3ELBA

Human ctp: phosphoethanolamine cytidylyltransferase in complex with cmp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
333
structure length
302
Chain Sequence
GRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine-phosphate cytidylyltransferase
publication title Human CTP:Phosphoethanolamine Cytidylyltransferase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 302
sequence length 333
ec nomenclature ec 2.7.7.14: Ethanolamine-phosphate cytidylyltransferase.
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3elbA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3elbA01
3CVYA 1KH2A 4J76A 4BWVA 2QUKA 3Q12A 4MW0A 5AHWA 4MLPA 4R2MA 1VBMA 4UZFA 2J5BA 1GPMA 4MUFA 4R2LA 1LI7A 2DXIA 3LE8A 1TQ8A 2A7XA 2QTMA 3M5WA 1J20A 1MRZA 1J1ZA 5TS2A 4K0RA 3FI0A 3FNRA 1IHOA 2ZP1A 3IUEA 1JMVA 1H3EA 3FDXA 1EE1A 1N2EA 1O95D 3PNBA 5K0TA 3INNA 4WSOA 1KQOA 1PFWA 1M8KA 3F3MA 4KR6A 1O96A 1JEEA 2YXNA 1N2HA 2J07A 1OBCA 1ILEA 4CQNA 3ZXIA 2VTBB 4HPWA 1O5TA 4QRDA 2QUJA 4AQ7A 3FOCA 3K32A 1O96B 5K0SA 4MW9A 3ZJVA 3D6VA 3PNYA 3GUZA 3KT6A 4X0EA 2H29A 1KQPA 2GOYA 4A91A 1QQTA 1CT9A 2Z09A 3CVWA 3QTTA 3QTBA 3P0HA 1K4MA 4AS1A 5H7XA 3IOCA 3OP1A 3NV7A 3OTWA 1PFYA 1J70A 4JZYA 4Q16A 5H16A 3IMEA 4MW5A 4KR9A 1MC1A 1T6YA 3DPIA 3Q4GA 2BYTA 3TNJA 5HUJA 1PFUA 3LOQA 1J09A 2A1UA 1MB2A 4ZCQA 3SZ3A 1NZJA 1NURA 1XJQA 3X1KA 4MVYA 2A1UB 2D5BA 4FZJA 1JHDA 2A4MA 2QJOA 4ZCTA 1KKUA 4JFAA 2VXOA 1N2GA 1X6VA 3IUBA 2QJTA 2WB2A 3CVUA 2D54A 1M8JA 2TS1A 1MBZA 1XNJA 2E21A 4ZT6A 1H3NA 4MW1A 2YWBA 4PBTA 2A86A 3CLUC 3MLBA 4MAFA 3CVXA 2HMAA 4MQ6A 2ZUEA 4MVXA 1ZUNA 5JBNA 1WXEA 4YBRA 1OBHA 1GTSA 1DNPA 1COZA 1M83A 1NUQA 3N2YA 4MWEA 3L93A 4JXXA 1H1TA 4EFKA 4XFJA 4PBRA 1TFUA 1WQ3A 4EG5A 4I6GA 2X1LA 4MVWA 1IRXA 2A84A 4KKVA 4QBTA 3AL0C 3TQOA 4GU5A 1LW7A 2GKSA 3CLSD 3D6UA 1EFPA 1G8FA 4MW4A 3G6KA 1N78A 4Q93A 2WQ6A 1NUTA 1J1UA 3IODA 4YMIA 1K97A 1EFPB 2DERA 3COZA 3K9WA 3FWKA 2B7LA 4TS1A 4EG6A 3LCJA 3TZEA 1WZ2A 3CLUD 1D2RA 1GTRA 3A4IA 5TGTA 4OUDA 1IFXA 4YP5A 1ZJWA 1I6KA 3RK1A 1K4KA 3P0JA 2A1TS 1GLNA 5DASA 2CYAA 4F4HA 2XRZA 4DDHA 1WQ4A 3CR8A 5FO1A 4MVCA 1EXDA 4G5FA 5HG0A 1R6XA 3PRHA 1JIJA 1T6XA 1G8HA 1T9GS 2CSXA 2CV0A 2PIDA 3ISJA 1JGTA 4MW2A 3IMCA 2AKEA 3G59A 1MJHA 3KT3A 3ZJTA 3IVCA 2PXHA 2DUMA 1KR2A 3GLVA 1TEZA 3CLTC 1BS2A 1KH3A 1NSYA 2DETA 3SZGA 4DLPA 1I2DA 4YP7A 5KHAA 3Q10A 1VLHA 2QJFA 2PG3A 3COVA 4KR7A 3KT0A 2X3FA 3SEQA 1KP3A 1O97D 2X1MA 5FNZA 4MWCA 1M1ZA 1A8HA 3ZJUA 1TYBE 2ZUFA 1F7VA 1U3CA 3JXEA 1F9AA 3IMGA 3FH0A 1WOYA 1EFVA 3FG9A 4ZT5A 2PZ8A 3FIUA 4MUJA 4PBSA 4NDAA 5F23A 3ND6A 2CFOA 3ZUGA 5J58A 1MB9A 2NZ2A 3UK2A 2J4DA 3DO8A 2DEUA 2YWCA 3AKZA 2Z3VA 2G36A 2OQ2A 1KQNA 3S3TA 4G5YA 4G6ZA 1QTQA 2HZ7A 1N77A 3CLTD 2V0GA 2CYBA 4L2IA 1V8FA 1WJGA 4WNYA 4ZT3A 1WY5A 3I05A 2NSYA 3VRHA 4DNXA 3MXTA 3COWA 4MUIA 3RJZA 4MWDA 1LI5A 5LLTA 4L2IB 1JIKA 1N2IA 1O6BA 1G59A 3IH5A 5KWVA 3GMIA 5IJXA 2A88A 2OV4A 1N75A 2EJCA 1K92A 1VL2A 2JA2A 2DLCX 2IELA 1O94C 1QU2A 3ND7A 4RUKA 4ZCSA 5HUHA 4KPUA 1Q15A 3X1JA 4EG3A 3SP1A 2E18A 1H3FA 1MOPA 4PY2A 2QTRA 1EUYA 1OWMA 1IQ0A 3FY4A 1P7PA 5DB4A 4EG4A 3N8HA 3HZRA 1GN8A 1NUUA 1OD6A 3UOWA 1R6UA 2PZAA 1S4MA 3QE4A 1JZQA 3IOBA 2PZBA 4I6EA 3AIIA 5J59A 1U7DA 2IP1A 3ND5A 1JZSA 4ND6A 4NZPA 3VU8A 2RE8A 2E0IA 3A05A 1O0BA 5DK4A 3H05A 3KFLA 1R6TA 1QU3A 2DPLA 5EKDA 2CV2A 1PFVA 1TYCA 1KP2A 1GZUA 3AG5A 1ULHA 3HGMA 4EG7A 1Q11A 3E27A 2A1TR 1F7UA 1PG0A 3DV2A 4EGAA 1VBKA 2D13A 1T9GR 4CDMA 4P2BA 1X8XA 4ND7A 1O94D 1NI5A 4OUDB 1U0BB 1M8GA 4GRIA 3COYA 3SEZA 3CA8A 4DDMA 4U7JA 2QUHA 1YULA 2CUZA 3H9BA 4HK4A 4ARCA 2C5SA 1EJ2A 2EL7A 1XNHA 2X0KA 3RHSA 1QNFA 3U1VA 3HL4A 1Q19A 3MLAA 4HJRA 4ZT4A 4DJAA 3NBKA 4MUHA 3PXUA 5IHXA 2AZXA 1JECA 1U3DA 4ZT2A 3PNVA 2Z08A 4MW7A 3CVVA 5KCMA 5FO0A 2J08A 5TEWA 4CDNA 3ELBA 1KAQA 5LFAA 1EUQA 4ZCRA 1N3LA 3AG6A 3H99A 4MWBA 3N9IA 2JAXA 4YP6A 5TEVA 1O0CA 3A2KA 3IVXA 1N1DA 1JEDA 2WQ7A 4S1OA 3IDFA 3SYTA 2VTBA 3HV0A 2J09A 3UC5A 1FYDA 4ZT7A 2CYCA 5BNZA 2IJGX 1OWPA 1NUSA 3CLRC 3HMQA 2CT8A 2H2AA 3VGJA 1EFVB 3IOEA 4JXZA 1YUNA 2DR2A 1KH1A 3DLAA 1B6TA 1WXGA 2YY5A 1Y42X 2WSIA 4CT0A 1PG2A 2GM3A 3P52A 3N05A 3UMVA 4HJXA 4ARIA 1TYAE 1YUMA 3RFFA 1JIIA 1VBNA 2E89A 4QREA 1IQUA 3H97A 5LM3A 4MUGA 1FFYA 3SDBA 4F3RA 4MULA 4NAHA 3X1MA 2AG6A 3A04A 1YI8A 4NAUA 2O8VA 4MUNA 2O5RA 4MUEA 4RPIA 3TS1A 1TYDE 1I6MA 4MW6A 3CLSC 1WXFA 3L92A 1KAMA 4JYZA 3RK0A 2CV1A 1QRSA 2JANA 4U63A 2RD2A 1NP7A 1WXIA 3MMXA 1MAWA 3KT8A 3CLRD 4NATA 4OJMX 3ZIUA 1J21A 1N2BA 1SURA 3FETA 4J75A 1V47A 4H3SA 1MAUA 4KPUB 1UFVA 3H9CA 4ZCPA 1ZH6A 1M8PA 5DEOA 2QTNA 2V0CA 1U7XA 3TQIA 4U8HA 1XNGA 2R5WA 1F4LA 1QJCA 4DDKA 3AFHA 4XFDA 1N2JA 1T6ZA 1IH8A 1ZH0A 1YIAA 3IVGA 3UY4A 2BTEA 3MUEA 3ZGZA 1GAXA 1YIDA 4K03A 2QUIA 3FHJA 1O95C 1WXHA 2XRYA 3ZXSA 3ILVA 1IVSA 1N2OA 2I1LA 4UZEA 3G5AA 4EG1A 1M8FA 1OWNA 2PFSA 1RQGA 4EF6A 3NBAA 1NYLA 4DE5A 4XSVA 1I6LA 3TZLA 1OWOA 1G8GA 4R0NA 3RBAA 1JILA 1QRUA 4NX2A 1OWLA 1IQRA 1KORA 1O97C 3HFJA 1HYBA 1QRTA 2HGZA 5J5AA 3P0IA 3BL5A 3C8ZA 1WKBA 4EG8A 4E1AA 1NUPA 4I6JA 1Q77A 4MUKA
chains in the Genus database with same CATH superfamily
