA 4OQFA 4MW6A 3W1EA 4AF6A 3AJ8A 2AJLI 3A1FA 2BLLA 4UAUA 1CB0A 4PXSA 3THRA 4OLHA 1CV2A 1A5TA 4YCMA 4I9UA 5SY9A 1IAQA 1AIPA 4BFYA 2M2IA 3CTPA 2QN1A 4HAIA 2J5XA 1QIMA 2QJWA 2N1BA 3G1WA 1UOPA 4BEVA 5EKSA 3SZUA 1CDEA 2NVWA 5B12A 4HH4A 2CXSA 2Q3DA 4D9EA 1HQYE 1T4GA 3EZ9A 2QTBA 1B43A 3OJEA 4YHHB 2GO1A 2V97A 3UNXA 2G1KA 4KPYA 3MJFA 4L5YA 1VJGA 2O3JA 5DNVA 3WKEA 3DE7X 5EMLA 4DMKA 1A88A 3U7RA 4RDCA 1D4ZA 1CZRA 4CLRB 5CVEA 3I32A 1ENOA 4GVLA 3CBQA 2BE7A 3AJDA 3VR4H 2NU6B 3AHHA 1C8KA 4CMKA 2X2FA 3UA3A 1RU3A 3IH5A 4DQKA 3EEIA 3OP1A 4D97A 4H7FA 2EDCA 3DF7A 4ESVA 4XVCA 1L6RA 1QWSA 3DEKA 4MIEA 5T41A 4DC0A 2GBFA 2P9ZA 4QJBA 4RTQA 4EHIA 2NSJA 4FFSA 4DLWA 2J6CA 1M8GA 5EIWA 3IPCA 5EJ5A 2ROQA 2ZSBA 1C9KA 2ISSD 3OPQA 3D5EA 3FSGD 4UTPA 4FI3F 1JHQA 2ZFUA 3P7MA 3D6UA 4TWAA 3VFDA 3G2IA 1OWNA 2WKQA 4MCAA 4CMEA 4HUQB 2GYUA 1ZEMA 4DB2A 2UZ1A 2X7JA 5AXDA 2YV1A 4NPHA 1BQEA 2QGFA 3GCWA 4I5GA 3UJDA 4NJMA 1IVSA 1V1MA 3W04A 5CVTA 1LRJA 3AERB 3HV0A 3HR7A 3GPIA 5LLTA 3OF5A 4Z0HO 1UFKA 2GXQA 2O6LA 2QRLA 1IN4A 2R44A 3B89A 4GMGA 4AG5A 4Q4HA 5ELLA 1T5LA 2FWNA 1A9YA 4RKFA 4MQ4A 2H4YA 1J8VA 3S1AB 4DQUA 3JSXA 1MFZA 2LKCA 4M9RA 4TVBA 5THXA 4DAEA 4KAXA 4KE6A 2J31A 4R1OA 5BSUA 1H1DA 5F5NA 2B0JA 3WGKA 1OD6A 4HEA1 4C3UA 1QUFA 4IL5A 1ZO8A 1UKYA 1QU2A 2XOKA 5LJLA 3OIYA 4X62B 5C18A 5BSWA 3GEIA 2CKDA 1KZ4A 3MOGA 3BVPA 3E15A 1TZBA 1MVNA 4RMIA 3OTOB 2WG1A 1PL8A 3PFGA 5EEHA 4C4ZA 3CZAA 4BFSA 4TKVA 3EGCA 3RYCB 2AZ4A 2GEKA 1KDOA 3IODA 4JCOA 3V9AA 1A0OA 1N3BA 3HXPA 3LT1A 4G65A 1JHDA 3ZU5A 1N3LA 4U8HA 3BC1A 2M6SA 1QORA 5CPFA 1Y6FA 1G8AA 2F90A 3CUVA 3G1TA 3N74A 4ZOLF 2BYTA 1JDTA 2UUOA 2Y67A 3I8XA 2BCGY 