3ELBA

Human ctp: phosphoethanolamine cytidylyltransferase in complex with cmp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
333
structure length
302
Chain Sequence
b'GRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine-phosphate cytidylyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Human CTP:Phosphoethanolamine Cytidylyltransferase
rcsb
total genus 102
structure length 302
sequence length 333
ec nomenclature ec 2.7.7.14: Ethanolamine-phosphate cytidylyltransferase.
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3elbA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3elbA01
5J5AA 2X3FA 3FNRA 3GUZA 1U3DA 3P0IA 3U1VA 2DETA 2IELA 3KT6A 3A04A 1JZSA 2I1LA 1YUNA 1NUQA 3H97A 3IODA 2E0IA 1T6ZA 4UZFA 4FZJA 2OQ2A 4MW9A 3Q12A 1T9GS 4J76A 3H99A 1J21A 2C5SA 3QE4A 3CVWA 2PZAA 1R6TA 1ZH6A 3N8HA 1EFVB 2JAXA 3H9BA 4EG4A 1NUPA 1KQNA 4DNXA 4NAUA 2A1TR 3UY4A 3IMGA 3AFHA 2QUJA 1T6YA 2Z08A 3IH5A 1IRXA 4EFKA 3MXTA 1G8FA 1WY5A 1N77A 4ND6A 1WXEA 1WJGA 5J59A 1O95D 1G8GA 1X8XA 1J70A 1FYDA 3L92A 4TS1A 4ZT3A 4ARIA 1N2IA 4NZPA 1Q15A 4WSOA 3AG6A 2XRZA 3PRHA 1OD6A 4KPUA 3CLRC 3I05A 3IVXA 1MAUA 5F23A 2A88A 4XFDA 3ZIUA 3CA8A 1GAXA 5FO1A 3SZGA 2D5BA 4R2MA 1JEDA 4PY2A 1I2DA 1TYCA 3INNA 1GPMA 3IUEA 3AL0C 3LCJA 1WXFA 1KKUA 1OBHA 3FIUA 3DV2A 3RHSA 3X1JA 4PBSA 2J4DA 2QTRA 2GOYA 4MAFA 3HFJA 3KT3A 4H3SA 3CLUC 2ZUFA 3D6UA 1UFVA 1V47A 3CLSD 1N2GA 1H3NA 1KQPA 5IJXA 4X0EA 3FETA 1QNFA 1EFPA 3ND7A 1YIAA 1VL2A 4JFAA 3NBKA 3HZRA 2A84A 1VBKA 3VGJA 1BS2A 4DJAA 4DDMA 2A4MA 3QTTA 2Z09A 4K03A 1O0CA 1G8HA 2O5RA 4F4HA 1TYAE 1PG2A 4MUFA 4EF6A 1GTRA 4MWCA 1IFXA 3JXEA 3A4IA 3IOBA 4QREA 1PFUA 3MLBA 2H29A 3KT0A 4OUDB 3OTWA 2IP1A 1I6MA 1M8GA 4NATA 1QQTA 3AKZA 3IOEA 1D2RA 1EJ2A 3ZXSA 1VBMA 5EKDA 1IQUA 1MJHA 4RPIA 1SURA 1O96B 1JEEA 2YY5A 3UMVA 5HUHA 4MUJA 4YP7A 1K92A 1XNJA 1VLHA 1F7VA 2X0KA 1WKBA 2IJGX 1M83A 4MWDA 2CYCA 3ISJA 4MVWA 1IQRA 3TQIA 5TEWA 1N78A 1KP2A 1IVSA 3CVUA 1WQ3A 1LW7A 2J5BA 2QUKA 3HV0A 5HUJA 2E21A 2DXIA 3LOQA 5TGTA 3MUEA 4MUHA 3K9WA 3IMCA 4AQ7A 1K97A 1U3CA 1XNGA 3G59A 3N2YA 4R0NA 3KT8A 3CLTC 1O94D 3S3TA 4MW5A 1O95C 4XSVA 1KP3A 4AS1A 4YMIA 2VXOA 3F3MA 1YUMA 1O96A 4L2IA 4HJRA 4Q93A 4MVXA 1N1DA 1M8FA 2QJFA 1MRZA 4NDAA 1GZUA 1NYLA 1OBCA 3COWA 4JYZA 4ZCQA 1S4MA 4JZYA 1H1TA 5DK4A 4EG1A 4YP5A 2YWCA 1M8PA 3KFLA 3G5AA 1NURA 2NSYA 1NZJA 1NI5A 4P2BA 4J75A 1TQ8A 1JECA 4CT0A 1J1UA 2XRYA 3TZLA 2EJCA 3L93A 3FI0A 4K0RA 2A7XA 1R6UA 1Y42X 4U8HA 1NP7A 1ZH0A 2ZP1A 2PFSA 3IMEA 4EG8A 1GLNA 1B6TA 5TEVA 1YULA 1WZ2A 1M8JA 1J20A 3BL5A 4GRIA 1EFPB 3CLSC 3HL4A 3ZXIA 5JBNA 1NSYA 1MAWA 4UZEA 1V8FA 1P7PA 4R2LA 4OJMX 4PBRA 2PZBA 2NZ2A 4I6JA 4DLPA 1M1ZA 4I6EA 2V0GA 2WSIA 2G36A 2CV2A 2DUMA 2J07A 4G5YA 1TYBE 4S1OA 4DDKA 5H7XA 4ZT4A 1ULHA 2D13A 3D6VA 1IHOA 2GKSA 4MVCA 3IVCA 2CYAA 3ND6A 3HMQA 1Q19A 1F4LA 3MMXA 1COZA 3P0JA 1PFVA 4YBRA 1QJCA 1WXGA 2BTEA 1N75A 3ILVA 2CUZA 1M8KA 2CYBA 2QTMA 3COYA 5K0SA 1KAQA 1MC1A 3CLRD 2VTBA 1EXDA 3LE8A 4MW6A 4ZT6A 3RBAA 3ND5A 2A1TS 1IH8A 2PXHA 1O94C 4JXXA 1Q77A 3PNBA 3ZJUA 4RUKA 1WQ4A 2A1UB 2OV4A 4F3RA 2VTBB 4I6GA 3GLVA 1XNHA 1JILA 3HGMA 3ZJVA 2BYTA 1N3LA 1WXIA 4ZT7A 4A91A 2PZ8A 3PNVA 4G5FA 1KAMA 1MOPA 3AIIA 4E1AA 2X1LA 3OP1A 1OWOA 4EG6A 5FO0A 2RD2A 3COZA 3GMIA 5IHXA 1EUQA 5DASA 3CVYA 3FOCA 3ZUGA 3TNJA 1ILEA 3E27A 1K4MA 1IQ0A 1KORA 1OWPA 3COVA 4ND7A 1N2HA 2DEUA 2E89A 2CV0A 3H9CA 5H16A 1WOYA 3PXUA 3N9IA 4EGAA 1KH2A 4ZCTA 3ELBA 4NX2A 1XJQA 2Z3VA 1RQGA 3TS1A 4HK4A 4MW2A 1QTQA 2PG3A 2CV1A 1G59A 4MW7A 4U7JA 3CR8A 4QBTA 3Q10A 2J08A 1Q11A 1JGTA 1J1ZA 1F7UA 2B7LA 3C8ZA 4KPUB 3RFFA 2RE8A 1JIKA 2X1MA 3K32A 5LM3A 1FFYA 5TS2A 2H2AA 1DNPA 3ZGZA 1U0BB 2D54A 1A8HA 1EE1A 2DR2A 2QJOA 3IVGA 2AZXA 1VBNA 3SEQA 3CLUD 2AKEA 1LI7A 3DPIA 1YI8A 1LI5A 2YXNA 2DLCX 3IOCA 5K0TA 4ZT5A 3VU8A 2QJTA 5FNZA 1O6BA 4MUNA 1N2EA 1EFVA 5KHAA 3AG5A 3X1KA 1OWNA 3MLAA 5HG0A 3H05A 1K4KA 4MW4A 1NUTA 2GM3A 2CT8A 2A1UA 4CDNA 1N2JA 1T9GR 2J09A 3RK0A 1CT9A 2DERA 2ZUEA 5KWVA 2V0CA 1U7XA 4BWVA 5AHWA 3A05A 4MUKA 2DPLA 3DLAA 2YWBA 4ZCRA 5BNZA 3NV7A 1YIDA 3UK2A 1I6LA 1X6VA 2QUHA 3FY4A 1OWLA 1JIIA 1NUSA 2HMAA 4KR9A 3TZEA 4GU5A 4MUIA 4EG7A 4MQ6A 1KH1A 1H3EA 4MWEA 1QU3A 2O8VA 3FWKA 3G6KA 2WQ6A 5KCMA 2CFOA 1T6XA 5DB4A 1PFWA 4MWBA 3P0HA 2E18A 4MW1A 4HJXA 3FH0A 2WQ7A 2TS1A 3RK1A 3NBAA 3QTBA 3CLTD 3TQOA 1MB9A 2WB2A 4MVYA 1O97C 1MB2A 2HGZA 4HPWA 4YP6A 2JA2A 1GN8A 3DO8A 1O97D 2QTNA 4EG5A 1N2OA 1OWMA 3CVXA 1TFUA 1KH3A 4ZT2A 1JMVA 1QRUA 4WNYA 1GTSA 1ZUNA 2AG6A 4ZCPA 1TYDE 3UC5A 3A2KA 4KR7A 4JXZA 4MUGA 4MUEA 1WXHA 1PG0A 4PBTA 2A86A 1N2BA 3CVVA 4U63A 3RJZA 1ZJWA 4DDHA 4MW0A 3P52A 4XFJA 3Q4GA 3FDXA 5LLTA 5DEOA 1NUUA 4OUDA 1R6XA 3VRHA 2R5WA 1QRSA 1QU2A 1TEZA 4Q16A 3M5WA 4L2IB 2HZ7A 2PIDA 1PFYA 3X1MA 3ZJTA 1MBZA 4CDMA 1F9AA 2JANA 5J58A 5LFAA 4ZCSA 3UOWA 4KR6A 3PNYA 1O0BA 2EL7A 4NAHA 1EUYA 3SEZA 1QRTA 1JIJA 3FG9A 4DE5A 1I6KA 1KQOA 1U7DA 3IDFA 4KKVA 2CSXA 1HYBA 3FHJA 3SP1A 1JHDA 3SYTA 4CQNA 3N05A 1O5TA 2QUIA 4ARCA 3SZ3A 4MLPA 4MULA 1JZQA 3IUBA 4G6ZA 4EG3A 1J09A 3SDBA 1KR2A 4QRDA 1H3FA
chains in the Genus database with same CATH superfamily