5JISA 1UBKS 5HGJA 1W0CA 4ZC8A 3SQNA 1Y33E 3D4BA 1N9GB 2FQQA 1Q7BA 4HPXB 4HNUA 3PEYA 3I92A 5AK5A 5LMZA 2W2PA 3IDOA 3CF2A 4KLAA 1G20A 1Q0ZA 3O92A 4WKBA 4WBNB 1Z0UA 4XB6B 3IEUA 1PR6A 2Q3HA 1T6BY 1TQ8A 2JFBA 3SYMA 3THWB 4WY8A 5EKUA 3ZY2A 2QTMA 4CG3A 5HZMA 3BZBA 1YZKA 1N2EA 1RQNA 3O6VA 2AA3A 4A9AA 3KUXA 4YJ3A 2BH2A 4GGOA 3DO6A 3HQ4O 5B36A 2WUEA 1M8KA 4DG5A 1GZSA 4A2PA 2B2NA 2B6NA 4PQFA 4QJIA 1WABA 3EVCA 4BLTA 4Y9DA 1Q1QA 4L78A 2PA0A 4ID3A 2FPLA 4A0RA 3CCBA 4DARA 2NO7A 3K1AA 4OQXA 3UXYA 1LK0A 3HBAA 4WVFA 3RU2A 1TF2A 4HLQB 2HMYB 4HNGA 3IQDB 4MINA 2JIQA 4HUQB 3RAFC 2Y1CA 3NEYA 4PV7A 2BISA 4L0CA 4CW7A 5CYPA 2OHGA 3P0HA 2ZRBA 1K4MA 3BF7A 3VPAA 3HLTA 1VZ2A 2P1ZA 1MCZA 5AICA 5TVGA 3B1KA 2ZR8A 2R4QA 2WT4A 3PE4A 4K5QA 1J70A 1T9ZA 4B33A 5LOVA 2NNWB 1K98A 3DBRB 1GU1A 1KFKB 3OKAA 1H6AA 3A2NA 3OLYA 3JYLA 2BYTA 3PHIA 3ODPA 1A9RA 4BQNA 4U02A 5LZ5A 1NMYA 3IKLA 1ZOIA 4TTQA 4GVXA 3RS3A 4UTVA 3U7FB 2AC2A 1FX0B 1XQVA 2IU0A 2FWMX 3L1IA 3FYUB 3WLTA 4AMZA 3OFJA 4QDUA 2O05A 1R0WA 2VQEB 4L5CA 5ALWA 3KK0A 2VRWA 2XQFA 4BFLA 1JHDA 1C30A 1PJSA 3W7BA 4EH1A 5LKRA 2PS3A 3CZMA 5CDUA 1RWKA 1E8MA 2BSAA 2R6GA 3R0XA 3ZU2A 2C7RA 4B5LA 5CW1A 3DF7A 1UWKA 5F1OA 4OOEA 3HU3A 2GBIA 2PL1A 3TCXB 2QRLA 2RHBA 3GRCA 2C2XA 4WZAB 1R66A 2DE0X 4BTVA 4JLNA 4FU0A 4WY5A 4JBNA 3MHPA 1NQUA 1XTVA 3BE5A 3BFJA 3U7QA 4ZK6A 2APJA 1IB0A 1WXEA 2DBVO 4TKZA 5K45A 3TFOA 1CF9A 4LJ7A 2OLEA 2GVDC 2ZAIA 3A4MA 4KTTE 1CUWA 4ZO7A 5TDHA 4MO9A 3KYIB 2OD7A 4XD7A 3PUJA 1KI3A 1DAKA 1E32A 1XHLA 3DTVD 5EXSA 4R9VA 5HKOA 1FP1D 3BT7A 5BW5A 4N8SA 4RYLA 3JQFA 3I5UA 1Z47A 4MVWA 5E2BA 3KZXA 4CUJA 5AJTA 1CULC 4GZ5A 3TKYA 4QBHA 1Z8FA 1RVV1 2PT7A 3HPRA 3L7CA 3VYVA 3WSTA 2W98A 2DPXA 1U2TA 2DHEA 4G1EB 1P2TA 1QJ4A 2RGWA 2UZAA 1K7YA 3ABIA 1OXKB 2YZ7A 1UKBA 2R1TB 3WG9A 1U2EA 1DTWB 2X4LA 3QOFA 1DP4A 2G82A 2I8CA 3G6KA 1SIWA 2J5KA 1CJUC 2PMDA 4NHOA 5TB5A 3ZI4A 2GZRA 4EHLA 2DU8A 2FVYA 3PFFA 4KPFC 3K9WA 4PG7A 1J6UA 1YMQA 3A4TA 2X9NA 3QWBA 5PNTA 3MJTA 3LGXA 3KVVA 4WAUA 3DEYX 5KYNA 1HLFA 4V2UA 4BVAA 3ONWA 3TNDA 3V4PB 4I9NA 5CFRA 1UBLS 2AIRA 3AHCA 3H8VA 1QBKC 4X7BA 4OHBA 3T0GA 4X64B 4DDVA 2WJ4A 3LUCA 4AF7A 2XRZA 4DV6B 3WLFA 2X7HA 3HJRA 3VH3A 3O4GA 5DGHA 1XU9A 2WWYA 1H4QA 1I24A 4XE5A 2QLMA 1IM2A 1HZZA 1DDOA 4GR5A 4X65B 3FA2A 2XH8A 4E2WA 3AQ4A 1ZMRA 3GLGA 1ADCA 4RJLA 5IARA 2AKEA 4FYMA 1T8TA 1Y7IA 4Y1RA 2A94A 1OHHA 2WU3A 1HE1C 3ZJTA 2NU7B 3IVCA 2PMEA 3MOGA 4R1TA 3GLVA 1B26A 1EFTA 2CVHA 3HBNA 4M83A 2QUAA 1KH3A 2BFDA 1GZ3A 4P1ZA 3TLMA 2ATCA 5ERGB 3G3EA 2KPOA 3SZGA 1S2MA 2DETA 1EK6A 3FZYA 5KHAA 1E4EA 5BQ5A 2HQBA 5HHTA 1X7XA 2AYZA 4NOLA 4WK4B 2X3FA 1T3TA 2AK3A 3SEQA 1N36B 4IF4A 3TZ6A 4FFLA 2VIIA 2P4HX 2XVZA 2J3JA 3UJDA 4O1IA 1N7GA 3RRYA 3ZJUA 4UQOA 1UMCA 4XX1A 1MA3A 1AUOA 2ZCUA 3PGKA 2PUVA 2YC4C 3FOEC 1F9AA 1L5HB 3IKJA 4BYGA 1AK2A 2RHHA 3F5FA 3L8GA 1EFVA 4Q34A 4J2TA 4EBFA 1KETA 2EGHA 4ZT5A 4K6MA 1RAEA 1GARA 3IEXA 3U6KA 2WKWA 1CLEA 1AHHA 4JJZA 3D54D 2QLBA 2YMMA 4QYIA 1ONBA 4W5JA 2N1BA 1WCIB 3VR4A 2PBLA 4BO6A 3C6BA 2LKDA 3NIBA 5HRAA 2OPHA 5KYYA 2AFIB 3GOQA 3VAAA 3W8FA 1S2LA 1JJBA 2JLBA 4AWBA 5HS4A 4G26A 4PPFA 2WG1A 5IDVA 1RVDA 3CPEA 3DO8A 2GLTA 4JLAA 5I9TA 5ALVA 4EG0A 3QZUA 1R37A 2I4LA 1RBMA 2AMYA 4P31A 3WA6A 1KVUA 2G36A 2X41A 1N57A 1P91A 3KE8A 3OHPA 1C29B 2YYZA 1V2GA 2XDQA 1BJTA 2YDXA 3CLTD 4LHXA 3WFIA 2V0GA 2ACWA 4URYR 4L73A 3N0TA 1J90A 1QFSA 3B3QA 1UBTS 1OC2A 3LWBA 4FDUA 4M3NA 4OIFA 3QYPA 3ROZA 4UNSA 2PV0A 1L7DA 4CM8A 3QKSB 4EPRA 1J9ZA 5GTDA 4P7JA 5DNYB 3ASVA 5EZ5A 2H4YA 2R8XA 4IIYA 4MV0A 4XDHA 1LI5A 2P7IA 3C41J 4Y1FA 5BMVF 4OI2A 4X90A 3S5UA 5K0ZA 4HGQA 2VYVA 3D3EA 3KXPA 2UUPA 4ZJZA 3CEMA 5LUAA 3P7MA 1IEQA 1T9HA 1LXCA 4RBNA 5AMXA 5THKA 1K92A 3IJ5A 3OSZA 4OYLA 2B83A 4J0CA 4PRYA 3SBDA 5K03A 2WWRA 2VBIA 3AB7A 4ND2A 2INGX 3JQAB 3DE0X 4ZARA 3G1TA 1P6XA 1B2LA 3KKKA 1BDJA 2F1OA 1ARZA 2QP4A 2ZTSA 3FZGA 4HLUC 4RJIA 5D3ZA 4LDPA 1E2BA 3BMCA 4K81B 5F12A 1DUSA 2ZYHA 3IQGX 3LL4A 2QQGA 2GESA 3Q72A 1HYGA 4RZUA 3CM0A 2XA2A 1DJPA 2JGKA 4CNQA 1LA2A 1FYXA 1C9JA 3MMSA 2WBLC 4G1UC 5DZSA 2QAGA 2EKQA 2EP8A 1KEZA 1YGYA 4BNUA 3SC2B 3P96A 3PR3A 1WSBA 4LJ9A 4NYIQ 4MQMA 1CJTC 2IUSA 4Q3DA 5DXAA 5JWHA 3EPLA 3USCS 2BR3A 3WV4A 4ZU1X 3K0FA 3NB0A 2VF8A 3G5MA 3K70B 2JLYA 1JXMA 1O2DA 4KQEA 3UN1A 3BYZA 2WKRA 3FBWA 1MUUA 3OAAD 2OP0A 4HV4A 4BPBA 5C4GB 3HCPA 3VISA 3K0HA 4QRHA 5LWQA 4W9MC 3RYTC 1QCZA 2Y9MB 5BUSA 2QN9A 3K9GA 1F6BA 2C9CA 4PAWA 4AK9A 3N59A 3JQ9A 1JEYB 2RHCA 3V1KA 2ODPA 4EG7A 4PPYA 4ZGGA 5C7YA 2JFYA 1GU0A 4J0QA 2VK1A 3NHKA 4KRGA 4TKLA 3SCZA 1L5VA 4QEZA 1Q0HA 1T0HB 3O83A 1YOBA 3OCJA 4YXWD 2VBGA 1F51E 1H6CA 1WDMA 1E0SA 1Y1TA 1NI5A 2EKLA 3DS8A 4GOLD 2DY1A 4J0DA 1TAGA 4FPXA 4PQGA 5FTLA 1V7PC 2MMGA 1AGYA 3LF1A 3DAFA 3QUSA 4JYMA 2QDXA 4OL0A 3SEZA 4C29A 2ODBA 3WHPA 2O2DA 2R0QC 2CFIA 4C7OB 5F1PA 4WBNF 1NLFA 1DMRA 3GEEA 1KSGA 1W6RA 3VA7A 2HXYA 4UOZA 3PNSA 3E22A 5BSKA 2CNNA 5I5GA 3R3XA 5FULA 1Q19A 4U7DA 4HXFB 2HU5A 5G40A 1JEQB 3I9MA 1NZFA 1M1YB 1JUDA 5KTRA 3OMXA 1LKZA 1BKDR 3R8XA 4DDTA 3PKZA 5D7BA 3N86A 1Y1RA 3ZEAA 4M2LA 3KJNA 1PLJA 4BLPA 1VJCA 1KEEA 4KSYA 1AXEA 4BMDA 1K7CA 1YDMA 3H99A 