1CD5A 1CQJB 1YE8A 4F97A 1F6DA 4MZDA 1OXMA 1XPOA 1JJVA 2WIJA 2GBIA 2HI0A 1C3LA 2OQVA 2COUA 3IVXA 3WYFA 3PX7A 3FGOA 4FT2A 4WUVA 3AEXA 4XUEA 4JIGA 4PBRA 1KL7A 1CJCA 2DPGA 4IHKA 3S1LA 3EXEB 3TQIA 1Z6PA 4XQ9A 4NPCA 5GONA 4DCMA 1NG9A 1KZHA 4HDOB 4C0HA 1Z25A 2Z4SA 4NHOA 2ZWVA 1E6LA 4KJZA 5EZYF 3EEFA 3OM0A 4RACA 5T8KA 1HEYA 1T10A 4J0GA 1YQQA 2GH1A 3W9YA 2RAPA 3NGLA 3SCZA 4Q3CA 4Q1EA 5FWDA 1BJKA 5LOVB 3RS2A 3TZQA 4AZ3A 2SCUB 3S7TA 3ZHCA 2WT4A 4CDMA 1SUAA 1EB9A 1Y4SA 1Z33A 2EU8A 3K2QA 4Y1EA 3TXAA 1K8YB 4D56A 4BLTA 2B98A 3HJGA 3H1FA 5ICEA 3L7LA 2XUDA 1BYIA 1TTQB 1GPDG 2Z1MA 4PZPA 4DBZA 3PHJA 5ITWA 1QHHB 4RTNA 3OU7A 4REMA 4YGXB 5JJLA 4CMBA 3T3HA 4MVWA 3WVNA 2XB4A 2P9BA 3ZKWB 1S2NA 4DVJA 3WWEA 2QLJA 1T4DA 3IS3A 5ELMA 1VA4A 4TLMB 3KXIA 2I99A 4J16C 1CJVC 4U7PB 1J0EA 4ME6A 4X7BA 4UVEA 4C2BA 3JWJA 1DKOA 2AUMA 2VYND 2ZPAA 1ULZA 3KPVA 4JQSA 3TUZC 5ILGA 3TNLA 5KREA 5G02A 3W2FA 1OXTA 5IDVA 2ARKA 4ZI5A 3ZHBA 2JK1A 2QS9A 1SXIA 2DQ4A 1XTJA 3MNFA 1WSBA 2YS6A 3QUBA 4WUTA 1X1QA 2NVUB 1EA7A 4YCDA 3QWFA 3U4DA 4B7AA 2W7TA 5CAEA 5LP1A 1M1ZA 3A7EA 4ZEMA 5SY4A 3I6YA 1QPBA 4O2BA 1E96A 4C0SA 3VDNB 2G40A 3P9NA 2D1TA 4R9VA 5FUBA 4BNIA 5CEFA 4HNRA 3FF4A 2X19A 3PITA 4ZHSA 3CRMA 5THQA 1PHPA 5AI6A 4CQLA 3QEBZ 1YF3A 3S1AA 3JZIA 4EARA 1SEVA 2NUTA 3ZN2A 1Y3BE 3HJNA 4M0KA 3WK8A 1IUOA 5CM9C 3OI7A 4E1BA 2VWQA 3FDZB 2JJYA 3B7WA 4QFCA 4RK5A 4CM5A 5BV0A 2YHUA 3AW9A 3RC1A 2WTUA 3EPLA 4JQYA 1E1RA 1LX7A 3N86A 3R76A 3W06A 3VRHA 1ODSA 2JDID 4Z9XA 3B9BA 3ZJYA 1KQOA 1GCIA 5IWAB 2D1YA 2NM0A 4Y1FA 2W2PA 1D4OA 1Y5IA 2MSDB 3BTOA 1GNVA 2QQ5A 4J3JA 1HC7A 3NDIA 3WJ2A 5KU7A 1B23P 1ZWKA 3NGXA 4B4VA 2CMKA 