3ELHA

X-ray structure of acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with dudp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
133
structure length
133
Chain Sequence
AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDSAVDEISIWFPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 41
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3elhA00
2DYAA 4FKXA 2BX6A 1JXVA 1NSPA 4S0MA 1HLWA 3ENAA 3VVUA 1NCLA 3FKBA 3ZTQA 3WX8A 3Q86A 2CWKA 1EHWA 4CP5A 1KDNA 3FC9A 1NPKA 2DXFA 1MN9A 4ANDA 1UCNA 3R9LA 3EE3A 1F6TA 1XIQA 3BBBA 1LWXA 1NSQA 3FBEA 4FKYA 2B8PA 5BXIA 1S59A 3PJ9A 4ENOA 1PAEX 4F36A 1NDCA 1NB2A 2VU5A 2DXDA 1BHNA 3MPDA 3VVTA 3NGTA 1BE4A 2B8QA 1HHQA 4WBFA 1B4SA 3ZTRA 3B6BA 3Q83A 4DUTA 3EMTA 4DZ6A 1NUEA 3FBBA 3DKDA 3ZTSA 1F3FA 4W98A 3BBFA 3ZTOA 2HVEA 2HVDA 3EM1A 4UOHA 1XQIA 3ELHA 3EVWA 5IOLA 4UOGA 4ANCA 3DDIA 2DXEA 1NDLA 3NGUA 3EVMA 3Q8YA 3VGUA 3PRVA 3EJMA 1S57A 3Q89A 4C6AA 2DY9A 5CAAA 3B54A 1NSKL 1WKKA 3G2XA 1WKJA 3NGSA 4KPCA 4EK2A 2ZUAA 4DI6A 1BUXA 3GPAA 1WKLA 1S5ZA 2AZ3A 3FCWA 1HIYA 1ZS6A 1LEOA 3VGTA 1W7WA 5CABA 1NDKA 1K44A 1NHKL 3ZTPA 4HR2A 3VGSA 1PKUA 1U8WA 1NLKL 3BH6B 3GP9A 4F4AA 3FCVA 3BH7B 3JS9A 3EICA 4ANEA 2BEFA 3FBCA 5C7PA 1B99A 1NDPA 2NCKL 3Q8UA 4UOFA 1MN7A 3EVOA 4O0NA 1VYAA 2AZ1A 2HURA 3L7UA 3BBCA 3NGRA 3VGVA 3ETMA 3FBFA 3Q8VA
chains in the Genus database with same CATH superfamily
5LMUJ 1U2FA 4FKXA 1U1MA 3SXLA 4IRDA 1FNMA 1UKUA 4L73A 2JFDA 4QYZJ 2HHWA 4B3SJ 2WOMA 4LRDA 3MPYA 2VG5A 1RWNB 4G6VB 2OTLS 1Q78A 3FK4A 2QN6B 1HNVA 1S77D 4OI1A 1YJ9S 5CYQB 2YXLA 3ZC4A 1B4SA 1HQ2A 1FRXA 1Q8IA 1SUQB 4KJIA 2NZ4A 1W2BR 4OHYA 4OLPA 4URGA 4O0IA 3PR5B 5U47A 2E1RA 3PKMA 3GWCA 2UXCF 3RG6A 2V4RA 3D4JA 1HNIA 3MMCB 3LA0A 1RWKB 3GG0A 4PUOB 3VQTA 1QY7A 3GJQB 3UI3A 4EEYA 4PRFA 4UTGA 4GKJF 3BGUA 5K8NA 2AQ4A 1HLWA 3O2IA 3NCRA 3ET6B 4YMEA 4NOHA 3K58A 3AODA 2EFNA 1RT7B 3IG1A 2C2ZB 1RCXB 1O0PA 3H98A 4F36A 4K4VA 1LFWA 1NBEB 3H42A 4OYWA 4M5NA 4YP3A 2B3TB 1JQGA 4A8KA 1NMEB 1KQKA 5EX3A 2IDEA 1D1UA 1W26A 4FYYB 4M5DA 5IOLA 3PW0A 2B0GA 1ZA2B 4P75A 4OYZA 4NLOA 5LXRA 2D69A 2M8HA 2F1FA 3UD5A 2ZH3A 4IOAQ 3EGVA 2VJUA 5KFAA 2DGQA 4R5PB 3TQ1A 4IO1A 2UU9J 3ZZTA 4IDKB 4C8KA 5DM6Q 2VG7B 4DR4J 3I4PA 3IM9A 2Y0SD 1YITS 2H9ZA 3ZNJ1 3CUNA 2D9OA 2WVDA 4IG3A 4NCAA 1N0UA 2RE1A 2I1RA 3CCMS 4I2QB 4M5KA 3UVJA 2OTJS 3LWMA 4JUZA 3TZXA 1TTHB 5C2CA 3FRZA 2JHEA 1NSQA 3LP2A 1U47A 2XMJA 1JX4A 3OSNA 4BLGA 3GR0A 4I6AA 3UD3P 4JI1J 2XMUA 4L74A 1FWKA 4LFAF 5D3GB 3M30A 1HL6A 3KG0A 1WF2A 2COLA 1V3RA 4UUXA 4UOGA 3PO5A 4WU3A 4EI2A 2YH1A 2H4YB 3QO9A 2HNYA 4JI7J 1YZ6A 3AXKA 3C2PA 4JI2J 1T0TV 2V34A 2C3OA 2E29A 4K2XA 3RBDA 3H7HB 5IFMA 3EGZA 3OBIA 1KS2A 2B5JB 1PBAA 3AB2B 5F9LA 1EP4B 1RTIA 4HL9A 5IM0A 2QGFB 4O3NA 4IH6A 1U7LA 2FVRA 2W25A 2CQ2A 1F3VA 4ED8A 4NEYA 1EQ0A 3QRRA 2MPUA 4ZHRB 4XTTA 3MMBB 4RX6A 3EGWB 4ED5A 4F04B 2JNJA 1XBWA 4Y3CA 5KFDA 2O5DA 5F8LA 4J7CA 1RWXB 1VJQA 1ZAXA 4DHVA 1OS5A 1MSWD 2MKYA 3NAHA 1DY3A 3K57A 2HQFA 3VAKA 1NUEA 3R5BA 3HXMA 1RWPB 1KKHA 3NWRA 2HVDA 2HNZA 3M6XA 3OSPA 1UWAA 1SPBP 2XLIA 1HQEA 1EKRA 1JMTA 1SIWB 5K5MA 3H40A 3HVWA 5D4NA 1RBOB 1YLXA 1FHTA 2CQ0A 1U26A 4AFFA 1DZ5A 3GU0A 4DR7J 2BW2A 2R7QA 3HKWA 4EGLA 1MROA 2PDAA 1YQHA 2I6WA 3OFEA 1R6VA 4ECUA 3DRPB 1M0SA 4V19X 3HSDA 2AJ4A 2DNYA 3MGJA 2OI2A 3D0HE 2FVCA 5HI7A 2CPZA 4OYAA 4B17A 4FXWA 3NNCA 4TY8A 3RBZA 1MWZA 4KC5A 4DR5F 3AAWB 1NKBA 3MCNA 2EC0A 1UZHA 2RS2A 2BKNA 1NB7A 2E1MC 1K47A 2YH0A 4EBEA 4PXEA 4Q2MA 2MLYA 4YDXA 2CQIA 2W9BA 2VQEJ 2BA9A 2LEPA 4CLYA 1MNEA 5AE3A 2HFNA 2DRBA 3MM6A 1TZ0A 4O4GB 4KT0C 4DPUA 4CIOA 3KHGA 4CTAA 1WNEA 1WORA 4ICLB 4CO4A 4LBHA 3SDEB 4NYZA 4F7VA 2DEIA 3AJDA 4IFVA 1U8WA 2ZE2B 1XMOJ 4XK8C 3NNAA 2VFTA 3I0RA 4EMDA 5KG2A 2QMXA 3UCZP 4QW9A 2C3YA 1TKDA 3L7PA 2VBXA 3OVBA 1MLAA 1KDNA 5KFSA 2XLKA 3LP0A 2EEYA 2YNIB 3GV8B 4Y2CA 2FJDB 1TL3A 3RUBL 5IC4B 1I1GA 2LLZA 6AT1B 2NYHA 2D74B 4CLLA 5EWEA 4IRKA 3AOAA 2ATLA 4J9RA 4C3KA 4DR6F 1SC3B 4G1QA 4GKKJ 3M05A 1YJNS 2KT2A 1RWUA 2BXJA 3GYXB 3K7RA 2A10A 2FTRA 1VHIA 3W60A 4OL8A 1FKPB 1YBTA 1S6OA 3ISNC 2RF2A 2V5HG 2OJ3A 1NK5A 1Y5LB 2WB4A 2V69A 4DUYF 1BD6A 2RS8A 4Q8FA 1X4HA 1WJ9A 3QJJA 4BWJA 4XAKA 4KSEB 4U95A 5KOXA 2C3PA 4JYAF 1N33F 2FHJA 1ACMB 5KFUA 1RT1B 2QSWA 2P9EA 2HBZB 3H2VE 2CADA 1RZMA 3G71S 4ED4A 2DNKA 5LT5A 4ZVPB 1S9FA 4LFCF 3G9CA 7FD1A 4DS5A 3PG9A 1KTVA 1URRA 1T9TA 2OEMA 2VV5A 3MTJA 3G6ES 1VC0A 4KHRA 1Z2ZA 1FD8A 1HKAA 3MAQA 1JLGA 1QE1A 1P9YA 4G65A 1PBUA 4WFYA 4PZVA 2UXBJ 2HHHF 3MM7B 1SVDA 5EWGA 4LSLA 4DX8H 2HPUA 5D8HB 2ZD1A 3IBCB 3CO0P 4RW7A 1HD0A 2F4VJ 3K8WA 1X4DA 2J8AA 2G0JA 2OUGA 3HVTA 3MCOA 1WD6A 1GTEA 1TVRB 1YJTA 3DMJA 5A8RA 1EZZB 3MUMP 3UN3A 5C24B 5HN0A 3NS7B 4DI6A 7AT1B 2AU0A 2LKZA 1RT2A 2AGQA 3OUYA 3V6HA 4JI4J 2D41A 4R0EA 4ZPVR 1VRUA 2VICA 4I6YA 3P5TL 3TUJC 4NZ7A 2QA2A 1B0TA 3I56S 1O6XA 1RTJA 3H8YA 4C0HA 4DR2F 4PXCA 2FZCB 2XGQA 4PPDA 2ZM6J 4MKYA 3DNCA 4WP3A 4ZLJA 4B9TA 2CXEA 1RYSA 1PC4A 7FDRA 3ILLA 2XQCA 8RUCA 2OGUA 4NL5A 3BSNA 1DTQB 1F9FA 4I67A 4MYTA 3A1YG 3KJQB 3DU6A 1S1UB 2MQ8A 3O3LA 2UXDF 3QNWB 3LAKA 4B3TJ 1LWFA 4DOZA 2H4WB 1B64A 1DFDA 1L3KA 1NDLA 4PCQA 3H2UB 3CCJS 3IWNC 3R7SB 2ZBQA 2E1AA 3HD1A 2MQMA 1NM2A 2RRBA 4IOBA 2M0GB 3SEOA 2FLPA 1OJ4A 4XPCA 3CMES 2UVVA 1HWLA 1FA0A 2MEWA 3DDNA 3SQGA 4J9NA 5IS2A 4EO8A 3HHLB 1FRKA 3KLFB 2GO8A 2H51B 3PM9A 2ACYA 4B08A 4DLGA 1AXQA 1KP6A 2WAQD 2BJEA 3T5HA 3SSSA 3DC2A 4OI6A 1IWAA 2VBYA 2MZJA 3UW1A 4QPXA 1F9EB 3ZZPA 4DL5A 3HO1A 3L95X 1GMVA 1JJHA 1FRHA 1RAHB 2X1FA 1IQZA 1SUQA 5HBMB 1KOHA 5IQQA 2AGOA 4OZ1A 1NNDA 3IP0A 2HHTA 1N34J 4DV7J 4BC9A 4I7FB 3VR1A 4CRJA 2XBPA 3FDSA 4PQAA 1S57A 1Y7PA 4KYZA 2JOQA 2O01C 2V94A 3P5BP 5A8KB 2JLFA 4R25A 3W8PA 1HMVB 1VK8A 2IYGA 3V81A 2CQPA 3MMCA 2GVDB 2YWFA 4PUOA 5HP1B 1UA1A 3R8YA 2KI2A 2RUSA 2X7IA 2M3DA 2PC6A 4HHHA 1NJIT 3QGPA 4C3LA 2Z56B 2QSFA 5C5JA 1J5EJ 1B3TA 1QAIA 3ET6A 2J76E 5BR8J 5GMEA 3TX8A 4K0KF 3C14B 3PW5A 2ADBA 1IKVA 2B51A 3IAS9 5AJ3F 2RVJA 1TQLA 3T1AA 4N47A 1NK8A 1T9YA 3PYGA 2NLWA 2JVRA 1NJZA 1VQ4S 1HHTP 1TL5A 1GXLA 1FD2A 3RBXA 2OH2A 2VIHA 3G82B 4HTIA 5D15A 5J1NA 5KFRA 2I9SA 4RU9A 2HAFA 2JLEA 1WHYA 1JJ2R 1VQKS 1XMQJ 3VQSA 1Q81T 3ISND 2HHUA 3ILOA 2BOAA 2Q6BA 2I0XA 5GMDA 4HLBA 4KPCA 5H9FJ 1HHSA 2MMYA 3PTWA 4B9VA 4IDKA 1HBOB 3FEYB 2XC9A 2VG7A 2DNZA 3E2EA 5RUBA 3KHRA 5KFXA 1LWEB 2J0SD 3CCTA 3VWSA 3N0VA 3OTCA 3IRWP 2AT1B 3LPEA 1Q8KA 3ENAA 2UV8A 4I2QA 3K5OA 4JI5J 1YKWA 3K8VA 3R1LA 3SIPB 1UMJA 4AQYJ 3QJLA 1FF2A 2PFFB 1NXIA 2HFOA 1TL1B 1CLFA 1UW9A 3VZHA 1ZTTA 2J8SA 3CJQA 3E8OA 2M52A 4B3MJ 2DCLA 2WBMA 2ZH2A 4CO0A 3R6GB 2QIFA 2AWZA 3DLLQ 2G1DA 3V2UC 5M2PA 2V8PA 3CCSS 2C2KB 1T95A 1CULB 4K4UA 3UDCA 1GNKA 4JI3J 1U6ZA 4L72B 3EJMA 4KGVB 1NSKL 4P2SA 1UEVA 1RT6B 2HZVA 4LF7F 4RW9B 4A8WA 5HROB 2RB7A 4WTYA 5GADI 3ZFVA 1I51B 1HR0F 4WXOA 1TUGB 2JJ4D 3MEEA 1JLCB 3J7AN 2BJ1A 3D3CJ 3K5NA 3UFCX 3QZ8A 2B9EA 1KVJA 1QLNA 2Y1JA 1H98A 5BYSA 1VBXA 5LL6d 1CVJA 1FESA 4JI8J 1OY6A 3MD3A 2FJBB 2VA3A 4WWSA 1NU4A 2F9DA 1U2RA 3A13A 1B7FA 1FEHA 2XCAA 4LF4J 2W2NP 4O3PA 2MQQA 1BE4A 5EHHA 2YTCA 1OPZA 2IFXA 2W2PP 3CCZA 4WFBQ 1WOSA 1REVB 2RU9A 4EU0A 5ITHA 2Y8YA 4R0JA 1OO0B 1NPPA 4RNNA 5KG3A 4M5GA 4OZ3A 3EPIA 3A8JA 3GLJA 4M5MA 5A0YB 2C2NA 4USWA 3CJ8A 1S1WB 1VFJA 4KGZB 4DFPA 2D3OR 2NXNA 4JV2A 4EUVA 4P6QA 1F5BA 3QRQA 4ED3A 2PE8A 1L3SA 2YPZA 1PYOB 4IG0A 1F5CA 1NKCA 1C0UB 1X8DA 2YWHA 1HW8A 2UZAA 4C0BA 4F3QA 3MMAB 2HLTA 2OIHA 1NK9A 5ETVA 5HO4A 2K06A 4PXDA 4TKTA 3ZTQA 3C6TB 3H5SA 4OZLA 4QWCA 3DLEB 4ES1A 5AXNA 1S6PA 1DTTA 3PX4A 2LYVA 3CXCR 1XEZA 4DCJB 3M2UA 1SBRA 2HHSA 3N4WA 1JLQB 1QD1A 3IN5A 3DM2B 2C3MA 2RJZA 2XB2D 2OLWA 3RB3A 4JI0F 5KFCA 4QBUA 2UVRA 3HHLC 2GS8A 5C25B 4DBQA 3DU5A 1VQMS 2B9WA 1XTZA 2P9GA 3OVAA 2BVZA 4H4MB 1W25A 1UAWA 4GKJJ 3QGIA 5J2QB 3THPA 2CDQA 4O4GA 4DF8A 2XMKA 1NH7A 2GO9A 4DQQA 2XLJA 2IBKA 1FRIA 3H59A 3ICLA 2DVIA 1KFDA 5DRKA 4LRCA 1T05B 2JWNA 4HR2A 5F3TA 1GAOA 1WTBA 3AT1B 1GT8A 3D66A 3IWLA 4RR5A 4M95A 4EFAC 3BM7A 4HHUA 3I5AA 4ZP6A 3JSMB 1C1CB 4D3HA 1P1LA 1TUVA 3DOMB 2YNFB 2PA3A 1OPIA 2HWIA 3BKTA 3KKFA 1MMDA 4ECSA 2Y1RI 3N9UC 3R9LA 5KFIA 1GTHA 1XR5A 1U49A 2YNIA 3MR5A 5I4MA 5D78A 1KTQA 3GFZA 1VQSA 2HNDA 2MTLA 1G4CA 2VF3A 2FLOA 4NXMF 4AT1B 3W2WA 1NPRA 4UOHA 3DGVA 1K73T 2RH3A 1GH8A 2QC3A 2DCUB 1X5OA 4HH1A 3UDLA 3ZZOA 2D9PA 4LBIA 2O66A 1BQMA 1X5PA 4CLTA 3VGTA 3UD4P 1I6JA 3LGHA 2MZSA 1NLKL 3LH2S 2VPXB 1RT3B 1T3OA 2BE7D 3Q8UA 2ABYA 3EVOA 1SH0A 3AD9C 4A8FA 4CLUA 4LFAJ 2DITA 3C16B 1U2CA 2LEAA 4F0HA 5D4OA 9RUBA 4F26A 1IBKF 3MCSA 1OQ3A 5ETKA 4LUBA 4OIXA 1XIQA 3IGVA 3JSYA 1QAJA 4P10A 3P96A 2QV6A 3A3NB 4CNYA 4EBDA 3R2DJ 1GXTA 2QA1A 3CSKA 3MM7A 2JFKA 1OSCA 3NGKA 5KG5A 2YQ1A 2EFGA 4MIWA 3GTYX 1N32F 3MMJA 2QO3A 1IR0A 5D0GA 5B0DA 4ZLPA 2EFQA 2L3MA 1QTMA 5J2PB 5C24A 3RBEA 2J7UA 1R27B 1GMUA 3G4SS 1S5ZA 1U02A 1O8BA 3D3BJ 4PR6A 4CWBA 2HS3A 1VBYA 1PKUA 3GB0A 2Z8QA 3PIOQ 3C6UB 2LQ5A 5C7PA 1IR1A 4DV1F 1VQ7S 2Z2LA 3QIPB 3US5A 1TKXB 3VGVA 2E5JA 3WC0A 3G8TA 1JNZB 2CJ9A 1SKSA 4DUZF 5I3PA 3R5AA 2KVQE 1SV5B 4URSA 4CO1A 2F9JA 5GVQA 5KFNA 1SC1B 3HSGA 4IKAA 3BS9A 4XDDA 2N7YA 1S9EB 1UTAA 1S1UA 1HFEL 3N6NA 2VA2A 4DDFA 2VUGA 2Q3PA 1UJ5A 2DTJA 3IGNA 3JTOA 5FDLA 1LFPA 1ZTWA 3DOKA 3FJ2A 4EBCA 2E9TA 5K14A 1FRJA 1R8AA 2VZ9A 3LTOA 3A3PB 3AB4B 5E5NA 2ZITA 5IXUA 3KG4A 5K8PA 3T1YF 1ROFA 2LQ8A 2CKWA 3TWZA 5F8MA 5CZVA 1Z4UA 1APSA 3Q8RB 1RT4B 5L1LA 5J2MA 3SCLE 1S79A 4YR3A 4WP9A 1TV6A 4EWTA 1RACB 5DJBA 3Q2TC 1AW0A 4DR5J 3G6XA 1GFWB 3QRPA 3HKZD 2W2OP 1DLOB 3IR5B 2DIUA 1FX2A 4OYOA 2RILA 1FDAA 3NGDA 4OLOA 3SMZA 2KU7A 1OYDA 1IJFB 1X4CA 2XS2A 2XS7A 1PJ6A 4LT6A 2RQ4A 2ZUGA 3M9NB 3GSDA 3HHLD 1U0SA 4GVBB 2YQ0A 1N4LA 2XHCA 4KHMA 3PY8A 4KKOB 5EUHA 4QJVA 4HACA 2XM3A 2CQ4A 2BACA 5HBMA 2IMWP 4TLQA 2K7JA 5H1SV 3ZTOA 3KFWX 2OEJA 2PGCA 4IRCA 1UVJA 2NPIA 3HX9A 1NK7A 4Y2AA 8ATCB 4I7FA 2B7BB 1Z2LA 2HWHA 3CDBA 1WC6A 3V6DB 3QFHA 3AA8A 1T8EA 3TAMB 2NREA 1HMVA 2HFZA 3RR8A 5A76A 4ZVOB 4USTA 4NPOA 1WELA 4RW6B 3WIVA 5B09A 3JB9k 3CJRA 3OVSA 2YPYA 2W1BA 2CG8A 4G3IA 3OLAA 1EKSA 3M9OB 4YY3F 3ZZUA 2B4OA 3F44A 1VRTB 1NRKA 3OLBA 4F4ZA 2MJUA 4DR6J 3C14A 1WUUA 3DLKA 1VOMA 3MI7X 3CJ4A 1YRXA 2R7WA 4WKRA 2EFVA 2HEKA 2GHVC 5D0EA 1V5IB 5K8OA 2EKNA 1HYSB 3DXSX 2P8IA 2CZ4A 4DUYJ 1Q82T 2UUAF 3SZ2A 3FBBA 1CJTA 2YNHB 4OI0A 1V6HA 5DQGA 2ZJQQ 4OV1A 2RMLA 3JYTB 2YWWA 5FLXU 1TL4A 4RUAA 1F1BB 4ZITA 5HVFA 4JI6F 4CO3A 4NMXA 2FLNA 2FD2A 3CJ3A 4LFCJ 5C42A 4OJ3A 1LWEA 5IV3A 5FLXY 2G9OA 3IO1A 5T7LB 1LW0A 1CPZA 4HT5A 2MZTA 3KYLA 5FJ4A 3AJ1A 2IRYA 1UVLA 1FRMA 3RB6A 3Q2SC 3UWTA 4Z7YA 2MKJA 3T6BA 3O44A 1TL1A 4DSKA 2IC3A 