3ELMA

Crystal structure of mmp-13 complexed with inhibitor 24f
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
169
structure length
164
Chain Sequence
YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYFMLPDDDVQGIQSLYGPGDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagenase 3
publication title Discovery of potent, selective, and orally active carboxylic acid based inhibitors of matrix metalloproteinase-13
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 164
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2008-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3elmA00
3LJZA 3KECA 2FV9A 4JIJA 3WV3A 2N8RA 2MZEA 4H3XA 1CXVA 4Q1LA 1AF0A 1GO7P 3HBUP 2E3XA 2OW2A 4PKRA 1OS9A 3Q2HA 2MLRA 3ZUKA 4IJOA 2MLSA 1SLNA 1R55A 2D1NA 1HFCA 2W14A 4AXQA 1BKCI 1GKDA 2J83A 4WKIA 4GUYA 2OVXA 2O3EA 1BUVM 5BOTA 1JANA 2OXZA 2WOAA 1OMJA 3EHXA 1Y0VA 1K7GA 2O36A 1XUCA 1USNA 2YIGA 1MMBA 2JIHA 1SMPA 2X3BA 2Y6DA 4JA1A 1ZP5A 2QPJA 5I4OA 3DPFA 1RMZA 4JPAA 1YCMA 4PKUA 1JKYA 3LMCA 3KHIA 1G05A 1G12A 1IAAA 4HMAA 3G42A 1KUKA 1MNCA 1UMTA 2DW1A 3LK8A 3KMCA 3EDZA 3TT4A 1BZSA 2YB9A 3B92A 3G5CA 1KUGA 3CKIA 3USNA 1O0TA 1I1IP 3HYGA 1G49A 2OY4A 1PWUA 1A86A 1EAKA 4H30A 1R1HA 1ZXVA 1PWPA 2X7MA 1IACA 1HTDA 1BSWA 1C3IA 1DTHA 5CXAA 1G9KA 3DPEA 1JAPA 4FXYP 4FVLA 2CKIA 3HDAP 3LKAA 4PKTA 1KUIA 1ZS0A 1IAEA 3F16A 2POJA 4ON1A 2USNA 1XFXA 3ZXHA 3HY9A 3L0VA 2OXUA 3MA2A 1WNIA 4QKZA 1K7IA 1Y93A 2OW0A 2SRTA 1IABA 3EHYA 1IAGA 4AUOA 2CLTA 1PWWA 2X3CA 1YQYA 2I47A 5L79A 2E2DA 4H49A 3VTGA 3HDBA 2W12A 1EUBA 3KEKA 1R1IA 1CQRA 3KMEA 3LQ0A 2OXWA 3U1RA 2DDFA 3F1AA 4H76A 4GWNA 1S4BP 1XFYA 2JT6A 4FXQA 4L6TA 4ILWD 2OY2A 1G4KA 1BQOA 3LE9A 1BUDA 1JIWP 4L63A 3SHIA 5I43A 1AKLA 1D5JA 4AYKA 2D1OA 3AIGA 1D8FA 2K2GA 1AYKA 1OM7A 3EDIA 5D3CA 4GR3A 2HU6A 1UEAA 4DD8A 4I03A 5CUHA 1GXDA 3B8ZA 5I12A 1FLSA 3F17A 1QUAA 3KWVC 2RJPA 2OZRA 2OVZA 2Y6CA 3LEAA 1K7QA 3V96B 1XURA 5I0LA 3AYKA 1Z3JA 4CTHA 2JSDA 3DNGA 4H82A 1YOUA 5B5OA 2PJTA 1JIZA 4XCTA 4XM8A 1KAPP 4GR0A 4H1QA 2EROA 1ZTQA 4I35A 456CA 1SU3A 5LABA 1HFSA 1GE6A 3TVCA 4PKSA 1UMSA 1SATA 1ZVXA 3LUMA 5D1UA 3K7LA 4GQLA 3HBVP 5CZMA 4GR8A 4DF9A 1CIZA 1JAOA 2J0TA 1BQQM 1ZXCA 2WO8A 3N2VA 4ZR5A 4WF6A 3I7IA 2W15A 3HY7A 1I76A 4PKWA 3B2ZA 3LIRA 1D7XA 1UTZA 3LILA 1DMTA 1GE5A 3LQBA 1SRPA 2WO9A 4IUWA 1HY7A 1R1JA 2V4BA 1ATLA 1PWVA 1ND1A 3DL1A 5BOYA 1OO9A 1MMQA 3EDHA 3LJGA 3GBOA 1BKCA 1EB6A 2DDYA 1CGLA 3L0TA 3ZVSA 1BIWA 2L0RA 3K7NA 1C8TA 1XFZA 1KUHA 1HOVA 3P1VA 3DSLA 2MZIA 1GKCA 1MMPA 1OM6A 2OW1A 3LGPA 1H71P 4DPEA 2XS3A 1QIAA 4FU4A 1QJJA 4XM6A 5H8XA 4L19A 3P24A 4H84A 1QIBA 3LIKA 1XFVA 4R3VA 3EWJA 1BM6A 2OW9A 1B3DA 2W0DA 2XS4A 4JQGA 3TSKA 1KUFA 1XFUA 5D1SA 5D7WA 2ERQA 3RTTA 4WZVA 1PWQA 1O0QA 3LJTA 4IN9A 3RTSA 966CA 4GF1A 4A3WA 4G9LA 2ERPA 5I2ZA 2KRJA 