5IUNC 3OAAD 1CB7A 1IZZA 1DWQA 4OMUA 1J4AA 4FEEA 3BRSA 4A8TA 1E60A 3UXYA 4BZZA 4L4UA 2RIRA 5M3BA 3RRNA 4Z2YA 2OC9A 2HF7A 2X19A 1N7GA 3A04A 3EXG1 4HAUA 3COPA 4NEHB 3KLMX 4Z3KA 3H4IA 2L19A 3IODA 1GSOA 3NORA 4R5HA 1JDBB 5JXIA 1NBME 3IT0A 3DT9A 1XRNA 1Y5RA 4ZXFA 2PAAA 4KIWA 4D6PA 2Z6VA 1SVUA 2NT3A 1OC4A 1U7PA 3D3KA 3HCFA 3Q7QA 4GO1A 3QKWA 2VTKA 1OYWA 3I2FA 4AJHA 5LZ2A 3HKDB 5ILQA 4WKGA 3SU8A 2NN3C 3LLUA 3N8HA 3VM6A 1IB0A 3OUUA 4IH1A 4B6GA 4E2XA 1DAOA 2CLHB 2VA8A 1XR3A 3SR0A 1TU4A 4EJ6A 4ZDJA 3NJ8A 4FBLA 4HDNA 4PYJA 1H9AA 1R0YA 2A57A 4EHAA 1KTIA 2I76A 2P4SA 3PJEA 2Z5FA 4YUWA 5CDUA 3BXEA 4F1JA 1T5HX 1DOAA 4X95A 5TDHA 5IMSA 1WY5A 3GU3A 1B74A 3BTUA 3T5TA 5FUMA 5CTAA 2VUTA 3CLHA 2RHGB 4UAJA 1ZJ4A 3I01A 4OL0A 1Z83A 2P6NA 1G8GA 3ED1A 3G2QA 3NLLA 3C24A 1TTTA 1J70A 4L9AA 1N2IA 1ZUIA 4YJHB 4EPYA 4KRXA 1ISJA 1LJ8A 5AJVB 5B1HA 1ZK1A 5TQ2A 2YJ5A 3EGEA 1JWLA 4C1BA 3DF9A 3IAM6 3PRHA 3IIMA 1VA4A 3KLOA 5IBQA 2PH3A 1YSCA 2WWYA 3WNBA 4NC9A 3D8UA 4E5UA 3G0HA 1XFDA 2WFLA 3OQ1A 3VO9A 1E94E 4CM8A 2XMQA 5AI4A 3WGTA 5AW4A 1TMYA 4LRQA 1E2PA 3HJTA 1XVIA 1NBMA 2WW8A 3X1XA 3INNA 3BVPA 3V55A 1SM4A 3ZU3A 4AB1A 1PLLA 3W2HA 2VSOA 2XODA 1N9GA 3RVNA 4YROA 2VATA 3ZOZA 1FFXB 1Q1NA 2ZJZA 2RGWA 1WHTB 2W2NA 4PZDA 3MHPA 4FHEA 2H17A 3NX4A 4PTLA 4OXRA 1O4VA 5JCJD 5JW6A 1Z34A 2D5LA 4GR4A 4UREA 4UMFA 2BKXA 1FYXA 4HN4B 4ZQCB 3WLLA 2AOVA 3CPEA 3OOYA 3R8CA 3V8QA 1PWXA 1EWRA 1NMQA 2UUBB 3O8CA 1KPHA 1YC2A 3NIDB 1IN4A 2I80A 4ALNA 1ECLA 5IJXA 2QVLA 4S2UA 2INGX 1U4NA 1PDOA 2YV4A 3PIDA 2Z95A 3TRHA 4N7RA 2NUAA 3HZRA 2OCBA 3RROA 1QO7A 5A62A 4HNVA 1Z5GA 4GZ6A 3KXPA 3QLUC 3RC8A 4WBSA 2R00A 1T2VA 5K4HA 2Q9AA 5MN4A 4FCCA 1N0UA 1JR2A 3PTZA 1Z7BA 1YOBA 1VJ1A 1TYAE 2BEWA 1PG2A 4NPAA 3EAGA 5D51S 4EUSA 1VPDA 3KQUA 3T41A 4L8YA 1U6KA 1RHKA 3IOBA 4F2WA 1Z8FA 4XW2A 2VNIA 1PT8A 4O2BA 1KI6B 3K2BA 2KMLA 3W5CA 2W0MA 1EX7A 3FPFA 2QGZA 4RS4A 1P5RA 3THOA 3FPAA 3EPJA 3KD2A 1EJ2A 1Z6AA 4IMRA 1XTQA 5AK0A 4ZARA 3UT6A 2YRFA 1CUEA 1S2GA 3MPOA 2XQJA 1E1CA 1C1XB 1V1MB 4XVCA 2YWJA 2V7QD 1Q3TA 3CUWA 3L84A 5GMOA 2RB5A 2ADFA 2GH1A 3DWGA 4WLNA 1FFWA 1E2NA 3FOWA 4MR9A 3PYLA 1FCJA 5DHAA 4F2DA 1SC4A 3TRIA 3ES9A 2ZRPA 3GLHE 4KYTA 2WTUA 5JAUA 3QPDA 4ND2A 1U0LA 4A9AA 1IQRA 1NHWA 1IBSA 3IXLA 3A6PC 3ZWNA 2WLTA 4JIMA 4EFDA 1C80A 1R0WA 3RTGA 5JNLA 1NAHA 4MRAA 4WW0A 4EO9A 5IT0A 3PR1A 1Y5LA 1LBTA 2GRUA 3L7MA 4UOZA 1KP2A 1ODJA 5ARCA 1ST2A 3OLYA 1T36B 2FSIA 2P2SA 2YXPX 1UMDA 2EJBA 1HQYE 1LV8A 1DG1G 2ZI4A 4JB2A 3AHJA 4LV5B 4OFZA 3SHVA 4NWIA 2QW1A 4XDHA 5ENDA 3RVDA 3N2YA 2QV0A 2YC2C 4OSEA 3P2JA 4ALMA 4YGXB 3WLTA 3VVCA 3AR3A 1TA4A 4A0GA 2GYUA 3S1SA 3DTNA 2NP6A 5AXBA 2CLMB 1NVUQ 3RRFA 5BUSA 3JZFA 4NJOA 3GO4A 3EEYA 1KE2A 5L4NA 3DQZA 2C1ZA 2H5IA 2ZT8A 4NDAA 1AXEA 1GRNA 3UJ9A 3BK1A 2NO5A 2QRMA 4MHTA 3QPUA 1Z3CA 2Z4SA 1E9EA 3F6YA 4IPTA 5FX2A 4HSEA 1D9XA 3X0DA 3BCUA 4CMJA 2JK1A 2X5OA 1NOIA 3G5AA 3LW8A 2NSYA 2ZYIA 4NR0A 3SDSA 1XMPA 2ZBDA 2XBLA 3NALA 1M6HA 3DKVA 3DTTA 5EYPA 2PGLA 3ZW9A 4R51A 2C9MA 3N8DA 4MKZA 4ZZ2A 1OKKA 1WMSA 4NABA 3H5LA 3PG5A 2ZI3A 3TAHA 4BNUA 2QRKA 4UNSA 5TVGA 2ODBA 1XCLA 1EDOA 2IE8A 5C8YB 1TJYA 1RQ7A 1SXIA 4LMBA 3DQQA 4I4LA 4TTJA 1F2TB 3RU3A 2XMPA 5CA1A 3FSGA 1WE2A 4E88A 3IPAA 1U28A 1Z74A 4F5DA 3AIKA 1Q16A 1Y6QA 5A4DA 5JAHA 5K3SA 3GFVA 3SIWA 4FYPA 3TX6A 4EY3A 5LKRA 4YJFA 1C9MA 4R9VA 1QS0A 1U11A 1D2AA 1V43A 2ZWIA 3OZCA 4PZCA 4K6HA 4R16A 5H3LA 4FB4A 1YZ3A 3BUSA 2P8JA 2DPMA 2ZPAA 4I6EA 3OOWA 3AW9A 1N6KA 1GZVA 1Q1GA 2VYVA 2WSSD 1KZ6A 2X8AA 1GXSB 2V6FA 3B5IA 2D2IA 1FTNA 4WNAA 5EVJA 1WVGA 5EERA 5J2UB 3EG5A 3PLRA 4JVNA 3GPIA 1W59A 4PPGA 4QPZA 2H57A 1R6AA 2WAYA 2YMPA 2YN4A 3JAWA 4L0MA 5GONF 2KWIA 1RCFA 4Y7DA 4BZPA 4X41A 2VHEA 1EDDA 2WP8J 3KYDB 3U9LA 1WUHS 2IU3A 1SIUA 3FMPB 4TWBA 1FY2A 4D3YA 1U94A 3WL8A 5A5GA 5L51A 1CVRA 1X7GA 1KS9A 2CYBA 2YJ6A 2X4IA 3COYA 4R41A 1FXUA 2ETVA 3CLRD 3H9UA 2Q5OA 1RAGA 1WRBA 1BEUB 2H1HA 4J1SA 4K6FA 4MVJA 5EXPA 4BVAA 1DE0A 4DARA 4FR0A 1V7ZA 5B5SA 2XXAB 3PXGA 4KHPB 2HEGA 4DA8A 1WQ4A 2BR4A 3N2GB 3OX3A 5DTRA 4ZO6A 2QRVA 5ITZB 2VTBB 1ZFNA 2PANA 3QEKA 3V4ZA 2AV6A 2FDRA 5AR1A 2Q2WA 2OHXA 2WYVA 5C52B 2CBXA 4QWWA 4DTCA 3AWIA 3HB5X 3E4CA 1U8FO 1ZSYA 2H07A 1DXYA 1X87A 1SC9A 2B4RO 1TKAA 2XWSA 3PVCA 2COUA 1O95A 3BPSA 5LJLA 2WMNB 1CY2A 4LZAA 4C30A 3DE1X 1XZAA 2J9FA 2K5UA 1YA6A 3EGXA 2C2ZA 2RCNA 4XAQA 2QL7A 2RHLA 3HCNA 1Z13A 5J2UA 2PSEA 5KDOA 3E5HA 5BMVF 3HJGA 4KEAA 2ZU6A 2V59A 4MRSA 4EG0A 2Q9UA 4Z4QA 4RIEA 4JZKA 3KSRA 2P2GA 2O14A 3WMRA 4DIBA 4LE2A 5C7LO 5IKOA 2C84A 3V1LA 5LOVB 4WA7A 2P4UA 2G25A 3T7CA 3GY0A 1QS0B 2RH5A 3HSSA 4AUMA 3AHIA 1JA1A 1G38A 2JAUA 3QEMB 3AEUA 3DDOA 4NHOA 5CIYA 1U7HA 1WOYA 3MWJA 3L3BA 4KV7A 3NTOA 1D6SA 1XJQA 5A0FA 2ZTVA 3DV0A 2VPTA 2VF2A 1YNSA 2W00A 2AFIE 1YTLA 3DHEA 3UG6A 5JRJA 1PR1A 4MQLA 5H3CA 1WY7A 3SMVA 4B2PA 3QXCA 4I19A 2WUGA 1UFQA 3TNFA 2RDMA 4CKCA 3OI7A 4N49A 4QODA 2WIJA 1ADGA 2AKYA 2NYUA 3EEQA 3PFWO 5BSHA 2EQBA 1XPOA 1KU6A 4CETA 2P3OA 1BXGB 1GUAA 3DMHA 4HGPA 2I4LA 4S35A 4X6LA 2E55A 1Y34E 2PUHA 2XHEA 5LDGA 2HMUA 1MVOA 2QD4A 3MWLA 3O9MA 5HK9A 1I3LA 2IP2A 2YRXA 4LXXA 1K98A 2O59A 3GDGA 3PIIA 