3CW2C 3MPUB 2FZKB 2KT5A 4OHXA 4LF8F 1RAOA 1HARA 3BYPA 4F4YA 3TZYA 3H5YA 4WIQA 4DR1F 2X1GA 4WU2A 4A8QA 4L3KA 3S8SA 1RADB 3M8PB 4LSNB 3HHDA 3QLHB 1GEHA 4QCLA 1D9FA 1M5KC 4LF6F 2HGNA 2IY5B 4FS2A 5EWFA 4F2SA 4IR1A 4DR2J 2HHVA 2AYMA 6FD1A 2KYZA 1VQ9S 2V50A 4RW9A 5HROA 4A8XA 3M32A 3K59A 2ADCA 2QA4G 3HVAA 3I5BA 3DRXA 3TQEA 3OR2B 3BR8A 3GCXP 3O8WA 1JLCA 3OJSA 3G87A 1YSJA 1H0HB 1MN7A 2UXDJ 2M4MA 4J9VA 4WKYA 4DJBA 2P6SA 1TL7B 2VOPA 3R7NB 1RYRA 3CD6S 1CJKA 3THTA 3QFWA 1S9GA 4ED2A 2GCFA 1C2PA 3FQLA 4M94A 4OX7A 3HZEA 2MQLA 2L48A 3O6QA 1RUSA 5CYMA 3HP6A 5H9EJ 4K5RA 3W9HA 3D5MA 4V19J 3W2VA 1UPMB 2PT0A 1S1WA 2XWXA 1S1VB 1K0VA 1Y0HA 4RNOA 3QT5A 4TVAB 4K8RA 3SQOP 4CYUB 5GADU 1WG1A 5F8GA 4O3RA 2HVIA 2G2ZA 4U7UK 4NMLA 1CEZA 1WKLA 5IQ6A 4OYMA 1C4AA 5JMNA 2JL9A 2R4FA 4O3QA 1G1XA 3BH7B 4NYOA 1LQ9A 3MMAA 2E7XA 4X64F 2ZVIA 3NGRA 2GGPB 3I4HX 1WHWA 4NA1A 5ETQA 3C6TA 3CJKB 4QPTA 3DLBA 4P73A 3DLEA 2CQDA 2MKCA 4PWUA 4LBPA 2RQCA 2JX2A 4RPFA 5AE2A 2YBVA 2KFZA 1JLAB 3HFZB 3LOUA 1QVGR 1JLQA 2CZVC 3RYLA 3DM2A 2H65B 2FB0A 2BZ2A 3Q23A 5C25A 1R89A 1BHNA 4M8LA 4QIEA 1HHQA 2R2TA 1SJFA 3T5JA 4H4MA 3PFEA 4DCOB 5J2QA 3WX4A 4YB7A 2KM8C 1U45A 2B4VA 3RAQA 2F3JA 3N28A 1LNQA 1RKJA 4OJ1A 4K0KJ 2DHSA 3CJ2A 2HK3A 2NS1B 4ERDA 1T05A 4L6V3 3W9JA 4OHVA 3G8SA 1EIYB 2QT7A 5AJ3J 1FJGF 2R2SA 4X4VA 1IKXB 3JQMA 4N56A 4UY8T 2I38A 3MAHA 2ATCB 4PG7A 5CCLA 2GMLA 3JSMA 3UQSA 1WF1A 3OPKA 1VQYA 3QT8A 2YNFA 5DLGA 4Q5VA 2VQFJ 5DDQC 3NBPB 2W9CB 5AXLA 4ID5A 1WHVA 2LA4A 4CO2A 2XI2A 4GO7X 4QU6A 1IKWA 4KO0B 3F0NA 2JSXA 2V63A 3BYRA 2ASYA 3SSQA 4KE5A 1U1OA 3BQ0A 1LW2B 3KTQA 4KFBB 2LP4A 4H4KC 1SJ3P 3MM9B 2E5GA 2ASJA 4PWDA 1VRQC 4DQSA 4JBCA 3S7RA 1BC6A 1N5QA 5CD4H 2R7OA 1SH2A 4FYVB 1WF0A 3MURP 2Z0GA 4B02A 1FVQA 2NQPA 3ZTPA 2OAUA 4PPZA 1Q79A 1RT3A 3E01A 2XZDB 5G0RB 5F3ZA 1RTZA 2VODA 4L75A 2K1RA 3ADAC 2IVMA 3QGHA 2A6MA 2ZFHA 1UFKA 5EN1A 1YRUA 4OYPA 4UF4A 4MFBB 1FKOA 3JTPA 4ZVGA 3VHQA 5A6WA 2DHGA 4LF7J 4MK7A 3GFHA 2GV1A 4MT1A 4C48A 1EETA 2JEIA 3TUIC 2VBZA 3H2LA 1KHVA 4NCGB 1HR0J 5J2NB 4TU7A 3TEHB 1RWOB 1GMWA 5GAGI 1OMSA 2MYFA 4ES2A 1E6VB 3EM1A 1AFJA 2NUHA 2AGPA 4NLTA 4C4WA 2H48B 5J2PA 4YQWA 4C6AA 2CQHA 2CWXA 2JVOA 1VMBA 3PW7A 3FZ2A 5D0HA 2I8EA 3P45B 4IFYA 4DSFA 4TU8A 1KFSA 3C6UA 3OFGA 3NCQA 4ELUA 4ECRA 4NLUA 1TKXA 3I87A 3PV8A 4RW4B 2HQDA 2WTFA 4P2MA 2MZRA 1X9MA 1HW9A 1PCAA 3RTVA 1N36F 2P6TA 3OFHA 1DQ8A 4WK1A 3CTRA 3C19A 4RWWA 2IIHA 4QZVB 1SV5A 1A9NB 2DIVA 4NZ0A 4NRUA 1KD1T 1QM9A 1S97A 3TZWA 4PXBA 3WQPA 1NO8A 3VZIA 2ZBCA 1KLMB 4ZS6A 3CDUA 3AQOA 2HQCA 3PACA 3C15A 4Q45A 5IV4A 2OHDA 3CJ5A 2RU3A 5AXKA 2YNGB 4YUDA 3R5DA 1PSDA 5DETA 3PW2A 4DSEA 3U27A 3KJNB 3EZOA 1SC4B 3TZZA 3M9MB 4RLEA 1H3DA 5I3QA 3M8WA 3BDPA 1SCJB 2HS0A 1S0VA 4P7TA 1Q86T 5I3UB 4KPYA 1DLOA 1YG0A 2LU2A 4PQUA 4JI0J 1ITPA 4QIVA 2B6AB 1VR6A 3GIJA 2YKMA 1JIHA 2F65A 2WVEA 4YN3B 2CJQA 4NLRA 1E6YB 3CIMA 3PFOA 1ZOTA 3D6MB 3CB4A 2CAJA 1P6TA 3C66A 2C2RA 4KB7A 2DRDA 2DXFA 4ZP7A 4MMOA 1VGYA 3FBEA 4GVBA 4QWDA 1KRPA 5DM7Q 4DV5F 4Q0BB 2DEJA 1Y3KA 3RJMB 1RDRA 2IBOA 1CS4A 1WOPA 1N6QA 4KRWA 3FSYA 5B08A 1IQTA 4PYDA 4LF2A 4FDFA 2XI3A 4J9QA 3JTNA 2HGLA 2V9WA 2J9CA 3FSIA 3V6DA 3TAMA 5E33A 2LXFA 1S72S 4PG6A 4ZJOA 3KLGB 5IZHA 3G96A 2ZUAA 1D8YA 4RW6A 2CJKA 2V8VA 2AIRB 2CQGA 2AJFE 3BGLA 2FUG9 2E66A 2E7VA 4J90A 3POTB 1CQNA 2DT9A 3UCUP 3U1LA 4M5LA 2B9YA 4UT4A 4NXMJ 3FVYA 4QOTA 2J5AA 2W8LA 2Y1LB 4DPYA 1GK8A 1R8BA 3ONQA 3GFXA 4C3MA 4FS1A 3LGMA 4CP5A 4F4KA 3SV3A 4G1IA 1X4GA 4ZLNA 2BE2B 1FWLA 1HYSA 1L3VA 2YWEA 2E5IA 2V8DA 4CH0S 3D9BA 4CT8A 3KUGA 3BB5A 2DNLA 1R0CB 2VFUA 2ZC4A 5HSPA 2POKA 1J27A 1YZ7A 4ZJLA 3OR1A 4DQPA 2YNHA 1T3NA 1RWVB 4F4WA 1SQEA 2WRMA 1Y11A 4HH0A 1G6BA 1WTFA 3MR7A 3JYTA 4OHZA 4NASA 1JKHA 2I5JA 3FFIA 2Y8WA 3W65A 3HM9A 5GAHU 4C8YA 1UVKA 1YJWS 2XMAA 1IBKJ 1ZM9A 1NZ8A 5LSRA 3N6MA 3MF5A 4C7QA 2DGTA 1CJVB 2AJ1A 3WHIA 3DCAA 5T7LA 4F2RA 3MD1A 3M1VB 2FC9A 4O4RA 5AE1A 1H2UX 2C2OB 1VC6A 2QLBB 2HBYB 3NG8A 3BGOP 4FNHA 5KFLA 1N32J 5L1JA 3HI9A 1F60B 2WVCA 2AJQA 1RBLA 2CNNB 4J5OA 2FGOA 8AT1B 4UQTA 2CUYA 2EW9A 1YBUA 4LSNA 4RW8B 1Y3JA 2A18A 1Q7LB 5KOWA 2FJAB 1QJHA 4DV1J 4ZCIA 1UJ6A 1N5TA 3S01A 2OPSB 2YKPA 2CNKB 4Q2LA 2ZDOA 1HQUB 5CCMA 2B43A 3HDSA 4DUZJ 1WDTA 5L38A 1X60A 3OR2A 3VTIA 2DRAA 1FNOA 3W66A 5CYJA 1ZPVA 1S4FA 2KRBA 1S6QB 2CJAA 3AH6A 2BRLA 5IT4A 1IVZA 4A4JA 3U1NA 4FBTA 2K3KA 2R42A 4CH1A 1JLEA 1DJ0A 4QYRA 2R2RA 4OZJA 2QMUB 2HG4A 3B4DA 2ROEA 2HHQA 1LKZA 1FO1A 2AHOB 3T1YJ 2DR6A 2DO4A 3LGNA 4OYBA 1FE4A 1CBKA 3NAIA 2FHKA 1X9SA 1IUJA 1CC8A 2ZOMA 1RU1A 2HFSA 4QWBA 1SH3A 4LRBA 4AYBD 3HLUA 1R8HA 1OSDA 2G2OA 4ELTA 3KMQA 4GC7A 3D6HB 1RQ0A 5BJRA 3IS9A 2B9XA 5ETRA 4FXDA 3PXGa 1YJ7A 2MGZB 2OEKA 4CYUA 5HVGA 4HI1A 3KXDA 3VALA 2JRSA 4UQGA 4E0DA 4B9UA 1JLFB 3MXHP 1GXUA 1VBZA 4I1TA 4CLZA 2DPJA 5HMYA 4TU9A 4MKAA 3KK3B 2GQQA 4ZVFA 3CJ0A 2ZZTA 4DQRA 5ETSA 4LRFA 5LJ3Y 3FEZA 3L7UA 2UUCJ 3CJKA 3ZZRA 5L1IA 4FYWB 3QT7A 1Q16B 2KG0A 1U1RA 3DI6B 4USVA 1N88A 2BJ3A 2N7CA 3GIKA 3DN9A 2Z4PA 4DL4A 3N5FA 3BBBA 3FUYA 2D3ZA 2XYHB 1WHXA 2F8MA 4WJBA 1ZA1B 4FF4A 4OFZA 3I96A 1QSSA 1N52B 4ETZA 3KK2B 3HK2A 2MZ1A 1T9VA 1M1GA 1JXEA 5B0FA 1T03B 2HK2A 2QA4S 3KJVB 1S7IA 4FYDA 2H3EB 3CDWA 2J9DA 1FXDA 4QYZK 5CAAA 3OW2R 3VAGA 3DRSA 4K4XA 1JNRB 3RZAA 1H72C 1UA0A 1TKTA 2C1EB 3DRYA 1IKXA 5KFVA 1X31C 4U8YA 1KSPA 1NHKL 4NI2B 4DX6A 1IWGA 2E1CA 4P2XA 2OPRB 3BR9A 2JH3A 4X65F 2UUAJ 2R7XA 2J0XA 5J1EB 5KFWA 2Q1LA 4DL3A 3QPIA 4DWIA 2W9CA 1L3UA 2X1AA 1RI7A 1VISA 4KGMA 5SZTA 3FC9A 1YIJS 3BGRB 4WYLA 4RNFA 4J9PA 1HPZB 4KO0A 2HWTA 4JI6J 2V0NA 2RSQA 3A12A 4A47A 1YX2A 5KFQA 5MLCV 3MAAB 3GSIA 1FJCA 1U25A 2FYXA 5KFBA 3PO4A 2HIYA 2WOMB 4Q44A 3DKDA 4KFBA 5E3CA 1R0BG 2VG5B 1MU2A 1YGYA 3GG1A 3MECA 4DZDA 3KK1A 3AA9A 3DDIA 3Q89A 2JEJA 1VI7A 2QL7B 1ZM4A 4HVZA 3KG1A 4Q7AA 2NUUG 3DLGA 2MDAA 2L08A 2M8DB 1C0TA 2GC8A 2XS5A 2DO0A 4LF8J 3AHPA 4LQ3A 4BDPA 2BM1A 1IJEB 1N48A 3UNYA 1BLUA 4DR1J 2FJVA 1DRZA 2MQPA 4NLDA 4RBUA 4A46A 4XO0A 1VYAA 1IM6A 5JVHQ 3GYGA 3VAMA 3D1OA 4M5IA 1UETA 2KDOA 1FNXH 4LF6J 2KT3A 1KBRA 4MFBA 4MAKA 4XPEA 1NSAA 3QIDA 4Z37A 4KGKA 1LWCB 5BXIA 4OJGA 3CPWR 1FTCA 4NCGA 3I82A 4IH7A 2LEBA 5J2NA 3OXFA 1URNA 4NYPA 1ICEB 1JJCB 1VQLS 3VCDA 4K59A 4USJC 4ECZA 5F8NA 5KG4A 3BPDA 4BHQA 3IG1B 1K1SA 3PEHA 1HNZF 1RB0A 5HANA 1WEXA 1T9XA 4DV6F 1REGX 3W9IA 4MKBA 1P27B 2ROGA 3DGPB 2HMIA 3N01A 2EVZA 4F0MA 2FLLA 5E3PA 2BQRA 4QQBA 1M5PC 1AUSL 4ER8A 4D3GA 2GNKA 2KB2A 2W4DA 5K8MA 2KFYA 1HBMA 2CPIA 2FHMA 2IM1A 1BWVA 2J0WA 3ZZ0A 5KFJA 3ITHB 2XY5A 1FXRA 3CO9A 4OZNA 1KLMA 4WZMA 5GAGU 4RKUC 3MPWA 4ILMA 2RUGA 4IG3B 4U7CA 2ZDPA 3GIRA 2B8QA 2AJ0A 2KJWA 3IRXB 3BZQA 3PJWA 3UVJB 3V5RA 1J5OA 4C8LA 1Y10A 1KN6A 3OTBA 4X64J 3T5KA 4B9MA 2MB0B 3EX7B 5D4PA 4NWBA 1D09B 3I9V9 3LP2B 4A8OA 4USUA 2J9DE 4CM0A 4OI3A 3W62A 2Q66A 3A8IA 5I42B 4QIFA 1M5VC 4F8RA 2BJ9A 1PYSB 1RHQB 5EX0A 5I3UA 4ZVQB 4YB6A 3JS9A 4DL6A 4X4OA 1ZZFA 2HNYB 4P74A 1U8SA 4UW2A 2AZ1A 3J80U 3T5LA 3JSRA 2CPFA 2EWHA 3QT6A 4X4RA 4MIBA 4ED6A 2O67A 2UXBF 3OJUA 4IO9Q 5KFTA 1F6TA 2AP6A 1LWXA 5LSLA 3BPSP 3T9ZA 4PG4A 3GJTB 4Q0BA 3J80Y 4C8OA 2DK2A 3L09A 3OFFA 5THWA 3KMSA 3MUVP 1R8PA 3Q83A 1X5TA 3JQJA 3PR4A 3LF0A 1WWHA 4EYIB 2L41A 1XQIA 2GQCA 2Z57B 5KG6A 2G0IA 2GIFA 1EAYC 4ED7A 3BKFA 4DU7A 2X3DA 3KLGA 3G86A 3KLEB 1UJ4A 1RE1B 1VCTA 3R27A 2BKPA 1DBDA 2KZMA 4M63A 1PJ7A 1SJRA 3NOGA 4C9DA 3FCVA 4ECXA 3FBCA 1C1BA 2CJXB 3VV2B 1Q8BA 4ZIVA 4WIIA 2N4CA 1K1QA 3SI8A 4DEZA 3DOLB 2MQNA 4LF5F 4B3OA 2QLXA 3LP1B 2BE2A 3EE3A 2LXIA 5F9NA 3DRRA 4ZPWR 4I6WA 1CQMA 1PJ5A 3SSRA 1S0MA 1CJUA 4GRSA 4DG1B 1RAFB 5CH7B 1YWXA 2FGCA 1V9OA 1MG7A 5HLFA 1XNRF 1HNWF 3BBFA 5KFPA 4F50A 2EK6A 4WCEQ 2XNQA 4TY8B 2VDIA 4Y6IA 3Q8YA 4BC7A 2GJFA 3MEDA 5L39A 2IPOB 1RAEB 1TU0B 1PIEA 4DSLA 2BJ7A 2AF6A 2Q43A 5ETOA 5FD1A 3LALA 1H38A 2J6SA 2W4PA 2LQBA 3ENQA 4X62F 2HQ3A 1SJ1A 3CEDA 3I6PA 3M1VA 1UWBA 4E2FB 4NEZA 4ZCMA 1G7CB 2B7CB 4JV0A 4FP9A 2C28A 1JXVA 2AKWB 1FKAF 1NCLA 3WX8A 3ENVA 3HT3A 2XY7A 3K17A 2CRLA 1EHWA 3G8QA 4TNOA 2R8JA 3D1HA 5KG7A 2F63A 3I0RB 4WFXA 2M5YA 2V4JB 5A8WB 3UE2A 4A8MP 2VU5A 4RW8A 5KFMA 4TXSA 5CZXA 4FZVA 5HVHA 2RQMA 2OPSA 4OX8A 1RP5A 3LP0B 2WSFC 2FVSA 4N8NA 3GILA 3CDEA 5KFKA 4DV0F 2W01A 3CIZA 1WG5A 2ZEJA 1TL3B 1UEUA 1S6QA 1VDHA 3V4MA 3BQ2A 3M6UA 1Q5VA 1S99A 5HK4A 2HSEB 3KLIB 3IWXA 1T94A 4F4AA 5EGYA 4CQ1A 2EFOA 3J7Z5 3RGIA 3HHKA 1M5SA 2HBRB 3T1HJ 1R6YA 2XHWA 3ZXWA 3CDAA 1PG5B 2YWGA 5CYQA 1WG4A 2JEFA 2EC2A 1AZSB 5JVGQ 1NPKA 4OZ2A 3KUHA 5ETLA 1HBNB 1KC8T 2W7AA 4I64A 4EO6A 2UVWA 3A8KA 4F3MA 1NB2A 2MKHA 1N0VC 1BQXA 2M70A 2OPQB 3Q8SB 4C11B 3NXZA 4J9OA 4KAIA 4PG8A 2ERRA 4JV5F 1IM4A 3KLHB 2MGZA 5IWAF 3EUNA 1B7YB 1U6BA 2WONB 1NHUA 3M8SA 4FVCA 1JLGB 1QE1B 3SCJE 3N79A 1WACA 5B0AA 1SI9A 3TOQA 1VLOA 1T9UA 1W7WA 2C2MB 2D1CA 2R7TA 4DV5J 4FBUA 4AQYF 2ZD1B 2ZH4A 1IBLF 4RW7B 1ZZNA 2DH9A 1RT7A 3WC2A 1H2VZ 2MY7A 3AY0A 5A8RB 4GMKA 1HWJA 4CLWA 3Q8VA 1NSPA 3DI6A 3D6TB 3DHXA 2H1YA 1RT2B 1M90T 1F9HA 5GMKa 4C97A 2R7UA 3EDRB 1OQ6A 4EYHB 3UN5A 2BRKA 5DO2A 3SV4A 4M5JA 2WHOA 1RTJB 3M7VA 2HZCA 1L5UA 4IUFA 1RHRB 4ZOSA 5E2QA 3KK2A 4CLPA 1X4EA 3CD5A 2E9RX 1ZAWA 5IT0A 1F0XA 2HVEA 4R5PA 3TEGA 3CMQA 4DS4A 5LMNF 4ZVRB 3KJVA 1H7XA 4LSZB 2QLWA 2RAQA 2HFUA 5LM7E 3Q8QB 4ZP9A 4ZPDA 3TJAA 3MEGB 1VHFA 2IRXA 2BYCA 1WKJA 1N54B 1D9AA 3B4MA 1SKUB 1FE0A 3LQVA 4JI8F 1FWPA 2OPRA 1SXLA 3GIMA 3DXBA 5J1EA 2HZAA 3GZ7A 2H5IB 2B4PA 1Q5YA 3OTOF 2PSZA 4ECQA 4TQSA 1FK9B 2KN4A 4RJVA 2CPYA 1RT5B 4N8OA 3BGRA 2VFVA 5D3GA 2ZHBA 3SQGB 1HPZA 2YX4A 4WPAA 1VQ8S 4Y2IA 1IXKA 3J7YI 2WSCC 3MAAA 2UUBF 2QFIA 1GX6A 1FX4A 2VKRA 5DGAA 5J1PA 4V1Ak 3WZ0A 1P8GA 3D54A 3SBMA 1AA1B 2N82B 2B5JA 1NZAA 2V2ZA 4N77A 4ZVSB 2RDJA 2LVWA 4DV2J 1EP4A 2HKEA 4OMFG 1JJ4A 2VC1A 2V8HA 1RHKB 2IA6A 3D28A 4ZHRA 3MMBA 5SUHA 3O5TB 2IDLA 2JC1A 3R6LB 3O1LA 3BH6B 3GP9A 5M2RA 2KKHA 2IJRA 1UFLA 1KONA 2VFRA 4CZCA 2YWKA 3TA2A 3V81B 4I2PB 4DR3F 4AXJA 1AT1B 3GV7B 2MJNA 1LWCA 3EXCX 4MTPA 1D9DA 3KUEA 4RWXA 3D1QA 3LW5C 3EZ5A 3E51A 4ZVUB 2WVBA 3W1YC 1NKEA 5H9FK 3OXGA 2VKZG 1VIOA 4IYQA 1ZYQA 4DSJA 5KTQA 3IBFB 5L8RC 1U09A 4CDIA 2VH7A 5HQMA 1H7WA 4U6PA 2RD5C 1LV5A 4J9MA 5K9FA 1IKVB 1NAQA 2XULA 4USHA 1EB0A 2EBEA 2V67A 3FMBA 5T41A 3HD2A 2X1BA 4CLFA 3DRPA 2OKQA 3DGPA 3I31A 2AZ3A 3PW4A 4KH0B 2O3DA 1WC5A 2R2UA 3UR0A 2U1AA 1V3SA 3MM5B 1TKZB 5HATA 3H4BA 3L4BC 3AFGA 2UXCJ 2P9CA 3L3CA 1T7PA 1R3NA 2XSJB 4ECTA 3ITHA 1SL2A 3QAEA 2W24A 1H73A 2JC0A 1FJEB 2ZH1A 4Y2MA 4I68A 3UO0A 3IRXA 4ZVTB 1FRLA 4ICLA 4K4YA 5DDRC 4WFAQ 3OHBA 5HMZA 4WZQA 5KT4A 4LF1A 3SDEA 4ZCKA 2ILYA 1DARA 1RTDB 2NXJA 4N7TA 2R7SA 2ZE2A 4J9KA 1VQ5S 