2AIGP 2JT5A 2AYKA 1CAQA 1C7KA 2DW2A 1XFWA 1R54A 3I7GA 3OHOA 1GE7A 5L7FA 1JK3A 3LUNA 3BA0A 3HB2P 3Q2GA 1B8YA 3EDGA 2OI0A 1RM8A 1HV5A 1QICA 3KEJA 2Z2DA 2TCLA 1J7NA 3WV2A 2A8HA 1OM8A 5D1TA 2K9CA 1BKCE 830CA 3OHLA 4DV8A 2X3AA 1SLMA 2JNPA 4PKQA 3O64A 3UVCA 1KBCA 1I73A 3F18A 3F15A 3O2XA 1IADA 1FBLA 4WKEA 3AYUA 3NX7A 4PKVA 3WV1A 1A85A 1Y8JA 4XBHA 3N2UA 1D8MA 4HX3A 1XUDA 2MZHA 4XM7A 1JH1A 3KRYA 1CGFA 3VI1A 2RJQA 4AIGA 1GO8P 1ROSA 1ASTA 1OS2A 1Q3AA 4H2EA 1UTTA 1CK7A 5B5PA 2DW0A 3DWBA 4GWMA 5JMYA 4A7BA 1FM1A 1JAQA 3ELMA 1QJIA 1CGEA 3F19A 4J4MA 4EFSA 3E8RA 1L6JA 4G0DA 1YP1A 2W13A 4JP4A 5D2BA 1MMRA 4WK7A 5BPAA 3TS4A 1JJ9A 2FV5A 5I3MA
chains in the Genus database with same CATH superfamily
3LJZA 3KECA 1XM5A 2FV9A 4JIJA 1XAXA 3WV3A 2N8RA 2MZEA 4H3XA 1CXVA 4Q1LA 1AF0A 1GO7P 3HBUP 2E3XA 2OW2A 4PKRA 1OS9A 3Q2HA 2MLRA 3ZUKA 4IJOA 2MLSA 1SLNA 1R55A 2D1NA 1HFCA 2W14A 4AXQA 1BKCI 1GKDA 2J83A 4WKIA 1OZ9A 4GUYA 2OVXA 2O3EA 1BUVM 5BOTA 1JANA 2OXZA 2WOAA 1OMJA 3EHXA 1Y0VA 1K7GA 2O36A 1XUCA 1USNA 2YIGA 1MMBA 2JIHA 1SMPA 2X3BA 2Y6DA 4JA1A 1ZP5A 2QPJA 5I4OA 3DPFA 1RMZA 4JPAA 1YCMA 4PKUA 1JKYA 3LMCA 3KHIA 1G05A 1G12A 1IAAA 3DTIA 4HMAA 3G42A 1KUKA 1MNCA 1UMTA 2DW1A 3LK8A 3KMCA 3EDZA 3TT4A 1BZSA 2YB9A 3B92A 3G5CA 1KUGA 3CKIA 3USNA 1O0TA 1I1IP 3HYGA 1G49A 2OY4A 1PWUA 1A86A 1EAKA 4H30A 1R1HA 1ZXVA 1PWPA 2X7MA 1IACA 1HTDA 1BSWA 1C3IA 1DTHA 5CXAA 1G9KA 3DPEA 1JAPA 4FXYP 4FVLA 2CKIA 3HDAP 3LKAA 4PKTA 1KUIA 1ZS0A 1IAEA 3F16A 2POJA 4ON1A 2USNA 1XFXA 3ZXHA 3HY9A 3L0VA 2OXUA 3MA2A 1WNIA 3DTEA 4QKZA 1K7IA 1Y93A 2OW0A 2SRTA 1IABA 3EHYA 1IAGA 4AUOA 2CLTA 1PWWA 2X3CA 1YQYA 2I47A 5L79A 2E2DA 4H49A 3VTGA 3HDBA 2W12A 1EUBA 3KEKA 1R1IA 1CQRA 3KMEA 3LQ0A 2OXWA 3U1RA 2DDFA 3F1AA 4H76A 4GWNA 1S4BP 1XFYA 3DTKA 2YUFA 2JT6A 4FXQA 4L6TA 4ILWD 2OY2A 1G4KA 1BQOA 3LE9A 1BUDA 1JIWP 4L63A 3SHIA 5I43A 1AKLA 1D5JA 4AYKA 2D1OA 3AIGA 1D8FA 2K2GA 1AYKA 1OM7A 3EDIA 5D3CA 4GR3A 2HU6A 1UEAA 4DD8A 4I03A 5CUHA 1GXDA 3B8ZA 5I12A 1FLSA 3F17A 1QUAA 3KWVC 2RJPA 2OZRA 2OVZA 2Y6CA 3LEAA 1K7QA 3V96B 1XURA 5I0LA 3AYKA 1Z3JA 4CTHA 2JSDA 3DNGA 4H82A 1TVIA 1YOUA 5B5OA 2PJTA 1JIZA 4XCTA 4XM8A 1KAPP 4GR0A 4H1QA 2EROA 1ZTQA 4I35A 456CA 1SU3A 5LABA 1HFSA 1GE6A 3TVCA 4PKSA 1UMSA 1SATA 1ZVXA 3LUMA 5D1UA 3K7LA 4GQLA 3HBVP 5CZMA 4GR8A 4DF9A 1CIZA 1JAOA 2J0TA 1BQQM 1ZXCA 2WO8A 3N2VA 4ZR5A 4WF6A 3I7IA 2W15A 3HY7A 1I76A 4PKWA 3B2ZA 3LIRA 1D7XA 1UTZA 3LILA 1DMTA 1GE5A 3LQBA 1SRPA 2WO9A 4IUWA 1HY7A 1R1JA 2V4BA 1ATLA 1PWVA 1ND1A 3DL1A 5BOYA 1OO9A 1MMQA 3EDHA 3LJGA 3GBOA 1BKCA 1EB6A 2DDYA 1CGLA 3L0TA 3ZVSA 1BIWA 2L0RA 3K7NA 1C8TA 1XFZA 1KUHA 1HOVA 3P1VA 3DSLA 2MZIA 1GKCA 1MMPA 1OM6A 2OW1A 3LGPA 1H71P 4DPEA 2XS3A 1QIAA 4FU4A 1QJJA 4XM6A 5H8XA 4L19A 3P24A 4H84A 1QIBA 3LIKA 1XFVA 4R3VA 3EWJA 1BM6A 2OW9A 1B3DA 2W0DA 