1T2NA 3PQ8A 1WETA 3V4PB 5KTOA 4IMIB 1SHLA 3M4ZA 4GVLA 1A1VA 3KUXA 2H1IA 1MD9A 2XE6A 1ZNXA 1A8HA 1XTRA 3PDIB 1FC0A 2XMDA 4EEKA 1PSDA 2V6JA 2X9VA 1EYZA 4RYDA 4CLDA 2V4UA 2AMVA 5C8ZA 4X71A 2WNHA 3SE7A 3KSUA 2B4KA 2VYND 3G9QA 3KNZA 3NDJA 5FA6A 2UZ1A 4UTPA 5BQFA 3HFRA 3HCCA 4A6PA 5M2QA 2GAIA 5CYFA 1DEKA 5DLQC 4TTSA 2Q0HA 5FNZA 1PLJA 1OVGA 4BQIA 3OECA 2OCYC 3OEYA 3U7QA 3VZCA 3C39A 2PZJA 3B48A 1IEQA 3GLIB 4J16C 2BKUA 4MP3A 3WFJA 3B7WA 4NONA 5TPZD 3VH2A 4IDBA 3OQNA 3LWDA 4MA4A 3TOVA 1GDDA 4MW4A 2FVYA 2ZR8A 3WP0A 2Z2XA 1X7DA 2FUCA 3DAPA 2O8DA 1VDZA 3EOZA 1F12A 4GE3A 2HRBA 4CHTA 5C8XA 5LB2A 3KQMA 4G1MB 4BWVA 3DE0X 5EIXA 2YVAA 1GL3A 4OXKA 5FI0B 4JHLA 1I1OA 1T9ZA 5ARBA 1DKNA 5EP2A 5KJCA 1U2EA 4OLAA 3OMWA 3CO5A 3GL9A 4X54A 3PEFA 5G4KB 3OU2A 3G1WA 3EF0A 2EATA 4PYKA 4BPBA 3FY4A 4OBEA 3V7UA 3V2HA 3I23A 1L4HA 1DX9A 3B7PA 3TZEA 1M34A 1POXA 2XUFA 3QVLA 4P58A 2PGDA 1JIVA 1NULA 2AE2A 3KS9A 4CM7A 1M74A 3L2OB 1H6CA 4M0CA 3PVZA 3KETA 2E82A 2E4UA 3CX3A 4PLCA 4BWFB 1UEIA 2C0QA 2PRZA 3UB4A 2QI9C 3HBLA 2JCXA 2HBZA 1CZNA 1PFWA 5JCOC 4JSYA 1S2MA 1SPXA 2A0KA 2OVFA 3QVGB 5DNCA 1LCIA 4DMKA 4CMHA 2H2WA 3PENA 2KX7A 4URWR 3NBAA 4RD4A 1SBZA 2IFTA 3H9EO 4ETIA 5CB8A 1QC5A 3CLTD 1JI3A 2PS1A 2QG9A 4U4AA 2DH6A 1ZEMA 4C43A 3CNLA 3K6SA 4MRMB 1A5AB 2HJSA 4K2AA 2HGZA 4DLXA 3VPBA 4WT7A 3WK9A 3KKMA 1SCNE 5A03A 2NADA 2CJFA 1ZQ9A 3B3QA 4EMTA 4WXEA 4CYMA 4ER5A 4E12A 1EFLA 4E09A 5GQSA 1QOQB 1XMSA 3VR4D 3FRIA 4TZ6A 1EVYA 4XWYA 1QHXA 5DN9A 2R6HA 5EXSA 2A86A 2A9RA 1N2BA 2C61A 1MNAA 1Z16A 4QGHA 2GB4A 4QJ4A 2J9GA 1WD7A 5E8RA 5EY5B 2TYSB 4HN9A 4QE3A 3QITA 3IHWA 5CA0B 5TC4A 3RLIA 3DMDA 2EBFX 4OUDA 5KO2A 1OE0A 3ZV4A 3MC1A 3TI9A 5FUWA 1AVTA 4MI1A 4NMLA 1J9GA 1XZ8A 4OXYA 1ZUHA 1NVDA 1PJLA 1TLLA 1N8SA 2CNLA 1JW9B 2ZAIA 3BZUA 3MUNA 1JWBB 1P80A 4LRYA 4UXJA 2IYYA 2R86A 4DJFC 4XM1A 2FZEA 4P7FA 5TY0A 1KVQA 4K9PA 4MI6A 4ZCSA 4EUFA 3W8FA 1RKXA 2BHTA 2EFYA 1UBHS 3IDSA 4LKRA 3BHIA 1LBIA 1HLFA 1U80A 4PGMA 2FUKA 2CVZA 3NDPA 1ZOIA 2ECKA 1EINA 3BAZA 3JYOA 2CLEB 4MQUA 1VE3A 3L7KA 3ZDRA 4DBLE 4S05A 3M7IA 2JIBA 3UBTA 3X1YA 1S2NA 4BZQA 1KZHA 1MB3A 3WMEA 3AUTA 1KI9A 2C4TA 4U2DA 4UHEA 3L05A 4WK2B 3FHJA 4DFDA 5IWCA 3ROXA 2HF2A 4Q3LA 4CM6A 4II7A 1UP6A 5I7RA 4NZNA 2ZRDA 3IEXA 3PJDA 2I4MA 2IYUA 2VUIB 5F2OA 5GOZA 2AJDA 2ZBUA 3GIWA 3NCTA 5CDYA 1SCBA 3I04M 3P2YA 1XLUA 2ZXUA 1SKQA 2ABWA 1RFLA 4EPTA 5JMOA 1VKNA 1PJTA 1UC8A 4MJLA 1X7YA 4QC2A 2Z98A 4KAJA 4QOSA 2JH8A 3C5EA 1Z2AA 4R2XA 3G1UA 5C3MA 3ZHYA 1PQ4A 4BBAA 4I0WB 5ALLA 1KL7A 4TPKA 2RGGA 1GRQA 4R9UC 3K9NA 1IIRA 1PGOA 2HO4A 4QPJC 1PFKA 2X6RA 3AUSA 1X77A 4TLLB 4BMZA 4Q7KA 4RK6A 1AZSC 3F8SA 3JW8A 3UV7A 3TOXA 2GRAA 1YR8A 2R8EA 2OQ2A 2OGWA 3O93A 4MYCA 4H17A 2OZEA 1T1EA 1QHYA 4GPEA 5IM5A 1W1IA 3SG0A 4BUCA 2A9FA 4Q15A 2GN1A 3F46A 1IHUA 4Z8XA 2BHLA 4DCUA 2R1ZA 2JGRA 2R25B 1PZNA 2I65A 1ZH6A 3ZU6A 1M6VA 3ZWAA 1N8KA 2R7LA 3HXQA 4ZO8A 1VCNA 1NUPA 1VMDA 3AH8A 3GEHA 3SBEA 4EAAA 5HSGA 5K20A 3GNQA 2DFNA 2WU4A 3DZ8A 5CEFA 2XKKA 2IF0A 4DKJA 3SBXA 4TMYA 4YT2A 1CE8A 2F4VB 1OBVA 1XZHA 1EX9A 3KJQA 3PRYA 3UK1A 3VZSA 3KTAA 1T6YA 5J4LA 2I4RA 4PCUA 4YUYA 4F56A 2I6XA 4N3CA 4C0LA 4DY4A 2JFGA 1VG8A 2GZDA 3CKKA 4TV8F 4BFVA 2GZSA 1FYDA 4XTRA 4EHBA 621PA 3OJEA 2VDWB 4GEGA 4OH1A 3LHIA 3L0ZA 3OJXA 3ZLJA 3M3DA 5E7IA 3F6BX 3JAKA 4KPUA 2AJCA 3C3JA 3M4XA 2ZT6A 4WL0A 1Y8ZA 4DLRA 5F23A 5A2QA 4FKBA 4M1MA 4JCOA 5E9QA 4C05A 5L7TA 2CMDA 5AJHA 1SC6A 1KYYA 4FE4A 4J0IA 4KTTE 2HPAA 4MV7A 5E2AA 1DAEA 5BWCA 2VJNA 4FMCB 3UWOA 5KOIA 3KBBA 4ZIRA 3I4CA 1F0NA 3KLNA 1GSAA 4X64B 3NVAA 1W87A 3SZOA 3TLGB 4B6PA 2HFJA 1SVIA 3W3AA 4YDRA 5DIZA 5GY7A 1GQSA 4D46A 1KJJA 2VTDA 3FMVA 3OZTA 2EX4A 3VDRA 1Y4DE 3D4OA 3EIUA 3EJWA 4P3NA 4PX5A 4CW7A 4HADA 3G13A 1Y6ZA 4AS3A 3CGWA 4MS1A 1PJAA 1TM2A 1SA0B 2BONA 3TRDA 2XA1A 4A0HA 1EWQA 1J5EB 5IZCA 2Y0PA 2PSFA 4YJ3A 1X2BA 2EC5A 5KNBA 3U39A 4M4SA 2BGKA 4RORA 3D6UA 2ZB2A 4M9UA 1VXOA 4YWJA 1TZJA 5EL0A 3FTFA 5GZ1A 5EPUA 4EBBA 4B47A 3WWZA 3EFEA 5KMGA 4KVFA 1VCIA 4BWYA 1TTPB 4UU0A 1GR1A 1V96A 3JR7A 3K8YA 2X2OA 1SCAA 3CWQA 3I1FA 1BS2A 2P9EA 4W9RA 1XTVA 2VSXA 2Y05A 3D64A 2Z09A 4MWGA 5HMMA 3A6EA 2R1TA 1EP1B 1SN7A 3BXFA 2H59A 3T3NA 3SHFA 3OQJA 2GEVA 1IM8A 4RGVA 1D0VA 2Q21A 4B33A 1IXSB 3LT4A 4MUFA 3V4RA 2G28A 2A92A 4WASA 3JXEA 4IKEA 4LYEA 1K27A 2W4QA 2VAPA 3MLBA 1KZ1A 1TZKA 3F97A 3NHMA 5FWXB 1FP2A 5IRCD 1K63A 1G18A 4HNRA 3B6ZA 3EEBA 5DGDA 5EXTA 1Q22A 4ZVOA 3PJRA 3JQ8A 3AKZA 1NM5A 1GFSA 2FOLA 2JFNA 4IXWA 1EFAA 4MV8A 4QLBA 3PCXA 3K5IA 2OCGA 3DGFC 3NC0C 4H4EA 4X8HA 5DXAA 3VU0A 4GYJA 3OKCA 3I1IA 2VLIA 2ANCA 3UMVA 1WTCA 4WVFA 4YFYA 3GZNB 5KVSA 2PMKA 4UE3S 1QOPB 4O4HA 2IYQA 1EE9A 2JCSA 4IIHA 3VDQA 5K0EA 2WC1A 3Q3VA 1BFDA 3DVLA 1WF6A 5D8DA 2VRBA 2CXTA 4RTSA 1G7SA 5BQPA 4CMCA 1YMQA 5IYZB 3TOZA 2XAAA 2YRWA 1EIZA 1BKYA 3N0RA 3EVDA 3P97A 4B3CA 4AMUA 4ZTZB 5LQNA 4WJKB 4KQGA 3DOIA 1G9SA 3FKSA 1JDTA 5IX8A 2I34A 4B35A 3MUEA 5KQMA 1P0MA 1IY8A 4M38A 2I1WA 4JVLA 1E98A 3IR6A 3ZGXA 3WTBA 4LF9B 2WHEA 1UOEA 4QTUB 5KJEA 4MW5A 2EBUA 1KRWA 2JI4A 1UDRA 1ITZA 1DC8A 1H2XA 2R1VB 2FF7A 3QJ5A 1EKXA 1IG3A 2FPWA 3JWIA 1VJRA 4KFUA 1FX0A 1D9ZA 