5L46A 2R7VA 2C2DA 1AFIA 2ILZA 1LXJA 5I42A 1K8AT 3IXQA 1H6KX 2QZ8A 4MJKA 4X4NA 1F2HA 1ELOA 1NDKA 5KAKA 4P9SA 4CO5A 4NLQA 3AOBA 2N3OA 1QAYA 1KQSR 5F8JA 3BREA 3CE8A 3BBCA 5KT5A 1LOUA 2C2EA 4LF9F 3RW7A 2J6UA 4KBIA 3M8QB 1AYEA 1LK7A 1RHUB 5F8IA 3MEEB 5KFOA 2VASA 1S59A 2ZZNA 4Y0FA 3KHHA 1OYEA 3SFGA 1PILA 2I2YA 3GJSB 4PAAA 4WP8A 1SL0A 3ZTRA 1FKPA 1O5JA 3EGNA 2QJ3A 4X65J 3NS5A 1BGXT 4LQ9A 2BOPA 5HQLA 4ANCA 3M8RA 2GQ2A 5D6GA 5HAOA 1X4FA 3KLEA 1RHJB 1YDLA 1U48A 4F67A 2F5GA 5L1KA 1GQEA 2R3VA 2QE5A 3MFHA 4QIWD 5LJ5Y 1RT1A 3RRGA 4LIWA 5CA5A 3C3LA 2H54B 2QEXS 3KHLA 4B9NA 3NOCA 3G6VA 1K44A 2GVZB 2PD1A 3L7OA 2QFJA 4OX9F 3H4DA 2UVUA 4ZDNA 2XG8A 4HHJA 1NDPA 3WIUA 3PDNA 4USIA 3LPYA 2CIMA 4U7UD 1M1KT 2F7VA 3DOLA 3BSCA 3R7BB 4U96A 3ULHA 3RU0A 3K5LA 1BXNA 2H5EA 4ECVA 4IG0B 1JLBB 2BMBA 3LP1A 2CDRB 4YDDB 4HI2A 2AEFA 2PA8D 2UUWA 3TUZC 4WFZA 1F2GA 3UCGA 2IVYA 1TVRA 4DG1A 4MYUA 3BN7A 3QYYA 3FRYA 2ZH5A 2GMHA 5CQGA 1R31A 4W98A 1S6PB 3VAFA 1DTTB 2NSBA 5F8HA 1SKRA 1YHQS 3A3OB 3M2UB 1S1XB 4CT9A 3TVKA 1SIZA 4DFJA 2RNEA 5E3AA 2QL5B 3CCES 1S12A 2HW3A 1UVIA 1ZAVA 4NLGA 4QWAA 2ALYB 3FCWA 3CCVS 4DX5A 4AD6A 5JUMA 2ASDA 3OD2A 2GIRA 1DTQA 4WE1B 4Q43A 2RDDA 2QYCA 2KG1A 4NLSA 1HNZJ 4KGXB 3UR3C 3NLCA 4I56A 3OTEA 4DV6J 3PYDA 2DR7A 2OD4A 2RIJA 2GA7A 2V4JA 3N6LA 5A8WA 3R3TA 3TVZA 2LDYA 1RLCL 3PCOB 1X5SA 4YR2A 4NLVA 2L9NA 2J7KA 4NLXA 2V2VA 4IQMA 2DH8A 3GV5B 3TR5A 3CC4S 1TK5A 4L3NA 1NK4A 4LVNP 3C8YA 3HHLA 2R8HA 1WKKA 3KLFA 2HHXA 3QJPA 2HNDB 3DHWC 3KLIA 2VOOA 2GJ2A 1VQOS 4KTQA 3W2WB 2KVIA 3I32A 2DR5A 2KM8B 1D0EA 2BV3A 4FF1A 3SYZA 2AYEA 4CLKA 3GJRB 3W5ZA 4ZCLA 2R8IA 2CQ3A 1LXNA 2DYAA 2UUTA 1AZSA 1BQMB 3TAPA 3I55S 1U1NA 3HCXA 1HBNA 1RCOB 4DV4F 4PABA 1XMBA 2D3UA 2AV5A 4LR8A 3HFVA 5F0WA 2W8KA 3V6JA 3CMAS 2OPQA 4C11A 5HMXA 4DF4A 1U1LA 5A8KA 3PYFA 1F3FA 2EFPA 2GVDA 5GAHI 3KLHA 9ATCB 3B78A 5HP1A 2GAGC 2VB6A 2W2QP 2NZCA 2WONA 4WK3A 2BBEA 4B3RF 3LUYA 2FHJD 4LFBF 4DCPB 2VBWA 1MW7A 2LMIA 1MWQA 1X0FA 1KLNA 1N56A 3D68A 1LEOA 2R8GA 4TYAA 3CC7S 2JDJA 3EICA 2MHEA 2MY8A 1B99A 1YBAA 3ETMA 4DPTA 3H5UA 5D4LA 4DPWA 3CF5Q 4WF9Q 2DNOA 5ETTA 1FI4A 1N5VA 3G82A 3TA1A 2J0QD 2XO6A 1XC9A 2CVIA 1PO6A 1OIAA 2XCPA 2OELA 4DSIA 1FFSB 5LXYA 5JJBA 2W9AA 2BW7A 4JYAJ 1N33J 4DL2A 2CPXA 2ALZA 2ZHAA 2DXDA 3W5XA 3U1MA 3EMTA 3LAMA 5DG9A 2LXUA 2DGWA 5B0EA 1HBOA 1KR4A 3CULA 3AD7C 3MEGA 4LREA 2ROPA 3UDEA 1S4EA 4Y65A 4HYKA 3NCPA 2CA9A 2IM2A 1BY9A 3GFYA 4LF5J 2YX7A 4WXWA 1FDDA 4DL7A 2AYBA 1WDDA 2HHHJ 1VC5A 4OHWA 5FDLB 2OSQA 3NEKA 2K2PA 3DOKB 3RW6A 5CHCB 1XR6A 5K14B 3VGSA 2IVFB 5F0UA 1FFWB 2QL9B 4O0NA 4AL5A 1XNRJ 5KFYA 3MM8B 1HNWJ 4FNIA 5J2MB 1FK9A 1VQNS 1N5SA 1PC5A 1CC7A 1TV6B 1RT5A 2HYIB 3KLVA 4LMZA 1A7GE 1CULA 4ZP8A 2OP5A 3IAM9 3PYEA 2ACMA 3CCQS 3D0GE 2BUNA 2HRTA 3W64A 1RAGB 2G1HA 4AUKA 1RT6A 2R9LA 4X62J 1RJJA 3CD7A 4ED1A 2QMWA 4KHPF 2CYYA 2IHR1 3W5YA 1FCAA 2FVPA 1LK5A 2M2BA 3GIIA 2OD6A 2WSEC 2LQ9A 4Q8EA 3D0IE 4PKDB 1R0AB 5DZ6A 4OV6A 4HACB 2EPIA 3DLHA 4RUHA 3GPAA 3NY0A 2BQ3A 4GO5X 4NXNF 3TO8A 1DQ9A 2YVSA 4ZIWA 1EJ7L 4DX7A 4OX6A 4ZVEA 1ZPWX 3R5CA 1QUVA 1H74A 5KFFA 2EKYA 3RR7A 2LDIA 2RT3A 3T19A 4I2PA 1Y5IB 2CQ1A 3J7YU 4DV0J 1REVA 3HJVA 1D3WA 1Q0NA 5DQHA 2XYPB 2ZH7A 4O44B 2CG4A 3CCLS 5A0YA 2E7WA 3QMQA 5HL7Q 3DLKB 4C0OC 3T6JA 3QQCD 4X2BA 3PX0A 1YJUA 3GONA 3ILJA 1VJWA 5B0GA 4X4TA 4DV3F 3KOAA 2ZNZA 2XNRA 3NGUA 1C0UA 1A6LA 4YEAA 4OI2A 1NJWA 2EXUA 2F8EX 5IC6B 2G2YA 2EI5A 4LVOP 3T3FA 3MUTP 1CJTB 2ZH8A 3TJ8A 4ZKAA 2VQFF 4BCAA 5CABA 4NX9A 1AUDA 2V68A 1ZM3A 3MM5A 1TKZA 4ANEA 4F4XA 1NJXA 2WB1D 1KWMA 1Q1KA 3IBWA 4U9RA 4N5SA 3J7A1 2YQ3A 4QR0A 4YB1P 2Z2YB 2GFFA 2C22A 3L9ZA 3M4XA 1RXOB 4JV5J 4IOCQ 2XSJA 3QZ7A 1P1TA 4PYAA 5IWAJ 5C42B 2QTWA 3BEGB 2FZGB 4RNMA 1RTHB 4TYBA 2B56A 3THVA 3AJ2A 1LW0B 3QSYB 4J9SA 2VONA 4U67Q 3W7BA 2MKSA 4JOUA 3PJXA 4H4OB 1IBLJ 2E5LF 4NRTA 2CQCA 1RTDA 2ZHOA 1F5AA 2GHWA 2IC3B 3P4UB 1XK8A 3J81j 3TP2A 3PRBA 3MZIA 3PRVA 4CM2A 2MQOA 2NYIA 1RA6A 1Y5NB 5ADZA 2QLJB 5DQIA 3M2VB 2IMOA 1FDBA 3SCKE 1C1CA 4EK2A 3HZGA 3DOMA 4HKQA 1HA1A 2IM3A 3IA0A 2DNNA 2WBRA 4EZ6A 1EQMA 2CPJA 2DGSA 5ETPA 4RL1A 2EK1A 5D0RA 5H9EK 2XY6A 4N41A 3M32B 3TANA 4S0MA 5LMNJ 1I94F 4ILRA 3M8QA 2G13A 3IMQJ 2DD8S 2BE9B 2A3JA 3NL0A 4RNHA 2ZNYA 2Z2ZA 3HT0A 4FPIA 2PN6A 4EZ9A 1FDNA 3X3UA 1DURA 3PEJA 2XWYA 4K2JA 3K5PA 3NGTA 2PFDA 4Y2KA 1XNQF 1WC3A 1CJKB 2HAIA 3AD8C 1S9GB 4KR0B 3EVWA 2RKIB 1SC6A 3OTOJ 1WEZA 4DN0A 2EG2A 3MCMA 2DGOA 4NLWA 4K4WA 2Y0BB 3ISZA 2DNPA 5CYMB 1WSVA 3C16A 2GAHC 2VPYB 2ZOFA 4ZN3A 2AYGA 2OFGX 4W90B 4DPOA 2VPWB 4X4QA 2GVZA 1WC1A 2KH9A 3W2VB 1YI2S 3S1TA 2UUBJ 3BKUA 1PYTA 2FJEB 2HURA 4I0WA 4USMA 3NMAA 2BR0A 1SQFA 3FMWA 2K7KA 3FKBA 2RRAA 1JLBA 2V2KA 2AW0A 3K2YA 1R7IA 1HNXF 3NKYA 3PX6A 4M1KA 3MPDA 1QTNB 1RGVA 1O51A 4YHHF 1IR2A 1SJ4P 4WFNQ 3P8BB 1S49A 1S1XA 4AXIA 3MOJB 2A6OA 3EDQB 3IM8A 2XMTA 3HSJA 3QIPA 1V3ZA 1OY9A 4K50A 4DR3J 2A1BA 2CPDA 4FPRA 5AXMA 3CVKA 2DHXA 5BYQA 1DQAA 1FFGB 3CT9A 2HS4A 1L3TA 4YFUA 4WE1A 2KXNB 2GJIA 1S9EA 1RISA 4DL0C 2LFVA 5A6PA 4Z2XA 3U02A 3AOCA 1YK9A 4E8UA 3JAMU 2B4UA 4J9LA 2RDIA 2UP1A 2HQGA 1JK9B 3T41A 2WZ1A 1HBUB 2DNRA 2P2CB 2LA6A 3EZUA 2RRNA 1S1TB 1RT4A 4K4SA 1WI6A 1KNZA 2DGUA 5KG0A 3BO2A 4ID5B 2CVEA 2L9DA 3JAMY 1U1PA 2FHOB 4W4MA 3AXMA 1U1QA 1BQNB 2QX0A 1IKWB 4ZVHA 4JP8A 3CWJA 2IM0A 2GZOA 4PWWA 4NLPA 4DFKA 5CXTA 4XDCA 2DHHA 2WCXA 1VQ6S 5HQ8A 3BDEA 1T9WA 4PWDB 4A8SA 5M2UA 1G3OA 3TRGA 3NS6A 5K20B 3EPGA 3GYNA 2V4QA 4KKOA 3TARA 2W4CA 3FCHA 3BV8A 1U0HB 3MOZA 4F02A 3P3DA 4X84A 3E01B 1IBMF 2MHNA 1KOOA 2K1RB 3EXYA 4FN5A 5MAOA 4ZPCA 1WC0A 3RAXA 3FZBA 1MMLA 3H0PA 4CCHA 4WBFA 4NCBA 2XMWA 1RAAB 4X4PA 1FKOB 2BANB 4IR9A 2KJVA 2OFHX 2QLFB 4KQZA 1N5YB 2R7RA 4GC6A 1TAUA 5DGBA 4LF9J 2J9EA 3ZZZA 1EETB 4PG5A 3TYTA 1VRTA 2KRRA 4ZN1A 3IC1A 4H4KA 1FTRA 2Z30B 2XEXA 5E41A 2G0CA 2XZTB 4QU7A 4F25A 1U24A 2CNLB 2LCWA 3RRHA 2FIUA 3CC2S 3GCWP 3OV7A 2DNGA 5KFHA 3BSOA 1TUWA 3UN2A 3JXOA 4IFYB 1RAIB 2MLZA 2E5HA 2C3UA 2KZZA 2MSSA 1NEEA 2DY1A 2FVQA 2EG1A 4X66F 1TFYA 2YKNB 4ANDA 3C46A 1QSYA 4GVLA 2N3LA 4OI4A 3PHTA 2FY1A 3BF4A 2OPPB 1RLDA 3OHAA 1XERA 5HMWA 1AROP 5KT2A 4L76A 4J37A 3VVTA 1I5OB 4DUTA 3KNGA 3MFIA 4OX9J 3B8HA 5LMUF 3TNVA 2IJFA 3ELHA 4B3SF 4KH1B 2K3IA 3BO4A 1YVFA 2D7SA 2BJ8A 3C15B 1FJ7A 3NGSA 1YRTA 4C8ZA 3F56A 1XWLA 3T9NA 3ZNUA 1X4AA 4KV8B 3K0JA 4PEOA 4P71A 4E98A 2DKOB 5E7OB 2M7SA 3GE9A 3QBCA 3QGGA 2MLXA 3ETOA 5A2QU 3MM8A 4TQRA 1RBAA 2G4BA 3M6VA 2E9ZA 2CWKA 3M8PA 2Z58B 1CSJA 2MZQA 3QLHA 2ZBRA 2ZKUA 4PQUB 4B9LA 2U2FA 4C2MA 2HVHA 5A2QY 3I5CA 1ZH5A 4P7VA 4ENOA 3UDVA 2YKMB 1WEYA 1TK0A 3JQKA 1N8RT 3OTDA 1IKYB 1RSCA 1UVNA 4ALZA 1PGZA 3D2WA 2DR8A 4BS2A 2ZKTA 3IR7B 4CNZA 1R0AA 3V6KA 1TP7A 2QG9B 4ZK7M 3VAIA 2UUCF 1CS4B 1TL7A 1N6QB 4IH5A 2IRUA 1QSLA 3NMRA 4MKVA 4P2FA 3MEKA 4N76A 4QR1A 2BDPA 5E3QA 2YKAA 1XR7A 4O3SA 5HJXA 1WOOA 5GAEI 3W3SA 3K89A 3PVXA 2PMHA 2PO4A 2IA0A 2QYGA 2DBBA 2CQBA 2VL1A 1YTYA 3AQPA 1Q95G 4O44A 4RBTA 4RZRA 2UU9F 3FQKA 1S1VA 4C8NA 4DR4F 4AL7A 1SL1A 2PEBA 3OL6A 2BKOA 1JB0C 3MR2A 4W92B 4OZ0A 1K9MT 3CJTA 3UPFA 4AL6A 5G4DA 3LO3A 3PZPA 5DLFA 2X51A 3EVMA 1ZBTA 3W63A 3QWPA 3V4IB 2HRUA 2VG6B 2GGPA 3IFEA 4NZ6A 1BUXA 3OR1B 4DV4J 3G6YA 4ZMMA 1KHWA 1HIYA 4JI1F 5B0BA 4G1PA 4K7QA 4UUWA 1Y4ZB 1JKHB 2I5JB 3FFIB 2BEFA 4TN2A 1GX5A 3QSIA 4R8UB 1JLAA 4UOFA 5E3RA 3KDOA 2AX0A 5KFZA 4Y34A 4JI7F 4U8VA 2CPHA 3D67A 2A0FB 4JI2F 1RTHA 4B3RJ 4LFBJ 5LSOA 1MN9A 1NJYA 3Q8PB 2CJYB 3TI0A 3TAQA 1FVSA 4ZLLA 4YY3J 1KQGB 2CJBA 3I0SB 2KXHA 3BO3A 4H4OA 2ZBPA 2ZH9A 4H54A 3Q22A 3NP5A 5KT7A 4TY9A 1H2TZ 2VJVA 1T02A 3KNAA 2NXCA 3DYAB 3M6WA 2YKOA 4I4BA 2KO1A 1WSRA 5JXSA 4Y28C 5DS7A 5DDOC 1VQPS 3M2VA 4FXVA 4BBYA 4O3OA 4IQXA 1P9QC 5E0OA 3U7JA 2JEGA 3M2RB 2IAJB 4I69A 3MHYA 3NBPA 2YY3A 2ZBIA 3WDOA 2YKQA 3H5XA 2CNOB 4NLYA 3TA0A 5ETNA 2XO7A 1UFWA 2ZWOA 3MPVA 2BM0A 2LECA 3FBFA 1JXLA 3OT9A 5C2GA 2JLGA 5D77A 1KQFB 1OY8A 3VVUA 4J91A 4HT7A 3SCIE 2JZ5A 2MKKA 2ZJRQ 3DLJA 4P72A 4ILLA 2DISA 2DB1A 1LW2A 2A2DA 1UCNA 1S10A 1X9WA 4Z7CA 1KVKA 3TVYA 5CD4A 1JLEB 3MM9A 4FKYA 2J6TA 4ES3A 1JWWA 2W7PA 2KYXA 1HNVB 4DR7F 4HTJA 2MKIA 1X7VA 4QR2A 1AB8A 4ZPAA 1T11A 1KEKA 1QUPA 4OYXA 3ILIA 2RKIA 2OO4A 3Q24A 3W8GA 3DFEA 4O23A 3VGUA 5G0RA 3DDKA 3VF0B 2IJNA 1DHMA 2CZ9A 3HHNB 2DPIA 1ULRA 4LR9A 1HWUA 3R5GA 4WYWA 3W61A 3FGVA 1ZS6A 2FJWA 3IS9B 2N4DA 1XN9A 4CLSA 1HNIB 3EYZA 4F3OA 3QAUA 3F41A 1I3OB 3PNIA 2VQEF 2M88A 2BX6A 4KHPJ 5DG8A 3TX0A 3BQ1A 1HI8A 4DLEA 3FNNA 3GMGA 1E6VA 5HJYA 2AEJA 1HWKA 3M8ZA 1U4BA 4ITSA 4QIGA 1XMOF 4P52A 4NXNJ 4FYXB 1QVFR 2KHDA 3I9ZA 4BWMA 2F8HA 4LRAA 1RABB 1W2IA 4NA2A 1RU2A 1FT8A 3CGIA 3HHEA 2P5VA 5ETMA 5EDWA 4DPXA 2AEMA 4M5DB 2ZWPA 5LOQA 2XMMA 4DU8A 3B54A 3RB0A 4RW4A 3H90A 2FDNA 3KWMA 4HDGA 1IN0A 3BJYA 2X3GA 2VDHA 2Y1IA 3A8EA 1V5VA 4YOEA 3M8YA 3NWGA 3DRSB 1K0TA 1VK3A 3BN4A 3ZZYA 1TK8A 4CI0B 4GKKF 4ZA1A 2BQUA 5KT6A 1TKTB 4DV3J 1VS3A 1R43A 2F40A 2YNGA 1DAXA 3D7SB 4ELVA 3CJSA 3J7ZT 2DHAA 4LJMA 1Y00A 3LWLA 1HBUA 3PJ9A 2OMLA 5B7WA 3HMJG 1S1TA 1EARA 4FF3A 3R97A 1UVMA 5IT9U 2FC8A 1S76D 1TFWA 1FEEA 3M30B 2AX1A 1BQNA 1RA7A 2DXEA 1ZM2A 1EX8A 1UW4A 4DMZA 3OL7A 3QO9B 3R1HA 1RK8A 1QDUB 2B6AA 2WK4A 5IT9Y 1WC4A 4YS2A 1E6YA 1FERA 2Y3YA 1HI1A 5KFEA 1MU2B 3MECB 3KK1B 3OQ2A 2NR0A 4MK8A 4HDHA 4WTOB 1C4CA 2BJDA 4RO0A 2V9KA 2ZC3A 6FDRA 1XJWB 1D8ZA 2PIIA 1NHVA 1RTIB 2LQJA 5IM0B 2E5LJ 3HSZA 2Z2MA 4A48A 2RQKA 3DLGB 2F4VF 1C0TB 1U1KA 1U0HA 1NK0A 1IBCB 4F0KA 2HRYA 2XGPA 4ID8A 4ZPBA 1FJGJ 3HVRA 1RHMB 4DXLA 3MDFA 3D6FB 2EBGA 3TW0A 3CCRS 2DR9A 4B9SA 4JI4F 4YR0A 1RKIA 2DGXA 4AE5A 4TLRA 3K5MA 2BANA 3ZTSA 2F4FA 3N5BA 1SKWA 2M9KA 2XMVA 1S6UA 1N5YA 1MWYA 2FY8A 2ZM6F 4RU2A 2FJXA 2H5JB 2HNZB 2LU1A 4YB5A 1TMMA 3QATA 5KG1A 1I94J 3RRKA 2UV8G 3QWUA 3HFKA 3HPOA 3POTA 3EWGA 1CG2A 2RHQB 1TMJA 1R8CA 5DG7A 4RUCA 2ZJPQ 1HQEB 2DNMA 3OL9A 1UP1A 2ASLA 5KFGA 1TELA 3FEXB 4RBVA 2VD3A 3P49B 4ED0A 2NSCA 3VAJA 4M5HA 4B3TF 2NCKL 5DZ7A 1TR0A 1XNQJ 4JV1A 1Q8LA 4URQU 1UL3A 3J81U 1MROB 1GMWD 2DGVA 2HMIB 5T14A 1TAQA 4RUBA 2BABA 4OQJA 2DH7A 2YKNA 3IR6B 2VHGA 2HFVA 2OPPA 4KY3A 4DN9A 2R8KA 3J81Y 4UOCA 1YJRA 3CD0A 3CNQP 1HBMB 3PRDA 1HD1A 4DZ6A 3S6EA 2ZH6A 2VFSA 1HWIA 1S7HA 1VLYA 2O1PA 4UZBA 1Q7YT 2W9BB 3P6YC 1KVIA 4X4SA 1OWXA 3GR1A 2KFNA 3PIPQ 1CJVA 3MTKA 2PMZD 3MM6B 4ECWA 3T1HF 1A0OB 2IYIA 4UZCA 2VC0A 4CTAB 2PEHA 4KV8A 2L9WA 1J5OB 1HNXJ 3CCUS 4X4UA 5BYRA 1M1HA 3B82A 4NA3A 2NXUA 2GW8A 2CFXA 2DNQA 4IFVB 4NE9C 2SXLA 3SFUA 4MIAA 2DJWA 2HGMA 3TJ9A 1UZDA 2E1PA 1N34F 4YHHJ 1UPPA 2J7WA 4DV7F 1BMQB 1X4BA 1S0OA 3Q86A 5L9NA 1Z1ZA 4A8YA 2FPHX 3OXLA 1RWWB 1U6FA 1RWMB 1SJQA 3LANA 1HI0P 3KJFB 4K4ZA 3MWBA 3VAHA 4C8MA 4QW8A 2E44A 1HQUA 3H20A 1IKYA 1N36J 4K4TA 2HBQB 2WW8A 2DNHA 1MMNA 3B6BA 1G2EA 1VBKA 4C98A 4J9UE 2HLUA 2KXFA 2NPFA 1M5OC 1J5EF 4UY85 4HEA9 5BR8F 2ZVSA 4DQIA 2OMOA 2CPEA 4G1QB 2OSRA 2DY9A 3UNGC 2PI5A 4DFMA 2W7OA 1SB6A 2MSTA 2RF2B 2Q79A 2XTJP 1RAJA 2Y9HA 2KL8A 4KIAA 1Q53A 2WW4A 3OL8A 3CCWA 4ETXA 2K8GA 2RHSB 3BGFA 1B0VA 3PHEA 4OZ5A 1XMQF 3X1LB 1WI8A 1VIXA 1Y9OA 1X0PA 2V6AA 2A2CA 1B0PA 1FXLA 3JSBA 3BSAA 1C1BB 2GX8A 4JB8B 5KT3A 1QAXA 1NDCA 3KDNA 3R2CJ 3ZO7A 2HIQA 1JLFA 2ZOGA 1J2VA 1NK6A 4B3OB 3HULA 3TUPA 2ZZMA 3KK3A 3DRRB 4JI5F 4LSLB 3PKYA 1UEKA 4MH8A 3V4IA 2PI4A 3GQCA 2VG6A 1B70B 4OYIA 3HVTB 1CJUB 2APOA 3DMJB 1S48A 2VPZB 4K5SA 5HLFB 2KHCA 4B3MF 1IBMJ 2XSFA 2HVZA 3RB4A 4ZJQA 4R8UA 3OUYB 3Q0AA 2C42A 5GAEU 3HF5A 3MEDB 2QRRA 4USKA 5AT1B 3ENWA 2HQIA 1VRUB 2Q6CA 1YJVA 5F41A 2AJ2A 4CH7A 4JI3F 5L9XA 4ATNA 3H25A 1BWEA 3E3XA 5FIIA 1SQGA 5B0CA 4LR7A 1T03A 3A4TA 1UWBB 4FF2A 1ZETA 3HJFA 2B8PA 3WBZA 4ZPTR 3MR3A 3I0SA 1PAEX 3RAMA 2XZWA 4DV2F 1S0NA 4Y00A 2D3O1 2GHPA 5DDPC 2GMJA 1Q4RA 2HHPA 3DYAA 2FQQB 1NH8A 2PMWA 2V2QA 3NRBA 4FVMA 1LWFB 4NI2A 1M5HA 2GIQA 2XYGB 3NNHA 3F73A 3MR6A 2AD9A 2MXYA 2W2MP 2V8GA 2NXEA 3G2XA 4X66J 3M2RA 1PAUB 2IAJA 3R5JB 2KTQA 4LF4F 2WVFA 4MK9A 3FSXA 4OJHA 4ECYA 2YX1A 2AMCB 4LIRA 4QWEA 4XIUA