2XS4A 4JQGA 3TSKA 1KUFA 1XFUA 5D1SA 5D7WA 2ERQA 3RTTA 4WZVA 1PWQA 1O0QA 3LJTA 4IN9A 3RTSA 966CA 4GF1A 4A3WA 4G9LA 2ERPA 5I2ZA 2KRJA 2AIGP 2JT5A 2AYKA 1CAQA 1C7KA 2DW2A 1XFWA 1R54A 3I7GA 3OHOA 1GE7A 5L7FA 1JK3A 3LUNA 3BA0A 3HB2P 3Q2GA 1B8YA 3EDGA 2OI0A 1RM8A 1HV5A 1QICA 3KEJA 2Z2DA 2TCLA 1J7NA 3WV2A 2A8HA 1OM8A 5D1TA 2K9CA 1BKCE 830CA 3OHLA 4DV8A 2X3AA 1SLMA 2JNPA 4PKQA 3O64A 3UVCA 1KBCA 1I73A 3F18A 3F15A 3O2XA 1IADA 1FBLA 4WKEA 3AYUA 3NX7A 4PKVA 3WV1A 1A85A 1Y8JA 4XBHA 3N2UA 1D8MA 4HX3A 1XUDA 2MZHA 4XM7A 1JH1A 3KRYA 1CGFA 3VI1A 2RJQA 4AIGA 1GO8P 1ROSA 1ASTA 1OS2A 1Q3AA 4H2EA 1UTTA 1CK7A 5B5PA 2DW0A 3DWBA 4L7AA 4GWMA 5JMYA 4A7BA 1FM1A 1JAQA 3ELMA 1QJIA 1CGEA 3F19A 4J4MA 4EFSA 3E8RA 1L6JA 4G0DA 1YP1A 2W13A 4JP4A 5D2BA 1MMRA 4WK7A 5BPAA 3TS4A 1JJ9A 2FV5A 5I3MA
chains in the Genus database with same CATH topology
3LJZA 3KECA 2FV9A 4JIJA 3WV3A 2N8RA 2MZEA 4H3XA 1CXVA 4Q1LA 1AF0A 1GO7P 3HBUP 2E3XA 2OW2A 4PKRA 1OS9A 3Q2HA 2MLRA 3ZUKA 4IJOA 2MLSA 1SLNA 1R55A 2D1NA 1HFCA 2W14A 4AXQA 1BKCI 1GKDA 2J83A 4WKIA 4GUYA 2OVXA 2O3EA 1BUVM 5BOTA 1JANA 2OXZA 2WOAA 1OMJA 3EHXA 1Y0VA 1K7GA 2O36A 1XUCA 1USNA 2YIGA 1MMBA 2JIHA 1SMPA 2X3BA 2Y6DA 4JA1A 1ZP5A 2QPJA 5I4OA 3DPFA 1RMZA 4JPAA 1YCMA 4PKUA 1JKYA 3LMCA 3KHIA 1G05A 1G12A 1IAAA 3DTIA 4HMAA 3G42A 1KUKA 1MNCA 1UMTA 2DW1A 3LK8A 3KMCA 3EDZA 3TT4A 1BZSA 2YB9A 3B92A 3G5CA 1KUGA 3CKIA 3USNA 1O0TA 1I1IP 3HYGA 1G49A 2OY4A 1PWUA 1A86A 1EAKA 4H30A 1R1HA 1ZXVA 1PWPA 2X7MA 1IACA 1HTDA 1BSWA 1C3IA 1DTHA 5CXAA 1G9KA 3DPEA 1JAPA 4FXYP 4FVLA 2CKIA 3HDAP 3LKAA 4PKTA 1KUIA 1ZS0A 1IAEA 3F16A 2POJA 4ON1A 2USNA 1XFXA 3ZXHA 3HY9A 3L0VA 2OXUA 3MA2A 1WNIA 3DTEA 4QKZA 1K7IA 1Y93A 2OW0A 2SRTA 1IABA 3EHYA 1IAGA 4AUOA 2CLTA 1PWWA 2X3CA 1YQYA 2I47A 5L79A 2E2DA 4H49A 3VTGA 3HDBA 2W12A 1EUBA 3KEKA 1R1IA 1CQRA 3KMEA 3LQ0A 2OXWA 3U1RA 2DDFA 3F1AA 4H76A 4GWNA 1S4BP 1XFYA 3DTKA 2YUFA 2JT6A 4FXQA 4L6TA 4ILWD 2OY2A 1G4KA 1BQOA 3LE9A 1BUDA 1JIWP 4L63A 3SHIA 5I43A 1AKLA 1D5JA 4AYKA 2D1OA 3AIGA 1D8FA 2K2GA 1AYKA 1OM7A 3EDIA 5D3CA 4GR3A 2HU6A 1UEAA 4DD8A 4I03A 5CUHA 1GXDA 3B8ZA 5I12A 1FLSA 3F17A 1QUAA 3KWVC 2RJPA 2OZRA 2OVZA 2Y6CA 3LEAA 1K7QA 3V96B 1XURA 5I0LA 3AYKA 1Z3JA 4CTHA 2JSDA 3DNGA 4H82A 1YOUA 5B5OA 2PJTA 1JIZA 4XCTA 4XM8A 1KAPP 4GR0A 4H1QA 2EROA 1ZTQA 4I35A 456CA 1SU3A 5LABA 1HFSA 1GE6A 3TVCA 4PKSA 1UMSA 1SATA 1ZVXA 3LUMA 5D1UA 3K7LA 4GQLA 3HBVP 5CZMA 4GR8A 4DF9A 1CIZA 1JAOA 2J0TA 1BQQM 1ZXCA 2WO8A 3N2VA 4ZR5A 4WF6A 3I7IA 2W15A 3HY7A 1I76A 4PKWA 3B2ZA 3LIRA 1D7XA 1UTZA 3LILA 1DMTA 1GE5A 3LQBA 1SRPA 2WO9A 4IUWA 1HY7A 1R1JA 2V4BA 1ATLA 1PWVA 1ND1A 3DL1A 5BOYA 1OO9A 1MMQA 3EDHA 3LJGA 3GBOA 1BKCA 1EB6A 2DDYA 1CGLA 3L0TA 3ZVSA 1BIWA 2L0RA 3K7NA 1C8TA 1XFZA 1KUHA 1HOVA 3P1VA 3DSLA 2MZIA 1GKCA 1MMPA 1OM6A 2OW1A 3LGPA 1H71P 4DPEA 