2XGMA 2PNJA 4ASUA 1NM5C 1R15A 1G20E 1G7RA 3ICCA 4XLTA 5IKPA 3FOEC 3L8DA 4IFIA 2HHCA 2PU7A 5DK4A 3N5KA 3HJCA 4TKUB 1JFRA 3RW9A 3LY8A 5LIPA 1WWKA 1CY6A 2W8BB 4KJZA 2BBSA 1SXGA 3BWCA 3PKZA 4MZDA 4ETWA 3D59A 3M3PA 4P2BA 2AKAB 1V16B 5E0KB 4Y0AA 2D7JA 2NO4A 1ESDA 3QZUA 3R0VA 4V02A 1VI5A 3LPAA 4K1XA 3U3JA 2FCRA 1ADCA 1T4CB 1U99A 4LFAB 1O87A 5C81A 1RPAA 2C3MA 1N6OA 2GLUA 1G5TA 5A5VA 1RXVA 1I1NA 2YCLA 5T8KA 3OICA 1ZG3A 4DMLA 1VSVA 2DBRA 4LGMA 4BLTA 1RPNA 3A3KA 1E9FA 1NV8A 3KOOA 3NFRA 4Q6BA 4KFRA 2JC3A 4NHEA 1QTRA 5SZHB 1M8JA 3WV5A 3VTAA 4FHFA 2GEDA 1T2FA 4A2PA 3IERA 3PHJA 1SB8A 1XVTA 2BE7A 1NX6A 2BSXA 2Q41A 3DMFA 2WV9A 2GI4A 1J0DA 5DMXA 4C7MA 1Q7EA 2PX8A 2ZJ7A 3WWCA 1B15A 1XK7A 3RVRA 4N6GA 5AK6A 1I2CA 4CR8A 4M87A 3WKAA 3RBXA 1E1LA 3WGLA 1DJLA 4RLHA 4KDEA 5J63A 1ULHA 4W1QA 3S81A 4Y18A 2OQRA 2EHDA 3WBFA 2LTAA 5AVZA 4HYEA 4CT4B 1F4LA 4PQEA 1MJNA 3D6JA 4LMAA 4LFBB 1R4AA 1B41A 3BFJA 2WKWA 4DV5B 4C04A 3EIOA 4DQUA 3HKEB 3KU1A 3N7AA 3MGCA 1XTKA 3DEHA 3ZDQA 5F33A 4LF7B 2CUZA 2N75A 4A2QA 5BN5B 3I39X 4TS9A 2E2WA 4EITA 1EXDA 1X14A 4TWZA 4ZQIA 4LWOA 3I0MA 1ZBQA 3LBYA 4CM1A 2A58A 1CUYA 3KELA 2Y8EA 4C2UA 1V9SA 2AB0A 4CF3A 1MHPA 1T10A 3CKYA 1E0SA 2CEAA 3LWZA 4C7KA 2C03A 3PKJA 4OF4A 3BN3A 2WMDA 3HGMA 3EOBI 2E9SA 2PZ8A 3U7QB 5EFOA 1TVMA 4A7PA 1ZCBA 3OT1A 3IJ5A 5KWEA 3E7PA 1IUNA 1PEDA 2M6SA 4WXYB 4C08A 3HUTA 4GAEA 4ZALA 2J6BA 3AJRA 4Z1MD 3PQEA 4P08A 1J9EA 3U7EB 1N2CB 1L5NA 3MRTA 1RYZA 3KQTA 3PGA1 5A9SA 1A9YA 2VWHA 1FYFA 2W2VA 3AJ9A 3PV0A 4J2TA 4DMRA 3CCBA 3CVYA 2G5GX 4Z4GA 4BRUA 2V45A 1JWAB 4EYKA 1PDWA 2PMBA 2PWPA 3OZVA 3M1AA 3AHDA 3ZDCA 3LCUA 3COVA 3QSYA 3INTA 3TMKA 2TRSB 3H5AA 4E5MA 1W36D 2DEUA 2CV0A 4Z3OA 3LXMA 3TLZA 1IY0A 5K8JB 4Q4JA 2D2XA 3ZCTA 4H15A 3N7TA 4TXJA 4MS3A 3REQA 3T15A 3UMRA 4CKBA 3R4CA 3TS1A 3NQ41 1DC7A 3D0KA 2VDKB 1PZFA 1ZVQA 4LCBA 2ORIA 4KXFB 4E4RA 4C1NA 2FQWA 2C2WA 2J9YB 3A6FA 3GJYA 3EY9A 2JLBA 1JDPA 1PL0A 1YR9A 3E9CA 1DB3A 1Z4JA 3MJDA 2YINC 3ZD9A 4AY3A 3DOUA 3FCUB 1K6JA 2PRYA 2HA6A 4QPPA 1A72A 1JGTA 4FSXA 4W9NA 2FW0A 4ON9A 2C3PA 3U7IA 3ADPA 5LPNA 4NRDA 4ZU1X 4QG7A 5DYTA 3V2UA 2ZATA 3IAXA 2XYRA 2BI8A 2RK3A 2H2AA 2CMGA 3D7NA 3VYSB 2NO0A 3UICA 4Y2JA 2I4IA 3R5HA 5JDCC 1GGVA 1LD3A 5JLAA 4MWZA 5B3JC 2OHHA 1VBNA 3OIWA 4B44A 4C4OA 2EFHB 1Z2PX 2AXQA 2IUEA 2WG2A 1GIAA 4YJ2A 3TXAA 2UKDA 1X8LA 1ZN9A 3AESB 3EC2A 2VF7A 2FOIA 1CDZA 5FCDA 5BO5A 3UQZA 3ZE1B 3VU8A 4D6YA 2OCLA 1OGJA 2BV3A 5B36A 3IAM1 1QIJA 4QNNA 4P3PA 4RE5A 2D3WA 3EXFA 1L5GB 3RKRA 1XJ5A 5THXA 3JALA 3TQFA 3SS8A 2YV2A 4GWLA 1Z2CA 2WDZA 2J33A 2WWRA 1CR1A 2HNKA 2QNBA 3C45A 3DEYX 4TLMB 5AVKA 1H0RA 2QX8A 2Q1SA 3K20A 5C51B 3S2SA 1V0JA 2XTJA 4MQEB 1P2FA 1T9GR 3P9SA 2VR1A 3LRPA 4PZEA 4UTOA 4YV1A 3FDJA 3BSSA 3UFXA 3UVEA 4LCJA 3L9XA 3ZBQA 1U0JA 5DCYA 1XMVA 1XD2B 5HP4A 1M5UA 1SXJB 3ONNA 4FS8A 5GWXA 5E2IA 2V3WA 2X15A 4PGAA 4F91B 4R3UC 2JGDB 1P0IA 1NE7A 5P21A 1JEQB 4YCSA 2Q7XA 4TROA 3RHFA 3T61A 2FDCA 1FJGB 3U6KA 5AW1A 1PR6A 1U8ZA 2OV2A 4O8CA 3VTZA 5T3UA 3ICEA 4JL5A 5LA6A 1X70A 3C3PA 1VPLA 1NY6A 2Q1TA 3KALA 2IDJA 3Q0TA 3SR3A 2HK6A 4V0ME 2HYDA 4TM8A 5A4JA 5COAA 4Y6PA 1Z75A 5A06A 5DBIA 2FOXA 1AQLA 2AIRA 1UEJA 3FMFA 2CNDA 4NE7A 5DXJA 3UWKA 2BZGA 2CUKA 2M2IA 4R1NA 1JKFA 1IU9A 2PT7A 1SUFA 1VL8A 2ZFUA 4I36A 4J0DA 3C6MA 4BNJA 3G85A 3QTBA 4R1PA 1I4EB 5DV9A 4E5PA 2BGWA 1UK8A 3DAHA 2FSUA 3FIJA 1NBAA 4NE2A 5D84A 1RAHA 3EVAA 3ZTTA 4BVBA 2AUNA 5A02A 3M34A 4I1RA 5B4VA 4FD2A 4E0BA 2J3HA 1L8LA 2PBRA 3LOUA 3U62A 4EQ6B 3HKBB 2XNCA 5JS8A 5C34B 1CJTC 2D8MA 1B00A 1UP4A 2XRMA 1CIVA 4TS3A 2A1IA 5EXXA 5GPBA 5D3ZA 4NMWA 4ZI7B 1S0UA 1E3WA 4X00A 4JLSA 1U2GA 3UMBA 3O92A 4L9RA 2OBYA 1RJEA 4BV9A 3OQOA 1I5OA 4GXNA 2VI5A 2IPNA 1JSLA 2IEZA 3VO2A 1VHJA 4NS1A 4PAGA 1SC3A 4N8SA 1K2VN 1UAYA 2PDAA 3VZBA 1ZOSA 2W2KB 1EK2A 5JRZA 3I8SA 4MLCA 5I4BA 4QUBA 2C4VA 4P54A 4BCBA 5FULA 5LCXA 2YYYA 4GBJA 4IGAA 1R8SA 4YV2A 1Q92A 1FK8A 1LXCA 2LCIA 3BD9A 4QOJA 1R18A 3M6XA 2O8BB 1NP6A 1CR6A 1G8PA 1U04A 4JEMA 4XIFA 4B82A 1DCKA 1R0RE 4EJSA 3UMMA 3KXLA 3O74A 2Z4RA 5CDFA 1I80A 3CNQS 1SCJA 4E13A 5JZSA 2Q5FA 1YB7A 3UAYA 5G1PA 3HACA 1W0JA 3W9BA 4AKGA 1Y1PA 4KQ1A 4O0LA 2V58A 3KE9A 5F2NA 3HYTA 4L08A 1LTQA 4PZUA 4KXWA 5DP1A 2XCRB 3QIAA 4HXGA 2HJRA 5G41A 1EVKA 2ZYSA 3OFSA 1UODA 1GY8A 5PGMA 4K3VA 3UAVA 3ZDAA 1NWHA 1JPJA 2NPOA 2P40A 3F4BA 3E2IA 1LK7A 3FZYA 3JWEA 3CUTA 3OWHA 4NFSA 4BGDA 2JLVA 4JYMA 3PLNA 3TR5A 2HA0A 3DGEC 3SZ3A 5AOBA 1F6WA 3O26A 3B1ZA 4FJ0A 1S8OA 5BN3B 3NG1A 3ROMA 4L9WA 4CRWB 1E5LA 2XKBA 2X8BA 3B89A 5EUMA 3EX7C 2HF8A 5FOVA 2PMEA 3QUSA 5C37A 2R5NA 2QMUA 3D5EA 3OLQA 3W1WA 1X1QA 3R3HA 3SLRA 5IXYA 3FNRA 1QP8A 2VH1A 4GECA 5K4GA 5A7GA 3L0SA 3QA3E 1SXJA 4H9GA 4AYWA 4M8NE 4YACA 4Z0NA 1CQIB 3I9KA 3OZXA 1JALA 2UV8A 4HLNA 2Z2JA 3V8BA 2Q3MA 4ZVLA 4E1BA 3IALA 7AT1A 4B46A 1ECBA 1YUNA 3WOHA 2XW6A 1M2VA 4WA8A 4X60A 3LCVB 1U0HC 3Q12A 2J8ZA 3WK5A 3F7MA 5FOWA 5E4YA 3ZVLA 3HWX1 4U7WA 4DIUA 1YS6A 2P0AA 4BFTA 1Y8CA 4ZGGA 1U0EA 4OY3A 4R54A 2B4YA 1XXHE 1XCMA 3AKEA 2GS9A 3HHPA 4KB5A 5DM1A 4TL6A 4R3WA 2JI8A 5T3YA 3T99A 4W99A 4DSNA 4YLGA 2XCUA 1KYXA 3IIIA 4FYJA 1KQNA 5FI3A 4NAUA 3TCXB 