chains in the Genus database with same CATH topology
2DYAA 4FKXA 2BX6A 1JXVA 1NSPA 4S0MA 1HLWA 3ENAA 3VVUA 1NCLA 3FKBA 3ZTQA 3WX8A 3Q86A 2CWKA 1EHWA 4CP5A 1KDNA 3FC9A 1NPKA 2DXFA 1MN9A 4ANDA 1UCNA 3R9LA 3EE3A 1F6TA 1XIQA 3BBBA 1LWXA 1NSQA 3FBEA 4FKYA 2B8PA 5BXIA 1S59A 3PJ9A 4ENOA 1PAEX 4F36A 1NDCA 1NB2A 2VU5A 2DXDA 1BHNA 3MPDA 3VVTA 3NGTA 1BE4A 2B8QA 1HHQA 4WBFA 1B4SA 3ZTRA 3B6BA 3Q83A 4DUTA 3EMTA 4DZ6A 1NUEA 3FBBA 3DKDA 3ZTSA 1F3FA 4W98A 3BBFA 3ZTOA 2HVEA 2HVDA 3EM1A 4UOHA 1XQIA 3ELHA 3EVWA 5IOLA 4UOGA 4ANCA 3DDIA 2DXEA 1NDLA 3NGUA 3EVMA 3Q8YA 3VGUA 3PRVA 3EJMA 1S57A 3Q89A 4C6AA 2DY9A 5CAAA 3B54A 1NSKL 1WKKA 3G2XA 1WKJA 3NGSA 4KPCA 4EK2A 2ZUAA 4DI6A 1BUXA 3GPAA 1WKLA 1S5ZA 2AZ3A 3FCWA 1HIYA 1ZS6A 1LEOA 3VGTA 1W7WA 5CABA 1NDKA 1K44A 1NHKL 3ZTPA 4HR2A 3VGSA 1PKUA 1U8WA 1NLKL 3BH6B 3GP9A 4F4AA 3FCVA 3BH7B 3JS9A 3EICA 4ANEA 2BEFA 3FBCA 5C7PA 1B99A 1NDPA 2NCKL 3Q8UA 4UOFA 1MN7A 3EVOA 4O0NA 1VYAA 2AZ1A 2HURA 3L7UA 3BBCA 3NGRA 3VGVA 3ETMA 3FBFA 3Q8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYA A;  4FKX A;  2BX6 A;  1JXV A;  1NSP A;  4S0M A;  1HLW A;  3ENA A;  3VVU A;  1NCL A;  3FKB A;  3ZTQ A;  3WX8 A;  3Q86 A;  2CWK A;  1EHW A;  4CP5 A;  1KDN A;  3FC9 A;  1NPK A;  2DXF A;  1MN9 A;  4AND A;  1UCN A;  3R9L A;  3EE3 A;  1F6T A;  1XIQ A;  3BBB A;  1LWX A;  1NSQ A;  3FBE A;  4FKY A;  2B8P A;  5BXI A;  1S59 A;  3PJ9 A;  4ENO A;  1PAE X;  4F36 A;  1NDC A;  1NB2 A;  2VU5 A;  2DXD A;  1BHN A;  3MPD A;  3VVT A;  3NGT A;  1BE4 A;  2B8Q A;  1HHQ A;  4WBF A;  1B4S A;  3ZTR A;  3B6B A;  3Q83 A;  4DUT A;  3EMT A;  4DZ6 A;  1NUE A;  3FBB A;  3DKD A;  3ZTS A;  1F3F A;  4W98 A;  3BBF A;  3ZTO A;  2HVE A;  2HVD A;  3EM1 A;  4UOH A;  1XQI A;  3ELH A;  3EVW A;  5IOL A;  4UOG A;  4ANC A;  3DDI A;  2DXE A;  1NDL A;  3NGU A;  3EVM A;  3Q8Y A;  3VGU A;  3PRV A;  3EJM A;  1S57 A;  3Q89 A;  4C6A A;  2DY9 A;  5CAA A;  3B54 A;  1NSK L;  1WKK A;  3G2X A;  1WKJ A;  3NGS A;  4KPC A;  4EK2 A;  2ZUA A;  4DI6 A;  1BUX A;  3GPA A;  1WKL A;  1S5Z A;  2AZ3 A;  3FCW A;  1HIY A;  1ZS6 A;  1LEO A;  3VGT A;  1W7W A;  5CAB A;  1NDK A;  1K44 A;  1NHK L;  3ZTP A;  4HR2 A;  3VGS A;  1PKU A;  1U8W A;  1NLK L;  3BH6 B;  3GP9 A;  4F4A A;  3FCV A;  3BH7 B;  3JS9 A;  3EIC A;  4ANE A;  2BEF A;  3FBC A;  5C7P A;  1B99 A;  1NDP A;  2NCK L;  3Q8U A;  4UOF A;  1MN7 A;  3EVO A;  4O0N A;  1VYA A;  2AZ1 A;  2HUR A;  3L7U A;  3BBC A;  3NGR A;  3VGV A;  3ETM A;  3FBF A;  3Q8V A; 
#chains in the Genus database with same CATH topology
 5LMU J;  1U2F A;  4FKX A;  1U1M A;  3SXL A;  4IRD A;  1FNM A;  1UKU A;  4L73 A;  2JFD A;  4QYZ J;  2HHW A;  4B3S J;  2WOM A;  4LRD A;  3MPY A;  2VG5 A;  1RWN B;  4G6V B;  2OTL S;  1Q78 A;  3FK4 A;  2QN6 B;  1HNV A;  1S77 D;  4OI1 A;  1YJ9 S;  5CYQ B;  2YXL A;  3ZC4 A;  1B4S A;  1HQ2 A;  1FRX A;  1Q8I A;  1SUQ B;  4KJI A;  2NZ4 A;  1W2B R;  4OHY A;  4OLP A;  4URG A;  4O0I A;  3PR5 B;  5U47 A;  2E1R A;  3PKM A;  3GWC A;  2UXC F;  3RG6 A;  2V4R A;  3D4J A;  1HNI A;  3MMC B;  3LA0 A;  1RWK B;  3GG0 A;  4PUO B;  3VQT A;  1QY7 A;  3GJQ B;  3UI3 A;  4EEY A;  4PRF A;  4UTG A;  4GKJ F;  3BGU A;  5K8N A;  2AQ4 A;  1HLW A;  3O2I A;  3NCR A;  3ET6 B;  4YME A;  4NOH A;  3K58 A;  3AOD A;  2EFN A;  1RT7 B;  3IG1 A;  2C2Z B;  1RCX B;  1O0P A;  3H98 A;  4F36 A;  4K4V A;  1LFW A;  1NBE B;  3H42 A;  4OYW A;  4M5N A;  4YP3 A;  2B3T B;  1JQG A;  4A8K A;  1NME B;  1KQK A;  5EX3 A;  2IDE A;  1D1U A;  1W26 A;  4FYY B;  4M5D A;  5IOL A;  3PW0 A;  2B0G A;  1ZA2 B;  4P75 A;  4OYZ A;  4NLO A;  5LXR A;  2D69 A;  2M8H A;  2F1F A;  3UD5 A;  2ZH3 A;  4IOA Q;  3EGV A;  2VJU A;  5KFA A;  2DGQ A;  4R5P B;  3TQ1 A;  4IO1 A;  2UU9 J;  3ZZT A;  4IDK B;  4C8K A;  5DM6 Q;  2VG7 B;  4DR4 J;  3I4P A;  3IM9 A;  2Y0S D;  1YIT S;  2H9Z A;  3ZNJ 1;  3CUN A;  2D9O A;  2WVD A;  4IG3 A;  4NCA A;  1N0U A;  2RE1 A;  2I1R A;  3CCM S;  4I2Q B;  4M5K A;  3UVJ A;  2OTJ S;  3LWM A;  4JUZ A;  3TZX A;  1TTH B;  5C2C A;  3FRZ A;  2JHE A;  1NSQ A;  3LP2 A;  1U47 A;  2XMJ A;  1JX4 A;  3OSN A;  4BLG A;  3GR0 A;  4I6A A;  3UD3 P;  4JI1 J;  2XMU A;  4L74 A;  1FWK A;  4LFA F;  5D3G B;  3M30 A;  1HL6 A;  3KG0 A;  1WF2 A;  2COL A;  1V3R A;  4UUX A;  4UOG A;  3PO5 A;  4WU3 A;  4EI2 A;  2YH1 A;  2H4Y B;  3QO9 A;  2HNY A;  4JI7 J;  1YZ6 A;  3AXK A;  3C2P A;  4JI2 J;  1T0T V;  2V34 A;  2C3O A;  2E29 A;  4K2X A;  3RBD A;  3H7H B;  5IFM A;  3EGZ A;  3OBI A;  1KS2 A;  2B5J B;  1PBA A;  3AB2 B;  5F9L A;  1EP4 B;  1RTI A;  4HL9 A;  5IM0 A;  2QGF B;  4O3N A;  4IH6 A;  1U7L A;  2FVR A;  2W25 A;  2CQ2 A;  1F3V A;  4ED8 A;  4NEY A;  1EQ0 A;  3QRR A;  2MPU A;  4ZHR B;  4XTT A;  3MMB B;  4RX6 A;  3EGW B;  4ED5 A;  4F04 B;  2JNJ A;  1XBW A;  4Y3C A;  5KFD A;  2O5D A;  5F8L A;  4J7C A;  1RWX B;  1VJQ A;  1ZAX A;  4DHV A;  1OS5 A;  1MSW D;  2MKY A;  3NAH A;  1DY3 A;  3K57 A;  2HQF A;  3VAK A;  1NUE A;  3R5B A;  3HXM A;  1RWP B;  1KKH A;  3NWR A;  2HVD A;  2HNZ A;  3M6X A;  3OSP A;  1UWA A;  1SPB P;  2XLI A;  1HQE A;  1EKR A;  1JMT A;  1SIW B;  5K5M A;  3H40 A;  3HVW A;  5D4N A;  1RBO B;  1YLX A;  1FHT A;  2CQ0 A;  1U26 A;  4AFF A;  1DZ5 A;  3GU0 A;  4DR7 J;  2BW2 A;  2R7Q A;  3HKW A;  4EGL A;  1MRO A;  2PDA A;  1YQH A;  2I6W A;  3OFE A;  1R6V A;  4ECU A;  3DRP B;  1M0S A;  4V19 X;  3HSD A;  2AJ4 A;  2DNY A;  3MGJ A;  2OI2 A;  3D0H E;  2FVC A;  5HI7 A;  2CPZ A;  4OYA A;  4B17 A;  4FXW A;  3NNC A;  4TY8 A;  3RBZ A;  1MWZ A;  4KC5 A;  4DR5 F;  3AAW B;  1NKB A;  3MCN A;  2EC0 A;  1UZH A;  2RS2 A;  2BKN A;  1NB7 A;  2E1M C;  1K47 A;  2YH0 A;  4EBE A;  4PXE A;  4Q2M A;  2MLY A;  4YDX A;  2CQI A;  2W9B A;  2VQE J;  2BA9 A;  2LEP A;  4CLY A;  1MNE A;  5AE3 A;  2HFN A;  2DRB A;  3MM6 A;  1TZ0 A;  4O4G B;  4KT0 C;  4DPU A;  4CIO A;  3KHG A;  4CTA A;  1WNE A;  1WOR A;  4ICL B;  4CO4 A;  4LBH A;  3SDE B;  4NYZ A;  4F7V A;  2DEI A;  3AJD A;  4IFV A;  1U8W A;  2ZE2 B;  1XMO J;  4XK8 C;  3NNA A;  2VFT A;  3I0R A;  4EMD A;  5KG2 A;  2QMX A;  3UCZ P;  4QW9 A;  2C3Y A;  1TKD A;  3L7P A;  2VBX A;  3OVB A;  1MLA A;  1KDN A;  5KFS A;  2XLK A;  3LP0 A;  2EEY A;  2YNI B;  3GV8 B;  4Y2C A;  2FJD B;  1TL3 A;  3RUB L;  5IC4 B;  1I1G A;  2LLZ A;  6AT1 B;  2NYH A;  2D74 B;  4CLL A;  5EWE A;  4IRK A;  3AOA A;  2ATL A;  4J9R A;  4C3K A;  4DR6 F;  1SC3 B;  4G1Q A;  4GKK J;  3M05 A;  1YJN S;  2KT2 A;  1RWU A;  2BXJ A;  3GYX B;  3K7R A;  2A10 A;  2FTR A;  1VHI A;  3W60 A;  4OL8 A;  1FKP B;  1YBT A;  1S6O A;  3ISN C;  2RF2 A;  2V5H G;  2OJ3 A;  1NK5 A;  1Y5L B;  2WB4 A;  2V69 A;  4DUY F;  1BD6 A;  2RS8 A;  4Q8F A;  1X4H A;  1WJ9 A;  3QJJ A;  4BWJ A;  4XAK A;  4KSE B;  4U95 A;  5KOX A;  2C3P A;  4JYA F;  1N33 F;  2FHJ A;  1ACM B;  5KFU A;  1RT1 B;  2QSW A;  2P9E A;  2HBZ B;  3H2V E;  2CAD A;  1RZM A;  3G71 S;  4ED4 A;  2DNK A;  5LT5 A;  4ZVP B;  1S9F A;  4LFC F;  3G9C A;  7FD1 A;  4DS5 A;  3PG9 A;  1KTV A;  1URR A;  1T9T A;  2OEM A;  2VV5 A;  3MTJ A;  3G6E S;  1VC0 A;  4KHR A;  1Z2Z A;  1FD8 A;  1HKA A;  3MAQ A;  1JLG A;  1QE1 A;  1P9Y A;  4G65 A;  1PBU A;  4WFY A;  4PZV A;  2UXB J;  2HHH F;  3MM7 B;  1SVD A;  5EWG A;  4LSL A;  4DX8 H;  2HPU A;  5D8H B;  2ZD1 A;  3IBC B;  3CO0 P;  4RW7 A;  1HD0 A;  2F4V J;  3K8W A;  1X4D A;  2J8A A;  2G0J A;  2OUG A;  3HVT A;  3MCO A;  1WD6 A;  1GTE A;  1TVR B;  1YJT A;  3DMJ A;  5A8R A;  1EZZ B;  3MUM P;  3UN3 A;  5C24 B;  5HN0 A;  3NS7 B;  4DI6 A;  7AT1 B;  2AU0 A;  2LKZ A;  1RT2 A;  2AGQ A;  3OUY A;  3V6H A;  4JI4 J;  2D41 A;  4R0E A;  4ZPV R;  1VRU A;  2VIC A;  4I6Y A;  3P5T L;  3TUJ C;  4NZ7 A;  2QA2 A;  1B0T A;  3I56 S;  1O6X A;  1RTJ A;  3H8Y A;  4C0H A;  4DR2 F;  4PXC A;  2FZC B;  2XGQ A;  4PPD A;  2ZM6 J;  4MKY A;  3DNC A;  4WP3 A;  4ZLJ A;  4B9T A;  2CXE A;  1RYS A;  1PC4 A;  7FDR A;  3ILL A;  2XQC A;  8RUC A;  2OGU A;  4NL5 A;  3BSN A;  1DTQ B;  1F9F A;  4I67 A;  4MYT A;  3A1Y G;  3KJQ B;  3DU6 A;  1S1U B;  2MQ8 A;  3O3L A;  2UXD F;  3QNW B;  3LAK A;  4B3T J;  1LWF A;  4DOZ A;  2H4W B;  1B64 A;  1DFD A;  1L3K A;  1NDL A;  4PCQ A;  3H2U B;  3CCJ S;  3IWN C;  3R7S B;  2ZBQ A;  2E1A A;  3HD1 A;  2MQM A;  1NM2 A;  2RRB A;  4IOB A;  2M0G B;  3SEO A;  2FLP A;  1OJ4 A;  4XPC A;  3CME S;  2UVV A;  1HWL A;  1FA0 A;  2MEW A;  3DDN A;  3SQG A;  4J9N A;  5IS2 A;  4EO8 A;  3HHL B;  1FRK A;  3KLF B;  2GO8 A;  2H51 B;  3PM9 A;  2ACY A;  4B08 A;  4DLG A;  1AXQ A;  1KP6 A;  2WAQ D;  2BJE A;  3T5H A;  3SSS A;  3DC2 A;  4OI6 A;  1IWA A;  2VBY A;  2MZJ A;  3UW1 A;  4QPX A;  1F9E B;  3ZZP A;  4DL5 A;  3HO1 A;  3L95 X;  1GMV A;  1JJH A;  1FRH A;  1RAH B;  2X1F A;  1IQZ A;  1SUQ A;  5HBM B;  1KOH A;  5IQQ A;  2AGO A;  4OZ1 A;  1NND A;  3IP0 A;  2HHT A;  1N34 J;  4DV7 J;  4BC9 A;  4I7F B;  3VR1 A;  4CRJ A;  2XBP A;  3FDS A;  4PQA A;  1S57 A;  1Y7P A;  4KYZ A;  2JOQ A;  2O01 C;  2V94 A;  3P5B P;  5A8K B;  2JLF A;  4R25 A;  3W8P A;  1HMV B;  1VK8 A;  2IYG A;  3V81 A;  2CQP A;  3MMC A;  2GVD B;  2YWF A;  4PUO A;  5HP1 B;  1UA1 A;  3R8Y A;  2KI2 A;  2RUS A;  2X7I A;  2M3D A;  2PC6 A;  4HHH A;  1NJI T;  3QGP A;  4C3L A;  2Z56 B;  2QSF A;  5C5J A;  1J5E J;  1B3T A;  