2XS3A 1QIAA 4FU4A 1QJJA 4XM6A 5H8XA 4L19A 3P24A 4H84A 1QIBA 3LIKA 1XFVA 4R3VA 3EWJA 1BM6A 2OW9A 1B3DA 2W0DA 2XS4A 4JQGA 3TSKA 1KUFA 1XFUA 5D1SA 5D7WA 2ERQA 3RTTA 4WZVA 1PWQA 1O0QA 3LJTA 4IN9A 3RTSA 966CA 4GF1A 4A3WA 4G9LA 2ERPA 5I2ZA 2KRJA 2AIGP 2JT5A 2AYKA 1CAQA 1C7KA 2DW2A 1XFWA 1R54A 3I7GA 3OHOA 1GE7A 5L7FA 1JK3A 3LUNA 3BA0A 3HB2P 3Q2GA 1B8YA 3EDGA 2OI0A 1RM8A 1HV5A 1QICA 3KEJA 2Z2DA 2TCLA 1J7NA 3WV2A 2A8HA 1OM8A 5D1TA 2K9CA 1BKCE 830CA 3OHLA 4DV8A 2X3AA 1SLMA 2JNPA 4PKQA 3O64A 3UVCA 1KBCA 1I73A 3F18A 3F15A 3O2XA 1IADA 1FBLA 4WKEA 3AYUA 3NX7A 4PKVA 3WV1A 1A85A 1Y8JA 4XBHA 3N2UA 1D8MA 4HX3A 1XUDA 2MZHA 4XM7A 1JH1A 3KRYA 1CGFA 3VI1A 2RJQA 4AIGA 1GO8P 1ROSA 1ASTA 1OS2A 1Q3AA 4H2EA 1UTTA 1CK7A 5B5PA 2DW0A 3DWBA 4L7AA 4GWMA 5JMYA 4A7BA 1FM1A 1JAQA 3ELMA 1QJIA 1CGEA 3F19A 4J4MA 4EFSA 3E8RA 1L6JA 4G0DA 1YP1A 2W13A 4JP4A 5D2BA 1MMRA 4WK7A 5BPAA 3TS4A 1JJ9A 2FV5A 5I3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJZ A;  3KEC A;  2FV9 A;  4JIJ A;  3WV3 A;  2N8R A;  2MZE A;  4H3X A;  1CXV A;  4Q1L A;  1AF0 A;  1GO7 P;  3HBU P;  2E3X A;  2OW2 A;  4PKR A;  1OS9 A;  3Q2H A;  2MLR A;  3ZUK A;  4IJO A;  2MLS A;  1SLN A;  1R55 A;  2D1N A;  1HFC A;  2W14 A;  4AXQ A;  1BKC I;  1GKD A;  2J83 A;  4WKI A;  4GUY A;  2OVX A;  2O3E A;  1BUV M;  5BOT A;  1JAN A;  2OXZ A;  2WOA A;  1OMJ A;  3EHX A;  1Y0V A;  1K7G A;  2O36 A;  1XUC A;  1USN A;  2YIG A;  1MMB A;  2JIH A;  1SMP A;  2X3B A;  2Y6D A;  4JA1 A;  1ZP5 A;  2QPJ A;  5I4O A;  3DPF A;  1RMZ A;  4JPA A;  1YCM A;  4PKU A;  1JKY A;  3LMC A;  3KHI A;  1G05 A;  1G12 A;  1IAA A;  4HMA A;  3G42 A;  1KUK A;  1MNC A;  1UMT A;  2DW1 A;  3LK8 A;  3KMC A;  3EDZ A;  3TT4 A;  1BZS A;  2YB9 A;  3B92 A;  3G5C A;  1KUG A;  3CKI A;  3USN A;  1O0T A;  1I1I P;  3HYG A;  1G49 A;  2OY4 A;  1PWU A;  1A86 A;  1EAK A;  4H30 A;  1R1H A;  1ZXV A;  1PWP A;  2X7M A;  1IAC A;  1HTD A;  1BSW A;  1C3I A;  1DTH A;  5CXA A;  1G9K A;  3DPE A;  1JAP A;  4FXY P;  4FVL A;  2CKI A;  3HDA P;  3LKA A;  4PKT A;  1KUI A;  1ZS0 A;  1IAE A;  3F16 A;  2POJ A;  4ON1 A;  2USN A;  1XFX A;  3ZXH A;  3HY9 A;  3L0V A;  2OXU A;  3MA2 A;  1WNI A;  4QKZ A;  1K7I A;  1Y93 A;  2OW0 A;  2SRT A;  1IAB A;  3EHY A;  1IAG A;  4AUO A;  2CLT A;  1PWW A;  2X3C A;  1YQY A;  2I47 A;  5L79 A;  2E2D A;  4H49 A;  3VTG A;  3HDB A;  2W12 A;  1EUB A;  3KEK A;  1R1I A;  1CQR A;  3KME A;  3LQ0 A;  2OXW A;  3U1R A;  2DDF A;  3F1A A;  4H76 A;  4GWN A;  1S4B P;  1XFY A;  2JT6 A;  4FXQ A;  4L6T A;  4ILW D;  2OY2 A;  1G4K A;  1BQO A;  3LE9 A;  1BUD A;  1JIW P;  4L63 A;  3SHI A;  5I43 A;  1AKL A;  1D5J A;  4AYK A;  2D1O A;  3AIG A;  1D8F A;  2K2G A;  1AYK A;  1OM7 A;  3EDI A;  5D3C A;  4GR3 A;  2HU6 A;  1UEA A;  4DD8 A;  4I03 A;  5CUH A;  1GXD A;  3B8Z A;  5I12 