1TZJA 1XZGA 2E4WA 3AI1A 4DQUA 4QXQA 3KQMA 1QGUA 2I6XA 1ESMA 1Z6AA 3OD5A 4V0KA 3NTVA 3EG9B 3OZRA 3QRWA 4KFCA 4KO4S 1SO8A 2DFKB 1PP4A 1YQ9A 3GLQA 3GEHA 3MBKA 1E1DA 2Y0BA 3R7NA 1GG2A 1U0TA 3V7UA 3PFNA 3H3FA 2ZI6A 1YL6A 3DFMA 3GFRA 3KZVA 4X7MA 4J1SA 4RF5A 2JVKA 3RUFA 3VR5D 3E5HA 5EE5B 1FFXA 2BCJQ 2ZIVB 1GAJA 1J97A 1MO4A 2GT1A 4ZHQB 3D2BA 2V45A 4ZVSA 4C2UA 1SVUA 1D04A 2QQFA 4ZI5A 1W8IA 1AMUA 3I1IA 3R5JA 1AKRA 1BAPA 1JR3D 4BU1A 3U9SA 5AVQA 1PSZA 1HG0A 2WKQA 4KDCA 1WXGA 4RA9B 2EFEB 2SCUA 4CL2A 3ZVKA 3LX5A 4BC0A 2XUJA 2OL4A 3D3QA 1QAQA 4JQOA 1CR4A 4Y2RA 3D1LA 1ZPDA 3T1TA 1JFLA 2CB0A 4Q37A 4RQUA 2AD1A 2H85A 2VPWA 3NH9A 3MJDA 3U62A 2FSIA 2IEGA 3LXMA 4G0WA 3UHFA 3VPCA 1EWQA 3ZWQA 4E08A 2X8JB 5LNK1 3THXB 2WUFA 3VTAA 2PWPA 3W5IA 1Z3CA 2AMVA 2EWMA 5U4QA 4B87A 2AOUB 5FRDA 3UO8B 1ZRSA 5ICEA 1CP2A 2HKIA 2MOKA 3C1AA 4AVYA 1ZKDA 4A73A 4ZVPA 3QHPA 2W9XA 1IXRC 5LDHA 3PCTA 3E9DA 3CTMA 3NORA 4WBSA 4W63A 4CR7A 1G38A 3GVCA 4GLBA 3EZNA 3DOHA 3KG2A 4PG4A 5AOVA 3UYKA 1SWWA 3VAZA 2HMVA 5K3DA 1YL5A 2VYQA 2V5VA 3LQYA 1NP7A 2RD2A 3HUEA 4A15A 1J9EA 3TIGA 2F3UA 4MWZA 4EHIA 4LDAA 1C3XA 1V47A 3LCUA 2HJHA 5JEEA 5JDCA 5DM0A 1VPWA 1B6RA 1M8PA 2H1IA 2O20A 2P9CA 5GJCA 1A2QA 1K9SA 1DWOA 3QH4A 4UBNA 1GY8A 3BK2A 1AZWA 1LLUA 3A31A 4I1RA 2BW0A 4G1FA 1UMKA 2VNIA 4ZXPA 1WZIA 2CFCA 2BEVB 3G2MA 4IYJA 5TQVA 1Q0PA 4FHFA 2AWOA 4P4GA 1KE2A 5KJFA 3MAAC 1OKKA 1T2VA 2VHVA 4M9SA 2J9FA 4RV9A 4ZAWA 5EP2A 2IWRA 5REQB 4BNTA 5CTJA 2W4MA 3UBMA 2XRYA 2V55B 1JFFB 3GBVA 1NN1A 3CU5A 1MEOA 1E64A 1Z2EA 2OK8A 4GG1A 1E3MA 4FGJA 2HADA 2VSNA 4I55A 3W6OA 1Q95A 3PGLA 2IU3A 5GM2A 2HMSA 2AEFA 1Y3BE 4RGQA 3NBAA 5F4ZA 4J0IA 4G5GA 2YRFA 3S27A 2WP0A 1EUCB 4AF6A 1UDWA 1ESEA 2GAAA 5KHOC 1UDBA 5EXTA 3VKGA 4ASUA 1BHJA 1Y6JA 2WE8A 1V7CA 2PH7A 2XUZA 4E11A 3K31A 1GXSB 1JTEA 1AB6A 1QPBA 2XGMA 1SXHA 2X58A 4ALKA 2WHYA 2F3SA 5AVVA 2ZB4A 1TT5A 4IGFA 1KH2A 2QVXX 3BXHA 3G88A 1R4MA 1U7OA 5JQGB 5CB4A 1HFJA 4Y7CA 4PHGA 5IDYA 5ALXA 1QB7A 1V8OA 2EARA 2I33A 2GJ9A 4UZFA 3H1FA 1N3IA 5AOAA 5KOJB 3OTGA 4YAOA 3I52A 1JG2A 1DJOA 1W19A 3GLIA 3GZ4A 3VR3D 4DM7A 2GPJA 3W4IA 2GH1A 3G2LA 1Z7BA 4Q48A 2ZRNA 5K0FA 1I1OA 5DGXA 3M3DA 2QRZA 2ZSFA 3SX2A 3QFRA 3WB0A 4QULA 5IZCC 1EWTA 3IQHX 5FBZA 1RAHA 2XGGA 3R7AA 2IOFA 3GCWA 3QVUA 3RYHA 1R5NA 2VSYA 1BVUA 4IO1A 3UF0A 4Z0PA 5FUYA 2WYUA 3F3MA 1RQXA 3PR1A 1DINA 1NRWA 2GTPA 5JAOA 1Q20A 4DAEA 3EDYA 5AW5A 1BYUA 3SLKA 2TECE 3LECA 4IDOA 1LFDB 4PNZA 5DSXA 4AJJA 2HCFA 1A69A 2WFLA 3I9JA 1TU0A 2CXRA 2IDJA 1O9BA 3AO0B 1ZLXA 4Y2HA 2PRZA 1C8KA 4BNLA 3K6RA 3UG7A 1G64A 1L4BA 2PR7A 2V0NA 3DDCA 4WK6A 3VGJA 2EL9A 4EWLA 3W3ZB 4LIPD 1OFTA 5F9MA 5L6LB 2YWGA 3OQIB 9ABPA 3QVWA 4ARZB 3KX2A 1XTJA 3QTBA 4UMFA 4PX3A 4IWNA 1HORA 1DXQA 3MT9A 4BIIA 4EVRA 3A9SA 2BUCA 1XGKA 3GVHA 1KFEB 5KNBA 4TTVA 2WIAA 4RSHA 4TL6A 2D8AA 2AFIE 4KR9A 4EG1A 1RMTA 2C7PA 1V9SA 4NYJQ 1LV7A 2AUTA 2KHZA 1RJ9B 4H7IA 4AMYA 5FJJA 1BMTA 3L4SO 4BO1A 5JYDA 3WGIA 1U4OA 1U9ZA 2PX8A 3JD0A 3NTQA 1DXYA 1LBQA 3K1JA 3LDFA 4XUEA 5J5VA 5K4AA 3GJ3A 2XUPA 4QAQA 1DWQA 3TNFA 4DY6A 1KC1A 3V7FA 5GMOA 1UJ5A 5JNTA 3VOTA 3VR5H 2W6ID 3KZKA 4B8ZA 3ZDDA 2EW1A 1GVNB 4ZQCB 1QGYA 3GLRA 2OAGA 4JITA 5AW7A 2FR8A 3M82A 2VXOA 2GJKA 4G5RA 4QTUB 4V03A 3PB3A 5L95A 4EJMA 2X8LA 1CUAA 4HAWA 5ITVA 5JE8A 1FTYA 4CIWA 4D45A 3TIIA 4F8EA 1AM4D 2QZZA 2CMKA 3TJZA 3OQOA 1L7MA 1U7UA 2QM7A 4I9HA 1XLUA 4LSWA 2ZXEA 4MQ6A 4NDNE 4FI3F 4LWZA 5DSTA 5DTIA 2ZIWB 1Q14A 3ICVA 4DUYB 1FX1A 1KDVA 4JI4B 4NCAA 4KNWA 2R8OA 3I9OA 1KDZA 1JKMA 1XLTA 1X9GA 1ZCJA 1DCKA 1GTSA 2V3CC 5UKDA 2X1HA 3LY8A 1UMDB 4OMCA 1MO5A 1GQQA 2G1JA 1QLJA 3COSA 3Q7RA 2G0NA 3GEDA 4LWPA 1EYZA 4TKUB 5EP3A 4E31A 2UKDA 2HJWA 2P40A 3R6DA 4A8JA 3IAHA 3KYCB 4MAMA 5LJIA 4Q1FA 3DZGA 4LN1A 2ZIXA 4NBKA 4RF4A 5LYJB 1RLJA 2NXEA 2WUVA 3C87A 3WWCA 1JA0A 5C52B 4XYBA 2IP4A 2R6R1 4M6WA 1T5IA 3OOSA 1R18A 2XMZA 1SOVA 1O6CA 3C39A 3M1AA 4O4IF 2OD9A 2WHQA 1SJ9A 3MWEA 4CIAA 3I9KA 5KWJA 2W93A 1IJBA 3FTFA 1E9VA 4XR9A 1Z39A 2KWIA 1C1HA 3IVMA 4C4XA 6GPBA 2HA5A 1NW9B 8ABPA 3ZLVA 2JAUA 3PTLA 4TMVA 3E15A 1QIHA 3ECCA 3LF2A 3W34A 3LCJA 5BR1A 2EYQA 5D6OA 2PBZA 2VCEA 1CJCA 2ZI7A 1C3JA 1GTRA 1T4DA 2TRSB 2W58A 1WB9A 1GRVA 2PMKA 2C7QA 2X7XA 1VB3A 1PTJA 3KQLA 3SQLA 1QBGA 2IBMA 3NX4A 3NW9A 1YA6A 1IEXA 1T8PA 3UJCA 1X2EA 1GLNA 2YN2A 3BJMA 4IIGA 4F7WA 1SM4A 1OILA 2C99A 3KC2A 1XMXA 5FO1A 4JOCA 2BGUA 1G20B 2PCLA 3E9YA 1D4AA 3SMVA 3RAEC 3SVZA 3L79A 3C7CB 2C2OA 2BPOA 1NWHA 4YMLA 4FM9A 3IMCA 4AO8A 4G2TA 1NF8A 4TT8A 1V9CA 1E66A 1XTKA 3LQ1A 5IW8A 5K8JB 1M1YE 4GXQA 1BX1A 4OLBA 4GPZA 5AKHA 5FKJA 3CLTC 4H59A 2FWBA 4PRZA 1G63A 3S7ZA 2PGLA 3W6ZA 2CEKA 1VDMA 3G7SA 5ED4A 4NZZA 4CF5A 4H4DA 4CQMA 1YBHA 5B2FA 2R11A 3AYZB 2IUYA 3AGPA 2GAOA 1ISHA 2HBQA 4XARA 1NVTA 2JZCA 5HP4A 1AS0A 3I4FA 3RGWS 1D1QA 4MJ3A 4R2XA 3KALA 2X4IA 4UM9B 1JMYA 1KEWA 3UT5A 5B58C 4ZHQF 1TB4A 2J4CA 1CD5A 1Z2DA 3GH1A 3T7CA 3JYNA 1P1JA 2GNOA 3DZBA 4I8IA 1BN7A 2VRNA 4KN6A 1E6UA 4O2BB 3TQRA 1IWPB 4M60A 2AC4A 2EX4A 4JU8A 1TJ3A 3GV0A 1XZJA 4A92A 4J6FA 3OZEA 2NGRA 1DJLA 2PD4A 3SYRA 3PC4A 1IBSA 3IDQA 1MIHA 2ZJ3A 1E7YA 2IXFA 4I9UA 1F6WA 4M4SA 1RZRD 2PUHA 