4KK3A 1QHIA 4PZZA 1EVZA 3RGGA 2VSFA 1E64A 2REBA 4GKBA 4WZAE 3TL6A 1PL6A 4MR7B 3WWCA 5AOVA 3P9SA 3PXBA 1NZDA 1RPAA 1X7ZB 5A4AA 5CBPA 3DZGA 3UOWA 1ECCA 5K0ZA 1QM5A 1XMXA 1L9XA 1ZXXA 4MW7A 3U4QA 1QTNA 2OYCA 3CJRA 1WCIA 3BGVA 1U2PA 4EENA 4GOXA 2MSCB 2YJNA 1YR8A 3CWCA 4JR1A 4PHHA 1O3YA 2GEBA 3WAKA 5F2EA 5BW5A 1A7AA 2E48A 3CN7A 3AV0B 3MERA 2B99A 4AFNA 5EY5B 3WLAA 2WM3A 2JRCA 3RODA 2AI1A 2KLBA 1W85B 4PAWA 3TAXA 4DDVA 3B1JA 3Q8MA 4RS4A 1ZRNA 4IKEA 5KQLA 1NE7A 3LDHA 3QITA 1G21B 1EIZA 1F7VA 1QRSA 1JR3D 1KFCB 4KVAA 3BMNB 1A9RA 5IF9A 1BEZA 1DT3A 1C30B 2R6AA 3LUJA 3EZ7A 3C1TA 3FDXA 3KK0A 2GM9A 5DTEA 4K9LA 1GSOA 5CXUA 2FQ1A 3W1VA 4BNDA 2GK4A 2VQFB 3RB8A 2C77A 2YXLA 3SFZA 3UAOA 2Z04A 2P69A 1RIIA 4RIIA 4PLCA 1GPNA 4LXIA 3TLGA 3GJ0A 3ETHA 2WJ3A 2I7DA 2OQRA 3VX3A 3ANSA 2HO5A 5DO9A 1HI9A 4M53A 3SBOA 4JB0A 1VSTA 2VKTA 3CH4B 1PK9A 4X6UA 4ZICA 1B2RA 3DZFA 1ZK3A 3U4HA 4PM4A 3E7XA 3UANA 4QA9A 1WA5A 5EVCA 5TGTA 1DJLA 3AKEA 3AR8A 4LPSA 1BW9A 4KXXA 2XWQA 1QHSA 2JIZD 4HF7A 4KCGA 5AJUA 3M3DA 4WKCA 1JQKA 2F64A 3P19A 4H15A 5CXXA 4EKYA 5BR8B 1PQPA 3FWPA 1FW8A 3K6RA 1KORA 3PPIA 5DM0A 4RPKA 3EASA 4MO2A 3AJRA 1AHNA 1K2WA 1CUVA 4FD3A 4PQFA 5ALNA 2G17A 2D3TA 5C8ZA 2Q9AA 1Y89A 4PPQA 5DLDA 1ORHA 4JLUA 3WIVA 3RS8A 1MEOA 1NJ2A 3IB6A 3PJDA 4XE5A 3OE1A 2WFMA 4CEHB 3COYA 2DFPA 1BGWA 3O4IA 4YYEA 2G9NA 2QUJA 3FGPA 3KKOA 1UXGA 3O31A 3W5SA 1DHTA 1GD1O 3SF8B 1M7BA 5F77A 3MWDB 1V39A 5HFAA 3ZTWA 4Q1CA 3L8MA 2ZUEA 4XGIA 3RSLA 1C1XB 5KVQA 3O9ZA 3EIQA 4TVOA 1RHJA 3WZ2A 3VR3D 2N42A 1PS8A 2L17A 2XV1A 3DDHA 5CT5A 5FL3A 5U1PA 1L5QA 5AESA 4W4TA 5H82A 4DMCA 5KQRA 1N92A 3PFCA 2AYYA 2R8EA 4IW3B 1UBLS 