1QAI A;  3ET6 A;  2J76 E;  5BR8 J;  5GME A;  3TX8 A;  4K0K F;  3C14 B;  3PW5 A;  2ADB A;  1IKV A;  2B51 A;  3IAS 9;  5AJ3 F;  2RVJ A;  1TQL A;  3T1A A;  4N47 A;  1NK8 A;  1T9Y A;  3PYG A;  2NLW A;  2JVR A;  1NJZ A;  1VQ4 S;  1HHT P;  1TL5 A;  1GXL A;  1FD2 A;  3RBX A;  2OH2 A;  2VIH A;  3G82 B;  4HTI A;  5D15 A;  5J1N A;  5KFR A;  2I9S A;  4RU9 A;  2HAF A;  2JLE A;  1WHY A;  1JJ2 R;  1VQK S;  1XMQ J;  3VQS A;  1Q81 T;  3ISN D;  2HHU A;  3ILO A;  2BOA A;  2Q6B A;  2I0X A;  5GMD A;  4HLB A;  4KPC A;  5H9F J;  1HHS A;  2MMY A;  3PTW A;  4B9V A;  4IDK A;  1HBO B;  3FEY B;  2XC9 A;  2VG7 A;  2DNZ A;  3E2E A;  5RUB A;  3KHR A;  5KFX A;  1LWE B;  2J0S D;  3CCT A;  3VWS A;  3N0V A;  3OTC A;  3IRW P;  2AT1 B;  3LPE A;  1Q8K A;  3ENA A;  2UV8 A;  4I2Q A;  3K5O A;  4JI5 J;  1YKW A;  3K8V A;  3R1L A;  3SIP B;  1UMJ A;  4AQY J;  3QJL A;  1FF2 A;  2PFF B;  1NXI A;  2HFO A;  1TL1 B;  1CLF A;  1UW9 A;  3VZH A;  1ZTT A;  2J8S A;  3CJQ A;  3E8O A;  2M52 A;  4B3M J;  2DCL A;  2WBM A;  2ZH2 A;  4CO0 A;  3R6G B;  2QIF A;  2AWZ A;  3DLL Q;  2G1D A;  3V2U C;  5M2P A;  2V8P A;  3CCS S;  2C2K B;  1T95 A;  1CUL B;  4K4U A;  3UDC A;  1GNK A;  4JI3 J;  1U6Z A;  4L72 B;  3EJM A;  4KGV B;  1NSK L;  4P2S A;  1UEV A;  1RT6 B;  2HZV A;  4LF7 F;  4RW9 B;  4A8W A;  5HRO B;  2RB7 A;  4WTY A;  5GAD I;  3ZFV A;  1I51 B;  1HR0 F;  4WXO A;  1TUG B;  2JJ4 D;  3MEE A;  1JLC B;  3J7A N;  2BJ1 A;  3D3C J;  3K5N A;  3UFC X;  3QZ8 A;  2B9E A;  1KVJ A;  1QLN A;  2Y1J A;  1H98 A;  5BYS A;  1VBX A;  5LL6 d;  1CVJ A;  1FES A;  4JI8 J;  1OY6 A;  3MD3 A;  2FJB B;  2VA3 A;  4WWS A;  1NU4 A;  2F9D A;  1U2R A;  3A13 A;  1B7F A;  1FEH A;  2XCA A;  4LF4 J;  2W2N P;  4O3P A;  2MQQ A;  1BE4 A;  5EHH A;  2YTC A;  1OPZ A;  2IFX A;  2W2P P;  3CCZ A;  4WFB Q;  1WOS A;  1REV B;  2RU9 A;  4EU0 A;  5ITH A;  2Y8Y A;  4R0J A;  1OO0 B;  1NPP A;  4RNN A;  5KG3 A;  4M5G A;  4OZ3 A;  3EPI A;  3A8J A;  3GLJ A;  4M5M A;  5A0Y B;  2C2N A;  4USW A;  3CJ8 A;  1S1W B;  1VFJ A;  4KGZ B;  4DFP A;  2D3O R;  2NXN A;  4JV2 A;  4EUV A;  4P6Q A;  1F5B A;  3QRQ A;  4ED3 A;  2PE8 A;  1L3S A;  2YPZ A;  1PYO B;  4IG0 A;  1F5C A;  1NKC A;  1C0U B;  1X8D A;  2YWH A;  1HW8 A;  2UZA A;  4C0B A;  4F3Q A;  3MMA B;  2HLT A;  2OIH A;  1NK9 A;  5ETV A;  5HO4 A;  2K06 A;  4PXD A;  4TKT A;  3ZTQ A;  3C6T B;  3H5S A;  4OZL A;  4QWC A;  3DLE B;  4ES1 A;  5AXN A;  1S6P A;  1DTT A;  3PX4 A;  2LYV A;  3CXC R;  1XEZ A;  4DCJ B;  3M2U A;  1SBR A;  2HHS A;  3N4W A;  1JLQ B;  1QD1 A;  3IN5 A;  3DM2 B;  2C3M A;  2RJZ A;  2XB2 D;  2OLW A;  3RB3 A;  4JI0 F;  5KFC A;  4QBU A;  2UVR A;  3HHL C;  2GS8 A;  5C25 B;  4DBQ A;  3DU5 A;  1VQM S;  2B9W A;  1XTZ A;  2P9G A;  3OVA A;  2BVZ A;  4H4M B;  1W25 A;  1UAW A;  4GKJ J;  3QGI A;  5J2Q B;  3THP A;  2CDQ A;  4O4G A;  4DF8 A;  2XMK A;  1NH7 A;  2GO9 A;  4DQQ A;  2XLJ A;  2IBK A;  1FRI A;  3H59 A;  3ICL A;  2DVI A;  1KFD A;  5DRK A;  4LRC A;  1T05 B;  2JWN A;  4HR2 A;  5F3T A;  1GAO A;  1WTB A;  3AT1 B;  1GT8 A;  3D66 A;  3IWL A;  4RR5 A;  4M95 A;  4EFA C;  3BM7 A;  4HHU A;  3I5A A;  4ZP6 A;  3JSM B;  1C1C B;  4D3H A;  1P1L A;  1TUV A;  3DOM B;  2YNF B;  2PA3 A;  1OPI A;  2HWI A;  3BKT A;  3KKF A;  1MMD A;  4ECS A;  2Y1R I;  3N9U C;  3R9L A;  5KFI A;  1GTH A;  1XR5 A;  1U49 A;  2YNI A;  3MR5 A;  5I4M A;  5D78 A;  1KTQ A;  3GFZ A;  1VQS A;  2HND A;  2MTL A;  1G4C A;  2VF3 A;  2FLO A;  4NXM F;  4AT1 B;  3W2W A;  1NPR A;  4UOH A;  3DGV A;  1K73 T;  2RH3 A;  1GH8 A;  2QC3 A;  2DCU B;  1X5O A;  4HH1 A;  3UDL A;  3ZZO A;  2D9P A;  4LBI A;  2O66 A;  1BQM A;  1X5P A;  4CLT A;  3VGT A;  3UD4 P;  1I6J A;  3LGH A;  2MZS A;  1NLK L;  3LH2 S;  2VPX B;  1RT3 B;  1T3O A;  2BE7 D;  3Q8U A;  2ABY A;  3EVO A;  1SH0 A;  3AD9 C;  4A8F A;  4CLU A;  4LFA J;  2DIT A;  3C16 B;  1U2C A;  2LEA A;  4F0H A;  5D4O A;  9RUB A;  4F26 A;  1IBK F;  3MCS A;  1OQ3 A;  5ETK A;  4LUB A;  4OIX A;  1XIQ A;  3IGV A;  3JSY A;  1QAJ A;  4P10 A;  3P96 A;  2QV6 A;  3A3N B;  4CNY A;  4EBD A;  3R2D J;  1GXT A;  2QA1 A;  3CSK A;  3MM7 A;  2JFK A;  1OSC A;  3NGK A;  5KG5 A;  2YQ1 A;  2EFG A;  4MIW A;  3GTY X;  1N32 F;  3MMJ A;  2QO3 A;  1IR0 A;  5D0G A;  5B0D A;  4ZLP A;  2EFQ A;  2L3M A;  1QTM A;  5J2P B;  5C24 A;  3RBE A;  2J7U A;  1R27 B;  1GMU A;  3G4S S;  1S5Z A;  1U02 A;  1O8B A;  3D3B J;  4PR6 A;  4CWB A;  2HS3 A;  1VBY A;  1PKU A;  3GB0 A;  2Z8Q A;  3PIO Q;  3C6U B;  2LQ5 A;  5C7P A;  1IR1 A;  4DV1 F;  1VQ7 S;  2Z2L A;  3QIP B;  3US5 A;  1TKX B;  3VGV A;  2E5J A;  3WC0 A;  3G8T A;  1JNZ B;  2CJ9 A;  1SKS A;  4DUZ F;  5I3P A;  3R5A A;  2KVQ E;  1SV5 B;  4URS A;  4CO1 A;  2F9J A;  5GVQ A;  5KFN A;  1SC1 B;  3HSG A;  4IKA A;  3BS9 A;  4XDD A;  2N7Y A;  1S9E B;  1UTA A;  1S1U A;  1HFE L;  3N6N A;  2VA2 A;  4DDF A;  2VUG A;  2Q3P A;  1UJ5 A;  2DTJ A;  3IGN A;  3JTO A;  5FDL A;  1LFP A;  1ZTW A;  3DOK A;  3FJ2 A;  4EBC A;  2E9T A;  5K14 A;  1FRJ A;  1R8A A;  2VZ9 A;  3LTO A;  3A3P B;  3AB4 B;  5E5N A;  2ZIT A;  5IXU A;  3KG4 A;  5K8P A;  3T1Y F;  1ROF A;  2LQ8 A;  2CKW A;  3TWZ A;  5F8M A;  5CZV A;  1Z4U A;  1APS A;  3Q8R B;  1RT4 B;  5L1L A;  5J2M A;  3SCL E;  1S79 A;  4YR3 A;  4WP9 A;  1TV6 A;  4EWT A;  1RAC B;  5DJB A;  3Q2T C;  1AW0 A;  4DR5 J;  3G6X A;  1GFW B;  3QRP A;  3HKZ D;  2W2O P;  1DLO B;  3IR5 B;  2DIU A;  1FX2 A;  4OYO A;  2RIL A;  1FDA A;  3NGD A;  4OLO A;  3SMZ A;  2KU7 A;  1OYD A;  1IJF B;  1X4C A;  2XS2 A;  2XS7 A;  1PJ6 A;  4LT6 A;  2RQ4 A;  2ZUG A;  3M9N B;  3GSD A;  3HHL D;  1U0S A;  4GVB B;  2YQ0 A;  1N4L A;  2XHC A;  4KHM A;  3PY8 A;  4KKO B;  5EUH A;  4QJV A;  4HAC A;  2XM3 A;  2CQ4 A;  2BAC A;  5HBM A;  2IMW P;  4TLQ A;  2K7J A;  5H1S V;  3ZTO A;  3KFW X;  2OEJ A;  2PGC A;  4IRC A;  1UVJ A;  2NPI A;  3HX9 A;  1NK7 A;  4Y2A A;  8ATC B;  4I7F A;  2B7B B;  1Z2L A;  2HWH A;  3CDB A;  1WC6 A;  3V6D B;  3QFH A;  3AA8 A;  1T8E A;  3TAM B;  2NRE A;  1HMV A;  2HFZ A;  3RR8 A;  5A76 A;  4ZVO B;  4UST A;  4NPO A;  1WEL A;  4RW6 B;  3WIV A;  5B09 A;  3JB9 k;  3CJR A;  3OVS A;  2YPY A;  2W1B A;  2CG8 A;  4G3I A;  3OLA A;  1EKS A;  3M9O B;  4YY3 F;  3ZZU A;  2B4O A;  3F44 A;  1VRT B;  1NRK A;  3OLB A;  4F4Z A;  2MJU A;  4DR6 J;  3C14 A;  1WUU A;  3DLK A;  1VOM A;  3MI7 X;  3CJ4 A;  1YRX A;  2R7W A;  4WKR A;  2EFV A;  2HEK A;  2GHV C;  5D0E A;  1V5I B;  5K8O A;  2EKN A;  1HYS B;  3DXS X;  2P8I A;  2CZ4 A;  4DUY J;  1Q82 T;  2UUA F;  3SZ2 A;  3FBB A;  1CJT A;  2YNH B;  4OI0 A;  1V6H A;  5DQG A;  2ZJQ Q;  4OV1 A;  2RML A;  3JYT B;  2YWW A;  5FLX U;  1TL4 A;  4RUA A;  1F1B B;  4ZIT A;  5HVF A;  4JI6 F;  4CO3 A;  4NMX A;  2FLN A;  2FD2 A;  3CJ3 A;  4LFC J;  5C42 A;  4OJ3 A;  1LWE A;  5IV3 A;  5FLX Y;  2G9O A;  3IO1 A;  5T7L B;  1LW0 A;  1CPZ A;  4HT5 A;  2MZT A;  3KYL A;  5FJ4 A;  3AJ1 A;  2IRY A;  1UVL A;  1FRM A;  3RB6 A;  3Q2S C;  3UWT A;  4Z7Y A;  2MKJ A;  3T6B A;  3O44 A;  1TL1 A;  4DSK A;  2IC3 A;  3CW2 C;  3MPU B;  2FZK B;  2KT5 A;  4OHX A;  4LF8 F;  1RAO A;  1HAR A;  3BYP A;  4F4Y A;  3TZY A;  3H5Y A;  4WIQ A;  4DR1 F;  2X1G A;  4WU2 A;  4A8Q A;  4L3K A;  3S8S A;  1RAD B;  3M8P B;  4LSN B;  3HHD A;  3QLH B;  1GEH A;  4QCL A;  1D9F A;  1M5K C;  4LF6 F;  2HGN A;  2IY5 B;  4FS2 A;  5EWF A;  4F2S A;  4IR1 A;  4DR2 J;  2HHV A;  2AYM A;  6FD1 A;  2KYZ A;  1VQ9 S;  2V50 A;  4RW9 A;  5HRO A;  4A8X A;  3M32 A;  3K59 A;  2ADC A;  2QA4 G;  3HVA A;  3I5B A;  3DRX A;  3TQE A;  3OR2 B;  3BR8 A;  3GCX P;  3O8W A;  1JLC A;  3OJS A;  3G87 A;  1YSJ A;  1H0H B;  1MN7 A;  2UXD J;  2M4M A;  4J9V A;  4WKY A;  4DJB A;  2P6S A;  1TL7 B;  2VOP A;  3R7N B;  1RYR A;  3CD6 S;  1CJK A;  3THT A;  3QFW A;  1S9G A;  4ED2 A;  2GCF A;  1C2P A;  3FQL A;  4M94 A;  4OX7 A;  3HZE A;  2MQL A;  2L48 A;  3O6Q A;  1RUS A;  5CYM A;  3HP6 A;  5H9E J;  4K5R A;  3W9H A;  3D5M A;  4V19 J;  3W2V A;  1UPM B;  2PT0 A;  1S1W A;  2XWX A;  1S1V B;  1K0V A;  1Y0H A;  4RNO A;  3QT5 A;  4TVA B;  4K8R A;  3SQO P;  4CYU B;  5GAD U;  1WG1 A;  5F8G A;  4O3R A;  2HVI A;  2G2Z A;  4U7U K;  4NML A;  1CEZ A;  1WKL A;  5IQ6 A;  4OYM A;  1C4A A;  5JMN A;  2JL9 A;  2R4F A;  4O3Q A;  1G1X A;  3BH7 B;  4NYO A;  1LQ9 A;  3MMA A;  2E7X A;  4X64 F;  2ZVI A;  3NGR A;  2GGP B;  3I4H X;  1WHW A;  4NA1 A;  5ETQ A;  3C6T A;  3CJK B;  4QPT A;  3DLB A;  4P73 A;  3DLE A;  2CQD A;  2MKC A;  4PWU A;  4LBP A;  2RQC A;  2JX2 A;  4RPF A;  5AE2 A;  2YBV A;  2KFZ A;  1JLA B;  3HFZ B;  3LOU A;  1QVG R;  1JLQ A;  2CZV C;  3RYL A;  3DM2 A;  2H65 B;  2FB0 A;  2BZ2 A;  3Q23 A;  5C25 A;  1R89 A;  1BHN A;  4M8L A;  4QIE A;  1HHQ A;  2R2T A;  1SJF A;  3T5J A;  4H4M A;  3PFE A;  4DCO B;  5J2Q A;  3WX4 A;  4YB7 A;  2KM8 C;  1U45 A;  2B4V A;  3RAQ A;  2F3J A;  3N28 A;  1LNQ A;  1RKJ A;  4OJ1 A;  4K0K J;  2DHS A;  3CJ2 A;  2HK3 A;  2NS1 B;  4ERD A;  1T05 A;  4L6V 3;  3W9J A;  4OHV A;  3G8S A;  1EIY B;  2QT7 A;  5AJ3 J;  1FJG F;  2R2S A;  4X4V A;  1IKX B;  3JQM A;  4N56 A;  4UY8 T;  2I38 A;  3MAH A;  2ATC B;  4PG7 A;  5CCL A;  2GML A;  3JSM A;  3UQS A;  1WF1 A;  3OPK A;  1VQY A;  3QT8 A;  2YNF A;  5DLG A;  4Q5V A;  2VQF J;  5DDQ C;  3NBP B;  2W9C B;  5AXL A;  4ID5 A;  1WHV A;  2LA4 A;  4CO2 A;  2XI2 A;  4GO7 X;  4QU6 A;  1IKW A;  4KO0 B;  3F0N A;  2JSX A;  2V63 A;  3BYR A;  2ASY A;  3SSQ A;  4KE5 A;  1U1O A;  3BQ0 A;  1LW2 B;  3KTQ A;  4KFB B;  2LP4 A;  4H4K C;  1SJ3 P;  3MM9 B;  2E5G A;  2ASJ A;  4PWD A;  1VRQ C;  4DQS A;  4JBC A;  3S7R A;  1BC6 A;  1N5Q A;  5CD4 H;  2R7O A;  1SH2 A;  4FYV B;  1WF0 A;  3MUR P;  2Z0G A;  4B02 A;  1FVQ A;  2NQP A;  3ZTP A;  2OAU A;  4PPZ A;  1Q79 A;  1RT3 A;  3E01 A;  2XZD B;  5G0R B;  5F3Z A;  1RTZ A;  2VOD A;  4L75 A;  2K1R A;  3ADA C;  2IVM A;  3QGH A;  2A6M A;  2ZFH A;  1UFK A;  5EN1 A;  1YRU A;  4OYP A;  4UF4 A;  4MFB B;  1FKO A;  3JTP A;  4ZVG A;  3VHQ A;  5A6W A;  2DHG A;  4LF7 J;  4MK7 A;  3GFH A;  2GV1 A;  4MT1 A;  4C48 A;  1EET A;  2JEI A;  3TUI C;  2VBZ A;  3H2L A;  1KHV A;  4NCG B;  1HR0 J;  5J2N B;  4TU7 A;  3TEH B;  1RWO B;  1GMW A;  5GAG I;  1OMS A;  2MYF A;  4ES2 A;  1E6V B;  3EM1 A;  1AFJ A;  2NUH A;  2AGP A;  4NLT A;  4C4W A;  2H48 B;  5J2P A;  4YQW A;  4C6A A;  2CQH A;  2CWX A;  2JVO A;  1VMB A;  3PW7 A;  3FZ2 A;  5D0H A;  2I8E A;  3P45 B;  4IFY A;  4DSF A;  4TU8 A;  1KFS A;  3C6U A;  3OFG A;  3NCQ A;  4ELU A;  4ECR A;  4NLU A;  1TKX A;  3I87 A;  3PV8 A;  4RW4 B;  2HQD A;  2WTF A;  4P2M