3UPTA 3L3BA 1USUA 1MA0A 1PBTA 2NU6A 3K16A 5C7IO 2OGSA 3V9AA 3PL5A 4ZGWA 3UMYA 4JJIA 5ALZA 4D8XA 5J2UA 2Z1NA 4N9QA 1B93A 3HXTA 1G41A 2IYRA 2QS9A 3E4CA 3KL2A 3NC0C 4NECA 4OMFG 2DEUA 5FDFA 2XKJE 3HJGA 4GXTA 1GSIA 4FILA 4I99A 4RFLA 1W4BA 3TI7A 1LJLA 3VXKA 5CYGA 4D25A 3WLIA 2QMZA 3A0RB 1ECGA 3ESRA 3UUGA 1JRLA 2I6TA 5BNTA 1DOAA 5LZ7A 4JSRA 5EUQB 1D6SA 4PLCA 4D92A 3HDVA 3DE2X 3CE9A 3UICA 1ZK3A 5J4YA 1UANA 4P22A 3M4NA 4F1JA 2BTQA 4RD4A 1KEUA 1KRHA 4R2KA 1GV0A 3CIOA 4XLTA 4GRAA 2YOHA 2PMFA 6ADHA 3C3DA 1ADFA 13PKA 3FLEA 5FOTA 5DX0A 3H0KA 2VEDA 4IXWA 4BWFB 4EVQA 4R0VA 1TRHA 3FFBA 1LPAB 1Z83A 2R6ZA 2IPLA 1G59A 2GNAA 1MNAA 3NHFA 4PO9A 2BEWB 5AXBA 1WNFA 4H08A 3A3YA 1IY2A 3BE8A 4IZHA 1J8DA 4M1ZA 4QOIA 1HSOA 4MEBA 3ENZA 4YAWA 4ISBA 1ML3A 2HRDA 3MGGA 4XDGA 4BB6A 4NSNA 3F67A 3ND7A 3TW8A 2OHOA 3UH0A 1FP6A 4DYDA 2R8YA 5FL7D 1THMA 2QYOA 2EW2A 4BXOA 2PU5A 5DSZA 1SNYA 5F1YA 4QZVA 3KV3O 3QUTA 1E1RA 2R6CA 3WXBA 1D6JA 4C0XA 3C1UA 2DBZA 5CHYA 1IZYA 2ZSHA 1NUUA 3DFUA 3JD2A 2FU5C 3I04A 4KIFA 5ICMA 1XCLA 3PEWA 1E8DA 2QYSA 4D74A 4MV4A 5E2AA 3VNQA 2BFOA 2I9KA 3NIWA 1EFUA 4OB7A 2J3IA 5EFOA 1OXMA 3MG9A 4YT4A 3CSUA 1Y6ZA 1C0LA 2C7GA 1MNQA 2VJCA 4QUAA 1QZTA 2AC7A 3P71T 4PM4A 3GJ8A 4ZYLA 1C81A 2VP3A 3T1YB 2FAXA 2PL3A 3CUEF 3R5TA 2RJ3A 4KKXB 5HJ2A 1NVFA 2GCPA 1DCMA 2PKQO 2Q46A 5GJVC 4TMZA 4IGEA 2Q5EA 1U2DA 1D5WA 4PGGA 2H1VA 1P4HA 2FWPA 3EEQA 4B71A 4CMJA 1R0CA 3VX3A 3UKOA 3OIUA 3RIYA 3GROA 5AI0A 3E27A 2A1TR 4M22A 2FZVA 3DBLA 4DIMA 3H1GA 3OJWA 4Q9HA 3T0IA 4DSUA 1UDCA 3NAQA 4C4YA 5DNCA 2W7TA 4JUDX 1SQ6A 4HR7A 2IX3A 2Z6UA 3LRXA 1F8GA 5JQGF 1PZEA 1QZZA 2LXNA 1LPPA 4PINA 1CRQA 2DPYA 1U0BB 3GJ4A 3OZXA 1YQUA 1BGWA 1U80A 5HKLA 1KSFX 3I32A 1NTOA 1OYOA 2OPBA 3NWOA 2E6KA 4FDVA 2J3EA 3B9PA 4IOKA 4D9FA 4DV3B 2WJZB 1DHTA 1WZUA 2FG7C 2W37A 4QODA 3IKTA 3R8FA 4HK4A 2CVQA 2XCLA 1LVGA 4C04A 1UT5A 5CDSA 3ZVRA 2BHLA 2HA3A 4KP7A 3BB3A 2GILA 4TVKA 3ZKAA 2CNDA 2O9JA 4DJAA 2UYYA 1CIVA 3BTSA 5JXHA 1JECA 2O8NA 4LZOA 1GZHB 5AIAA 3GO4A 3Q9UA 1RQRA 2NAFA 1L7BA 2J08A 4PSKA 4D8YA 4C4TA 2WMNB 1A1VA 1HNXB 2D6FA 4JJKA 3MCVA 1XUOA 3LHKA 3WWDA 1KQFA 3CONA 2QZPA 4B85A 5FLYA 3ACCA 4X7RA 1T10A 1NE2A 2QV7A 3DHEA 1O0CA 2QGNA 2X5JO 1JV2B 1KYQA 3JR3A 3M6MD 4Q4CA 1XELA 3F9CA 2RGRA 1GGFA 3CRNA 2XXAA 3HYCA 5C34B 3RG8A 2ALJA 5JCJA 4GPD1 4E6EA 4EVIA 3UC5A 5CD9A 4PCUA 1AG9A 2VYND 2WIBA 2OGZA 3NAMA 2AX4A 4BJ3A 2X14A 1XP8A 3PYLA 2IOYA 1RYZA 4IR7A 1R1DA 1YJ8A 2A4KA 2R1VB 2YW9A 4LXYA 5BYJA 2WVAA 2ERYA 1EFVB 3BA1A 2KMLA 1XRJA 1CQJA 3OH8A 4BNNA 3JYQA 2DR2A 5CHEA 3C8DA 2GXSA 3FSRA 2YHAA 1MPTA 3BIJA 4Q4AB 5FAXA 2F62A 4DUGA 3JYHA 2WAOA 3BK1A 4YWHA 3LX8A 1ID8A 1PUXA 1DUIA 1FTSA 2WSIA 4XOUA 1MO6A 3IBYA 3N05A 2HNKA 2QN3A 1ZOPA 2OCLA 4BNGA 1BKSB 2BI8A 2YJ6A 1JFSA 1AT1A 2F9FA 2DF8A 4LS3A 5AM1A 4C0QC 2OAEA 1AKQA 4INOA 4BQPA 1A5ZA 2DR3A 3GGCA 4E7OA 3NGXA 2XOXA 3IAM6 1V7ZA 2BFNA 3CRRA 1MGPA 3HVKA 4MULA 2JCBA 3WRYC 1M2FA 2DFDA 2ZIEA 3L8DA 3EIOA 4J7UA 4LFBB 2HNAA 2QL7A 4KK3A 1XU7A 2QR5A 1T4CA 2O5RA 3QBVA 5IM4F 3P0FA 1BRMA 5HTOA 2ORYA 4Y6PA 1I6MA 5FI1B 4MW6A 4F4DA 3I01M 1SKQA 2X1VA 2Y8EA 1SUWA 5F3WB 4I4TA 1V5FA 2O14A 2AF4C 1XPOA 2WF8A 2F4NA 1KI6B 3CO5A 3IBTA 4LXTA 2HSJA 2M6SA 3DKPA 1W52X 2D5AA 2BJVA 5IJ0A 1CW2B 2J6CA 1U9CA 4JJFA 5I4BA 1PDWA 4G3XA 4EB3A 1SCKA 2VZLA 4EGFA 1B6SA 3RWOA 5CAEB 5CR9A 1WULS 1FRVA 1SPBS 4OJMX 3ZGNA 5GAJA 2ZKIA 4ND8B 1U2GA 3NHRA 4EHNA 4EJ2A 5D7NA 2YIVX 2GMWA 4HDCA 4Q4DA 3FJ1A 4R51A 1QHIA 1N0HA 1QP7A 4TQGA 4R8RA 1T8YA 2ZUCA 4U2FA 5BVGA 1Y7LA 4DMHA 3BMCB 3MSXA 4LGYA 3ZWXA 1Q17A 3ZUPA 4YJDA 1XEWY 1SHKA 1GT91 2VPPA 3IXLA 1PS8A 3J80A 3B36A 2L42A 3ZS9A 1OIXA 2RHLA 5LYJF 2OMKA 2QIOA 4GZMA 1YRBA 1OTHA 2YQ5A 4GQBA 5TPWA 3D8BA 3W1VA 1M1NB 1SVKA 2Y6VA 3LCMA 2SKEA 1IVSA 2PGJA 3VNRA 2V5UA 4N3NA 4WKGA 5BN5B 2VDQB 3RVNA 3LLSA 3HCWA 1N9ZA 3VVBA 1UWLA 1FY2A 1VL6A 2PFSA 3DFIA 3EGOA 1EK2A 4JD5A 3VOBA 5JXWA 4N41A 3VNVA 1NNUA 1J0EA 2GGSA 3CCFA 4PAGA 2ZUDA 3CUYA 1L7EA 1J2YA 1AO0A 4HNTA 3STHA 4TT3D 1LBEA 5E6UA 5JATA 3DEFA 2FE1A 2VDUE 3AV3A 4X91A 1Y9ZA 3KD2A 5DHPA 3KJIA 3DM9B 4FN4A 4R7ZA 5DLPA 4DIDA 5IFLA 2P35A 2F1KA 2JAPA 2ZJ2A 1AKYA 4MS4B 4JMPA 3P0IA 1R8YA 5A05A 3NANA 2GDJA 3IR6A 4KGVA 4MEAA 3W9YA 3BJEA 1HQYE 4EG8A 2XNDA 1VRCA 2YBDA 3FPLA 2C77A 5KU7A 2RGNC 5MGBA 2Y1GA 1YRQA 2VC2B 2W43A 2WPDA 3GWZA 5AM5A 4QPJC 1C2YA 2YVLA 5BRAA 5JI2E 1QAMA 3P0EA 2H4HA 3HCEA 1QZUA 3AKEA 1FP4A 1CS4C 2BM0A 1TCBA 4B8WA 1K2WA 2RKBA 3OZFA 1LI7A 2OV8A 3P4UA 1PQ4A 2O3RA 5M04A 3AERA 2IRWA 2P0AA 4B6RA 5L3QA 3PJEA 3BDIA 4RHUA 4XGIA 1URPA 3IPLA 4Q7KA 4HATA 2W2LD 4BLRA 3F90A 4X54A 4ZGBA 4IZIA 5EY5B 3CW2A 4IGKA 2AN9A 2PVPA 1D2GA 4IUCS 4Z0HO 4OUKX 3OPMA 1O95D 2QM0A 1P6QA 3Q88A 4XIFA 3G0HA 3PC8A 221PA 4IINA 3PPYA 4PC6A 2HUPA 2VZEA 1BD3A 3L6BA 4GSYA 4A2WA 3I2HA 1QHSA 3I9V6 3O2QB 3R24A 4U9HS 3QKRA 5AIBA 2F43B 1QGUB 1Q1ZA 2LRHA 5J40A 1JEEA 1EZZA 1KMHB 2W6ZA 4D9IA 3VPGA 2FCRA 1C0PA 1DSSG 5CDFE 4E5NA 2ZSBA 2A0WA 3S1LA 1UADA 3HJNA 4XYLA 2YOFA 2ZFUA 3IMFA 4GOND 3SR0A 3ZCVA 4YRIA 4AQ7A 4JN6B 2QGZA 3DOFA 5L7TA 1O96B 3KL4A 4JASB 1YFLA 1PV4A 4O2BF 1KVSA 2JI4A 4B7ZA 1FFXB 1U31A 1UAGA 