3BHJA 3GMDA 2UVDA 2ZIAA 4B43A 1DRWA 3F8TA 3UAOA 5GINE 1U4OA 2GN2A 2YJTD 4FIDA 3RC2A 1S7CA 4PANA 4I55B 4DOMA 1FLDA 2C5HA 4UHBA 1CVLA 1PL7A 1OV6A 4JUFA 1IRXA 1C9JA 2OWDA 2MSLA 3EZFA 4YJ2B 5G0UA 1B1AA 2VCHA 3RFTA 4GNKA 2JHFA 2F3RA 1WXEA 4DQKA 1FSPA 4DYDA 1O95D 3H3JA 3UWSA 3NTLA 3ABSB 1PTKA 4C4YA 2ZVJA 1P74A 3F47A 2WHPB 1PD1A 1FXSA 1I24A 1QIHA 1UKAA 2V6MA 4UVIA 5DXFA 4F8JA 1FVXA 1Y3IA 1EUCB 1ZHHA 3ERCA 3NT2A 3QNUA 5EA2A 2W58A 4RE6A 1M72A 5B2ZA 5EIBD 3CF4G 4R0MA 2VT3A 3UT0A 1J24A 1A9TA 2QYTA 3GUUA 3LWBA 2JBAB 4ZREA 3UXMA 4BLRA 2D5AA 4LSMA 2JK0A 3SNKA 3JARB 5AVWA 2AG0A 3C7AA 1LF5A 1P2GA 3M49A 3PGJA 4JJ4A 4WFKA 3C8DA 5AUPB 5JHHB 3PDWA 1TJ5A 2CEKA 4QJ5A 4FDAA 1HWYA 1MTOA 2IQ5A 1YJQA 1F2DA 3AOEA 2OKCA 3SZMA 3DMNA 5JJBA 3FSEA 4XARA 3FZQA 1GT6A 2MT9A 5D00A 4R8RA 3SN6A 2YXEA 2G4VA 4ZU6X 3WNCA 3Q3IA 1TJ3A 2GKOA 4AXBA 2FPOA 3L7JA 3JVEA 2XZPA 3G2IA 2UYCA 2BSQA 4IXMA 4LHXA 2GRJA 3IILA 1HT2E 1P6UA 1WUJS 2VEOA 3MQ2A 3GCZA 4FFRA 3V34A 1RCTE 2VYVD 2O2ZA 3L6RA 3OTOB 1ZKDA 1ZU5A 5JDCA 4DGQA 2YFKA 4PHHA 2VP9A 3WLPA 4F4FA 1PQUA 1ZXXA 2WSYB 2AEEA 8OHMA 1UK7A 2L2QA 5LXTA 3MGKA 3O2SB 3RUFA 1AGNA 4RA9A 4KMRA 1J7JA 3DZJA 1QQBA 5T7BA 2RGNC 4QUGA 3O83A 1G21A 1ULBA 1XAJA 3MZ0A 4JJ8A 4BRZA 1EFKA 2ODPA 3FSGD 4RJ2A 2HBQA 2OLJA 4J0FA 2EKQA 2PN1A 3EAFA 3QTTA 1GPKA 2JHCA 1MC8A 2O2DA 3OEHD 3ET4A 1O0CA 1AB6A 2P3SA 4QUEA 3SPXA 3CJTA 2R97A 2H3EA 2Y71A 1ESMA 2XMCA 3L07A 3CEAA 3QYFA 1RM4A 3WRXC 2W42A 1YZUA 2B99A 2DG2A 3PFFA 4N3NA 3STVA 3KYCB 4XQ0A 4DADA 3KAQA 4Z53A 3KVYA 3WAGA 1HE5A 2R6FA 2ZIUB 4NCKA 1A98A 1FUUA 5FKJA 3AEZA 1NQVA 3GXBA 4TZTA 3IOEA 1RYYA 5F2KA 2B0CA 1TAQA 1SWVA 1ORIA 1P29A 1VBMA 2FE1A 1ZM2A 3V6MA 3L7BA 2H00A 3FUUA 3NHBA 4QGGA 1Y3AA 3C7CB 2ZR0A 1QHSA 1IXKA 3QA9A 4YP1A 5TS3A 5BSGA 5FBVB 5IC4A 1QYVA 1YRAA 3QVTA 5IFKA 2FGJA 2AR0A 2H7XA 3NHPA 3R3XA 3INGA 4QUAA 4E5YA 3TDNA 1RRKA 2XQVA 1OHHA 5A9TA 2C31A 4HQFA 2ONCA 1PZXA 3QHAA 5J2TB 3OTQA 4JBLA 1DDIA 4RH0A 2JVIA 1GPYA 1AZLA 2G0TA 5B57C 1HDRA 5BN4B 4LIPD 4W1PA 1YACA 1TA0A 1EK0A 3WKCA 3FHLA 4WEQA 3TCNA 4TWAA 5KNLA 1LNSA 2EWMA 2NNLD 3GJQA 2PLAA 3L6UA 2ACVA 2AN9A 1JAIA 3O03A 3WGNA 1LW7A 2ZGVA 4X3PA 3I83A 5KOHB 3FAZA 2PUWA 1XNQB 4DR4B 1OX4B 3E7WA 2O2HA 5DGHA 1Y1RA 1PSZA 3CNBA 2YJ4A 4Z2AA 4DV6B 1MFPA 5JAQA 4BBPA 1UFRA 2YFYA 4FQ7A 1TMKA 5KTPA 3HXOA 1NI3A 2IY9A 1QHEA 3IUSA 4XSVA 4AP5A 3OFND 4AS1A 2R62A 3BTVA 3K5HA 1S3IA 3TO5A 4KH1A 5I7VA 4YR7A 1K7XB 2FPIB 3UTDA 3LLVA 1TT5B 3MMSA 4Q93A 4L28A 4IOMA 4D74A 1MEEA 1J0EA 4B0PA 2DTXA 4DCTA 1OBCA 2BPOA 1GNSA 2IUSA 4MR9B 1GQYA 4KHZA 4YP5A 5C0OE 1M8PA 4JENA 1QR6A 2EGHA 1HZZC 4RZQA 1UAAA 2WJVA 2YQZA 5JPIA 4GLFA 2ZPUA 3FF1A 4AUEA 4N7JA 2J67A 5ESDA 4MRRA 3TLGA 1J23A 5E95A 2DJ5A 4D4JA 1H6DA 3C6KA 4XQEA 1VMEA 1E3EA 1GA1A 1NQUA 1T5DX 2Q8QA 2YS7A 2R1VA 3KUDA 5HK8A 3M70A 2Y0CA 3TDMA 3JQAA 4ZIRB 1IWOA 1RP7A 3MUOA 3ASYA 4J1QA 2VT2A 3JQ9C 2WP0A 3MT0A 4MR8B 1E2JA 5DIFA 4YJDA 3QI2A 4IG4A 4DDVA 1MRNA 4RV9A 1WDLA 5TPWB 3FGPA 3KYCA 1XIVA 1EBFA 1B6TA 1Q0ZA 2AI1A 2BFCB 4JOCA 4WTOA 4YAFA 5LR6A 4NJMB 1T0JB 3K0FA 4YO7A 1AMOA 5C53B 1QVVA 4J7XA 3VSAA 1N7JA 3K0CA 3KIPA 4FFBA 3I4LA 2B6HA 2PH1A 4R01A 2RGCA 1NBIA 1CUFA 5CFNA 1H2EA 4I1UA 3ROEA 3HP1A 4F7WA 1VJ0A 4A6EA 4DY6A 2PHZA 1L9XA 2VDNB 3AFMA 3UYLA 3AONB 1N9ZA 2ZETA 4UE2A 4LAFA 5F12A 4A6DA 5AO9A 3ZI4A 4YA6A 2ZSFA 3UGQA 2GXAA 4IX9A 4V03A 2YHIA 1ZZEA 1ZU4A 1T35A 3HCAA 2QZPA 3P2OA 4ZJPA 4NOKA 1XN4A 3ND6A 4OQXA 5D01A 3H86A 5ALWA 4C6TA 4RMHA 1WXGA 4CKEB 1FTWA 3O75A 3JQQA 1NJGA 4DB2A 1ZP6A 2Z5VA 5ALJA 2FUG6 1UMCB 5L9AA 1V3TA 4E51A 3UUFA 3N6RA 4MVJM 4B3FX 5U1PA 4C6SA 3BERA 3QNMA 1T1SA 2DUNA 2G76A 3ND5A 2GPTA 4ZVRA 2IODA 5A4AA 4BASA 1NZFA 4EY7A 1L5FA 1W4ZA 4LNUB 4QULA 3M3HA 1OXUA 1V5IA 4ZRDA 2B37A 2I2WA 4EKIA 1JHOA 2UVPB 3GFBA 3QE2A 3GD5A 1WPXA 4KIUA 4P4NA 2QRPA 2WFLB 1KIFA 2I9PA 3IV7A 3VX3A 4F9TA 3ZJVA 2WYHA 3P2EA 4PTZA 1GKUB 5B3LA 4N18A 3FOFC 4Z7JA 1OFTA 5K09A 3DV0B 1I3NA 3EQ9A 3ETJA 3LXRA 1T26A 3OP1A 1RYMA 3NH6A 4ERNA 3EUAA 1RQ2A 4KIFA 3PQ3A 4YQEA 3K96A 3WBJA 1LC0A 2JEOA 2D1QA 3COZA 1Y6FA 4YCLA 2BFMA 4OMFG 2XYVA 3ZUGA 1NA5A 3D6MA 5AI8A 1G5FA 4B80A 4M0DA 2ZRNA 1P19A 4IO1A 4E32A 1UKYA 1I0LA 4A8JA 5E6RA 3T9BA 4XQ9A 5A1TA 3GRVA 5A4MS 1I7NA 2QT1A 4D0GA 1AF4A 1ZINA 4FFBB 2YXLA 3ELBA 2J9FB 3OE7D 4B45A 1RQGA 2UVQA 4NJMA 4MPTA 3RRZA 4BO2A 1EAMA 3A1NA 2D6FA 4OK3A 4XWKA 3CR8A 4FYIA 3GUVA 4KQWA 2W37A 1NKTA 2P27A 2X1VA 3MQ4A 1LPAB 2VWQA 1K1EA 2VOEA 3FCEA 3MCUA 4M9CA 3U5TA 2RGXA 2WJJA 3P5SA 3MD0A 4HVAA 4QT4A 2M6KA 1X1AA 1ZUWA 3DBLA 4W1SA 1YQQA 2QMYA 4QVGA 2ID7A 4KPUB 3UZUA 4R7GA 1Q1AA 2ZRLA 2OXCA 4RANA 1DQPA 1J1IA 1RJDA 3OZBA 4ZI3A 2C07A 4D9IA 3B6KA 4OLJA 4REMA 2ZPTX 5ICCA 2WHYA 5HR5A 5ALTA 3GLQA 1KEUA 2QL5A 1BOFA 1QHNA 1X0VA 3CZMA 1T6NA 2QAGA 2J41A 2B2CA 2WNIA 4P4SA 3W05A 2B1GA 2JJ1D 2PKQP 1E7SA 2QP4A 2ZJ3A 3DBVO 3KVVA 3R5XA 5FJIA 3SYMA 4BQRA 1Y9DA 2KI5A 4K9MA 3ULKA 3WAKA 2J3IA 1QMPA 4JKIA 5K0TA 4XZ3A 3KCNA 3KZOA 1VI2A 2VBCA 1QGDA 4CF7A 1IZ9A 4CFZA 1EFVA 4CEJB 3TFQA 4PXSA 3VI4B 2DLDA 3KR2A 5T4FA 3M4NA 5HG0A 2PRIA 1JSXA 1YONA 3JRNA 5SY9A 5THKA 4MV4A 3D3QA 1K8QA 1W4CA 3EVFA 4MPJA 4OPMA 