A;  2MZR A;  1X9M A;  1HW9 A;  1PCA A;  3RTV A;  1N36 F;  2P6T A;  3OFH A;  1DQ8 A;  4WK1 A;  3CTR A;  3C19 A;  4RWW A;  2IIH A;  4QZV B;  1SV5 A;  1A9N B;  2DIV A;  4NZ0 A;  4NRU A;  1KD1 T;  1QM9 A;  1S97 A;  3TZW A;  4PXB A;  3WQP A;  1NO8 A;  3VZI A;  2ZBC A;  1KLM B;  4ZS6 A;  3CDU A;  3AQO A;  2HQC A;  3PAC A;  3C15 A;  4Q45 A;  5IV4 A;  2OHD A;  3CJ5 A;  2RU3 A;  5AXK A;  2YNG B;  4YUD A;  3R5D A;  1PSD A;  5DET A;  3PW2 A;  4DSE A;  3U27 A;  3KJN B;  3EZO A;  1SC4 B;  3TZZ A;  3M9M B;  4RLE A;  1H3D A;  5I3Q A;  3M8W A;  3BDP A;  1SCJ B;  2HS0 A;  1S0V A;  4P7T A;  1Q86 T;  5I3U B;  4KPY A;  1DLO A;  1YG0 A;  2LU2 A;  4PQU A;  4JI0 J;  1ITP A;  4QIV A;  2B6A B;  1VR6 A;  3GIJ A;  2YKM A;  1JIH A;  2F65 A;  2WVE A;  4YN3 B;  2CJQ A;  4NLR A;  1E6Y B;  3CIM A;  3PFO A;  1ZOT A;  3D6M B;  3CB4 A;  2CAJ A;  1P6T A;  3C66 A;  2C2R A;  4KB7 A;  2DRD A;  2DXF A;  4ZP7 A;  4MMO A;  1VGY A;  3FBE A;  4GVB A;  4QWD A;  1KRP A;  5DM7 Q;  4DV5 F;  4Q0B B;  2DEJ A;  1Y3K A;  3RJM B;  1RDR A;  2IBO A;  1CS4 A;  1WOP A;  1N6Q A;  4KRW A;  3FSY A;  5B08 A;  1IQT A;  4PYD A;  4LF2 A;  4FDF A;  2XI3 A;  4J9Q A;  3JTN A;  2HGL A;  2V9W A;  2J9C A;  3FSI A;  3V6D A;  3TAM A;  5E33 A;  2LXF A;  1S72 S;  4PG6 A;  4ZJO A;  3KLG B;  5IZH A;  3G96 A;  2ZUA A;  1D8Y A;  4RW6 A;  2CJK A;  2V8V A;  2AIR B;  2CQG A;  2AJF E;  3BGL A;  2FUG 9;  2E66 A;  2E7V A;  4J90 A;  3POT B;  1CQN A;  2DT9 A;  3UCU P;  3U1L A;  4M5L A;  2B9Y A;  4UT4 A;  4NXM J;  3FVY A;  4QOT A;  2J5A A;  2W8L A;  2Y1L B;  4DPY A;  1GK8 A;  1R8B A;  3ONQ A;  3GFX A;  4C3M A;  4FS1 A;  3LGM A;  4CP5 A;  4F4K A;  3SV3 A;  4G1I A;  1X4G A;  4ZLN A;  2BE2 B;  1FWL A;  1HYS A;  1L3V A;  2YWE A;  2E5I A;  2V8D A;  4CH0 S;  3D9B A;  4CT8 A;  3KUG A;  3BB5 A;  2DNL A;  1R0C B;  2VFU A;  2ZC4 A;  5HSP A;  2POK A;  1J27 A;  1YZ7 A;  4ZJL A;  3OR1 A;  4DQP A;  2YNH A;  1T3N A;  1RWV B;  4F4W A;  1SQE A;  2WRM A;  1Y11 A;  4HH0 A;  1G6B A;  1WTF A;  3MR7 A;  3JYT A;  4OHZ A;  4NAS A;  1JKH A;  2I5J A;  3FFI A;  2Y8W A;  3W65 A;  3HM9 A;  5GAH U;  4C8Y A;  1UVK A;  1YJW S;  2XMA A;  1IBK J;  1ZM9 A;  1NZ8 A;  5LSR A;  3N6M A;  3MF5 A;  4C7Q A;  2DGT A;  1CJV B;  2AJ1 A;  3WHI A;  3DCA A;  5T7L A;  4F2R A;  3MD1 A;  3M1V B;  2FC9 A;  4O4R A;  5AE1 A;  1H2U X;  2C2O B;  1VC6 A;  2QLB B;  2HBY B;  3NG8 A;  3BGO P;  4FNH A;  5KFL A;  1N32 J;  5L1J A;  3HI9 A;  1F60 B;  2WVC A;  2AJQ A;  1RBL A;  2CNN B;  4J5O A;  2FGO A;  8AT1 B;  4UQT A;  2CUY A;  2EW9 A;  1YBU A;  4LSN A;  4RW8 B;  1Y3J A;  2A18 A;  1Q7L B;  5KOW A;  2FJA B;  1QJH A;  4DV1 J;  4ZCI A;  1UJ6 A;  1N5T A;  3S01 A;  2OPS B;  2YKP A;  2CNK B;  4Q2L A;  2ZDO A;  1HQU B;  5CCM A;  2B43 A;  3HDS A;  4DUZ J;  1WDT A;  5L38 A;  1X60 A;  3OR2 A;  3VTI A;  2DRA A;  1FNO A;  3W66 A;  5CYJ A;  1ZPV A;  1S4F A;  2KRB A;  1S6Q B;  2CJA A;  3AH6 A;  2BRL A;  5IT4 A;  1IVZ A;  4A4J A;  3U1N A;  4FBT A;  2K3K A;  2R42 A;  4CH1 A;  1JLE A;  1DJ0 A;  4QYR A;  2R2R A;  4OZJ A;  2QMU B;  2HG4 A;  3B4D A;  2ROE A;  2HHQ A;  1LKZ A;  1FO1 A;  2AHO B;  3T1Y J;  2DR6 A;  2DO4 A;  3LGN A;  4OYB A;  1FE4 A;  1CBK A;  3NAI A;  2FHK A;  1X9S A;  1IUJ A;  1CC8 A;  2ZOM A;  1RU1 A;  2HFS A;  4QWB A;  1SH3 A;  4LRB A;  4AYB D;  3HLU A;  1R8H A;  1OSD A;  2G2O A;  4ELT A;  3KMQ A;  4GC7 A;  3D6H B;  1RQ0 A;  5BJR A;  3IS9 A;  2B9X A;  5ETR A;  4FXD A;  3PXG a;  1YJ7 A;  2MGZ B;  2OEK A;  4CYU A;  5HVG A;  4HI1 A;  3KXD A;  3VAL A;  2JRS A;  4UQG A;  4E0D A;  4B9U A;  1JLF B;  3MXH P;  1GXU A;  1VBZ A;  4I1T A;  4CLZ A;  2DPJ A;  5HMY A;  4TU9 A;  4MKA A;  3KK3 B;  2GQQ A;  4ZVF A;  3CJ0 A;  2ZZT A;  4DQR A;  5ETS A;  4LRF A;  5LJ3 Y;  3FEZ A;  3L7U A;  2UUC J;  3CJK A;  3ZZR A;  5L1I A;  4FYW B;  3QT7 A;  1Q16 B;  2KG0 A;  1U1R A;  3DI6 B;  4USV A;  1N88 A;  2BJ3 A;  2N7C A;  3GIK A;  3DN9 A;  2Z4P A;  4DL4 A;  3N5F A;  3BBB A;  3FUY A;  2D3Z A;  2XYH B;  1WHX A;  2F8M A;  4WJB A;  1ZA1 B;  4FF4 A;  4OFZ A;  3I96 A;  1QSS A;  1N52 B;  4ETZ A;  3KK2 B;  3HK2 A;  2MZ1 A;  1T9V A;  1M1G A;  1JXE A;  5B0F A;  1T03 B;  2HK2 A;  2QA4 S;  3KJV B;  1S7I A;  4FYD A;  2H3E B;  3CDW A;  2J9D A;  1FXD A;  4QYZ K;  5CAA A;  3OW2 R;  3VAG A;  3DRS A;  4K4X A;  1JNR B;  3RZA A;  1H72 C;  1UA0 A;  1TKT A;  2C1E B;  3DRY A;  1IKX A;  5KFV A;  1X31 C;  4U8Y A;  1KSP A;  1NHK L;  4NI2 B;  4DX6 A;  1IWG A;  2E1C A;  4P2X A;  2OPR B;  3BR9 A;  2JH3 A;  4X65 F;  2UUA J;  2R7X A;  2J0X A;  5J1E B;  5KFW A;  2Q1L A;  4DL3 A;  3QPI A;  4DWI A;  2W9C A;  1L3U A;  2X1A A;  1RI7 A;  1VIS A;  4KGM A;  5SZT A;  3FC9 A;  1YIJ S;  3BGR B;  4WYL A;  4RNF A;  4J9P A;  1HPZ B;  4KO0 A;  2HWT A;  4JI6 J;  2V0N A;  2RSQ A;  3A12 A;  4A47 A;  1YX2 A;  5KFQ A;  5MLC V;  3MAA B;  3GSI A;  1FJC A;  1U25 A;  2FYX A;  5KFB A;  3PO4 A;  2HIY A;  2WOM B;  4Q44 A;  3DKD A;  4KFB A;  5E3C A;  1R0B G;  2VG5 B;  1MU2 A;  1YGY A;  3GG1 A;  3MEC A;  4DZD A;  3KK1 A;  3AA9 A;  3DDI A;  3Q89 A;  2JEJ A;  1VI7 A;  2QL7 B;  1ZM4 A;  4HVZ A;  3KG1 A;  4Q7A A;  2NUU G;  3DLG A;  2MDA A;  2L08 A;  2M8D B;  1C0T A;  2GC8 A;  2XS5 A;  2DO0 A;  4LF8 J;  3AHP A;  4LQ3 A;  4BDP A;  2BM1 A;  1IJE B;  1N48 A;  3UNY A;  1BLU A;  4DR1 J;  2FJV A;  1DRZ A;  2MQP A;  4NLD A;  4RBU A;  4A46 A;  4XO0 A;  1VYA A;  1IM6 A;  5JVH Q;  3GYG A;  3VAM A;  3D1O A;  4M5I A;  1UET A;  2KDO A;  1FNX H;  4LF6 J;  2KT3 A;  1KBR A;  4MFB A;  4MAK A;  4XPE A;  1NSA A;  3QID A;  4Z37 A;  4KGK A;  1LWC B;  5BXI A;  4OJG A;  3CPW R;  1FTC A;  4NCG A;  3I82 A;  4IH7 A;  2LEB A;  5J2N A;  3OXF A;  1URN A;  4NYP A;  1ICE B;  1JJC B;  1VQL S;  3VCD A;  4K59 A;  4USJ C;  4ECZ A;  5F8N A;  5KG4 A;  3BPD A;  4BHQ A;  3IG1 B;  1K1S A;  3PEH A;  1HNZ F;  1RB0 A;  5HAN A;  1WEX A;  1T9X A;  4DV6 F;  1REG X;  3W9I A;  4MKB A;  1P27 B;  2ROG A;  3DGP B;  2HMI A;  3N01 A;  2EVZ A;  4F0M A;  2FLL A;  5E3P A;  2BQR A;  4QQB A;  1M5P C;  1AUS L;  4ER8 A;  4D3G A;  2GNK A;  2KB2 A;  2W4D A;  5K8M A;  2KFY A;  1HBM A;  2CPI A;  2FHM A;  2IM1 A;  1BWV A;  2J0W A;  3ZZ0 A;  5KFJ A;  3ITH B;  2XY5 A;  1FXR A;  3CO9 A;  4OZN A;  1KLM A;  4WZM A;  5GAG U;  4RKU C;  3MPW A;  4ILM A;  2RUG A;  4IG3 B;  4U7C A;  2ZDP A;  3GIR A;  2B8Q A;  2AJ0 A;  2KJW A;  3IRX B;  3BZQ A;  3PJW A;  3UVJ B;  3V5R A;  1J5O A;  4C8L A;  1Y10 A;  1KN6 A;  3OTB A;  4X64 J;  3T5K A;  4B9M A;  2MB0 B;  3EX7 B;  5D4P A;  4NWB A;  1D09 B;  3I9V 9;  3LP2 B;  4A8O A;  4USU A;  2J9D E;  4CM0 A;  4OI3 A;  3W62 A;  2Q66 A;  3A8I A;  5I42 B;  4QIF A;  1M5V C;  4F8R A;  2BJ9 A;  1PYS B;  1RHQ B;  5EX0 A;  5I3U A;  4ZVQ B;  4YB6 A;  3JS9 A;  4DL6 A;  4X4O A;  1ZZF A;  2HNY B;  4P74 A;  1U8S A;  4UW2 A;  2AZ1 A;  3J80 U;  3T5L A;  3JSR A;  2CPF A;  2EWH A;  3QT6 A;  4X4R A;  4MIB A;  4ED6 A;  2O67 A;  2UXB F;  3OJU A;  4IO9 Q;  5KFT A;  1F6T A;  2AP6 A;  1LWX A;  5LSL A;  3BPS P;  3T9Z A;  4PG4 A;  3GJT B;  4Q0B A;  3J80 Y;  4C8O A;  2DK2 A;  3L09 A;  3OFF A;  5THW A;  3KMS A;  3MUV P;  1R8P A;  3Q83 A;  1X5T A;  3JQJ A;  3PR4 A;  3LF0 A;  1WWH A;  4EYI B;  2L41 A;  1XQI A;  2GQC A;  2Z57 B;  5KG6 A;  2G0I A;  2GIF A;  1EAY C;  4ED7 A;  3BKF A;  4DU7 A;  2X3D A;  3KLG A;  3G86 A;  3KLE B;  1UJ4 A;  1RE1 B;  1VCT A;  3R27 A;  2BKP A;  1DBD A;  2KZM A;  4M63 A;  1PJ7 A;  1SJR A;  3NOG A;  4C9D A;  3FCV A;  4ECX A;  3FBC A;  1C1B A;  2CJX B;  3VV2 B;  1Q8B A;  4ZIV A;  4WII A;  2N4C A;  1K1Q A;  3SI8 A;  4DEZ A;  3DOL B;  2MQN A;  4LF5 F;  4B3O A;  2QLX A;  3LP1 B;  2BE2 A;  3EE3 A;  2LXI A;  5F9N A;  3DRR A;  4ZPW R;  4I6W A;  1CQM A;  1PJ5 A;  3SSR A;  1S0M A;  1CJU A;  4GRS A;  4DG1 B;  1RAF B;  5CH7 B;  1YWX A;  2FGC A;  1V9O A;  1MG7 A;  5HLF A;  1XNR F;  1HNW F;  3BBF A;  5KFP A;  4F50 A;  2EK6 A;  4WCE Q;  2XNQ A;  4TY8 B;  2VDI A;  4Y6I A;  3Q8Y A;  4BC7 A;  2GJF A;  3MED A;  5L39 A;  2IPO B;  1RAE B;  1TU0 B;  1PIE A;  4DSL A;  2BJ7 A;  2AF6 A;  2Q43 A;  5ETO A;  5FD1 A;  3LAL A;  1H38 A;  2J6S A;  2W4P A;  2LQB A;  3ENQ A;  4X62 F;  2HQ3 A;  1SJ1 A;  3CED A;  3I6P A;  3M1V A;  1UWB A;  4E2F B;  4NEZ A;  4ZCM A;  1G7C B;  2B7C B;  4JV0 A;  4FP9 A;  2C28 A;  1JXV A;  2AKW B;  1FKA F;  1NCL A;  3WX8 A;  3ENV A;  3HT3 A;  2XY7 A;  3K17 A;  2CRL A;  1EHW A;  3G8Q A;  4TNO A;  2R8J A;  3D1H A;  5KG7 A;  2F63 A;  3I0R B;  4WFX A;  2M5Y A;  2V4J B;  5A8W B;  3UE2 A;  4A8M P;  2VU5 A;  4RW8 A;  5KFM A;  4TXS A;  5CZX A;  4FZV A;  5HVH A;  2RQM A;  2OPS A;  4OX8 A;  1RP5 A;  3LP0 B;  2WSF C;  2FVS A;  4N8N A;  3GIL A;  3CDE A;  5KFK A;  4DV0 F;  2W01 A;  3CIZ A;  1WG5 A;  2ZEJ A;  1TL3 B;  1UEU A;  1S6Q A;  1VDH A;  3V4M A;  3BQ2 A;  3M6U A;  1Q5V A;  1S99 A;  5HK4 A;  2HSE B;  3KLI B;  3IWX A;  1T94 A;  4F4A A;  5EGY A;  4CQ1 A;  2EFO A;  3J7Z 5;  3RGI A;  3HHK A;  1M5S A;  2HBR B;  3T1H J;  1R6Y A;  2XHW A;  3ZXW A;  3CDA A;  1PG5 B;  2YWG A;  5CYQ A;  1WG4 A;  2JEF A;  2EC2 A;  1AZS B;  5JVG Q;  1NPK A;  4OZ2 A;  3KUH A;  5ETL A;  1HBN B;  1KC8 T;  2W7A A;  4I64 A;  4EO6 A;  2UVW A;  3A8K A;  4F3M A;  1NB2 A;  2MKH A;  1N0V C;  1BQX A;  2M70 A;  2OPQ B;  3Q8S B;  4C11 B;  3NXZ A;  4J9O A;  4KAI A;  4PG8 A;  2ERR A;  4JV5 F;  1IM4 A;  3KLH B;  2MGZ A;  5IWA F;  3EUN A;  1B7Y B;  1U6B A;  2WON B;  1NHU A;  3M8S A;  4FVC A;  1JLG B;  1QE1 B;  3SCJ E;  3N79 A;  1WAC A;  5B0A A;  1SI9 A;  3TOQ A;  1VLO A;  1T9U A;  1W7W A;  2C2M B;  2D1C A;  2R7T A;  4DV5 J;  4FBU A;  4AQY F;  2ZD1 B;  2ZH4 A;  1IBL F;  4RW7 B;  1ZZN A;  2DH9 A;  1RT7 A;  3WC2 A;  1H2V Z;  2MY7 A;  3AY0 A;  5A8R B;  4GMK A;  1HWJ A;  4CLW A;  3Q8V A;  1NSP A;  3DI6 A;  3D6T B;  3DHX A;  2H1Y A;  1RT2 B;  1M90 T;  1F9H A;  5GMK a;  4C97 A;  2R7U A;  3EDR B;  1OQ6 A;  4EYH B;  3UN5 A;  2BRK A;  5DO2 A;  3SV4 A;  4M5J A;  2WHO A;  1RTJ B;  3M7V A;  2HZC A;  1L5U A;  4IUF A;  1RHR B;  4ZOS A;  5E2Q A;  3KK2 A;  4CLP A;  1X4E A;  3CD5 A;  2E9R X;  1ZAW A;  5IT0 A;  1F0X A;  2HVE A;  4R5P A;  3TEG A;  3CMQ A;  4DS4 A;  5LMN F;  4ZVR B;  3KJV A;  1H7X A;  4LSZ B;  2QLW A;  2RAQ A;  2HFU A;  5LM7 E;  3Q8Q B;  4ZP9 A;  4ZPD A;  3TJA A;  3MEG B;  1VHF A;  2IRX A;  2BYC A;  1WKJ A;  1N54 B;  1D9A A;  3B4M A;  1SKU B;  1FE0 A;  3LQV A;  4JI8 F;  1FWP A;  2OPR A;  1SXL A;  3GIM A;  3DXB A;  5J1E A;  2HZA A;  3GZ7 A;  2H5I B;  2B4P A;  1Q5Y A;  3OTO F;  2PSZ A;  4ECQ A;  4TQS