4ZEMA 4H7HA 3KT6A 3GY0A 4JDUA 2ZBQA 4QE3A 3HVIA 3JALB 4DCMA 1SXJC 1AN0A 3L7BA 3B6IA 1PJTA 1QS0A 4CF7A 2X42A 4LZWA 4CIXA 1X86B 2HXGA 3VZPA 3ZD8A 1M2WA 4IG9A 3THYA 1W36D 3IOCA 4NCIA 2PUBA 4C5AA 2R5NA 4G0QA 3L4JA 1HE5A 4TMWA 4DTIA 4G9EA 4ARSA 4CR8A 1GZ4A 2CLCX 3WWPA 1TD9A 1Z74A 2C4WA 1KL7A 1XN1A 2OBXA 2PVSA 2ZREA 3ZWYA 3CBQA 1H4TA 5LD2C 4C14A 1M10A 3W5DA 3T38A 1JKJB 1J09A 3Q7PA 4HQNA 4N6GA 1VSVA 3H5NA 1PJCA 2OZEA 2XMDA 1V45E 3L8YA 3GGJA 4IVRA 1TUEA 1MORA 2VHCA 4ZVLA 4ER3A 1QQAA 3HR8A 1K7XB 3A2MA 1ISIA 1ACLA 3QSYA 4EJFA 4R1OA 2JLRA 4YJKA 1KKUA 3MC1A 4DJDC 5A0FA 5L3VA 3ESCA 4HDOB 3ZE1B 3HYNA 7MHTA 1N6PA 3LC7O 3VFDA 2LUOA 4ZK2A 1C3VA 1QGDA 2C0CA 2A57A 3LPAA 1CEXA 4MWTA 4X61A 3WDSA 1AHPA 4L95C 1N1EA 1PD1A 3TSCA 3CVXA 1LW6E 5FP0A 2W6OA 1FYFA 4KFRA 5BQPA 4QKQA 1PWXA 4UE3S 1I01A 2XECA 5KKNB 3D6JA 3ILSA 4H60A 4D4LA 2J0QA 2QW1A 1XTSA 3UAOA 1QQ5A 2M6RA 2PO5A 5KS2A 3GPLA 3GC6A 1G9TA 4FLFA 1COZA 5CDHA 2C3YA 2X8WA 3HZZA 1I7SB 1WBDA 3FWHA 3JQBC 3AB3A 4DNFA 4FOLA 2WV9A 3UW1A 3VZQA 4E2XA 5D3MA 3ENNA 2YJGA 4QA9A 3TQSA 3EQ7A 2DCUA 2EGUA 4UATA 1KOGA 2AD5A 2BR5A 3KLNA 4NCKA 4OG2A 5C1OA 1R00A 4ARAA 3HVJA 1MB0A 2NSJA 3NFRA 1E6WA 1AQJA 4OL9A 1KIMA 1NLUA 3P9SA 3JVUA 4QBTA 3WQBA 3UUFA 5AKGA 3WYGA 1JQEA 1KDPA 3IRUA 2WYIA 1YB5A 4GU5A 5E6RA 2AB0A 2V8OA 1RJWA 1J07A 1CNEA 2Y0CA 3GLKA 4FS3A 1SELA 4HEA6 4HQKA 4DL9A 3ZWDA 3DXZA 1H9CA 4Q66C 1GLGA 1U4NA 3EIHA 4IO0A 3HEAA 4IX9A 4MP8A 5HXAA 4U2DA 4ZOCA 5CW2A 3SS7X 3NBQA 4MW4A 2OY0A 2R8BA 2VDPB 5EZQA 4LX8A 2GYVA 4FOOA 3MTAA 1ZBDA 1J23A 2FZEA 4HF7A 4J16C 5E9WA 3D8RA 1AS3A 3S55A 1F60A 3R77A 2XMQA 2CJYA 3TI9A 4UPEA 2CUTA 5EE1A 2GKGA 3EEFA 1E2UA 1NJ6A 5CPFA 2EDCA 2JLCA 3GQBB 1YZVA 3PLAE 1N6RA 3FGNA 2IYTA 1S1MA 4BFVA 2UZ0A 4RF2A 5I6DA 3NAGA 4L8WB 1AQNA 4QXRA 3P32A 3UTCA 4OUDA 3DQZA 3HU2A 3TLXA 3SIXA 2QVBA 2XITA 4D9NA 2V9PA 5HWSA 5T6MA 3CZAA 4I2NA 1K4KA 2HWWA 1R4MB 3H1AA 5ANRB 1J1IA 3AEQA 4M1WA 5ADHA 1DTEA 5EWMA 4MVCA 5FBKA 2VSFA 5IWCA 4MMXB 1W5FA 2C0QA 3K4PA 4RMIA 5B7GA 3ZVNA 3O93A 3KDAA 3TAXA 4Z1MD 3GLIB 2IHVA 4YJ2B 5KAMA 1MTZA 1TO1E 5ECGC 3L18A 3WRXA 1DFGA 4CLOB 3P2YA 1T6NA 2YQZA 5KC9A 3ML1A 2GFIA 2Y92A 3DDHA 5F73A 1V43A 4DLAA 3UOAB 3N75A 1SXIA 4LPKA 4Q5IA 3V7YA 4ZIRB 4RVNA 3VU9A 5E8RA 3FYSA 2OM2A 3R0QA 4DUPA 3OX3A 5GZ3A 4OGFA 3ERCA 3WZLA 4EPVA 5BN3B 4CV1A 3L8HA 3LPNA 3UMRA 3RRFA 1RFGE 4JZKA 2NT4A 2PUTA 5AW2A 1W87A 1R0LA 3D3NA 4HHEA 4UM5A 3IPCA 4BJ5A 5JZOA 2QRGA 1NUHA 1W93A 3WMXA 3F74A 1U8UA 2ZRLA 3CSDA 1FDIA 1Z15A 4X1OA 2WFLB 2VOJA 3KWLA 5ALHA 1PNRA 3LNCA 2VJYA 3MINA 2LPMA 3JQGB 3P2JA 4FS8A 4MK4A 3W05A 3NHJA 5ADUS 4BQQA 4OJTA 5BT9A 3E7WA 3QA3E 2JZOA 2IK8A 1ISFA 3R9KA 3G1WA 2J9RA 2UYCA 2EWWA 4JVLA 2FB9A 4MUJA 3URMA 2BHSA 4E1BA 1C7FA 3H6KA 3SJUA 1VPDA 4RD6A 2ZTHA 4GZ6A 7YASA 2QR2A 3B51X 3ORYA 4Q82A 4QTTB 4Z99A 1O77A 1R4AA 5D5PA 4AROA 3GRRA 2AQIA 5IKXA 3AI3A 4GRDA 2GD2A 4P93A 2IDKA 4EO9A 3BRSA 5H9VA 3R9WA 1NQXA 2GPSA 3PK0A 4F4FA 2CZQA 1B16A 4KX3A 3C6QA 1R4NA 1DKNA 3KZMA 1BOFA 2IFTA 2RGCA 2RARA 2AS0A 4MCIA 2UVPB 4F2WA 1DAFA 1E0JA 1CY2A 3D3WB 3EJWA 1E59A 4EB6B 4GMKA 1DWPA 1IZ7A 1TPYA 3H2ZA 4D4KA 3RVQA 3EVBA 4ZOAA 4DIFA 1CEEA 2UXBB 4EO4A 1CIPA 3H83A 1E9FA 3IKVA 2ZPUA 3FNFA 1KYWA 3IQFA 3NTLA 4CKBA 5JC8A 1QIJA 2QT9A 3I05A 3OE1A 1XEWX 1SKUA 1G7CA 1X80A 3VR2D 1SKMA 2YNMC 3O74A 4NG4A 4CV0A 5K20A 2LGJA 1N2IA 5GY7A 1U2SA 4EGCB 2J41A 5K3BA 1CUIA 4G0VA 1OZFA 5FYQA 3KXIA 1F1JA 2A88A 3EC7A 4GD3Q 4LRXA 4P7GA 3K2QA 4YEDA 4NR0A 2FKAA 2XMRA 1X1SA 2PX3A 4YYZA 1EX6A 1YVEI 3HJAA 4ZCIA 5LSAA 3DNFA 4CL0A 2FOXA 3DONA 1TZCA 4CZ2A 3C6MA 2QTHA 1X94A 3CUTA 5DF1A 4BQSA 3T7RA 5CFQA 1POWA 4RY2A 1L2TA 4RH1A 4ENQA 4MQLA 4Z4EA 2EERA 1MPXA 4XEHA 4QWWA 4ZALA 3JASA 2O3TA 3K30A 4ESOA 2Z95A 2D00A 5CNKA 4FOSA 1LRLA 1RRCA 2NZXA 1FZQA 3HLKA 1E0DA 5IT0A 1U28C 2DPMA 3EODA 4UTRA 4DV7B 3AEXA 4FYKA 3ROGA 1Q1NA 1Z8HA 4PFKA 4C0HA 5AJHA 1RCUA 5DHAA 1EJ6A 2ZIXB 5DX8A 3IT1A 3LUPA 1OH8A 4RFSA 2ZUTA 3X1ZA 2Q4TA 1FBTA 3PTZA 2IP1A 1TCCA 5T7BA 2NMVA 1FFCA 1LLQA 4FB4A 2JS7A 1XX6A 1RACA 4KB5A 1O0BA 3KFLA 1TO2E 2XSZD 2J3LA 3KVNA 5D87A 4KLCA 5DLEA 5EKDA 3U0VA 3U9TA 3I4LA 5HJ5A 3PT5A 1CRPA 4JH0A 3DCIA 2Q2WA 1SD2A 1DLIA 1VLVA 1GZUA 3UAZA 1XKQA 1YS7A 3N6RA 4B4UA 1NY6A 3G8DA 3LXRA 3DDSA 4J3NA 4Z1OA 4MIYA 2ES4A 2VPZA 2XX3A 2KE5A 3S2ZA 4MVJD 3UK7A 3A6JA 5AI4A 2ONYA 2D13A 1KO5A 1Q0RA 2QQ0A 1E20A 4Q02A 5FLXA 1JTFA 2W2NA 5KTPA 5KC8A 1FC0A 1ICIA 3PXDA 2KSQA 2X22A 1U0FA 3FUTA 3QIAA 1Q83A 4GRIA 4YDSA 3JY6A 5DISB 5CVCA 2RAFA 1Y3IA 4LJYA 1T4BA 1Y8CA 4OLFA 4XJXA 3DA8A 2BJWA 5GIOE 3D7LA 3HKCA 3PV0A 1QHFA 1Q3TA 2FN3A 2O2YA 3T6KA 1PRYA 4QVIA 2B2XA 2XGJA 4XKJA 3MLAA 2VYFA 4CLEA 4N48A 5JOQA 3P2KA 1EFCA 1GFSA 3NASA 3OCWA 1UBHS 2G4VA 2Z08A 1KVTA 4KLNA 2MYPA 5ABPA 4Q05A 3RVJA 1WNTA 2ZBEA 2PX5A 1AB5A 4YAKA 1FUIA 1UPXA 4DIBA 4GUAA 3CRW1 4J4HA 4FWBA 4V39A 1OGIA 3SC4A 2FG5A 3FGOA 3HRKA 1CR6A 1DAEA 3DJYA 2ZRAA 2NO4A 3CXUA 2EFCB 3KEQA 4UJ5A 4C5BA 1OVMA 2B92A 3HA2A 1BIFA 3X2FA 1UZNA 3Q8KA 1KJQA 4UEQA 1YRLA 5DI3A 3SYTA 1WPQA 1KWGA 1DKMA 3RSZA 3NKVA 4D3FA 4R84A 2FRDC 4IJ6A 3UK6A 2IXDA 1Z5PA 3CWCA 4QHTA 2CYCA 3UT5B 4EX7A 