A;  1FLS A;  3F17 A;  1QUA A;  3KWV C;  2RJP A;  2OZR A;  2OVZ A;  2Y6C A;  3LEA A;  1K7Q A;  3V96 B;  1XUR A;  5I0L A;  3AYK A;  1Z3J A;  4CTH A;  2JSD A;  3DNG A;  4H82 A;  1YOU A;  5B5O A;  2PJT A;  1JIZ A;  4XCT A;  4XM8 A;  1KAP P;  4GR0 A;  4H1Q A;  2ERO A;  1ZTQ A;  4I35 A;  456C A;  1SU3 A;  5LAB A;  1HFS A;  1GE6 A;  3TVC A;  4PKS A;  1UMS A;  1SAT A;  1ZVX A;  3LUM A;  5D1U A;  3K7L A;  4GQL A;  3HBV P;  5CZM A;  4GR8 A;  4DF9 A;  1CIZ A;  1JAO A;  2J0T A;  1BQQ M;  1ZXC A;  2WO8 A;  3N2V A;  4ZR5 A;  4WF6 A;  3I7I A;  2W15 A;  3HY7 A;  1I76 A;  4PKW A;  3B2Z A;  3LIR A;  1D7X A;  1UTZ A;  3LIL A;  1DMT A;  1GE5 A;  3LQB A;  1SRP A;  2WO9 A;  4IUW A;  1HY7 A;  1R1J A;  2V4B A;  1ATL A;  1PWV A;  1ND1 A;  3DL1 A;  5BOY A;  1OO9 A;  1MMQ A;  3EDH A;  3LJG A;  3GBO A;  1BKC A;  1EB6 A;  2DDY A;  1CGL A;  3L0T A;  3ZVS A;  1BIW A;  2L0R A;  3K7N A;  1C8T A;  1XFZ A;  1KUH A;  1HOV A;  3P1V A;  3DSL A;  2MZI A;  1GKC A;  1MMP A;  1OM6 A;  2OW1 A;  3LGP A;  1H71 P;  4DPE A;  2XS3 A;  1QIA A;  4FU4 A;  1QJJ A;  4XM6 A;  5H8X A;  4L19 A;  3P24 A;  4H84 A;  1QIB A;  3LIK A;  1XFV A;  4R3V A;  3EWJ A;  1BM6 A;  2OW9 A;  1B3D A;  2W0D A;  2XS4 A;  4JQG A;  3TSK A;  1KUF A;  1XFU A;  5D1S A;  5D7W A;  2ERQ A;  3RTT A;  4WZV A;  1PWQ A;  1O0Q A;  3LJT A;  4IN9 A;  3RTS A;  966C A;  4GF1 A;  4A3W A;  4G9L A;  2ERP A;  5I2Z A;  2KRJ A;  2AIG P;  2JT5 A;  2AYK A;  1CAQ A;  1C7K A;  2DW2 A;  1XFW A;  1R54 A;  3I7G A;  3OHO A;  1GE7 A;  5L7F A;  1JK3 A;  3LUN A;  3BA0 A;  3HB2 P;  3Q2G A;  1B8Y A;  3EDG A;  2OI0 A;  1RM8 A;  1HV5 A;  1QIC A;  3KEJ A;  2Z2D A;  2TCL A;  1J7N A;  3WV2 A;  2A8H A;  1OM8 A;  5D1T A;  2K9C A;  1BKC E;  830C A;  3OHL A;  4DV8 A;  2X3A A;  1SLM A;  2JNP A;  4PKQ A;  3O64 A;  3UVC A;  1KBC A;  1I73 A;  3F18 A;  3F15 A;  3O2X A;  1IAD A;  1FBL A;  4WKE A;  3AYU A;  3NX7 A;  4PKV A;  3WV1 A;  1A85 A;  1Y8J A;  4XBH A;  3N2U A;  1D8M A;  4HX3 A;  1XUD A;  2MZH A;  4XM7 A;  1JH1 A;  3KRY A;  1CGF A;  3VI1 A;  2RJQ A;  4AIG A;  1GO8 P;  1ROS A;  1AST A;  1OS2 A;  1Q3A A;  4H2E A;  1UTT A;  1CK7 A;  5B5P A;  2DW0 A;  3DWB A;  4GWM A;  5JMY A;  4A7B A;  1FM1 A;  1JAQ A;  3ELM A;  1QJI A;  1CGE A;  3F19 A;  4J4M A;  4EFS A;  3E8R A;  1L6J A;  4G0D A;  1YP1 A;  2W13 A;  4JP4 A;  5D2B A;  1MMR A;  4WK7 A;  5BPA A;  3TS4 A;  1JJ9 A;  2FV5 A;  5I3M A; 
#chains in the Genus database with same CATH topology