1RJ9B 3AVXA 1STOA 4OQDA 1H2EA 5LMUB 3L4BA 5IXSA 1QFYA 3EN0A 1RXYA 3KSUA 1Z15A 5ITZA 4F92B 3OF2A 1F2UB 1NN3A 1ZNYA 4GR5A 3SXUB 2Q3EA 4NKRA 5ARBA 4C7OA 4RA6A 4WZAA 2SBTA 1IK4A 3EGDA 5CG2A 2ZIXB 3B48A 1Y8AA 4AQYB 2JH8A 2Z8XA 1XBTA 2AYXA 4JLMA 3N53A 3VU1A 1YJBA 2B34A 4NDNE 4CMAA 1N8KA 3HA5A 3MGGA 3GJ7A 1T8RA 3R0ZA 4EKNB 3GZJA 2IYRA 3QWAA 3BIFA 3MRTA 4GPBA 1IWOA 3EAFA 4JA0A 4W6QA 1RXSA 4LV6A 4TXJA 2P79A 5BWCA 2VS1A 3H05A 3I4FA 4C7BA 3FPLA 5K6RA 4HAOA 3U44B 4F3CA 1XQXA 4Y0VA 9GPBA 3DBLA 5T64A 2O5RA 3E0QA 3S2GA 1NVVQ 1ADYA 5IVDA 3N0RA 4D9KA 3CLSD 1UAYA 1ZZEA 2HQRA 2WE7A 3LL7A 4I4TA 2Y3IA 3KXPA 4Q1DA 3PUZA 5GADl 3ROQA 3K72B 3WLHA 3MWEB 1WCXA 1WPQA 2AWOA 2WTNA 1GPWB 3GCZA 3PWKA 4Q7LA 4ZRMA 3TNYA 4B74A 4YPVA 1ZJWA 2J9FA 2JA1A 1X38A 1T8SA 3FZYA 3LKVA 3TM4A 1RTKA 2Y77A 5DHQA 3W2IA 3QU2A 3WB0A 4MS1A 2X1LA 4E03A 1M0EA 2X8AA 3IV7A 1NQ5A 2QP3A 4TRMA 1D9ZA 4H6VA 5C1IA 4OJYA 1QP8A 3RYFB 1GAWA 3KR9A 1XPJA 3BB1A 5FHQA 1P4SA 3IULA 5NLLA 2QORA 2BR3A 3MXOA 3UG7A 5BN5A 2A35A 2R8XA 5JAHA 4YS6A 5GINE 2AR9A 3C4JA 1U5BA 4HDSB 3E22B 4OJTA 1N5DA 1YKGA 1Y7TA 1Z08A 3G82C 3ADDA 3VXKA 4CR7A 5LYJF 2GF9A 3CNEA 4JFAA 4E33A 3H87A 5DNUA 3I8SA 2IP1A 3ITKA 2D13A 2E9SA 1K27A 2GNOA 1IPHA 3C8DA 3I53A 3QBVA 4U63A 5A4FS 1ID8A 3KRTA 3RYIA 5LOVF 2OG2A 3SJAA 4CKWA 4KX3A 4HTAA 1CWUA 2XYPA 1DIBA 1NR5A 1MQSA 1NBMA 3IR5A 2D1QA 3AETB 3Q6IA 3ELDA 4MUNA 1HDIA 2J7PA 1K5GA 3QEMA 4LQLA 3RTEA 3T7JA 3THWB 1AF4A 2O2HA 1TZMA 2WDZA 4B6JA 2GKSA 3VAYA 1WQ3A 1OAOC 3U39A 3BULA 4DMGA 3HP7A 1RYEA 1H0HA 1U2EA 3RTGA 3HDTA 4BUZA 1V8OA 1RLOA 3S5JA 1T91A 2PL3A 5TJ9A 2EZ8A 3SYKA 5AIBA 2JCXA 4ZARA 4BO5A 4EF4A 2AK2A 3FVVA 