A;  1FK9 B;  2KN4 A;  4RJV A;  2CPY A;  1RT5 B;  4N8O A;  3BGR A;  2VFV A;  5D3G A;  2ZHB A;  3SQG B;  1HPZ A;  2YX4 A;  4WPA A;  1VQ8 S;  4Y2I A;  1IXK A;  3J7Y I;  2WSC C;  3MAA A;  2UUB F;  2QFI A;  1GX6 A;  1FX4 A;  2VKR A;  5DGA A;  5J1P A;  4V1A k;  3WZ0 A;  1P8G A;  3D54 A;  3SBM A;  1AA1 B;  2N82 B;  2B5J A;  1NZA A;  2V2Z A;  4N77 A;  4ZVS B;  2RDJ A;  2LVW A;  4DV2 J;  1EP4 A;  2HKE A;  4OMF G;  1JJ4 A;  2VC1 A;  2V8H A;  1RHK B;  2IA6 A;  3D28 A;  4ZHR A;  3MMB A;  5SUH A;  3O5T B;  2IDL A;  2JC1 A;  3R6L B;  3O1L A;  3BH6 B;  3GP9 A;  5M2R A;  2KKH A;  2IJR A;  1UFL A;  1KON A;  2VFR A;  4CZC A;  2YWK A;  3TA2 A;  3V81 B;  4I2P B;  4DR3 F;  4AXJ A;  1AT1 B;  3GV7 B;  2MJN A;  1LWC A;  3EXC X;  4MTP A;  1D9D A;  3KUE A;  4RWX A;  3D1Q A;  3LW5 C;  3EZ5 A;  3E51 A;  4ZVU B;  2WVB A;  3W1Y C;  1NKE A;  5H9F K;  3OXG A;  2VKZ G;  1VIO A;  4IYQ A;  1ZYQ A;  4DSJ A;  5KTQ A;  3IBF B;  5L8R C;  1U09 A;  4CDI A;  2VH7 A;  5HQM A;  1H7W A;  4U6P A;  2RD5 C;  1LV5 A;  4J9M A;  5K9F A;  1IKV B;  1NAQ A;  2XUL A;  4USH A;  1EB0 A;  2EBE A;  2V67 A;  3FMB A;  5T41 A;  3HD2 A;  2X1B A;  4CLF A;  3DRP A;  2OKQ A;  3DGP A;  3I31 A;  2AZ3 A;  3PW4 A;  4KH0 B;  2O3D A;  1WC5 A;  2R2U A;  3UR0 A;  2U1A A;  1V3S A;  3MM5 B;  1TKZ B;  5HAT A;  3H4B A;  3L4B C;  3AFG A;  2UXC J;  2P9C A;  3L3C A;  1T7P A;  1R3N A;  2XSJ B;  4ECT A;  3ITH A;  1SL2 A;  3QAE A;  2W24 A;  1H73 A;  2JC0 A;  1FJE B;  2ZH1 A;  4Y2M A;  4I68 A;  3UO0 A;  3IRX A;  4ZVT B;  1FRL A;  4ICL A;  4K4Y A;  5DDR C;  4WFA Q;  3OHB A;  5HMZ A;  4WZQ A;  5KT4 A;  4LF1 A;  3SDE A;  4ZCK A;  2ILY A;  1DAR A;  1RTD B;  2NXJ A;  4N7T A;  2R7S A;  2ZE2 A;  4J9K A;  1VQ5 S;  5L46 A;  2R7V A;  2C2D A;  1AFI A;  2ILZ A;  1LXJ A;  5I42 A;  1K8A T;  3IXQ A;  1H6K X;  2QZ8 A;  4MJK A;  4X4N A;  1F2H A;  1ELO A;  1NDK A;  5KAK A;  4P9S A;  4CO5 A;  4NLQ A;  3AOB A;  2N3O A;  1QAY A;  1KQS R;  5F8J A;  3BRE A;  3CE8 A;  3BBC A;  5KT5 A;  1LOU A;  2C2E A;  4LF9 F;  3RW7 A;  2J6U A;  4KBI A;  3M8Q B;  1AYE A;  1LK7 A;  1RHU B;  5F8I A;  3MEE B;  5KFO A;  2VAS A;  1S59 A;  2ZZN A;  4Y0F A;  3KHH A;  1OYE A;  3SFG A;  1PIL A;  2I2Y A;  3GJS B;  4PAA A;  4WP8 A;  1SL0 A;  3ZTR A;  1FKP A;  1O5J A;  3EGN A;  2QJ3 A;  4X65 J;  3NS5 A;  1BGX T;  4LQ9 A;  2BOP A;  5HQL A;  4ANC A;  3M8R A;  2GQ2 A;  5D6G A;  5HAO A;  1X4F A;  3KLE A;  1RHJ B;  1YDL A;  1U48 A;  4F67 A;  2F5G A;  5L1K A;  1GQE A;  2R3V A;  2QE5 A;  3MFH A;  4QIW D;  5LJ5 Y;  1RT1 A;  3RRG A;  4LIW A;  5CA5 A;  3C3L A;  2H54 B;  2QEX S;  3KHL A;  4B9N A;  3NOC A;  3G6V A;  1K44 A;  2GVZ B;  2PD1 A;  3L7O A;  2QFJ A;  4OX9 F;  3H4D A;  2UVU A;  4ZDN A;  2XG8 A;  4HHJ A;  1NDP A;  3WIU A;  3PDN A;  4USI A;  3LPY A;  2CIM A;  4U7U D;  1M1K T;  2F7V A;  3DOL A;  3BSC A;  3R7B B;  4U96 A;  3ULH A;  3RU0 A;  3K5L A;  1BXN A;  2H5E A;  4ECV A;  4IG0 B;  1JLB B;  2BMB A;  3LP1 A;  2CDR B;  4YDD B;  4HI2 A;  2AEF A;  2PA8 D;  2UUW A;  3TUZ C;  4WFZ A;  1F2G A;  3UCG A;  2IVY A;  1TVR A;  4DG1 A;  4MYU A;  3BN7 A;  3QYY A;  3FRY A;  2ZH5 A;  2GMH A;  5CQG A;  1R31 A;  4W98 A;  1S6P B;  3VAF A;  1DTT B;  2NSB A;  5F8H A;  1SKR A;  1YHQ S;  3A3O B;  3M2U B;  1S1X B;  4CT9 A;  3TVK A;  1SIZ A;  4DFJ A;  2RNE A;  5E3A A;  2QL5 B;  3CCE S;  1S12 A;  2HW3 A;  1UVI A;  1ZAV A;  4NLG A;  4QWA A;  2ALY B;  3FCW A;  3CCV S;  4DX5 A;  4AD6 A;  5JUM A;  2ASD A;  3OD2 A;  2GIR A;  1DTQ A;  4WE1 B;  4Q43 A;  2RDD A;  2QYC A;  2KG1 A;  4NLS A;  1HNZ J;  4KGX B;  3UR3 C;  3NLC A;  4I56 A;  3OTE A;  4DV6 J;  3PYD A;  2DR7 A;  2OD4 A;  2RIJ A;  2GA7 A;  2V4J A;  3N6L A;  5A8W A;  3R3T A;  3TVZ A;  2LDY A;  1RLC L;  3PCO B;  1X5S A;  4YR2 A;  4NLV A;  2L9N A;  2J7K A;  4NLX A;  2V2V A;  4IQM A;  2DH8 A;  3GV5 B;  3TR5 A;  3CC4 S;  1TK5 A;  4L3N A;  1NK4 A;  4LVN P;  3C8Y A;  3HHL A;  2R8H A;  1WKK A;  3KLF A;  2HHX A;  3QJP A;  2HND B;  3DHW C;  3KLI A;  2VOO A;  2GJ2 A;  1VQO S;  4KTQ A;  3W2W B;  2KVI A;  3I32 A;  2DR5 A;  2KM8 B;  1D0E A;  2BV3 A;  4FF1 A;  3SYZ A;  2AYE A;  4CLK A;  3GJR B;  3W5Z A;  4ZCL A;  2R8I A;  2CQ3 A;  1LXN A;  2DYA A;  2UUT A;  1AZS A;  1BQM B;  3TAP A;  3I55 S;  1U1N A;  3HCX A;  1HBN A;  1RCO B;  4DV4 F;  4PAB A;  1XMB A;  2D3U A;  2AV5 A;  4LR8 A;  3HFV A;  5F0W A;  2W8K A;  3V6J A;  3CMA S;  2OPQ A;  4C11 A;  5HMX A;  4DF4 A;  1U1L A;  5A8K A;  3PYF A;  1F3F A;  2EFP A;  2GVD A;  5GAH I;  3KLH A;  9ATC B;  3B78 A;  5HP1 A;  2GAG C;  2VB6 A;  2W2Q P;  2NZC A;  2WON A;  4WK3 A;  2BBE A;  4B3R F;  3LUY A;  2FHJ D;  4LFB F;  4DCP B;  2VBW A;  1MW7 A;  2LMI A;  1MWQ A;  1X0F A;  1KLN A;  1N56 A;  3D68 A;  1LEO A;  2R8G A;  4TYA A;  3CC7 S;  2JDJ A;  3EIC A;  2MHE A;  2MY8 A;  1B99 A;  1YBA A;  3ETM A;  4DPT A;  3H5U A;  5D4L A;  4DPW A;  3CF5 Q;  4WF9 Q;  2DNO A;  5ETT A;  1FI4 A;  1N5V A;  3G82 A;  3TA1 A;  2J0Q D;  2XO6 A;  1XC9 A;  2CVI A;  1PO6 A;  1OIA A;  2XCP A;  2OEL A;  4DSI A;  1FFS B;  5LXY A;  5JJB A;  2W9A A;  2BW7 A;  4JYA J;  1N33 J;  4DL2 A;  2CPX A;  2ALZ A;  2ZHA A;  2DXD A;  3W5X A;  3U1M A;  3EMT A;  3LAM A;  5DG9 A;  2LXU A;  2DGW A;  5B0E A;  1HBO A;  1KR4 A;  3CUL A;  3AD7 C;  3MEG A;  4LRE A;  2ROP A;  3UDE A;  1S4E A;  4Y65 A;  4HYK A;  3NCP A;  2CA9 A;  2IM2 A;  1BY9 A;  3GFY A;  4LF5 J;  2YX7 A;  4WXW A;  1FDD A;  4DL7 A;  2AYB A;  1WDD A;  2HHH J;  1VC5 A;  4OHW A;  5FDL B;  2OSQ A;  3NEK A;  2K2P A;  3DOK B;  3RW6 A;  5CHC B;  1XR6 A;  5K14 B;  3VGS A;  2IVF B;  5F0U A;  1FFW B;  2QL9 B;  4O0N A;  4AL5 A;  1XNR J;  5KFY A;  3MM8 B;  1HNW J;  4FNI A;  5J2M B;  1FK9 A;  1VQN S;  1N5S A;  1PC5 A;  1CC7 A;  1TV6 B;  1RT5 A;  2HYI B;  3KLV A;  4LMZ A;  1A7G E;  1CUL A;  4ZP8 A;  2OP5 A;  3IAM 9;  3PYE A;  2ACM A;  3CCQ S;  3D0G E;  2BUN A;  2HRT A;  3W64 A;  1RAG B;  2G1H A;  4AUK A;  1RT6 A;  2R9L A;  4X62 J;  1RJJ A;  3CD7 A;  4ED1 A;  2QMW A;  4KHP F;  2CYY A;  2IHR 1;  3W5Y A;  1FCA A;  2FVP A;  1LK5 A;  2M2B A;  3GII A;  2OD6 A;  2WSE C;  2LQ9 A;  4Q8E A;  3D0I E;  4PKD B;  1R0A B;  5DZ6 A;  4OV6 A;  4HAC B;  2EPI A;  3DLH A;  4RUH A;  3GPA A;  3NY0 A;  2BQ3 A;  4GO5 X;  4NXN F;  3TO8 A;  1DQ9 A;  2YVS A;  4ZIW A;  1EJ7 L;  4DX7 A;  4OX6 A;  4ZVE A;  1ZPW X;  3R5C A;  1QUV A;  1H74 A;  5KFF A;  2EKY A;  3RR7 A;  2LDI A;  2RT3 A;  3T19 A;  4I2P A;  1Y5I B;  2CQ1 A;  3J7Y U;  4DV0 J;  1REV A;  3HJV A;  1D3W A;  1Q0N A;  5DQH A;  2XYP B;  2ZH7 A;  4O44 B;  2CG4 A;  3CCL S;  5A0Y A;  2E7W A;  3QMQ A;  5HL7 Q;  3DLK B;  4C0O C;  3T6J A;  3QQC D;  4X2B A;  3PX0 A;  1YJU A;  3GON A;  3ILJ A;  1VJW A;  5B0G A;  4X4T A;  4DV3 F;  3KOA A;  2ZNZ A;  2XNR A;  3NGU A;  1C0U A;  1A6L A;  4YEA A;  4OI2 A;  1NJW A;  2EXU A;  2F8E X;  5IC6 B;  2G2Y A;  2EI5 A;  4LVO P;  3T3F A;  3MUT P;  1CJT B;  2ZH8 A;  3TJ8 A;  4ZKA A;  2VQF F;  4BCA A;  5CAB A;  4NX9 A;  1AUD A;  2V68 A;  1ZM3 A;  3MM5 A;  1TKZ A;  4ANE A;  4F4X A;  1NJX A;  2WB1 D;  1KWM A;  1Q1K A;  3IBW A;  4U9R A;  4N5S A;  3J7A 1;  2YQ3 A;  4QR0 A;  4YB1 P;  2Z2Y B;  2GFF A;  2C22 A;  3L9Z A;  3M4X A;  1RXO B;  4JV5 J;  4IOC Q;  2XSJ A;  3QZ7 A;  1P1T A;  4PYA A;  5IWA J;  5C42 B;  2QTW A;  3BEG B;  2FZG B;  4RNM A;  1RTH B;  4TYB A;  2B56 A;  3THV A;  3AJ2 A;  1LW0 B;  3QSY B;  4J9S A;  2VON A;  4U67 Q;  3W7B A;  2MKS A;  4JOU A;  3PJX A;  4H4O B;  1IBL J;  2E5L F;  4NRT A;  2CQC A;  1RTD A;  2ZHO A;  1F5A A;  2GHW A;  2IC3 B;  3P4U B;  1XK8 A;  3J81 j;  3TP2 A;  3PRB A;  3MZI A;  3PRV A;  4CM2 A;  2MQO A;  2NYI A;  1RA6 A;  1Y5N B;  5ADZ A;  2QLJ B;  5DQI A;  3M2V B;  2IMO A;  1FDB A;  3SCK E;  1C1C A;  4EK2 A;  3HZG A;  3DOM A;  4HKQ A;  1HA1 A;  2IM3 A;  3IA0 A;  2DNN A;  2WBR A;  4EZ6 A;  1EQM A;  2CPJ A;  2DGS A;  5ETP A;  4RL1 A;  2EK1 A;  5D0R A;  5H9E K;  2XY6 A;  4N41 A;  3M32 B;  3TAN A;  4S0M A;  5LMN J;  1I94 F;  4ILR A;  3M8Q A;  2G13 A;  3IMQ J;  2DD8 S;  2BE9 B;  2A3J A;  3NL0 A;  4RNH A;  2ZNY A;  2Z2Z A;  3HT0 A;  4FPI A;  2PN6 A;  4EZ9 A;  1FDN A;  3X3U A;  1DUR A;  3PEJ A;  2XWY A;  4K2J A;  3K5P A;  3NGT A;  2PFD A;  4Y2K A;  1XNQ F;  1WC3 A;  1CJK B;  2HAI A;  3AD8 C;  1S9G B;  4KR0 B;  3EVW A;  2RKI B;  1SC6 A;  3OTO J;  1WEZ A;  4DN0 A;  2EG2 A;  3MCM A;  2DGO A;  4NLW A;  4K4W A;  2Y0B B;  3ISZ A;  2DNP A;  5CYM B;  1WSV A;  3C16 A;  2GAH C;  2VPY B;  2ZOF A;  4ZN3 A;  2AYG A;  2OFG X;  4W90 B;  4DPO A;  2VPW B;  4X4Q A;  2GVZ A;  1WC1 A;  2KH9 A;  3W2V B;  1YI2 S;  3S1T A;  2UUB J;  3BKU A;  1PYT A;  2FJE B;  2HUR A;  4I0W A;  4USM A;  3NMA A;  2BR0 A;  1SQF A;  3FMW A;  2K7K A;  3FKB A;  2RRA A;  1JLB A;  2V2K A;  2AW0 A;  3K2Y A;  1R7I A;  1HNX F;  3NKY A;  3PX6 A;  4M1K A;  3MPD A;  1QTN B;  1RGV A;  1O51 A;  4YHH F;  1IR2 A;  1SJ4 P;  4WFN Q;  3P8B B;  1S49 A;  1S1X A;  4AXI A;  3MOJ B;  2A6O A;  3EDQ B;  3IM8 A;  2XMT A;  3HSJ A;  3QIP A;  1V3Z A;  1OY9 A;  4K50 A;  4DR3 J;  2A1B A;  2CPD A;  4FPR A;  5AXM A;  3CVK A;  2DHX A;  5BYQ A;  1DQA A;  1FFG B;  3CT9 A;  2HS4 A;  1L3T A;  4YFU A;  4WE1 A;  2KXN B;  2GJI A;  1S9E A;  1RIS A;  4DL0 C;  2LFV A;  5A6P A;  4Z2X A;  3U02 A;  3AOC A;  1YK9 A;  4E8U A;  3JAM U;  2B4U A;  4J9L A;  2RDI A;  2UP1 A;  2HQG A;  1JK9 B;  3T41 A;  2WZ1 A;  1HBU B;  2DNR A;  2P2C B;  2LA6 A;  3EZU A;  2RRN A;  1S1T B;  1RT4 A;  4K4S A;  1WI6 A;  1KNZ A;  2DGU A;  5KG0 A;  3BO2 A;  4ID5 B;  2CVE A;  2L9D A;  3JAM Y;  1U1P A;  2FHO B;  4W4M A;  3AXM A;  1U1Q A;  1BQN B;  2QX0 A;  1IKW B;  4ZVH A;  4JP8 A;  3CWJ A;  2IM0 A;  2GZO A;  4PWW A;  4NLP A;  4DFK A;  5CXT A;  4XDC A;  2DHH A;  2WCX A;  1VQ6 S;  5HQ8 A;  3BDE A;  1T9W A;  4PWD B;  4A8S A;  5M2U A;  1G3O A;  3TRG A;  3NS6 A;  5K20 B;  3EPG A;  3GYN A;  2V4Q A;  4KKO A;  3TAR A;  2W4C A;  3FCH A;  3BV8 A;  1U0H B;  3MOZ A;  4F02 A;  3P3D A;  4X84 A;  3E01 B;  1IBM F;  2MHN A;  1KOO A;  2K1R B;  3EXY A;  4FN5 A;  5MAO A;  4ZPC A;  1WC0 A;  3RAX A;  3FZB A;  1MML A;  3H0P A;  4CCH A;  4WBF A;  4NCB A;  2XMW A;  1RAA B;  4X4P A;  1FKO B;  2BAN B;  4IR9 A;  2KJV A;  2OFH X;  2QLF B;  4KQZ A;  1N5Y B;  2R7R A;  4GC6 A;  1TAU A;  5DGB A;  4LF9 J;  2J9E A;  3ZZZ A;  1EET B;  4PG5 A;  3TYT A;  1VRT A;  2KRR A;  4ZN1 A;  3IC1 A;  4H4K A;  1FTR A;  2Z30 B;  2XEX A;  5E41 A;  2G0C A;  2XZT B;  4QU7 A;  4F25 A;  1U24 A;  2CNL B;  2LCW A;  3RRH A;  2FIU A;  3CC2 S;  3GCW P;  