1W5BA 2FZ5A 4QTZA 4RVOA 4DG5A 1TEHA 3D4NA 3L8ZA 1ZI6A 3CGGA 4GDMA 5KWVA 3E7DA 2ZUEA 4FLFA 3LDFA 4HQ6A 2CHQA 2G71A 3GV0A 2JGAA 5H83A 2R0QC 1MGPA 5DHSA 3NHJA 1HE4A 4QSMA 2QDKA 1CPYA 4OV6B 2Q2OA 1H23A 1YRLA 4EHKA 2QSZA 4B76A 2IWRA 3I58A 3BB3A 1XPUA 2BCJQ 2H7VA 2QGFA 4EA8A 1EHIA 3GFSA 1OUMA 1QHHA 2FQ1A 2F1KA 2O1XA 2PBLA 4MV9A 5EJ2A 1XNRB 4JDPA 1E3WB 2HI0A 4DRXA 1CNMA 1S4QA 3NM4A 3UXEA 4DIEA 3WGUA 1XKTA 2Q3FA 3R5TA 5JG7A 4ZI5A 4DVJA 2BKAA 2FK7A 1G55A 5TIIA 5J23A 4UEOA 1A71A 2GPWA 3LAWA 2VPQA 1KK1A 1XZCA 2JW5A 1E7RA 1G2OA 5B2FA 5A5DA 2R6ZA 1MXHA 5EJ6A 3BK2A 3P96A 1NVFA 2G0AA 3K70B 4BKQA 2A8YA 4PZZA 3PXCX 4ZZ1A 3AY0A 3T3MB 3T1TA 1NMSA 4Q1DA 3VAYA 4PFJA 1RI3A 3R8XA 3FXAA 4ENWA 1VGVA 1KMCA 3NBQA 3GMSA 4BY9E 1P8AA 1L5QA 1G1MA 5CX1A 3IP9A 1QPGA 2HR1A 2XOKD 1O97C 2GEUA 1BWRA 1SD2A 1E20A 4M1YA 5FTWA 2BGGA 2O19A 1IONA 3U4GA 3HSKA 4QAJA 3KLPX 3X2EA 5A4IS 4F6LA 3GLRA 5HFJA 2I1QA 3ZG6A 1LU9A 2ZB8A 3P1JA 4KIGA 4ZKEA 3SAJA 2EG9A 3E9ZA 4ZT2A 3E1SA 1M1YB 3AUAA 1DLIA 2P9JA 3LC0A 3N2KB 4KQIA 3L1HA 4V1CA 3DJFA 4HEQA 3IKVA 5JQGF 1UAGA 1DINA 4DLKA 4UNIA 1OT5A 1MABB 5KZMB 4XFJA 2FWIA 1HPLA 2FG7C 1Q0RA 1G3QA 5AK5A 3IURA 1N5RA 4L57A 4M37A 2O7QA 3FDXA 3M0EA 3R3SA 1UKVY 3WS7A 1R6XA 2R79A 1NJSA 2DUWA 3H75A 4I1YA 3I9V6 3TECE 4BKUA 3B6MA 2RJ3A 4GPAA 3FTNA 3VPXA 2WJGA 5JBQA 3EC7A 3LP8A 1J22A 2PIDA 5L3SB 1S8NA 2DU8A 4MGIR 3S70A 2HDNB 3TGWA 2XGGA 3VV2A 1QCCA 3NR2A 4WFIA 1CRWG 5ESWA 2WHXA 5F9FA 1TGVA 4G63A 5K8LA 1PIWA 5LQRA 3D6AA 1OCEA 1TZ2A 1Y48E 2D5CA 5CD9A 1PYGA 3O0TA 1NW6A 3BJZA 5JR3A 3AEQB 5JNWA 1B0UA 3R5SA 4NBWA 1WZUA 5C2JB 3QEMA 5D1HA 1FUIA 1BHJA 1M1NA 4QWMA 2CVHA 3KOXA 3Q11A 1DHTA 3H4VA 3OURA 4CQNA 1QGZA 3CPJB 3SIPA 3TK1A 4FMCF 3LBAA 4G65A 4JLVA 3QSGA 2ZYUX 4G0ZA 4PPQA 4NNJA 1W34A 4RHYA 3SIXA 1X86B 3BBLA 3NTVA 2JFPA 1TTQB 2XNDA 4QFDA 5MGNA 3OPXA 3BGOS 5CFRA 5HGJA 5KVAA 3OFKA 4IJ5A 3BWXA 4MQFA 4WXRA 3SDBA 1LUAA 2RHRA 2ENUA 4RV5A 4P0PB 3OD5A 4YRBA 2I8AA 4XOUA 3ZS9A 3IRUA 3ZBUA 3C4JA 3HB9A 3WE7A 4LXHA 5EC8A 1WCV1 2ZJ2A 1ZD8A 3HB0A 1YTUA 2IELA 4HXYA 4NI5A 1C3XA 5ADUS 2RAVA 1K86A 2NVUA 1IDOA 1KIAA 4G1VA 1LSSA 4CIDA 4MW9A 2V3CC 1E2GA 3VV3A 1T1GA 1DXOA 4P31A 4TGLA 4N65A 5EJEA 1T6BY 3KQQA 4OQEA 1USKA 3TIFA 4HPJB 4H6PA 5KDLA 2VJMB 3OPNA 3K30A 1WU8A 4Y2TA 4QTYA 1V45E 1XWFA 2Y1CA 4PLHA 3AIOA 1XLVA 4Q1BA 4U3JA 1QDUA 3W8RA 1W25A 4LVUA 1CQJB 5DRYA 5KTNA 1GUYA 3LPDA 2X4DA 4OB6A 1C9DB 4RLFA 1DIHA 1O08A 3D8SA 4PSCA 3DZKA 2ZI5A 1E1YA 1XQVA 3LFUA 3RD5A 3ROFA 2H5LA 4NCBA 5BT8A 2WPDD 4RIHA 5AM1A 5B1YA 3IMGA 3AFHA 5K3FA 1PNOA 3IH5A 2IV7A 2UUCB 1YKFA 5TJHA 1QCDA 3EDOA 3ESCA 2F1JA 5CIWA 3HG7A 3S8EA 1CUDA 1XAHA 1BKDR 2HSJA 3OQIB 2HLHA 1VG0B 2GJ9A 3IUYA 1ADFA 4HKTA 1KI7A 4KNYA 1GZ3A 2MINB 4TS1A 1E8MA 1IZYA 1D1SA 1Z35A 4OHRA 2Y1KA 4OLHA 2HOQA 2EWWA 1NJ1A 1Z6TA 3IQXA 2BTQA 3ZU2A 1PGJA 1II0A 5JZ9A 1R0KA 2AN4A 5B30A 1UJMA 2ILVA 2WSMA 4Q05A 4XM0A 4ZVVA 1EZ1A 3CWCA 1RMYA 3HKDA 3U4DA 4E2FA 2GESA 4GIBA 5JALA 1NXWA 2W4MA 3DS8A 3CA8A 4L74A 1B0PA 2PL3A 3PT5A 2Z8YA 1HQDA 3NIBA 3GEIA 1DG9A 3OM8A 3AT1A 1KI2A 4TL9A 3DBIA 3DJYA 4O8ZA 3R20A 1Z4OA 2V7TA 2WU0A 4ZYXA 1TYCA 3ZCRA 1GPMA 2ZB4A 1BRTA 3DAFA 3PNQA 3AL0C 1IBCA 1JDNA 3QKRB 3PQ5A 1KKUA 1F60A 1KFBB 4X63A 2ZUSA 5AKYA 3MYYA 2OQVA 4BLSA 4AYXA 4DA6A 4FBGA 1HQCA 1YWGO 3K1ZA 2P5UA 3V8PA 2RE8A 2QTRA 3SWWA 1NVAA 4YVFA 1E9SA 1ZL2A 2ES4A 4RTNA 1NTOA 2ZCJA 5HWSA 3EW9A 1M1NB 3C6XA 1YBFA 4KBGA 3CLSD 1K6MA 2PUDA 4IJWA 1GGMA 3H8SA 4KWTA 3JYNA 2RKWA 2P78A 2FUNB 4PZLA 3N74A 2XVMA 2D1TA 3ND7A 4HNGA 4Z7QB 1KQFA 4JFAA 5AM0A 1KI3A 4IIJB 3T52A 1T25A 4J16A 4XGKA 3RS7A 3R7BA 3ZNQA 2XQIA 5I51A 1AKUA 1X1BA 2AE1A 4KXXA 2I66A 1AXGA 3WLRA 2SBTA 4RADA 4MP6A 1ORTA 2BCEA 3LKBA 1PKXA 4G25A 2BHSA 1RLTA 4UHHA 4ESOA 3DUFA 5EHGA 3TR6A 3DNFA 2HSEA 4EEXA 2ZRJA 2FCAA 3WYGA 4ND8B 4NDZA 4RTKA 4AQDA 3R09A 3ML1A 3W8EA 2PKXA 3RK4A 3L6CA 3GJ5A 1QIGA 2BHNA 2P91A 4HD8A 1OLXB 3D6TB 5AH0A 4ZI2A 3AQIA 5KNDA 1V35A 4OLFA 3FUWA 3B1YA 5YASA 1FP6A 4CIVA 1TUBB 3WBBA 4DLBA 4OTZA 3KOWA 3SXUA 2B61A 4L4YA 1FMJA 1G5IA 2W4IA 2XTZA 2Y4NA 3CZAA 1CDEA 4FTWA 2C2HA 5JQGA 2YY5A 3JRWA 3DEAA 5HUHA 1URPA 2NX2A 5DCWA 1D2HA 3A14A 3KD3A 3KQWA 3KX2A 3RFXA 3N1UA 4KLRA 4EB0A 4R84A 3FDFA 4FYXA 1VTKA 4J7AA 1UM9B 2HA5A 1D5CA 3OM0A 3WLSA 3RC1A 1VPWA 1DTSA 4LHVA 5G1NA 4MV5A 1GYQA 1M83A 2YMMA 4MWDA 1Q7TA 3A6KA 4B5KA 1BG6A 5HHTA 4LWZA 4MQ5A 1THZA 1V3QE 3S44A 2H1OA 4F9GA 5BW4A 3U4AA 3WIUA 3HVHA 2JGMA 3LHKA 1YRWA 5JBIA 3T3OA 2QGNA 3GNSA 1GKIA 5DOVA 3EB9A 4BB6A 2BR3A 1WQ3A 4BLOA 3CVUA 4D9HA 2I91A 1RWNA 4Q47A 2HDWA 5FTLA 1X2EA 2ZSIA 3G9UA 1PKEA 1FFDA 2A6PA 2FR0A 1C7FA 3FWNA 3IA7A 3MWEA 5FQOA 4CHGA 1PN3A 3DR3A 1Q74A 2NZ8A 4OHPA 5DYNA 3LZDA 4KGXA 3QVWA 2C57A 4I4NA 5CLHA 5A1JA 4NBRA 2QZ9A 4Q7QA 5EE0A 4CLEA 1NQOA 3KQOA 4AKEA 3D6FA 3F7NA 4P8RA 1WP4A 3O8QA 3OM1A 4NG4A 1JJVA 4CCWA 4J90A 2G1PA 1LDYA 3EYWA 2HREA 3DMPA 3GZNA 4UMEA 4BLVA 3HI4A 5KYGA 5KNDD 3FPCA 3OX1A 1EBUA 3ORRA 4KK4A 2EX1A 3GWZA 3LQRA 4RF4A 2GM5A 2PUCA 1A2BA 1VGQA 4G4JA 3SBDA 3V8NA 3C70A 2LR0A 2X9QA 1NVTA 2P41A 4AX8A 2YNMC 1IZ7A 3HB7A 4WECA 4EFLA 4EHLA 1YKGA 3L41A 2XRYA 4NEQA 2XUJA 