3FYDA 5CW2A 3W8NA 5JJCA 5B5SA 1XJ0A 4TUYA 1I7QB 4EHHA 1H2WA 4XH9B 3A6FA 3QE9Y 4GM1A 5HRUA 3IVMA 3JZDA 4P53A 1R5JA 3R5JA 4P7GA 2SKEA 1GT91 4X24A 4B87A 4I5FA 2BUCA 4PHGA 4C6RA 2HBYA 2Q3LA 1ZUHA 1SBCA 3DFZA 4IUYA 5AVKA 1ZKMA 4JA2A 5JWRA 4C1NA 3GR6A 3TQFA 2NZJA 1JVBA 2B2CA 3INTA 4YALA 5DISB 2LCQA 3BSYA 4BVHA 3C3XA 2FE4A 4BQEA 1YDFA 4N3BA 3W4IA 2CDBA 2VUTA 4GKJB 4QYSA 1OBCA 2G08A 4O4HB 3FLBA 4IEEA 1XCPA 2ZE5A 1B41A 1FDVA 1BQ3A 2MOKA 4DCJA 4LFBB 1VGRA 1EFVA 5LA6F 1U6KA 3VU0A 1NQTA 5TPZD 3FBGA 4R9UC 5DZSA 3ZLBA 2ODTX 4PC2A 3UH0A 4NE2A 3B6ZA 1CZKA 3HY3A 4CIXA 1ZGHA 1HM5A 1RHRA 3LW8A 2JIQA 3MJ4A 3WMFA 2JCYA 3H5AA 5H3HA 2AEJA 3GA7A 2H63A 3JQ8B 3NYQA 3SQWA 5BQPA 1EXMA 4NMHA 1FLVA 1O96A 5AM5A 5HRCA 1UBGA 3OIVA 4N0QA 3RHFA 1VGQA 3GAMA 8GPBA 2BGJA 3GVIA 4DQXA 4F6RA 3UK2A 3BD9A 1H5UA 3IT3A 6PFKA 3MC1A 3NJRA 3RJ5A 2WU3A 2Y2VA 4QKQA 3UMJA 2X5KO 4IXNA 1A8SA 2HFKA 1OLSA 3PF8A 5BR7A 3NM4A 3TGLA 2OC4A 3R6TA 3TZHA 4D26A 1TM7E 3EVDA 1KAEA 3GBVA 4YACA 3UV3A 1EEHA 1JDBC 1PFWA 2GQ0A 2VF2A 3E35A 3KQLA 4PXAA 3SHWA 4N3NA 4E3WA 1POWA 2YC2C 3E3OA 4PCAA 4XGNA 5E7QA 3ZK7A 2O2SA 1BRTA 1GLGA 1M2JA 2CLDX 2Z98A 3B1VA 3LCCA 3ABSB 4LSZA 4RPLA 3VR2D 2OE2A 1FDTA 1PR0A 4JR2A 5J4VA 1FY2A 1U8ZA 5K01A 4K1LA 1W0JA 3JQQA 2LUOA 2GUGA 3LC0A 4WZZA 1L1RA 3FJOA 3HA7A 4ZHQA 3F7TA 3L7IA 4LXXA 4TWJA 2ZTHA 2YHAA 2FK8A 1IBSA 3MMZA 3N0VA 4BAUA 1P7ZA 1P2DA 3SFVA 3KJEA 3SS7X 1TAQA 4QXQA 2Z6QA 3LVQE 1WZEA 1O94C 4LRSB 2IUSA 1RC1A 2GEJA 2J6HA 3B9RA 3EVAA 5K3BA 2F43A 3GH3A 3CKYA 3UPTA 3T54A 1YRBA 2GB4A 3PXXA 4DUGA 4YMHA 2KYRA 2BHNA 3QMMA 5BV7A 2G72A 4H7JA 2ZYRA 3HBNA 4L15A 2K7ZA 7REQB 3I62A 1E2HA 2NZVG 