 3LJZ A;  3KEC A;  1XM5 A;  2FV9 A;  4JIJ A;  1XAX A;  3WV3 A;  2N8R A;  2MZE A;  4H3X A;  1CXV A;  4Q1L A;  1AF0 A;  1GO7 P;  3HBU P;  2E3X A;  2OW2 A;  4PKR A;  1OS9 A;  3Q2H A;  2MLR A;  3ZUK A;  4IJO A;  2MLS A;  1SLN A;  1R55 A;  2D1N A;  1HFC A;  2W14 A;  4AXQ A;  1BKC I;  1GKD A;  2J83 A;  4WKI A;  1OZ9 A;  4GUY A;  2OVX A;  2O3E A;  1BUV M;  5BOT A;  1JAN A;  2OXZ A;  2WOA A;  1OMJ A;  3EHX A;  1Y0V A;  1K7G A;  2O36 A;  1XUC A;  1USN A;  2YIG A;  1MMB A;  2JIH A;  1SMP A;  2X3B A;  2Y6D A;  4JA1 A;  1ZP5 A;  2QPJ A;  5I4O A;  3DPF A;  1RMZ A;  4JPA A;  1YCM A;  4PKU A;  1JKY A;  3LMC A;  3KHI A;  1G05 A;  1G12 A;  1IAA A;  3DTI A;  4HMA A;  3G42 A;  1KUK A;  1MNC A;  1UMT A;  2DW1 A;  3LK8 A;  3KMC A;  3EDZ A;  3TT4 A;  1BZS A;  2YB9 A;  3B92 A;  3G5C A;  1KUG A;  3CKI A;  3USN A;  1O0T A;  1I1I P;  3HYG A;  1G49 A;  2OY4 A;  1PWU A;  1A86 A;  1EAK A;  4H30 A;  1R1H A;  1ZXV A;  1PWP A;  2X7M A;  1IAC A;  1HTD A;  1BSW A;  1C3I A;  1DTH A;  5CXA A;  1G9K A;  3DPE A;  1JAP A;  4FXY P;  4FVL A;  2CKI A;  3HDA P;  3LKA A;  4PKT A;  1KUI A;  1ZS0 A;  1IAE A;  3F16 A;  2POJ A;  4ON1 A;  2USN A;  1XFX A;  3ZXH A;  3HY9 A;  3L0V A;  2OXU A;  3MA2 A;  1WNI A;  3DTE A;  4QKZ A;  1K7I A;  1Y93 A;  2OW0 A;  2SRT A;  1IAB A;  3EHY A;  1IAG A;  4AUO A;  2CLT A;  1PWW A;  2X3C A;  1YQY A;  2I47 A;  5L79 A;  2E2D A;  4H49 A;  3VTG A;  3HDB A;  2W12 A;  1EUB A;  3KEK A;  1R1I A;  1CQR A;  3KME A;  3LQ0 A;  2OXW A;  3U1R A;  2DDF A;  3F1A A;  4H76 A;  4GWN A;  1S4B P;  1XFY A;  3DTK A;  2YUF A;  2JT6 A;  4FXQ A;  4L6T A;  4ILW D;  2OY2 A;  1G4K A;  1BQO A;  3LE9 A;  1BUD A;  1JIW P;  4L63 A;  3SHI A;  5I43 A;  1AKL A;  1D5J A;  4AYK A;  2D1O A;  3AIG A;  1D8F A;  2K2G A;  1AYK A;  1OM7 A;  3EDI A;  5D3C A;  4GR3 A;  2HU6 A;  1UEA A;  4DD8 A;  4I03 A;  5CUH A;  1GXD A;  3B8Z A;  5I12 A;  1FLS A;  3F17 A;  1QUA A;  3KWV C;  2RJP A;  2OZR A;  2OVZ A;  2Y6C A;  3LEA A;  1K7Q A;  3V96 B;  1XUR A;  5I0L A;  3AYK A;  1Z3J A;  4CTH A;  2JSD A;  3DNG A;  4H82 A;  1TVI A;  1YOU A;  5B5O A;  2PJT A;  1JIZ A;  4XCT A;  4XM8 A;  1KAP P;  4GR0 A;  4H1Q A;  2ERO A;  1ZTQ A;  4I35 A;  456C A;  1SU3 A;  5LAB A;  1HFS A;  1GE6 A;  3TVC A;  4PKS A;  1UMS A;  1SAT A;  1ZVX A;  3LUM A;  5D1U A;  3K7L A;  4GQL A;  3HBV P;  5CZM A;  4GR8 A;  4DF9 A;  1CIZ A;  1JAO A;  2J0T A;  1BQQ M;  1ZXC A;  2WO8 A;  3N2V A;  4ZR5 A;  4WF6 A;  3I7I A;  2W15 A;  3HY7 A;  1I76 A;  4PKW A;  3B2Z A;  3LIR A;  1D7X A;  1UTZ A;  3LIL A;  1DMT A;  1GE5 A;  3LQB A;  1SRP A;  2WO9 A;  4IUW A;  1HY7 A;  1R1J A;  2V4B A;  1ATL A;  1PWV A;  1ND1 A;  3DL1 A;  5BOY A;  1OO9 A;  1MMQ A;  3EDH A;  3LJG A;  3GBO A;  1BKC A;  1EB6 A;  2DDY A;  1CGL A;  3L0T A;  3ZVS A;  1BIW A;  2L0R A;  3K7N A;  1C8T A;  1XFZ A;  1KUH A;  1HOV A;  3P1V A;  3DSL A;  2MZI A;  1GKC A;  1MMP A;  1OM6 A;  2OW1 A;  3LGP A;  1H71 P;  4DPE A;  2XS3 A;  1QIA A;  4FU4 A;  1QJJ A;  4XM6 A;  5H8X A;  4L19 A;  3P24 A;  4H84 A;  1QIB A;  3LIK A;  1XFV A;  4R3V A;  3EWJ A;  1BM6 A;  2OW9 A;  1B3D A;  2W0D A;  2XS4 A;  