4QECA 2DGDA 2GWRA 5LL6P 4M1OA 2VQFB 3FFTA 4G9GA 5CJ2A 3IJPA 5BWLA 1U0SY 1Y42X 2F4NA 4HPXB 2QG6A 2HLNA 3TPZA 3RAFC 2H52A 1R3DA 1E0AA 1B6RA 4E3ZA 4XVHA 2ZTHA 4CEJA 3E3MA 2LIPA 3GPLA 2NSJA 2XGSA 4Y9UA 2OAEA 1CRPA 1NVXQ 1BS1A 1E2LA 2X2PA 4RQBA 4UXHA 4IKOA 5JBNA 1U1CA 3ACCA 1SG6A 3BZBA 4FYYA 5AI9A 4DNQA 3NTXA 5CDSA 3WDKA 2VXBA 5A3QA 4W6ZA 3QEOA 2J7PD 3SQWA 4CV0A 3CRZA 4PBRA 4AUNA 5HYVA 4I9HA 4I6JA 1ND6A 3VPDA 3QU9A 3PD7A 4R9NA 3H0EA 4GX0A 2G63A 2OO7A 3ENNA 4BJ5A 4DLVA 4EY4A 4WVLA 4OH7A 5FUYA 5TPZA 3A27A 3B9PA 2VDMB 4GX5A 4ZT4A 2Q99A 5BSKA 4AMZA 3HYRA 4AG6A 2UXDB 2ARKA 1HEIA 1NF2A 2WPNA 1GUBA 3PFHA 2QROA 4INOA 5CGQB 1C8KA 5IK2D 1Z0KA 5F3RA 4A3SA 2A5GA 1M1UA 3KPYA 4UQOA 5AKJA 2HSZA 4MI3A 4MXDA 3ZQUA 1C2YA 3C5VA 4X85A 1TQ2A 2VHJA 1BWPA 1V2HE 4LPKA 5EE3A 4UBMA 4X7RA 4YJGA 1S96A 3GLTA 1YQTA 1G21E 2J5XA 2P35A 3AC0A 3IOYA 3OQHA 3PWZA 4HAOA 5IAKA 1R4NB 3SEFA 4LJLA 2A14A 3EWIA 1O94C 3NKFA 3E70C 2C5LA 1A96A 4GP6A 1P9OA 4JI1B 1UM8A 2JIMA 2C2GA 3UPTA 3B70A 2FU5C 3JAKB 3QPWA 4LI3X 4BEVA 5CB0A 1T5LA 2A1UB 1NNSA 2QSUA 1N5JA 1M73E 2ZTLA 2BR5A 2PZKA 3LV8A 4PZ9A 4GUAA 2ZDQA 2Q6KA 2XE4A 1KYQA 2JHAA 2PVPA 4GRDA 4X6YA 5CNMA 3HU3A 3K0AB 1RBQA 1BE0A 1VE1A 4M2LA 3GI1A 3W5UA 1LJUA 4A91A 3CY6A 4LISA 5COQA 5JMTA 3Q87B 3HNPA 3AIIA 3M82A 3ZK7A 2C0CA 4DSUA 2C7RA 3L5OA 2PUAA 3LVBA 4INPA 1MPTA 4QJ3A 5JXJA 3AERA 1ILWA 3FJ1A 1LFAA 3KYJB 4M6WA 1ZNZA 2CC2A 5EVCA 1D0IA 2LP4Y 4ME6A 4R2JA 2PO5A 3DKIA 4TYWA 5GGYA 4UHKA 1G2QA 2Z5GA 4RAQA 3E27A 1FBTA 5E8JA 4XPIA 2ACWA 4O4LB 4UUPA 4HDKB 4A6XA 3AOGA 3G9TA 3UJAA 1MKYA 3DAYA 3G79A 1HBJA 3DOCA 1I32A 2E89A 3LP6A 2AK2A 3H9CA 2QNIA 2G8LA 1ZAKA 1DXHA 2Q8NA 2ZEJA 3FLMA 5FNVF 3SC2B 4EM6A 3GLHA 4ZYWA 3Q9NA 3ECSA 4X8OA 1KC3A 3HV2A 4EJMA 4JWKA 4LC1A 3O4RA 4FWIB 4CQLA 1VA5A 4AKHA 5GM1A 3OZFA 3ENWA 3SZLA 4JQOA 2YWXA 4AAYA 1NKVA 2ZUBA 3TAUA 2ZG6A 3I42A 2GJSA 1L7PA 1NVEA 5I9NA 4LBWA 3TE6A 1J1ZA 1DQNA 4PC7A 1KDZA 3OCYA 5TR9A 2C99A 2WZDA 2BGUA 4F21A 4OREX 3VR6D 2PUBA 1EK5A 4UBKA 4MJXA 4C4SA 1RYNA 1OU0A 5KREA 1I2ZA 2AI2A 3K32A 1JFSA 4QPDA 5F3WB 1TK3A 3K2QA 4JP1A 3WL4A 4EKEA 2JKYA 3IBYA 5EWLB 1JSRA 2QP3A 3K7EA 1RCUA 4RIFA 3AMVA 4N5LA 2NWQA 4PLPA 4NFYA 3UWPA 2XCSB 5E3JA 5FOXA 3D54D 3C8HA 3LHDA 4EKYA 5KQLA 1C7IA 3WY9A 1HNZB 1JLRA 1YBHA 1ELOA 5F4BA 3FFWA 1HC7A 1WZCA 5KUTA 2JGLA 1J90A 1OA1A 1DAGA 1AX9A 2FFJA 1R9GA 4G1EB 4BAUA 3RIGA 1E9RA 2F8TA 1YDFA 3OTHA 3A6LA 3NPMA 5A4FS 4HB4A 1QG0A 4RNCA 5JSQA 5A0VA 3HDGA 5HF8A 4K9OA 3T4PA 5AKEA 4NU5A 3BD7A 5C1OA 1FDUA 1UFOA 3G7NA 4EJFA 3G0GA 1W2GA 4CG3A 4RZ3A 4DDKA 5IYZA 1YVRA 2Q4EA 3TLEA 4PSAA 3RK0A 3LGAA 5HRUA 2UUOA 2ONYA 3EXHC 2QTVB 1U7XA 5D3QA 1G6OA 5DWQA 4UBOA 1H8HD 1O77A 3DE6X 3KPJA 4MYDA 4I3FA 1JHVA 5JZOA 1GQFA 1Z0SA 2GCIA 3ABRB 2ZJBA 5CLLA 1AOXA 5JS6A 3OZEA 1A2KC 1MUUA 2B8EA 2QUHA 2XH8A 4Q9IA 3TW6A 2YKGA 2O5VA 3L18A 1EUZA 4AWBA 1LV7A 2ZSUA 4KR9A 1TT5A 4FW8A 4IHJA 5HCIA 2YASA 4LJ4A 3WK4A 3WYBA 3E58A 3LW7A 4YUVA 1W581 2O57A 5KCZA 3BMNB 4JVSB 4TXHA 1AHNA 1QZXA 3LK6A 4AKSA 1W93A 3D3JA 2XF8A 4KLNA 2B8WA 3IA2A 3V4OA 3CM0A 4JHXA 1AA9A 1JYEA 1AS0A 3OKPA 2GHRA 3JVIA 1SVLA 3KJXA 2HJGA 5A5EA 1AGRA 4UVHA 1E8NA 1JE1A 1NL3A 1IBRA 1U7ZA 2WI8A 3IS3A 3U3DA 1DI0A 2HNAA 1RAAA 3EZ2A 1KYIA 4FXOA 2ST1A 2XTMA 3KZ1E 3RQIA 1I7DA 5F98A 4WZ6A 5BUCA 1ORRA 4YYZA 1VJDA 2CE2X 4LDAA 3GLFE 4EF4A 4CJXA 2ZI7A 4G0UA 1MB2A 3ZGNA 4BV8A 1NRIA 3KU4A 5J4HA 5J2TA 1EX1A 4CUZA 4QKQA 5LQCA 3WGGA 1B3RA 1UZUA 3IKJA 4OGFA 2ZYRA 2ZTSA 3OTGA 1J2EA 2ZRKA 4LVNA 1E64A 3II6X 1HM5A 3GG9A 4J43A 4WNYA 4Y6GB 4CKZA 4PIVA 2X2EA 1BHSA 1Y3DE 3G02A 3A2KA 1QWOA 5KS2A 4IOJA 4OL9A 3FYUA 1SA0A 4XYLA 4UD2A 2V7UA 4FSHA 5EN4A 4PBTA 5ECDA 4BAGA 3F2IA 4CEIA 5AW9A 1ZY2A 1BX3A 4FFPA 3WTCA 4ENPA 5IM4F 5I47A 4G8DA 5IJ0A 2JD0A 5J4YA 2OXRA 1RABA 2O0JA 3JQFC 4ZK2A 2BFPA 3WYFA 2ZU0C 2ZBEA 3KEGA 3X2SA 3JVUA 2GK4A 1QHIA 5CCEA 1SZDA 4OQLA 5JO9A 4RK1A 1MO2A 2AC2A 4G0XA 5JFTA 2LV8A 4DSTA 2IY8A 3STUA 2QE7A 4LYDA 2EDCA 2E87A 1F1BA 3HB4X 3TYXA 4D4KA 3JVDA 5AD1A 4R68A 2RC5A 4FC7A 4BNGA 5LP6B 1GV1A 1IATA 3WDSA 1ODLA 1RWMA 3C3YA 4XR4A 4ARZB 4YRIA 1W47A 3KZCA 4Z49A 2GD0A 4BXOB 2NV2B 5JSYA 2XMZA 2XIJA 1LBSA 2X3YA 3ETCA 1CYEA 2VDOB 3EY4A 3GGGA 1V71A 1JMKC 1AHIA 1Y4UA 1GFZA 4H16A 4NAHA 3WSTA 1U1EA 1C0EA 4JDUA 5KPJA 1JIJA 5CEEA 3BE6A 1XK6A 2PJUA 1L4EA 2C5BA 4H35A 4P35A 1QZ3A 4F86A 1R6BX 5HX7A 5JY1A 4G5GA 5E6UB 4RTLA 2ZDGA 4TRNA 3SYTA 3QVJA 4DQVA 3L0OA 1C8BA 3Q40A 2ZLBA 4I7EA 3T7TA 3KDPA 3WQHA 2GCPA 1N2SA 4JX9A 3X1WA 1BJKA 3VVMA 6ADHA 3ZIAD 4LWQA 5EQTA 1X80A 3R7WB 1UBEA 2IDMA 4CL0A 3PYMA 1YR6A 1BCRA 2VUHB 1QCYA 3BXOA 3ONVA 2FPGA 5IDYA 3O3MB 4EB3A 1R7RA 4EKGA 1GOTA 4A5OA 1IDN1 2I3AA 4RXMA 5ICFA 3TB6A 3KZVA 3SHWA 3U1VA 1KEPA 5EZSA 4N12A 3VSDA 2ZRAA 4FCWA 1K8RA 1TT7A 3C1TA 7REQB 3T35A 1B8NA 4RHCA 3FTDA 4MDYA 4UZFA 4Y0VA 3R6LA 3W34A 2MIIA 1YI1A 1Y89A 4KXQA 4X9XA 1L7BA 2I6QA 1CEQA 5BURA 1N34B 3AGQA 1QF9A 3AF2A 3LLCA 1LWNA 4E2ZA 4YRKA 1GL6A 3JQDA 4OSOA 4R8VA 5DHUA 1F17A 2RONA 4HMOA 1NIPA 3FFBA 3UK7A 4B4WA 4NQRA 3H2BA 4LZJA 4EG4A 3WB1A 4C4RA 5KX5B 3IAS1 2MYTA 3FMGA 3CT6A 1AK9A 1JP7A 4M7OA 1TA9A 3E48A 2OM2A 4DNPA 