2P1DA 5D7NA 1A98A 1TLLA 4RTRA 4FN4A 3BBLA 3KV3O 4EK9A 1LF0A 1NM5C 1QCCA 1XN1A 3KYIB 3GH1A 5KB3A 5A6VA 3JAMA 1JAXA 3H1TA 2P68A 1U3WA 1GAXA 3NASA 1HF3A 2IXBA 2J6BA 1N5MA 1UFQA 4F5DA 3PNMA 3MD9A 2BF7A 4R4JA 4JI1B 4EYQA 3IDFA 1U04A 4DA6A 5I3CA 4E51A 1E4EA 1I13A 1X80B 1GPKA 3A1TA 3JQFC 5FBQB 4BWYA 4BX8A 3V32A 1M2GA 5DCYA 4XCVA 3QX9A 4JHXA 3S99A 4D9NA 2BGMA 1QFSA 4EO7A 1QR6A 2Q4EA 4YRCA 4PO1A 1KJYA 1NA5A 1R9NA 4RY2A 5HCNA 1W5BA 3LD9A 4V1CA 5CCBA 2Q27A 2XRMA 1XKLA 2R8BA 4BYMA 3WWPA 4CF4A 3GXOA 4PQEA 1T3SA 1TQ6A 4XD7D 2HSDA 1A9ZA 3PG5A 3K09C 1LSSA 4O08A 3TQOA 2XIQA 3EUEA 2I6UA 2POQX 2WWYA 3T4XA 4TROA 4EOGA 4F8EA 5A06A 2FDCA 3RSOA 2H8KA 4U9IS 1CUZA 5DCLA 4BLOA 1R5BA 3BK7A 4UM9B 1SC3A 4UASA 1GOTA 3O6VA 3WIOA 1NNUA 1EA5A 1IY0A 1V8PA 3A4NA 4ISCA 4TM7A 3UJ7A 5B3JC 4WZBA 3RUDA 4QQKA 1EHCA 1I2AA 4WOPA 5FXMA 5B53A 1QE5A 3W5BA 3AIKA 2IEZA 3AJ9A 4IHAA 4B85A 2PMBA 5JNRA 2YYSA 5EZ5A 1EX7A 4IJWA 5KYTA 4D6XA 3JD1A 4EW1A 2CJWA 5JNUA 3GLIA 2YWBA 1T9ZA 1VZ3A 4MO9A 4U2CA 2R6CA 3LUBA 3SX2A 2WSYB 3UBMA 3HEAA 2NU7B 3PGVA 1ICEA 2O2DA 4JWTA 4B3MB 3OE7D 1BXZA 3CT6A 1GM5A 2W83A 1DAFA 4UUQA 3F4BA 3WZMA 1HZZC 1Z63A 1EFPA 1PBTA 5FORA 3ZCXA 4P08A 2R4TA 3Q15C 5L6LB 1HX7A 4IKPA 4CTKA 3LQFA 3VISA 5B55A 1O03A 3BRQA 5AVTA 1RHKA 1G8KA 1QAOA 4G0MA 4FZVA 1QP0A 1VP9A 5BT9A 2ZCUA 3RUPA 4DDWA 5GZ3A 1BOOA 3N0XA 3HY6A 4JQZA 2PGJA 3ICEA 3GWGA 3E61A 4W1QA 3SP1A 2I2AA 4J6FA 5TT1A 2CFIA 3F3KA 1UADA 1F4LA 2FDRA 1JVNA 4IIYA 3C8ZA 3AEKB 3WGJA 2R1UA 3NVDA 4CI9A 1C81A 4KR9A 4F5ZA 3U7QA 3L82B 5BRJA 4BQRA 3Q11A 2HREA 2XVYA 4K7JA 3UMFA 3WHKA 5AVWA 3ACBA 1WU7A 4DV3B 621PA 4KN5A 4FZJA 4NARA 1N2IA 2R86A 