4JQG A;  3TSK A;  1KUF A;  1XFU A;  5D1S A;  5D7W A;  2ERQ A;  3RTT A;  4WZV A;  1PWQ A;  1O0Q A;  3LJT A;  4IN9 A;  3RTS A;  966C A;  4GF1 A;  4A3W A;  4G9L A;  2ERP A;  5I2Z A;  2KRJ A;  2AIG P;  2JT5 A;  2AYK A;  1CAQ A;  1C7K A;  2DW2 A;  1XFW A;  1R54 A;  3I7G A;  3OHO A;  1GE7 A;  5L7F A;  1JK3 A;  3LUN A;  3BA0 A;  3HB2 P;  3Q2G A;  1B8Y A;  3EDG A;  2OI0 A;  1RM8 A;  1HV5 A;  1QIC A;  3KEJ A;  2Z2D A;  2TCL A;  1J7N A;  3WV2 A;  2A8H A;  1OM8 A;  5D1T A;  2K9C A;  1BKC E;  830C A;  3OHL A;  4DV8 A;  2X3A A;  1SLM A;  2JNP A;  4PKQ A;  3O64 A;  3UVC A;  1KBC A;  1I73 A;  3F18 A;  3F15 A;  3O2X A;  1IAD A;  1FBL A;  4WKE A;  3AYU A;  3NX7 A;  4PKV A;  3WV1 A;  1A85 A;  1Y8J A;  4XBH A;  3N2U A;  1D8M A;  4HX3 A;  1XUD A;  2MZH A;  4XM7 A;  1JH1 A;  3KRY A;  1CGF A;  3VI1 A;  2RJQ A;  4AIG A;  1GO8 P;  1ROS A;  1AST A;  1OS2 A;  1Q3A A;  4H2E A;  1UTT A;  1CK7 A;  5B5P A;  2DW0 A;  3DWB A;  4L7A A;  4GWM A;  5JMY A;  4A7B A;  1FM1 A;  1JAQ A;  3ELM A;  1QJI A;  1CGE A;  3F19 A;  4J4M A;  4EFS A;  3E8R A;  1L6J A;  4G0D A;  1YP1 A;  2W13 A;  4JP4 A;  5D2B A;  1MMR A;  4WK7 A;  5BPA A;  3TS4 A;  1JJ9 A;  2FV5 A;  5I3M A; 
#chains in the Genus database with same CATH homology
 3LJZ A;  3KEC A;  2FV9 A;  4JIJ A;  3WV3 A;  2N8R A;  2MZE A;  4H3X A;  1CXV A;  4Q1L A;  1AF0 A;  1GO7 P;  3HBU P;  2E3X A;  2OW2 A;  4PKR A;  1OS9 A;  3Q2H A;  2MLR A;  3ZUK A;  4IJO A;  2MLS A;  1SLN A;  1R55 A;  2D1N A;  1HFC A;  2W14 A;  4AXQ A;  1BKC I;  1GKD A;  2J83 A;  4WKI A;  4GUY A;  2OVX A;  2O3E A;  1BUV M;  5BOT A;  1JAN A;  2OXZ A;  2WOA A;  1OMJ A;  3EHX A;  1Y0V A;  1K7G A;  2O36 A;  1XUC A;  1USN A;  2YIG A;  1MMB A;  2JIH A;  1SMP A;  2X3B A;  2Y6D A;  4JA1 A;  1ZP5 A;  2QPJ A;  5I4O A;  3DPF A;  1RMZ A;  4JPA A;  1YCM A;  4PKU A;  1JKY A;  3LMC A;  3KHI A;  1G05 A;  1G12 A;  1IAA A;  3DTI A;  4HMA A;  3G42 A;  1KUK A;  1MNC A;  1UMT A;  2DW1 A;  3LK8 A;  3KMC A;  3EDZ A;  3TT4 A;  1BZS A;  2YB9 A;  3B92 A;  3G5C A;  1KUG A;  3CKI A;  3USN A;  1O0T A;  1I1I P;  3HYG A;  1G49 A;  2OY4 A;  1PWU A;  1A86 A;  1EAK A;  4H30 A;  1R1H A;  1ZXV A;  1PWP A;  2X7M A;  1IAC A;  1HTD A;  1BSW A;  1C3I A;  1DTH A;  5CXA A;  1G9K A;  3DPE A;  1JAP A;  4FXY P;  4FVL A;  2CKI A;  3HDA P;  3LKA A;  4PKT A;  1KUI A;  1ZS0 A;  1IAE A;  3F16 A;  2POJ A;  4ON1 A;  2USN A;  1XFX A;  3ZXH A;  3HY9 A;  3L0V A;  2OXU A;  3MA2 A;  1WNI A;  3DTE A;  4QKZ A;  1K7I A;  1Y93 A;  2OW0 A;  2SRT A;  1IAB A;  3EHY A;  1IAG A;  4AUO A;  2CLT A;  1PWW A;  2X3C A;  1YQY A;  2I47 A;  5L79 A;  2E2D A;  4H49 A;  3VTG A;  3HDB A;  2W12 A;  1EUB A;  3KEK A;  1R1I A;  1CQR A;  3KME A;  3LQ0 A;  2OXW A;  3U1R A;  2DDF A;  3F1A A;  4H76 A;  4GWN A;  1S4B P;  1XFY A;  