1KIMA 2QUJA 4XD7D 4P81A 1XL0A 1NW7A 1TD9A 4DV4B 2VJYA 2VH5R 3JVVA 2YUTA 4PGGA 1TADA 5FFFA 1XZLA 1U0TA 3VKVA 2WWTA 4RS3A 2CVPA 3C74A 3W5AA 2ZYVX 1P45A 2NYAA 4ZT3A 3UHOA 2YBEA 2BFDA 2YVUA 5EAIA 4BC1A 3HP4A 3QLEA 4JLUA 3OLZA 2EVWX 1D0SA 1DIBA 4CTMA 4BMOB 3PR3A 2AFHA 3KB6A 3HFGA 1UQTA 3BWDD 1OD6A 4R6WA 3AZQA 2QM3A 1NW4A 1UC5B 2W6JD 3FWPA 2C9DA 4IEEA 3FBWA 1JG3A 4FKMA 4KXVA 3G8BA 4MV6A 3K4PA 4YUXA 4UARA 3OZSA 3RS9A 1MR3F 3H42B 5ALDA 5T67A 1XU9A 4PY2A 1CY7A 1OT3A 2JD1A 3PXDA 3KFVA 4RD0A 3OE5A 4KQMA 4NPHA 4BC0A 4FGZA 1SCUA 1R8QA 2YQ4A 3GEPA 4JI3B 1VJGA 5JROA 3C3XA 1OMOA 4IF6A 3TLBA 2YOHA 2Q5JA 3ICWA 3TDKA 1OBHA 3DEIA 5LYJB 4OQMA 4LJ8A 1BCSA 1FP7A 2WYUA 4PBSA 2MU1A 2J4DA 3NU1A 5JC1A 3BMQA 2GA8A 4U02A 2R7KA 2FEOA 3IKMB 1C30A 4Y7CA 3E9NA 3EUEA 1E61A 5E9JA 1TQHA 4COOA 5K0CA 1NMXA 1PNQA 1XU7A 1Z5VA 1JFLA 3SQLA 1MEOA 3UANA 1UXGA 2Q50A 2CNBA 3PFIA 4IVQA 1EIWA 2E6KA 3S29A 3KK0A 5BVGA 1RQRA 5A7HA 3I34X 3NBKA 2XDQA 2VUSA 1VBKA 2VL7A 1SFRA 3ZXUB 4CLRB 2ZK7A 4PO3X 1R88A 2WKSA 3CCFA 1FTGA 2Z4TA 4O5OA 4WN3A 1FX1A 1HUQA 5DFAA 2IX3A 5H59A 5ENZA 3IUMA 4K6GA 3CBQA 2N46A 1DX6A 1LI4A 3UO8B 4L5CA 4BO8A 3KBOA 4POOA 5LKAA 3JATB 3WLFA 1RXSA 1PJBA 1RAEA 5D5PA 3JS5A 1C3OA 1ESEA 1KYVA 4UM9B 3UMYA 1IFXA 2FSPA 5B7NA 3VTFA 4Q66C 1ZCZA 2B7BA 2WT8A 3O1IC 3WZMA 4ESHA 1F4PA 3PBKA 1IJBA 4IHAA 2IP1A 4G81A 5JE8A 5ELLA 5MN6A 1F6DA 4KLAA 1DJQA 1EP2B 2D62A 3P4UA 3MBOA 4DCNA 4QGSA 2P6PA 2HIAA 2NQ8A 2OEPA 2H4FA 2JFBA 1TZMA 3DMTA 3EG9B 2AF4C 3R44A 4UU1A 4L4RA 1R74A 2H92A 2XADA 4AJIA 1M34B 1QE5A 4PG4A 3ZU4A 2J3QA 3ZQJA 3CUEF 1CSEE 2CJWB 3UG7A 1F06A 1MG5A 1T8PA 4AJ2A 2CHVA 2F3PA 3LGSA 2ZTMA 4KDRA 2C96A 4B84A 5AVQA 4ZYUA 5AFSA 3AETA 3OC0A 1R5OA 3D2LA 5LC1A 1RRGA 3RS8A 3JWJA 3U4HA 1JAZA 1XROA 1U2RA 3EGIA 1FNBA 1Q91A 4HTAA 3LQYA 3SM9A 3CW9A 2GAOA 3K73O 1KQGA 5BRNA 4I1PA 2Y1LA 4L0DA 3CISA 1EP9A 2VHTA 3PNLA 2AYZA 4JLBA 3T1QA 2AXNA 4AX4A 4F4IA 4PU0A 3ONDA 5HE8A 3WSWA 1K5DA 4IILA 5C1PA 3FX2A 4LRWA 2JIZD 3O4VA 3CUYA 3FOBA 2A0YA 3FPKA 5HUJA 3CKLA 4NBKA 3N70A 4BVLA 1VOTA 3QPBA 1PS8A 4HDRB 1GQRA 4EX7A 5DN6D 4GSLA 3M6MD 4IEIA 4NICA 1IMJA 2G08A 2C88A 2X0DA 1Y9ZA 2O8FA 1H5UA 3BGSA 1GP2A 1OAOA 4N3BA 2FWBA 5CM8B 5L3QA 4HUTA 1JFTA 1KZGB 3ANYB 4O0MA 5TRTA 5KSWB 5EZYA 2F3UA 4KIJA 4RHFA 4UU7A 5B4UA 5FWNA 3VNAA 5JTUA 1VLVA 1WCWA 3OSZA 4N1AA 3ZH2A 3LGXA 1ZC3A 2YZNA 1XVUA 1XAGA 4OKIA 1AUXA 1PHPA 2CXHA 2A3RA 2YWCA 1V6CA 1HFJA 2ZWOA 2BRUC 5FTKA 2CJYA 2NPFA 2DC1A 5I7AA 4CQJA 3VKWA 1YGYA 2BAGA 3N53A 5BNIA 5DK6A 3IB3A 4CT0A 2GJKA 3RTDA 3FW1A 1ZUD1 3VKFA 3V1NA 1SUPA 2K4MA 1PZMA 3LDUA 4QDKA 2XPCA 4GOND 1NQWA 3ADOA 2CVOA 2QMHA 2WJPA 4HQOA 3CFYA 4ZYVA 1GNLA 3B1VA 4ICIA 1JQ3A 3N5CA 5KYWA 1DSSG 2B20A 1Q20A 5IP5A 3D2CA 1RHQA 2C2KA 2HBRA 3HBJA 4HAYA 5BQXA 1A9XB 5J4KA 5KSZA 2O6LA 3KYBA 1XDZA 5T4EA 3VJMA 1M5RA 1SZCA 1K3TA 3QIVA 4R7ZA 2VRNA 3FTEA 2QTBA 4QASA 1KSHA 3G0CA 3PGVA 4JP2A 1ZXBA 2N47A 5FR2A 3R75A 2P75A 2HWXA 4TN5A 4PRZA 3FSJX 3IB6A 4D5GA 4C0KA 3NTQA 4BMXA 2XDQB 4IFTA 1PUIA 2DUMA 4ZXPA 4C0QC 4F5WA 4XIJA 2CXSA 3N2ZB 3F78A 2CLFB 5AVXA 2JG3A 4RW0A 3S2YA 3O94A 4MKRA 3L8GA 1IHOA 1VQ1A 2C78A 1TCUA 4PS0A 2CK3D 1G16A 2RG1A 1YR1A 3ABOB 4KN8A 1WDWB 3S8MA 5LDDC 5LZ5A 2MWMA 2BLLA 1Z4LA 3T4EA 2A9KA 2CXNA 4I81A 1E1RA 3A0UA 3JASB 3K6RA 3LE8A 4NK4A 1JHRA 2VZEA 4KGVA 5CYOA 2REXB 2QRNA 4G1BA 3U3XA 3IIJA 2NZWA 4Q4HB 4KXYA 4TTQA 5HDBB 1IN8A 3TI7A 3H3FA 5DJ5A 4CQMB 1H9BA 2YOGA 3HN2A 1A04A 1OXVA 5JSKA 3SZRA 4BNZA 5CEJA 5KTTA 3F0TA 3ZDDA 3F90A 4RFLA 4M36A 4TT3A 3EXHA 3W8NA 4NIMA 3UT5A 4IV5A 3HDVA 5LVAA 4IRXA 4F1WA 2BYTA 2BFEB 4EH1A 2G9QA 4BMYA 4BO7A 1Q0SA 4CIWA 2P4HX 2IS1A 3DO5A 1YE5A 3T7DA 3JQ7A 3Q5DA 3NGMA 2REQA 4WJZA 4TTRA 2QT9A 3WB2A 3FOZA 1RTKA 4IDGA 4QU0A 4GL2A 4ER7A 3I6YA 2JB9A 4QQ8A 3GRAA 1XCOA 2PTHA 5FV4A 1XDDA 1TECE 1AQIA 1UKCA 1JIUA 1UADA 4XIYA 5FPYA 1S8AA 4PO1A 3LZCA 1U90A 3FNIA 5BOSA 1H9CA 3WMFA 1LEHA 4JP8A 1TJ4A 4B6QA 1LTKA 1GPWB 1X7WB 3OU7A 2GVZC 4Y1RA 4GT1A 1QH8B 4BLUA 3IQEA 4HDNB 2RKBA 1XXLA 1JN0A 1Q44A 3QUQA 1HI9A 3OIDA 2WWGA 4ER6A 1BEZA 2DFKB 2Z3VA 4K6CA 4KUEA 5H3HA 5LBTA 1CUCA 4C2AA 1W36B 5ER6A 5EJ4A 2BBWA 1QTQA 2GEFA 2J32A 1JXAA 3OJCA 4JJ6A 2CV1A 1T2EA 1Y6JA 2DX7A 2AG1A 2P90A 3QWHA 1F5SA 1N5OX 4U7JA 4EWLA 1NV9A 4DN6A 4H0FA 2HCFA 1U0GA 2I7CA 2ZWMA 2C9BA 4HWRA 3TL3A 1AQ6A 1VL0A 2EBHX 2HIHA 3DD1A 4HLQB 4QBHA 3A6HA 3K0CC 5ECGC 5HFNA 1R0BA 1DDGA 1FSGA 4QQKA 1USIA 1JMYA 3UUGA 3WKBA 4YYEA 5K3DA 2HM7A 4W9MC 3IQDB 2IBSA 1OLUA 1Y82A 4GOLD 4GX2A 4QEDA 4AMVA 5TS2A 5K6RA 1X3LA 2QR3A 2B8TA 4MP8A 2CLIB 3LTEA 3HDYA 4FFLA 4HFNA 2YTZA 1XF9A 2D5IA 4J0EA 4RF2A 5CNIA 2DCUA 4EW2A 3RRYA 4UJ3A 1OXXK 4NH4A 5TQ0A 1NONA 1VM6A 2GYVA 3T5MA 2F43A 2M98A 4DLNA 5CDTA 4ZTUB 2I8LA 3IIKA 2QE6A 2G40A 4ZT5A 1LW6E 2C2BA 5ES4B 5GADl 4FJ2A 3CJQA 1FP1D 1J42A 3HLKA 2FPXA 4OAPA 4B4KA 2WNSA 1ZOOA 3FUVA 2Q1WA 5BSFA 2CUTA 3FNFA 4HMPA 4WLEA 3TVDA 1ODTC 3DP7A 1CY0A 2QW0X 2M9MA 2J5QA 5D5HA 4UAVA 2I7TA 1IY9A 3ANTA 2I87A 4TXLA 5K03A 1I4LD 2MDTA 4M7PA 5HIMA 4EGJA 1K8XB 4DIFA 4XGQA 3TXXA 4UC0A 1H2BA 2CMHA 2O4UX 4PZ0A 3T1NA 3ZJ5A 4NXNB 2ROQA 3T6KA 2Q1YA 5L7WA 3S2UA 5A04A 3V1UA