1T6XA 4UHEA 4KQGA 3H9QA 1IJBA 1V5EA 4F3NA 2FMHA 2FYTA 1TRKA 4OQMA 5AOCA 3ZI7A 4LI0A 4C2AA 1UPFA 5DLPA 1CKEA 1M2KA 2IUEA 1RMQA 3PKIA 5F4BA 1TXGA 2XYGA 3SNHA 1JAHA 1X7GA 4HRVA 1SRRA 1NC1A 1VFNA 1XYGA 2MYTA 3T94A 5C5DA 1QGZA 4E32A 3I5XA 5JXGA 2WT8A 1DTEA 2ZBQA 2IYOA 4FVTA 2MDTA 3BRWA 3BZBA 4IZIA 4QARA 2ZRKA 4HDMB 4ITVA 3OJXA 1YGYA 6ADHA 4YAOA 3OO1A 3WNZA 5FUMA 4FXOA 2ZR7A 3IA7A 1CNFA 1EZ4A 4PPGA 1DTWB 3T9AA 4IV5A 4IRXA 4LPKA 5A7FA 4DB4A 4R2JA 1T29A 1PCXA 2A9PA 1R0KA 3C97A 4P92A 3DD5A 2I66A 3D4OA 2YWEA 4ZVNA 2JFBA 3FUWA 3DAHA 4JYAB 3M5PA 3GVPA 2BFBB 3JR7A 3L1VA 3TW8A 2PBLA 1IY8A 2DQZA 1N57A 1XEXA 3ZU3A 2VPXA 3KJGA 1BJTA 4MVJA 2P2DA 3AVTA 4H4EA 1U3CA 2XIJA 4FEYA 1HTTA 1X87A 5G0TA 2E4WA 1RKBA 1PJCA 3WXBA 1O9HA 3O94A 3R9IA 3SC6A 3CONA 4AY6A 4ANFA 3DWGA 3KZVA 3DEHA 4U5QA 4DABA 3AL3A 3ECCA 5DBIA 2WVGA 3AR2A 5DXAA 2PR2A 1ULHA 1WPGA 4LCEA 5CJPA 1D7AA 4H7HA 3C1AA 5FEUA 4A9AA 3JQAD 3FUCA 3ESCA 1IMOA 3GCDA 3HQ4O 3QX8A 4GP9A 4MUGA 3RF6A 4DDUA 4HR7A 4QHTA 3DL0A 5CYFA 2CVPA 4E46A 2IY7A 1G66A 4F5YA 3OEEA 1UP7A 5AK6A 5FPHA 4L51A 3WSWA 3CVOA 4IJQA 4ZMRA 4DUYB 2IPAB 1B8OA 1X1RA 3AY7A 3T1HB 2D6FA 3PDIA 1RRPA 4GE3A 4LKRA 4QTTB 3VAZA 3ZY3A 2GRUA 4IG9A 4BVAA 1SIUA 3V1MA 4QGBA 3CVYA 3UM9A 3BE6A 1W19A 3L7AA 4TLCA 4O4HF 2ZJBA 5AI4A 1AGRA 4ONEA 2HW8A 2DBYA 5J2UB 3OPNA 2YL2A 5WRFA 5KYYA 3DNFA 4UJ3A 3ESYA 3LUGA 3T0GA 1CUGA 2WB4A 1IZZA 2NN3C 1II0A 2C0PA 1RYZA 2PT7A 3IUNA 4A15A 3PQ2A 5HVNA 4LWPA 3DVAA 1DEAA 1FLAA 1KK3A 3BQ9A 2PUWA 3CY6A 1KWGA 1DEHA 4CQMA 3PE4A 5AVRA 5B58C 5C1PA 3P0HA 1YRYE 2F4NA 3F97A 4TTRA 4X00A 2PT5A 3R7BA 1YFKA 3L7DA 4QTYA 2COEA 5IKPA 1NW6A 2G3YA 4ER7A 4LVUA 