2IJGX 5BN1A 3OETA 4W6ZA 1BCRA 2ZBFA 3F6YA 2VK2A 4YQYA 3ICCA 4GKVA 5FWDA 2RH5A 2JAQA 4AYTA 4C3OB 2HMUA 5B1IA 4JXZA 3P4YA 4I66A 2ZVQX 3RJ5A 1JJFA 2IQIA 5CEEA 3T9FA 4PC3A 5CGQB 1YH3A 1QYDA 1O5OA 2B1IA 4KE9A 4KBGA 5ALGA 3CN7A 1AF7A 2NLOA 5C7LO 2NU6B 3AF0A 2HCJB 3RFXA 3NDRA 5HX7A 3LFTA 3ZXXA 4WACA 5D5HA 3S2SA 4AXBA 4C7VA 3FVWA 3PSAA 3ROKA 4RM2A 4EOGA 4Q7QA 4MB2A 1IY1A 1CG6A 5B3JC 3UBTA 2BF7A 2PEYA 2Q3FA 1Q74A 2CL5A 2HYDA 1Z29A 3JVEA 4MUGA 4DT1B 5CYOA 3G2OA 3KQSA 4CMKA 5LDGA 1ECCA 3K5IA 4IV8A 2W0SA 3QXXA 3VX4A 3WADA 2VA9A 2R96A 1G5FA 3R3JA 1J5EB 2OOKA 3OCYA 3UEOA 4DMCA 1HYEA 5P8WA 4Q9LA 1N32B 3DKIA 4JJGA 4AMUA 4C07A 2BTQB 2C9BA 4TQAA 4LTMA 2FR0A 1WCV1 3AHDA 1UP6A 3FYTA 3GRVA 3NT5A 4O0MA 5DRTA 4XUGB 5IVDA 3ZU5A 4AUNA 4PICA 1NGSA 1OH6A 1SD5A 1GG8A 5ALMA 1KERA 3EXHA 3GFBA 4QWMA 3HUTA 2R84A 4PSUA 1VE3A 1EX9A 1N2CB 2O8EB 4HC4A 1KJWA 3OE7A 1P60A 5FOXA 4CPDA 3T7IA 5FV4A 2OZLB 5DLDA 4RK7A 5DMXA 5ER9A 2BMWA 2VP6A 3C3MA 4UHBA 2FPIA 3NDIA 4PHHA 5DCLA 3EAQA 1Y63A 1Y7HA 4HDKB 2ISSD 4UXIA 4RSGA 4GP7A 4BNXA 4V0RA 2EBFX 3EC1A 2C54A 3FMIA 1B1AA 4U6NA 3V3TA 3VUFA 3C5VA 2I7CA 3F4BA 4CM3A 3E35A 4ZD6A 1PUIA 3QPDA 4X20A 4CI0B 3P9KA 3FDZB 1YIAA 4BNKA 3NAZA 4IQFA 3MUEA 1PNQA 4HVAA 1B0PA 3HDJA 1XRQA 1PTKA 3A6ZA 4K9KA 2WSYB 5SYMA 1FMFA 3AUFA 2C3UA 1O95C 4L4YA 2C7BA 1G3RA 3BBLA 5WRFA 2Q4DA 1DG9A 1HLPA 4HO1X 3VBCA 1E3IA 1NM5A 2V96A 2NQTA 3PR2B 5FTWA 3ORSA 4FC7A 3AOEC 4B34A 1NBME 3MIZA 1QH1A 4WOCA 4PS0A 2ZUBA 5F7ZA 2D0IA 1XHEA 4PLWA 3Q5GA 5C5EA 2P68A 3J7AC 3K73O 3U37A 2QD2A 5P21A 1IM8A 4AUMA 3HO6A 1Y48E 1IHDA 2HF8A 5EINA 3TLCA 4WI1A 3NPAA 3ROTA 1P1KA 3NO4A 4CF6A 4EYQA 1V8ZA 1VHDA 4GC5A 4RFVA 4EPXA 3ACDA 4WWHA 1FMCA 1MDBA 4LYEA 5CB4F 1XIVA 2QTAA 3VC7A 3AHJA 2FH5B 1HK7A 1KZ1A 3H2GA 4UU8A 2EW8A 4HKTA 4B6JA 4EAAA 1EDOA 4BVBA 5JANA 1SVNA 2QDKA 3D8TA 3GEIA 4ENWA 4EY7A 3PITA 5EWLA 4YJ2F 1V96A 4V0ME 4BUCA 1T2FA 1O87A 2COUA 3KUKA 3VTFA 2QMUA 1AHNA 1ZQ1A 3A70A 2VCYA 3R9IA 5B1HA 3L0PA 1JFTA 3QKIA 4NYMR 1QNLA 1J1ZA 1KJ9A 1FFGA 1WP4A 4BLSA 4UAUA 4ECAA 5AQ1A 1MVNA 2JBWA 1QVWA 5FEUA 3PNBA 3B48A 3RVOA 1F0YA 1SOMA 2BJHA 1D2NA 1ORHA 3AEZA 4PLTA 2G80A 2Q4EA 2R00A 2QTVA 1OYVA 4G8BA 5DV9A 1BE1A 3C70A 4G0OA 5I9LA 5GM1A 2QUBA 1S3GA 3NGLA 4MVJH 3T7EA 3I2GA 1N2HA 5ESWA 3DLCA 5KPJA 4K2HA 1T2AA 3C43A 4YMWA 1W85A 1GGHA 3BTUA 3PJDA 3I6QA 3VR6H 1I4EB 1BMQA 2ZM5A 1N2SA 3P2OA 1Z2NX 2NV0A 2VJOA 4LVCA 4Q0MA 1XZIA 2AFVA 2Q50A 8ATCA 4NBTA 4L28A 4CEJA 3RUCA 3RUEA 3DP9A 4PR0A 3SDSA 2P9HA 3I1FA 5TGDA 2GOYA 2OUIA 2YXLA 4TN5A 4A91A 4UPVA 3CNHA 4WKCA 2Q2QA 1CZNA 3WIBA 4D9BA 5AHRA 3CX3A 3PGXA 4XPIA 1FSPA 4F9FA 3TSOA 1SRQA 2JRCA 5L6MB 5JPDA 5FHQA 1T1GA 4YO8A 1Z0KA 3H04A 4W7HA 1EFRA 1T6YA 2DT8A 4B48A 2QGFA 5CNJA 5EZ6B 1CUCA 1OX4A 3PQ7A 5JASA 2YS7A 2HEGA 4KFUA 4B32A 2AMLA 5K01A 1QCCA 5KU1A 4II7A 3DOEA 4DJ5X 1NZJA 4YRTA 2I7XA 2IUTA 3FCUB 3HR4A 4BFWA 2WTMA 2HDWA 2IZ0A 1C41A 3FRHA 1NLYA 1Z5UA 2XKKA 3TUZC 4YV0A 3ZY3A 1A82A 1IN5A 1ZRNA 4KU4A 4OXQA 1A7KA 1XTZA 4OP3A 3ZV3A 4C88A 4WJLA 4PNHA 2WF5A 1NXVA 2FW7A 1LF0A 4QQ8A 5IHPA 4WLVA 5KNLA 1P75A 2ZZNA 4TWJA 5ELXA 3PEVA 4ZT6A 1ZUD1 1H3NA 1P33A 3AKDA 4L5YA 4EY8A 1XDBA 2P9GA 4KQIA 4PBTA 4DCPA 5LZ4A 2ZJYA 1NXXA 2CK3A 2JGDA 2HU8A 4HTFA 4IWYA 2XIQA 4FNMA 3LHFA 4IDBA 4XQGA 2CD7A 4MVXA 3D9QX 5IKMA 1E0AA 2XNKA 1OX6A 2OAQ1 4A4DA 2V03A 4O2AA 3ZCQA 5JFOA 2XXBA 1U0NA 1Q6YA 2NQ8A 4QUJA 4X1KB 4QBKA 2Y71A 4ALJA 3HVHA 3VTKA 2OBYA 1W4CA 4N7JA 3MJ4A 1WDWB 3PUYA 4QPNA 1VG0B 3HCOA 4FKMA 1JAXA 3V1TC 8OHMA 5KYWA 2OO5C 2P6UA 1I7PA 4CF4A 1JBQA 1Y5RA 1L7XA 2J0SA 4HDQB 4KMOA 3H6HA 1PYDA 3OI7A 3RROA 2MDTA 1HZJA 1SRRA 5COQA 1Y80A 4GYYA 5DLQC 3TZQA 2BMVA 2FWIA 5H3LA 3BRQA 3UW3A 4ETNA 4M98A 2HFJA 1Z4PX 2J67A 1RWNA 4G89A 4KNYA 4CKWB 2GN9A 3ONFA 4N4AA 5GADl 3GL9A 4PAMA 5LVAA 4OHOA 3GG2A 1Z35A 3C7AA 1NMXA 3GARA 4X41A 1YKGA 4BGUA 5E6UB 1JAZA 2IKQA 3K0CC 4Z1MA 1Z4NA 2Q5OA 4ZO4A 5K3AA 5IASA 4MYDA 2QZ4A 2GD0A 4IX1A 1VKHA 4EY4A 1K8YB 3P9NA 4DYHA 4U00A 1ZR2A 3FVTA 1EIWA 4CM9A 1AURA 1HDEA 4NJMA 1EHIA 1ZK1A 2GZMA 1FFEA 2HA4A 2XQKA 3A14A 4MX8A 4PZAA 1QDUA 4UCQA 2ZT5A 3MJVA 1NPYA 3WBBA 1FP4B 4CT4B 4EKYA 4BAGA 1P9LA 1R6XA 3USZA 4ISCA 2WYWA 2OUKA 3LBFA 4RW0A 3ICWA 3DXYA 1YVRA 3ELDA 4NARA 2O8CA 3WGVA 1H66A 1FPQA 3AEYA 4JBIA 2CMGA 1E79D 4G8DA 4H0NA 4BE9A 1NW3A 2ADMA 3WMRA 3LK6A 3QVTA 4LDJA 1QOPB 1FVHA 1GM5A 2OLJA 1V41E 2CVPA 5JCXA 4OVKA 2XNJA 1XRLA 1JPNA 2QJFA 3GUCA 3IGFA 4JL6A 2JFXA 4KXUA 2P65A 2QYTA 1QH9A 4YRDA 4J0GA 4PNEA 4NCBA 1X70A 1EWVA 2AZ4A 4HB4A 5JT1A 1E1KA 5K8VA 4NV0A 3UJHA 1W7AA 4I4CA 3KZNA 1GSHA 3U6BA 3WJAA 4ZO9A 2JA1A 3AY6A 1QP0A 2G63A 4OH7A 3TE6A 4U9IS 2REOA 3QVGB 3VAYA 2I1WA 3H2KA 1VYTA 3TWOA 1XV5A 3D4IA 4DV1B 5L51A 1PIWA 2A92A 3AUJB 3T61A 3ZWPA 4DLWA 5ITZB 3GGSA 1I6WA 2GPAA 3FG9A 4G0PA 4EQZA 2JGFA 4K1XA 2ZZMA 4KXFB 5EXDA 3GJZA 1H6BA 3EZ6A 4N3BA 4CVNA 1LEHA 1OLSA 4BPRA 1VKZA 3JRXA 1BXRB 3OOEA 1G3QA 5EPUA 5AI5A 1ZZEA 4QLBA 4NNJA 1VSBA 4XCQA 4RDCA 4X63A 2PU7A 3O3CA 5BSWA 3K0AA 1JDVA 4TSRA 3U40A 5TIIA 2DHQA 4LF8B 2JGMA 3AR2A 5AFSA 2WJYA 4JNKA 1PKEA 1NJSA 2CKDA 3EH2A 4MPDA 3AFMA 4AAYA 1DCFA 2BFPA 4TKVA 2UYQA 