3OV7 A;  2DNG A;  5KFH A;  3BSO A;  1TUW A;  3UN2 A;  3JXO A;  4IFY B;  1RAI B;  2MLZ A;  2E5H A;  2C3U A;  2KZZ A;  2MSS A;  1NEE A;  2DY1 A;  2FVQ A;  2EG1 A;  4X66 F;  1TFY A;  2YKN B;  4AND A;  3C46 A;  1QSY A;  4GVL A;  2N3L A;  4OI4 A;  3PHT A;  2FY1 A;  3BF4 A;  2OPP B;  1RLD A;  3OHA A;  1XER A;  5HMW A;  1ARO P;  5KT2 A;  4L76 A;  4J37 A;  3VVT A;  1I5O B;  4DUT A;  3KNG A;  3MFI A;  4OX9 J;  3B8H A;  5LMU F;  3TNV A;  2IJF A;  3ELH A;  4B3S F;  4KH1 B;  2K3I A;  3BO4 A;  1YVF A;  2D7S A;  2BJ8 A;  3C15 B;  1FJ7 A;  3NGS A;  1YRT A;  4C8Z A;  3F56 A;  1XWL A;  3T9N A;  3ZNU A;  1X4A A;  4KV8 B;  3K0J A;  4PEO A;  4P71 A;  4E98 A;  2DKO B;  5E7O B;  2M7S A;  3GE9 A;  3QBC A;  3QGG A;  2MLX A;  3ETO A;  5A2Q U;  3MM8 A;  4TQR A;  1RBA A;  2G4B A;  3M6V A;  2E9Z A;  2CWK A;  3M8P A;  2Z58 B;  1CSJ A;  2MZQ A;  3QLH A;  2ZBR A;  2ZKU A;  4PQU B;  4B9L A;  2U2F A;  4C2M A;  2HVH A;  5A2Q Y;  3I5C A;  1ZH5 A;  4P7V A;  4ENO A;  3UDV A;  2YKM B;  1WEY A;  1TK0 A;  3JQK A;  1N8R T;  3OTD A;  1IKY B;  1RSC A;  1UVN A;  4ALZ A;  1PGZ A;  3D2W A;  2DR8 A;  4BS2 A;  2ZKT A;  3IR7 B;  4CNZ A;  1R0A A;  3V6K A;  1TP7 A;  2QG9 B;  4ZK7 M;  3VAI A;  2UUC F;  1CS4 B;  1TL7 A;  1N6Q B;  4IH5 A;  2IRU A;  1QSL A;  3NMR A;  4MKV A;  4P2F A;  3MEK A;  4N76 A;  4QR1 A;  2BDP A;  5E3Q A;  2YKA A;  1XR7 A;  4O3S A;  5HJX A;  1WOO A;  5GAE I;  3W3S A;  3K89 A;  3PVX A;  2PMH A;  2PO4 A;  2IA0 A;  2QYG A;  2DBB A;  2CQB A;  2VL1 A;  1YTY A;  3AQP A;  1Q95 G;  4O44 A;  4RBT A;  4RZR A;  2UU9 F;  3FQK A;  1S1V A;  4C8N A;  4DR4 F;  4AL7 A;  1SL1 A;  2PEB A;  3OL6 A;  2BKO A;  1JB0 C;  3MR2 A;  4W92 B;  4OZ0 A;  1K9M T;  3CJT A;  3UPF A;  4AL6 A;  5G4D A;  3LO3 A;  3PZP A;  5DLF A;  2X51 A;  3EVM A;  1ZBT A;  3W63 A;  3QWP A;  3V4I B;  2HRU A;  2VG6 B;  2GGP A;  3IFE A;  4NZ6 A;  1BUX A;  3OR1 B;  4DV4 J;  3G6Y A;  4ZMM A;  1KHW A;  1HIY A;  4JI1 F;  5B0B A;  4G1P A;  4K7Q A;  4UUW A;  1Y4Z B;  1JKH B;  2I5J B;  3FFI B;  2BEF A;  4TN2 A;  1GX5 A;  3QSI A;  4R8U B;  1JLA A;  4UOF A;  5E3R A;  3KDO A;  2AX0 A;  5KFZ A;  4Y34 A;  4JI7 F;  4U8V A;  2CPH A;  3D67 A;  2A0F B;  4JI2 F;  1RTH A;  4B3R J;  4LFB J;  5LSO A;  1MN9 A;  1NJY A;  3Q8P B;  2CJY B;  3TI0 A;  3TAQ A;  1FVS A;  4ZLL A;  4YY3 J;  1KQG B;  2CJB A;  3I0S B;  2KXH A;  3BO3 A;  4H4O A;  2ZBP A;  2ZH9 A;  4H54 A;  3Q22 A;  3NP5 A;  5KT7 A;  4TY9 A;  1H2T Z;  2VJV A;  1T02 A;  3KNA A;  2NXC A;  3DYA B;  3M6W A;  2YKO A;  4I4B A;  2KO1 A;  1WSR A;  5JXS A;  4Y28 C;  5DS7 A;  5DDO C;  1VQP S;  3M2V A;  4FXV A;  4BBY A;  4O3O A;  4IQX A;  1P9Q C;  5E0O A;  3U7J A;  2JEG A;  3M2R B;  2IAJ B;  4I69 A;  3MHY A;  3NBP A;  2YY3 A;  2ZBI A;  3WDO A;  2YKQ A;  3H5X A;  2CNO B;  4NLY A;  3TA0 A;  5ETN A;  2XO7 A;  1UFW A;  2ZWO A;  3MPV A;  2BM0 A;  2LEC A;  3FBF A;  1JXL A;  3OT9 A;  5C2G A;  2JLG A;  5D77 A;  1KQF B;  1OY8 A;  3VVU A;  4J91 A;  4HT7 A;  3SCI E;  2JZ5 A;  2MKK A;  2ZJR Q;  3DLJ A;  4P72 A;  4ILL A;  2DIS A;  2DB1 A;  1LW2 A;  2A2D A;  1UCN A;  1S10 A;  1X9W A;  4Z7C A;  1KVK A;  3TVY A;  5CD4 A;  1JLE B;  3MM9 A;  4FKY A;  2J6T A;  4ES3 A;  1JWW A;  2W7P A;  2KYX A;  1HNV B;  4DR7 F;  4HTJ A;  2MKI A;  1X7V A;  4QR2 A;  1AB8 A;  4ZPA A;  1T11 A;  1KEK A;  1QUP A;  4OYX A;  3ILI A;  2RKI A;  2OO4 A;  3Q24 A;  3W8G A;  3DFE A;  4O23 A;  3VGU A;  5G0R A;  3DDK A;  3VF0 B;  2IJN A;  1DHM A;  2CZ9 A;  3HHN B;  2DPI A;  1ULR A;  4LR9 A;  1HWU A;  3R5G A;  4WYW A;  3W61 A;  3FGV A;  1ZS6 A;  2FJW A;  3IS9 B;  2N4D A;  1XN9 A;  4CLS A;  1HNI B;  3EYZ A;  4F3O A;  3QAU A;  3F41 A;  1I3O B;  3PNI A;  2VQE F;  2M88 A;  2BX6 A;  4KHP J;  5DG8 A;  3TX0 A;  3BQ1 A;  1HI8 A;  4DLE A;  3FNN A;  3GMG A;  1E6V A;  5HJY A;  2AEJ A;  1HWK A;  3M8Z A;  1U4B A;  4ITS A;  4QIG A;  1XMO F;  4P52 A;  4NXN J;  4FYX B;  1QVF R;  2KHD A;  3I9Z A;  4BWM A;  2F8H A;  4LRA A;  1RAB B;  1W2I A;  4NA2 A;  1RU2 A;  1FT8 A;  3CGI A;  3HHE A;  2P5V A;  5ETM A;  5EDW A;  4DPX A;  2AEM A;  4M5D B;  2ZWP A;  5LOQ A;  2XMM A;  4DU8 A;  3B54 A;  3RB0 A;  4RW4 A;  3H90 A;  2FDN A;  3KWM A;  4HDG A;  1IN0 A;  3BJY A;  2X3G A;  2VDH A;  2Y1I A;  3A8E A;  1V5V A;  4YOE A;  3M8Y A;  3NWG A;  3DRS B;  1K0T A;  1VK3 A;  3BN4 A;  3ZZY A;  1TK8 A;  4CI0 B;  4GKK F;  4ZA1 A;  2BQU A;  5KT6 A;  1TKT B;  4DV3 J;  1VS3 A;  1R43 A;  2F40 A;  2YNG A;  1DAX A;  3D7S B;  4ELV A;  3CJS A;  3J7Z T;  2DHA A;  4LJM A;  1Y00 A;  3LWL A;  1HBU A;  3PJ9 A;  2OML A;  5B7W A;  3HMJ G;  1S1T A;  1EAR A;  4FF3 A;  3R97 A;  1UVM A;  5IT9 U;  2FC8 A;  1S76 D;  1TFW A;  1FEE A;  3M30 B;  2AX1 A;  1BQN A;  1RA7 A;  2DXE A;  1ZM2 A;  1EX8 A;  1UW4 A;  4DMZ A;  3OL7 A;  3QO9 B;  3R1H A;  1RK8 A;  1QDU B;  2B6A A;  2WK4 A;  5IT9 Y;  1WC4 A;  4YS2 A;  1E6Y A;  1FER A;  2Y3Y A;  1HI1 A;  5KFE A;  1MU2 B;  3MEC B;  3KK1 B;  3OQ2 A;  2NR0 A;  4MK8 A;  4HDH A;  4WTO B;  1C4C A;  2BJD A;  4RO0 A;  2V9K A;  2ZC3 A;  6FDR A;  1XJW B;  1D8Z A;  2PII A;  1NHV A;  1RTI B;  2LQJ A;  5IM0 B;  2E5L J;  3HSZ A;  2Z2M A;  4A48 A;  2RQK A;  3DLG B;  2F4V F;  1C0T B;  1U1K A;  1U0H A;  1NK0 A;  1IBC B;  4F0K A;  2HRY A;  2XGP A;  4ID8 A;  4ZPB A;  1FJG J;  3HVR A;  1RHM B;  4DXL A;  3MDF A;  3D6F B;  2EBG A;  3TW0 A;  3CCR S;  2DR9 A;  4B9S A;  4JI4 F;  4YR0 A;  1RKI A;  2DGX A;  4AE5 A;  4TLR A;  3K5M A;  2BAN A;  3ZTS A;  2F4F A;  3N5B A;  1SKW A;  2M9K A;  2XMV A;  1S6U A;  1N5Y A;  1MWY A;  2FY8 A;  2ZM6 F;  4RU2 A;  2FJX A;  2H5J B;  2HNZ B;  2LU1 A;  4YB5 A;  1TMM A;  3QAT A;  5KG1 A;  1I94 J;  3RRK A;  2UV8 G;  3QWU A;  3HFK A;  3HPO A;  3POT A;  3EWG A;  1CG2 A;  2RHQ B;  1TMJ A;  1R8C A;  5DG7 A;  4RUC A;  2ZJP Q;  1HQE B;  2DNM A;  3OL9 A;  1UP1 A;  2ASL A;  5KFG A;  1TEL A;  3FEX B;  4RBV A;  2VD3 A;  3P49 B;  4ED0 A;  2NSC A;  3VAJ A;  4M5H A;  4B3T F;  2NCK L;  5DZ7 A;  1TR0 A;  1XNQ J;  4JV1 A;  1Q8L A;  4URQ U;  1UL3 A;  3J81 U;  1MRO B;  1GMW D;  2DGV A;  2HMI B;  5T14 A;  1TAQ A;  4RUB A;  2BAB A;  4OQJ A;  2DH7 A;  2YKN A;  3IR6 B;  2VHG A;  2HFV A;  2OPP A;  4KY3 A;  4DN9 A;  2R8K A;  3J81 Y;  4UOC A;  1YJR A;  3CD0 A;  3CNQ P;  1HBM B;  3PRD A;  1HD1 A;  4DZ6 A;  3S6E A;  2ZH6 A;  2VFS A;  1HWI A;  1S7H A;  1VLY A;  2O1P A;  4UZB A;  1Q7Y T;  2W9B B;  3P6Y C;  1KVI A;  4X4S A;  1OWX A;  3GR1 A;  2KFN A;  3PIP Q;  1CJV A;  3MTK A;  2PMZ D;  3MM6 B;  4ECW A;  3T1H F;  1A0O B;  2IYI A;  4UZC A;  2VC0 A;  4CTA B;  2PEH A;  4KV8 A;  2L9W A;  1J5O B;  1HNX J;  3CCU S;  4X4U A;  5BYR A;  1M1H A;  3B82 A;  4NA3 A;  2NXU A;  2GW8 A;  2CFX A;  2DNQ A;  4IFV B;  4NE9 C;  2SXL A;  3SFU A;  4MIA A;  2DJW A;  2HGM A;  3TJ9 A;  1UZD A;  2E1P A;  1N34 F;  4YHH J;  1UPP A;  2J7W A;  4DV7 F;  1BMQ B;  1X4B A;  1S0O A;  3Q86 A;  5L9N A;  1Z1Z A;  4A8Y A;  2FPH X;  3OXL A;  1RWW B;  1U6F A;  1RWM B;  1SJQ A;  3LAN A;  1HI0 P;  3KJF B;  4K4Z A;  3MWB A;  3VAH A;  4C8M A;  4QW8 A;  2E44 A;  1HQU A;  3H20 A;  1IKY A;  1N36 J;  4K4T A;  2HBQ B;  2WW8 A;  2DNH A;  1MMN A;  3B6B A;  1G2E A;  1VBK A;  4C98 A;  4J9U E;  2HLU A;  2KXF A;  2NPF A;  1M5O C;  1J5E F;  4UY8 5;  4HEA 9;  5BR8 F;  2ZVS A;  4DQI A;  2OMO A;  2CPE A;  4G1Q B;  2OSR A;  2DY9 A;  3UNG C;  2PI5 A;  4DFM A;  2W7O A;  1SB6 A;  2MST A;  2RF2 B;  2Q79 A;  2XTJ P;  1RAJ A;  2Y9H A;  2KL8 A;  4KIA A;  1Q53 A;  2WW4 A;  3OL8 A;  3CCW A;  4ETX A;  2K8G A;  2RHS B;  3BGF A;  1B0V A;  3PHE A;  4OZ5 A;  1XMQ F;  3X1L B;  1WI8 A;  1VIX A;  1Y9O A;  1X0P A;  2V6A A;  2A2C A;  1B0P A;  1FXL A;  3JSB A;  3BSA A;  1C1B B;  2GX8 A;  4JB8 B;  5KT3 A;  1QAX A;  1NDC A;  3KDN A;  3R2C J;  3ZO7 A;  2HIQ A;  1JLF A;  2ZOG A;  1J2V A;  1NK6 A;  4B3O B;  3HUL A;  3TUP A;  2ZZM A;  3KK3 A;  3DRR B;  4JI5 F;  4LSL B;  3PKY A;  1UEK A;  4MH8 A;  3V4I A;  2PI4 A;  3GQC A;  2VG6 A;  1B70 B;  4OYI A;  3HVT B;  1CJU B;  2APO A;  3DMJ B;  1S48 A;  2VPZ B;  4K5S A;  5HLF B;  2KHC A;  4B3M F;  1IBM J;  2XSF A;  2HVZ A;  3RB4 A;  4ZJQ A;  4R8U A;  3OUY B;  3Q0A A;  2C42 A;  5GAE U;  3HF5 A;  3MED B;  2QRR A;  4USK A;  5AT1 B;  3ENW A;  2HQI A;  1VRU B;  2Q6C A;  1YJV A;  5F41 A;  2AJ2 A;  4CH7 A;  4JI3 F;  5L9X A;  4ATN A;  3H25 A;  1BWE A;  3E3X A;  5FII A;  1SQG A;  5B0C A;  4LR7 A;  1T03 A;  3A4T A;  1UWB B;  4FF2 A;  1ZET A;  3HJF A;  2B8P A;  3WBZ A;  4ZPT R;  3MR3 A;  3I0S A;  1PAE X;  3RAM A;  2XZW A;  4DV2 F;  1S0N A;  4Y00 A;  2D3O 1;  2GHP A;  5DDP C;  2GMJ A;  1Q4R A;  2HHP A;  3DYA A;  2FQQ B;  1NH8 A;  2PMW A;  2V2Q A;  3NRB A;  4FVM A;  1LWF B;  4NI2 A;  1M5H A;  2GIQ A;  2XYG B;  3NNH A;  3F73 A;  3MR6 A;  2AD9 A;  2MXY A;  2W2M P;  2V8G A;  2NXE A;  3G2X A;  4X66 J;  3M2R A;  1PAU B;  2IAJ A;  3R5J B;  2KTQ A;  4LF4 F;  2WVF A;  4MK9 A;  3FSX A;  4OJH A;  4ECY A;  2YX1 A;  2AMC B;  4LIR A;  4QWE A;  4XIU A; 
#chains in the Genus database with same CATH homology
 2DYA A;  4FKX A;  2BX6 A;  1JXV A;  1NSP A;  4S0M A;  1HLW A;  3ENA A;  3VVU A;  1NCL A;  3FKB A;  3ZTQ A;  3WX8 A;  3Q86 A;  2CWK A;  1EHW A;  4CP5 A;  1KDN A;  3FC9 A;  1NPK A;  2DXF A;  1MN9 A;  4AND A;  1UCN A;  3R9L A;  3EE3 A;  1F6T A;  1XIQ A;  3BBB A;  1LWX A;  1NSQ A;  3FBE A;  4FKY A;  2B8P A;  5BXI A;  1S59 A;  3PJ9 A;  4ENO A;  1PAE X;  4F36 A;  1NDC A;  1NB2 A;  2VU5 A;  2DXD A;  1BHN A;  3MPD A;  3VVT A;  3NGT A;  1BE4 A;  2B8Q A;  1HHQ A;  4WBF A;  1B4S A;  3ZTR A;  3B6B A;  3Q83 A;  4DUT A;  3EMT A;  4DZ6 A;  1NUE A;  3FBB A;  3DKD A;  3ZTS A;  1F3F A;  4W98 A;  3BBF A;  3ZTO A;  2HVE A;  2HVD A;  3EM1 A;  4UOH A;  1XQI A;  3ELH A;  3EVW A;  5IOL A;  4UOG A;  4ANC A;  3DDI A;  2DXE A;  1NDL A;  3NGU A;  3EVM A;  3Q8Y A;  3VGU A;  3PRV A;  3EJM A;  1S57 A;  3Q89 A;  4C6A A;  2DY9 A;  5CAA A;  3B54 A;  1NSK L;  1WKK A;  3G2X A;  1WKJ A;  3NGS A;  4KPC A;  4EK2 A;  2ZUA A;  4DI6 A;  1BUX A;  3GPA A;  1WKL A;  1S5Z A;  2AZ3 A;  3FCW A;  1HIY A;  1ZS6 A;  1LEO A;  3VGT A;  1W7W A;  5CAB A;  1NDK A;  1K44 A;  1NHK L;  3ZTP A;  4HR2 A;  3VGS A;  1PKU A;  1U8W A;  1NLK L;  3BH6 B;  3GP9 A;  4F4A A;  3FCV A;  3BH7 B;  3JS9 A;  3EIC A;  4ANE A;  2BEF A;  3FBC A;  5C7P A;  1B99 A;  1NDP A;  2NCK L;  3Q8U A;  4UOF A;  1MN7 A;  3EVO A;  4O0N A;  1VYA A;  2AZ1 A;  2HUR A;  3L7U A;  3BBC A;  3NGR A;  3VGV A;  3ETM A;  3FBF A;  3Q8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...