2IYXA 1WHSA 4B2PA 1TKAA 4YAKA 3RJTA 1V3TA 2Q1UA 3EISA 4OHBA 3H8SA 5HKKD 5DIFA 3GYBA 5JCOA 3LDAA 3STHA 2EZTA 1TPYA 4I6GA 4AWXA 4PAGA 5BSKA 3PF9A 3JRNA 2YWHA 3REOA 4EJ0A 2FG6C 3BTSA 3W2EA 2W11A 3DB2A 1Y6RA 1O1YA 1LK7A 2DPXA 3BMQA 1MZVA 4FE4A 1MG0A 5B1HA 5LDHA 1QP4A 2E3JA 2GLTA 3K16A 1ONBA 3DBRA 3KB2A 3P9IA 5E0KB 3UB2A 1OBVA 4C7JA 5M2QA 2IYQA 3SIRA 2ZRMA 1OXUA 2RGDA 2PXCA 1KI7A 1NJ6A 4INJA 4HTFA 4DKXA 3SQXA 4GYJA 4Z3DA 2VJMB 3AG5A 3WB2A 4GS5A 1VQ1A 2XCLA 4AXBA 1JQLB 4R9RA 1PKEA 1JDBB 2I9PA 1D2AA 4C4OA 3AUYA 3FMGA 1AUOA 3W7VA 1U9IC 4ON9A 1NF8A 4MMYB 4JP1A 3K6KA 2XQIA 2VVTA 4HL6A 2AF3C 3H0CA 3KTOA 4PZYA 4Y9UA 3PLAE 2JAPA 2XUJA 3CCBA 4MP8A 1SBZA 2I4MA 3EGOA 4R2HA 4IMIB 3NORA 1QFJA 1Z82A 2QVCA 3DH0A 2IODA 1SUPA 4FYKA 5SYMA 2MSWA 1QYCA 5EWLA 2A67A 3ZHYA 5FR1A 2FEOA 3TTXA 1NVVR 5K0BA 2I76A 1USKA 3VM6A 1I5RA 4MWOA 1OVMA 1W36C 3UAVA 4CKCB 5K09A 3CVVA 2PM8A 1HNXB 4X7RA 4WEOA 4TOIA 1BGXT 4MARA 4WASA 3SVTA 1Z4PX 3GW8A 5JMPA 2GBLA 4GGPA 2ZQYA 4WAUA 2DKNA 1I2CA 1YS4A 3OTHA 1PV2A 4WLEA 4MITA 1GILA 4Y2VA 3PA6A 4EL0A 5KHOC 1I7NA 4G2TA 3NTUA 2DBQA 1F8UA 3PYXA 3DOIA 2WICA 1JLHA 3ZDCA 1WF3A 3VO8A 1YHNA 1DFGA 2C4WA 2VXYA 2WK1A 3NG1A 3VPHA 2BL4A 4L2IB 3E3AA 4U6NA 3AVUA 3H84A 4Y2JA 3ONEA 3SKYA 4E2WA 5ADVA 1IEQA 2A4MA 4TL9A 1G5RA 2B7BA 5I9LA 2WF6A 4RY9A 5H02A 2HLNA 2B4KA 3EG9B 4IQ8A 3B5JA 2HXGA 1VPVA 1E1NA 4H4CA 2WQ7A 1JIIA 1XZGA 2QN6A 1EE2A 3DO6A 3OPMA 1ODFA 4OXKA 4R1LA 2O8CA 2VHYA 1YCDA 3IEXA 4CVNA 1SY7A 3H9CA 3MHPA 1XD9A 1U7UA 2FK7A 4PIVA 5DF1A 4DIBA 4ZZ3A 5AUOB 3MYRA 4S0XA 4NZNA 3ENKA 1J2UA 5G40A 4RZQA 3T3IA 3ZHXA 4D4GA 4NYJQ 2XZPA 3DDNA 1XNGA 3B20A 4NXMB 1GGKA