2MSDB 1NKVA 3BZWA 4IILA 1DE0A 3LP8A 1N6NA 1ABFA 1ZGGA 1PN3A 1WY5A 3OPXA 1MR3F 4MR9B 2RB5A 3B3GA 1C5KA 5FV7A 4CFZA 4F7DA 1IIRA 3DLHA 3COWA 1V8BA 3KCQA 3DUFB 5A6VA 1Z2AA 5D6NA 1H2FA 1HDYA 3D6TB 2I0FA 5BN4A 3JQCA 3E9CA 3RV4A 1W47A 4KIJA 4D9JA 1AGNA 3JRNA 4YQEA 1KI1A 3C5EA 5EQFA 4QOHA 3RVMA 1FSGA 3LUHA 4QU8A 4YDRA 1RXCA 4M1QA 4PFJA 4R05A 1G8AA 4F8JA 2JA2A 2P69A 3I72A 3ZWWA 5C18A 3JRWA 1R0KA 1GNRA 1N2CE 1BZYA 1YDWA 2OG2A 2RBEA 5K4GA 2VQFB 1SHJA 4I9FA 1Q50A 4EUKA 3K9QO 3GCXA 2H00A 2P1RA 1TLTA 1QRAA 2C03A 2V7PA 3EFBA 1QLHA 3MS2A 2IPNA 2QTRA 3DMFA 3L0YA 1EUYA 5D3MB 4M53A 2HAEA 5A62A 5A71A 2M2IA 4ETWA 2D8MA 1KJNA 3PTAA 2J30A 2COEA 1VB5A 4FHCA 4QLOA 4D0SA 1VZ3A 3MA0A 3WIEA 3KB1A 2OEPA 1NHGA 1S4MA 4KPEC 5KX5B 5BYKA 3EVTA 4UTOA 1X92A 1C4KA 2FWAA 4FYJA 4NPAA 1LU9A 4PXYA 4EW6A 5B3LA 4TMKA 5K8CA 5A03A 1XZNA 4LYHA 4BEWA 3O4IA 4G01B 3KTOA 4JI5B 1ZZGA 3L9WA 4LHWA 2ZJ4A 4X60A 1E3JA 5I9SA 4E15A 3H2SA 2MJLA 3GRFA 1BO6A 5LMNB 2X4GA 4XR4A 5DYIA 3UQZA 2JGIA 2LWIA 2ID8A 2JZNA 1G7SA 2C2YA 4OFXA 3LGSA 1L5ZA 3WNZA 1RPZA 3QVLA 3RC9A 3ZN2A 3PEUA 3V7NA 3K15A 1QFMA 2XWBF 4FSXA 4I5IA 3T1OA 4FW8A 1IUKA 4AULA 4Z4HA 5BY2A 3EMDA 2I7DA 1O94D 1PLKA 2IIPA 4OUDB 1FL9A 1T9BA 1U1CA 1EUDA 1KZYC 1GFWA 1NBAA 2IYQA 4NZNA 1I1NA 2KLBA 1AMNA 1VPEA 3F7OA 2ID4A 1ELOA 4IDCA 3WIVA 2P2YA 4F6CA 5BSTA 5I9NA 4P6VF 3ICEA 1VA4A 2JJ2A 1QRDA 4PYKA 5G2OA 1LPSA 2HLHA 2F48A 2P2DA 3MTJA 4KN8A 5DK6A 1OPXA 3FZNA 2BHNA 2VJKA 1JPVA 4M8LA 3FOWA 4XDYA 3IAM1 2R25B 3AT1A 2YVQA 3PXUA 3HCBA 4OMUA 5AKXA 5TEWA 3I3SR 3G5TA 4AJLA 4JKOA 4GECA 5B3AA 3UTDA 1VJ1A 3KQNA 1WXDA 1PZGA 5D00A 4CCAA 2UZ3A 1FDVA 4C5CA 4MWBA 4M21A 5HGXA 1WQ1R 5L7WA 1DDGA 1Y8RA 1EXWA 2GFHA 1H8HD 4L8GA 4XFKA 8GPBA 4JLBA 1N1DA 3VO9A 2WD7B 3E3AA 3KYBA 4M8NE 4IW3B 4XVQA 1UF9A 2IDZA 3Q9LA 3KPWA 1IM5A 3LBAA 4K3UA 1TEVA 2CXOA 4O3FA 1NVWQ 3S2IA 5HMMA 5HTKA 2OCGA 3LC1O 3PCRB 3PNQA 3UCXA 2PFGA 4R8MA 2DKFA 1Y5NA 2NSDA 3EMBA 1MOSA 4UEOA 1QFZA 4B5KA 2RGEA 3JAMA 3KRTA 1V3VA 2Q7OE 5B4TA 2EP5A 4EVSA 5KPDA 4QBFA 3IURA 4KQGA 2RB4A 4ZQIA 5F5XA 5NULA 2XBUA 4XX0B 4QHSA 3UAXA 4LEIA 1JZTA 4D81A 3MGCA 2E48A 1OZAA 2PGAA 3N0XA 4JC0A 4II3A 2V4MA 2YN4A 4P82A 4RSRA 4W6QA 2YZMA 1J2RA 1FCJA 1UM9A 4MV8A 4NPCA 4RANA 3ZE6A 4NK4A 3MB5A 2Q9AA 1SA0B 3OLQA 4BVKA 5A4FS 2VZ0A 4KQWA 5E4JA 5CX4A 4Y9TA 3ZDCA 2PGOA 3AUKA 4LBZA 3D8SA 2ZSEA 5JXJA 1U94A 4RVFA 2E7ZA 4BMYA 2VJLA 1UMBA 2OHHA 3DR3A 4RU1A 1BDIA 2ZI4A 3BE6A 2PSFA 1QVAA 2FF7A 5F1KA 1MAVA 1RI1A 4PXSA 5JRZA 1OXVA 4ODIA 1EDEA 1CUEA 4ML3A 4YK7A 1FMLA 1R12A 3HCAA 2FPMA 3EAGA 2XT6A 3QVSA 4MWGA 5BNWA 2ZE5A 1KVQA 1X80B 3I12A 4M1TA 4MQ5A 4CI9A 4EUEA 4RKRA 2IKSA 3L5OA 1ULTA 4EJSC 2GHQA 2QVLA 3VI4B 4LQCA 4YLGA 1Q16A 2ZJ8A 4IFBA 1YC2A 3BHJA 1NXWA 5FB3A 4B6PA 1L4GA 4IWXA 5I47A 3I04M 4AKIA 4NATA 4HDAA 2VSXA 3PQ2A 4X6XA 1WF6A 5A9TA 1J21A 3E2IA 1GNVA 1VLQA 3FNEA 1XZHA 4QDZA 2ASEA 2ZAMA 1ULSA 5ERYA 5H82A 3AVTA 1VHTA 2HHCA 2D4AA 3CZ9A 1AGXA 4HNSA 2C0PA 1JIXA 1ZCZA 5AJYA 1U3WA 3D0OA 4TTTS 1OFUX 3HBLA 3J7TA 2DQKA 2E5FA 1QJCA 2H0QA 1L6RA 2Z9CA 3A9UA 3CTPA 3GRKA 1SVSA 1G0OA 2RC6A 3INGA 4K9PA 4RY8A 4ZQEA 5A3VA 4IF6A 2O8DA 2Q4BA 3VZDA 1OFGA 3IVGA 2EEZA 1UL1X 2ZTVA 4I4LA 3FGZA 2FX5A 1I3NA 3GYGA 2Y6UA 3R7WA 1L4FA 4YN3A 3NMUF 3GT0A 3PE3A 3FCAA 4NJEB 2IHNA 1CY6A 2YXPX 4JQCA 4D02A 1TA0A 1QF9A 1WXHA 2Z56A 3I9V1 4I1YA 4QSHA 5HM6A 4G5HA 3DCNA 5C2JB 2HK8A 2HOQA 1DJNA 1ZCBA 5TX7A 2WU4A 3AL3A 4Q1BA 4UZEA 4ZQHA 1TQDA 4D1YA 5BORA 4N40A 1BVYF 3WGKA 5FHRA 1ZVMA 1HURA 4UDYX 2LVBA 2ZB3A 3ZK8A 4ZZ0A 1AVTA 3HXPA 1NYLA 1KARA 2JH9A 3QU2A 2WAYA 5CB6A 2QNIA 1FU7A 5DRYA 5B37A 1TCVA 5B2ZA 5KOHA 2ZS9A 2XTNA 1Y8QB 5K7SA 2BZSA 1O97C 4Z0TA 2XDAA 2VFAA 4X1YB 1CRWG 3ZKWA 3TGLA 4FFWA 2FSUA 4K9RA 5AVSA 5CLJA 4PZ0A 1X7ZA 4E1AA 2RH8A 3KQQA 1Q77A 3O1IC 4TTPA 2YX1A 4DZTA 4DCUA 2I91A 3NUGA 4LHEA 3I62A 1IQPA 3AZOA 4YRGA 2QUKA 4PRLA 4DLUA 4AXXA 1H2WA 1LY1A 4N0PA 1GR0A 1ZKMA 4NHEA 4YRPA 1W0KD 5HCIA 1SUDA 2ZIGA 3OU6A 3PUIA 5JTUA 3L8FA 1DC5A 1ODLA 3OX1A 1JEOA 4FYPA 2WTUA 2ZSUA 3D2AA 4AUEA 1GNSA 3G68A 5IRCD 5F5LA 5C1DA 2F3QA 2Q1SA 4PG6A 1YRAA 2AUNA 5E4FA 4HFNA 3EWIA 4JROA 1TGVA 4JP2A 4XQCA 1A77A 3UHJA 2FK7A 2DLNA 5B5SA 3MK31 4LOKA 2C2GA 3RC2A 4PXAA 2PM8A 3FNRA 1FNNA 1H0SA 3KZOA 1XDDA 2GD1O 4B35A 2K87A 2QXUA 3EW7A 3H19A 5JO9A 3VC3A 4Z3KA 3INNA 1TU3A 1VP9A 4DCNA 3N3BC 4YV1A 1RZ3A 4KR6A 3DYVA 2Q41A 5MN6A 2JFHA 1NJFA 4GI3A 4YT5A 2GAFA 1DIAA 4KQJA 5E9JA 5F51A 5ENDA 3FROA 5HF5A 3LUBA 4KQMA 1JWAB 3FOCA 5IZ4A 3ADDA 4DMRA 1HDCA 5CYFA 2IZ7A 3JWHA 2NACA 4DQVA 4HQ6A 1TVKB 1CU1A 2XD9A 4W99A 4E51A 1GRCA 3SQWA 3WKDA 3HEMA 2GAJA 3OKCA 4JELA 4Z54A 2ZBUA 3REOA 4IJUA 1RQ7A 2GJAA 3EDMA 4HH3C 4BFYA 2P75A 4ILEA 5JBIA 1A5AB 1E3TA 1HT0A 2IHYA 4EDFA 2FI1A 3JQDA 1ULAA 4BLWA 3DEJA 1H2BA 3PNKA 2ODNA 4LOHA 4RK0A 2G5CA 5EE0A 2XCUA 1Y1LA 2NVBA 5E3IA 3MJEA 4RADA 3DHWC 1L4UA 1MC1A 3IAS6 1EB8A 3L8CA 3Q15C 3LCCA 3E18A 2BGLA 4MPPA 4YRKA 4HEA1 4KXMA 1EVJA 4G4SO 4BNVA 1IHUA 3FAZA 4JXKA 4PC2A 4BEBA 3I6YA 8ADHA 3M33A 2JGRA 1GZ5A 2FQYA 1K66A 1TF5A 1X42A 2O3SA 3TGPA 5C37A 4UW9A 4BWYA 3ZCTA 5IZCA 5DTRA 3K9HA 1FQOA 4UU7A 2X6RA 3B6KA 3NWPA 2W6JA 