3DTK A;  2YUF A;  2JT6 A;  4FXQ A;  4L6T A;  4ILW D;  2OY2 A;  1G4K A;  1BQO A;  3LE9 A;  1BUD A;  1JIW P;  4L63 A;  3SHI A;  5I43 A;  1AKL A;  1D5J A;  4AYK A;  2D1O A;  3AIG A;  1D8F A;  2K2G A;  1AYK A;  1OM7 A;  3EDI A;  5D3C A;  4GR3 A;  2HU6 A;  1UEA A;  4DD8 A;  4I03 A;  5CUH A;  1GXD A;  3B8Z A;  5I12 A;  1FLS A;  3F17 A;  1QUA A;  3KWV C;  2RJP A;  2OZR A;  2OVZ A;  2Y6C A;  3LEA A;  1K7Q A;  3V96 B;  1XUR A;  5I0L A;  3AYK A;  1Z3J A;  4CTH A;  2JSD A;  3DNG A;  4H82 A;  1YOU A;  5B5O A;  2PJT A;  1JIZ A;  4XCT A;  4XM8 A;  1KAP P;  4GR0 A;  4H1Q A;  2ERO A;  1ZTQ A;  4I35 A;  456C A;  1SU3 A;  5LAB A;  1HFS A;  1GE6 A;  3TVC A;  4PKS A;  1UMS A;  1SAT A;  1ZVX A;  3LUM A;  5D1U A;  3K7L A;  4GQL A;  3HBV P;  5CZM A;  4GR8 A;  4DF9 A;  1CIZ A;  1JAO A;  2J0T A;  1BQQ M;  1ZXC A;  2WO8 A;  3N2V A;  4ZR5 A;  4WF6 A;  3I7I A;  2W15 A;  3HY7 A;  1I76 A;  4PKW A;  3B2Z A;  3LIR A;  1D7X A;  1UTZ A;  3LIL A;  1DMT A;  1GE5 A;  3LQB A;  1SRP A;  2WO9 A;  4IUW A;  1HY7 A;  1R1J A;  2V4B A;  1ATL A;  1PWV A;  1ND1 A;  3DL1 A;  5BOY A;  1OO9 A;  1MMQ A;  3EDH A;  3LJG A;  3GBO A;  1BKC A;  1EB6 A;  2DDY A;  1CGL A;  3L0T A;  3ZVS A;  1BIW A;  2L0R A;  3K7N A;  1C8T A;  1XFZ A;  1KUH A;  1HOV A;  3P1V A;  3DSL A;  2MZI A;  1GKC A;  1MMP A;  1OM6 A;  2OW1 A;  3LGP A;  1H71 P;  4DPE A;  2XS3 A;  1QIA A;  4FU4 A;  1QJJ A;  4XM6 A;  5H8X A;  4L19 A;  3P24 A;  4H84 A;  1QIB A;  3LIK A;  1XFV A;  4R3V A;  3EWJ A;  1BM6 A;  2OW9 A;  1B3D A;  2W0D A;  2XS4 A;  4JQG A;  3TSK A;  1KUF A;  1XFU A;  5D1S A;  5D7W A;  2ERQ A;  3RTT A;  4WZV A;  1PWQ A;  1O0Q A;  3LJT A;  4IN9 A;  3RTS A;  966C A;  4GF1 A;  4A3W A;  4G9L A;  2ERP A;  5I2Z A;  2KRJ A;  2AIG P;  2JT5 A;  2AYK A;  1CAQ A;  1C7K A;  2DW2 A;  1XFW A;  1R54 A;  3I7G A;  3OHO A;  1GE7 A;  5L7F A;  1JK3 A;  3LUN A;  3BA0 A;  3HB2 P;  3Q2G A;  1B8Y A;  3EDG A;  2OI0 A;  1RM8 A;  1HV5 A;  1QIC A;  3KEJ A;  2Z2D A;  2TCL A;  1J7N A;  3WV2 A;  2A8H A;  1OM8 A;  5D1T A;  2K9C A;  1BKC E;  830C A;  3OHL A;  4DV8 A;  2X3A A;  1SLM A;  2JNP A;  4PKQ A;  3O64 A;  3UVC A;  1KBC A;  1I73 A;  3F18 A;  3F15 A;  3O2X A;  1IAD A;  1FBL A;  4WKE A;  3AYU A;  3NX7 A;  4PKV A;  3WV1 A;  1A85 A;  1Y8J A;  4XBH A;  3N2U A;  1D8M A;  4HX3 A;  1XUD A;  2MZH A;  4XM7 A;  1JH1 A;  3KRY A;  1CGF A;  3VI1 A;  2RJQ A;  4AIG A;  1GO8 P;  1ROS A;  1AST A;  1OS2 A;  1Q3A A;  4H2E A;  1UTT A;  1CK7 A;  5B5P A;  2DW0 A;  3DWB A;  4L7A A;  4GWM A;  5JMY A;  4A7B A;  1FM1 A;  1JAQ A;  3ELM A;  1QJI A;  1CGE A;  3F19 A;  4J4M A;  4EFS A;  3E8R A;  1L6J A;  4G0D A;  1YP1 A;  2W13 A;  4JP4 A;  5D2B A;  1MMR A;  4WK7 A;  5BPA A;  3TS4 A;  1JJ9 A;  2FV5 A;  5I3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...