1SUSA 4LBVA 4QPCA 4K26A 3TVYA 3H11A 2ODAA 1DELA 2AI2A 1JR3E 2QJOA 3LIPA 3MBIA 4PYNA 5JD5A 1F14A 3PXEA 2OBFA 3VKVA 2G9QA 2ZJ1A 4FEGA 4MH0R 1I9GA 5DYYA 4AL4A 3RHTA 4ZEOA 3RRMA 3W79A 5K8TA 1M8JA 3LOUA 3SQXA 1C50A 1CUSA 2IEDA 3IPXA 1NI3A 4XQ0A 3R0VA 4LYYA 5IX8A 2JFQA 4O33A 5HIJA 1A72A 3ND8A 1EVKA 2PQ6A 3D1VA 1NBHA 3FFXA 4EENA 1UIRA 1Z5VA 1YXMA 2R87A 3DP7A 2NV6A 1M2OA 3QLTA 4K2AA 4C7JA 2I2WA 3LC0A 2WC1A 3FOBA 3HYRA 3IP8A 2FXIA 4GBJA 6REQA 4OFZA 1RU3A 1NUQA 2QQEA 3NKFA 1PL6A 3UCFA 2C2ZA 2FPIB 2OP1A 1HG1A 3L93A 1XZLA 4DA8A 2JIRA 5AW8A 1NA5A 1ONSA 3L1UA 2D4HA 1ZW1A 1RWOA 4DZRA 3JS5A 3DZDA 3ICOA 3DTVA 3QVVA 1YJXA 5HDBB 5KX5F 5EJ2A 3LZ6A 4FJ1A 4KKVA 4LDQA 4ENVA 4FINA 1TLLA 2AOWA 2OR3A 4GPBA 4X1IA 4EFDA 1UXKA 1X7YB 4QUEA 3MFYA 4ANFA 3AZPA 3OQNA 5EIWA 2UZ4A 5F78A 2YJTD 4F9EA 3A58B 2XYHA 1XR3A 5FUVA 2WF6A 2FW8A 5TJHA 5IT5A 1Z4QA 4YHHB 2BFFA 4WW0A 1Q2XA 3EYWA 3T7SA 3QLUC 4ZREA 5CIYA 1NYTA 8LDHA 1NUTA 1RXSA 1X1DA 4E7PA 4BVEA 1J1UA 2EF1A 3WFJA 2OYCA 3ZCXA 4ZYXA 5CM9C 4PANA 2VK8A 4YRBA 3VH2A 3COZA 3UH1A 4D80A 1HEYA 4MAAA 3EEYA 3TLAA 4IIDA 3CE6A 3CMMA 5HQ3A 1F2DA 3IBSA 1TADA 2IXBA 1Z8DA 1NVMB 2OAP1 4GMDA 2LW7A 4IUBS 4AICA 4DV2B 4E22A 4JQZA 4XD2A 4YALA 2D1QA 1W5AA 3MZ0A 4ZQBA 5IUNC 5JAZA 4J7CA 3M4ZA 5IKOA 3KBBA 1OB5A 4BVHA 1GGNA 4Q4HA 1ZJWA 1WO8A 4JB0A 4AMBA 3GNQA 1LQ2A 4NYMQ 4R54A 3PFHA 1UOQA 2Q1WA 2JIMA 5BNFA 2PH5A 1EHYA 4PIPA 3U16A 3RWBA 5TMDA 3SDZA 4C0SA 2H65A 5B6IA 2G77B 1E99A 3KLPX 2CHFA 4H27A 4D97A 2JNWA 1CVIA 10MHA 4XB2A 4OYHA 3ZJYA 1P73A 2IBTA 4YH1A 2NUPB 4XWYA 4NY1A 3K0EA 4Q3BA 2M9MA 3H9QA 3MPOA 4U6QA 2ZIUB 3GJQA 5M29A 4R16A 2R7AA 3PKJA 3F8SA 4EM6A 4F4IA 4FX5A 4LHSA 3B1VA 1MAAA 1Y9DA 2EFYA 4JEMA 2VS1A 1ZR4A 3BH6A 4YP7A 1G9XA 2CBZA 3CLHA 4X93A 4LCEA 4Y2XA 3COVA 2FW0A 2I2BA 1EXMA 3KT0A 1GQYA 2O3QA 5ER6A 1XXHA 2RK3A 3O9MA 4GOJA 5JAQA 2OCDA 3I6ZA 2V1XA 1JQKA 1WSWA 1Z07A 2ZYVX 1LLDA 3OIYA 4G85A 5DULA 4V1CA 5FNZA 3D8HA 3SX0A 1RWVA 2ZT6A 2ZZKA 1H0KA 1M7BA 4JUIA 1M7GA 4NBVA 1TYBE 1VKJA 3GP8A 2E5LB 2Z98A 3DAPA 1SMKA 3I5MA 1F2UA 2WMYA 3CUKA 3N8NA 4IJ5A 1Q21A 3L77A 5CA1B 2NO6A 3OU7A 4UFPA 5F2KA 2EX0A 3W0LB 1PW7A 3FIUA 2ZRPA 3GI1A 1P5ZB 1MX3A 4NJOA 4IHAA 1E2FA 2IS2A 3ULKA 5KUTA 2BKEA 4TMFA 1FS6A 5CA0A 4WNAB 4XXHA 4D3DA 5CTAA 4D99A 3AY3A 2A35A 3ND6A 4IIUA 1N0UA 3CXRA 2PGIA 3A6HA 3HP4A 2EX1A 2YWCA 3LZDA 1UEIA 3NHBA 4CLHA 3ABOB 4DAOA 3A28A 1Z17A 1OX4B 4FYHA 4H4CA 2GK4A 4QVKA 3T94A 4KXQA 2JCXA 4NIMA 4Q1AA 2OQ2A 1FP7A 3BORA 4CR6A 4V0QA 1XEXA 2GK6A 5DBIA 1MH1A 2PJDA 4MS1B 2A5FA 1ZAKA 2V7EA 4OP1A 4NBWA 1NRJB 3B2EA 5EWJB 4Y2YA 4WCFB 4DSNA 3JQAD 3VI3B 4LOLA 1V8PA 4L76A 4TRNA 5SYNA 1RKXA 1IBMB 2QRKA 2O2GA 1R0YA 2D1YA 2XT9A 3MRTA 3NC4A 3BMOB 2G07A 4OXNA 2VHQA 4R2WA 2CXSA 1M2NA 1X38A 1E3LA 3JSAA 2NWQA 2JGDB 5C80A 2F59A 1KF0A 4HTFB 1N3YA 3NVAA 2FETA 1P1CA 3FYHA 1IAQA 2DQZA 1O94C 1QU2A 2JD1A 1DPGA 2I80A 4XJVA 2FX3A 2EJWA 3A11A 3QQ5A 1TF7A 4K46A 4O2AB 2ZJ7A 3C3YA 3LVFO 2MCFA 4BKRA 4IJVA 3VJMA 5HKKD 4FHDA 3PNOA 1QSGA 3DFKA 3ETJA 4PLZA 4M0LA 1VLJA 5A2QA 3P94A 1JDTA 3IOMA 3L1VA 5ALLA 5JXGA 2NZ8A 2QM3A 2GZAA 3OD1A 5CGZA 1IQ0A 4RA6B 3R76A 4IIJB 4ND5A 3GK3A 5DB4A 3K70D 2YFYA 4B47A 3WGZA 4GPTA 3EXFB 1ZSNA 3MJHA 1DX6A 1XN4A 3GD7A 4X9XA 4BVLA 1YJBA 1RLOA 5IJ9A 1FMJA 1LK5A 2ZAGA 4RTSA 2NTEA 1AKWA 4G1CA 1K3UB 3JARA 3R44A 4HCJA 3S2FA 3KO8A 3ZCRA 16PKA 2Q07A 2ZJ5A 2VSQA 3A9RA 4X6LA 4CL3A 5B6PA 3ZDAA 3BL8A 3M5DA 3DFZA 3P9ZA 2JCVA 1YB4A 4WGFA 3FMPB 3TLYA 3PP8A 4GQIA 5AHKA 2WPNA 4IV0A 1ZC4A 2EKDA 3B12A 1WVGA 1UFQA 2LDBA 3AESB 4G8JA 4PPQA 4KGDA 3X2EA 1E3EA 7AT1A 1B3RA 3OAAA 3QUCA 5GZ1A 3TR0A 4NQZA 2M6LA 3N5CA 1WBJB 4ER6A 1NQAO 1UKEA 1J06A 2J0UA 3F7TA 5DM70 3HI4A 4EUNA 1YBVA 1HDGO 1M2EA 2GA9A 4YTEA 1U6JA 3VQTA 2H1WA 1JP7A 3IP3A 5CITA 1GTZA 3KQTA 1PDVA 3LW8A 4ZTUB 2X2FA 3WLOA 1ZVJA 3U4QB 3L49A 3OOJA 5KYTA 1FJHA 4ND7A 4XEUA 4ENSA 4Q9DA 2ESRA 4DLYA 4DR3B 2P4QA 2VWGA 3KSDO 2PQ2A 4CCYA 4YXWA 1XTTA 4HP8A 3S1AB 5DW3A 1IWOA 4C6TA 4E21A 1A4UA 1KYYA 2CDAA 2PJZA 3TSWA 1NBOA 3SJAA 4CYMA 3HP1A 4TN1A 1Q57A 3ROFA 5I3CA 3AJRA 3E48A 4LJKA 3LUDA 2BE7A 2IF0A 3G79A 3PHHA 5G1PA 5JCPA 4RKQA 3E5MA 2Y0EA 1Z34A 4QTZA 3HL4A 3QFSA 3NBKA 3ZHRA 2O2IA 3O8QA 4HN9A 4PG8A 4B3HA 2IIQA 5EPEA 3AR6A 1H8EA 2YUTA 3P0RA 3BHMA 5KOYA 1XQ9A 3H5IA 3N70A 3I2FA 4U3JA 1ZXLA 4YUWA 1ZJ5A 5BW4A 1NF2A 2X0FA 2FFJA 3GBPA 5BXYA 3R6TA 1ZI8A 4DSZA 4M36A 4JVOA 2OTCA 2IU4A 5DWDA 5BO5A 1X14A 1CQPA 1KYXA 2GZ2A 5ILQA 3QXCA 3PKIA 1EGVB 3NI2A 3V1MA 1TAUA 4XGQA 2ZBRA 3FSGD 5LB2A 2WJJA 3K9NA 3SMQA 4F9GA 3GZNB 1RR6A 2QD5A 3VKHA 2I2XB 3CQ9A 3NXKA 5JSFA 3FTDA 5G02A 1IUOA 3VR5A 1RQ2A 4PFQA 3MS4A 4B4VA 1DQSA 4JBXA 4JK3A 1XMJA 2BGJA 3DLIA 4F5YA 2JFUA 1TVMA 3SNKA 3WNDA 3ON5A 4L7VA 1C3OA 1ZN9A 1E7WA 1L0BA 1YHZA 3EIEA 1MIOB 1YQXA 3B9QA 2FE4A 3JZDA 5KYXA 3FPFA 2ZSJA 3JZAA 4EABA 2C5EA 3E4DA 3HB9A 3KHTA 1DL5A 3T5CA 1B23P 3GUVA 4MKXA 2YINC 4GIBA 4GP6A 2IS4A 1N2ZA 4RC9A 2E89A 2O2EA 1FLVA 2W83A 4HAXA 2PD6A 1AQ6A 1G1MA 1MP0A 4KYIB 4QGGA 4ZU6X 4D98A 4E5MA 5IULC 1PS0A 4YVFA 2GZ1A 1R8XA 1SUAA 3FWPA 4KEAA 3KOWA 1UBUS 4RD2A 1M2VA 1X1CA 1D1PA 1MRNA 1W36B 5AJZA 3G0BA 2H31A