3EMOA

Crystal structure of transmembrane hia 973-1098
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
VVIDNVANGDISATSTDAINGSQLYAVAKGVTNLAGQVNNLEGKVNKVGKRADAGTASALAASQLPQATMPGKSMVAIAGSSYQGQNGLAIGVSRISDNGKVIIRLSGTTNSQGKTGVAAGVGYQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hia (Adhesin)
publication title Repetitive Architecture of the Haemophilus influenzae Hia Trimeric Autotransporter
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Membrane protein/cell adhesion
total genus 33
structure length 126
sequence length 126
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03895 YadA_anchor YadA-like membrane anchor domain
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.30 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 GSPII I/J protein-like 3emoA00
3CI0K 2RETA 2GR7A 2LMEA 2GR8A 5BW0B 3EMOA 3CI0I 3CFIA
chains in the Genus database with same CATH superfamily
5HG0A 4DE5A 2G3DA 4EF6A 4MUJA 1N2HA 2IECA 3IODA 4MUFA 2GW4A 1N2OA 1IHOA 2A7XA 2A53A 2X3FA 2LMEA 3UA0A 3UK2A 3AG6A 5G2FA 1N2GA 2G16A 4MUEA 4DDHA 2A88A 1N2BA 3INNA 3EMOA 3CFAL 3IOBA 3IVGA 5KWVA 3ISJA 4MUGA 4MULA 3IMEA 2A56A 3IUBA 1N2EA 3LF4A 3MXTA 3IUEA 4DDKA 1N2JA 3Q10A 4MQ6A 4DDMA 4MUNA 2A84A 3IOEA 3LE8A 2RETA 3COWA 3IVXA 3IVCA 2G2SA 3CFIA 1N2IA 4G5YA 3UY4A 4EFKA 3IOCA 3Q12A 3COVA 2A52A 4MUHA 3QTTA 2OGFA 3N8HA 2A86A 5EXCA 3CI0I 3CI0K 3COYA 3HL6A 4FZJA 4MUKA 2A54A 3AG5A 2EJCA 2G5ZA 4BHRA 4MUIA 3CFFL 3COZA 3MUEA 2GR7A 2GR8A 1UFVA 3CFHL 2I52A 1V8FA 3IMGA 4IXJA 5BW0B 2A50A 4G5FA 3IMCA 1MOPA
chains in the Genus database with same CATH topology
3CI0K 2RETA 2GR7A 2LMEA 2GR8A 5BW0B 3EMOA 3CI0I 3CFIA 3CI0J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CI0 K;  2RET A;  2GR7 A;  2LME A;  2GR8 A;  5BW0 B;  3EMO A;  3CI0 I;  3CFI A; 
#chains in the Genus database with same CATH topology
 5HG0 A;  4DE5 A;  2G3D A;  4EF6 A;  4MUJ A;  1N2H A;  2IEC A;  3IOD A;  4MUF A;  2GW4 A;  1N2O A;  1IHO A;  2A7X A;  2A53 A;  2X3F A;  2LME A;  3UA0 A;  3UK2 A;  3AG6 A;  5G2F A;  1N2G A;  2G16 A;  4MUE A;  4DDH A;  2A88 A;  1N2B A;  3INN A;  3EMO A;  3CFA L;  3IOB A;  3IVG A;  5KWV A;  3ISJ A;  4MUG A;  4MUL A;  3IME A;  2A56 A;  3IUB A;  1N2E A;  3LF4 A;  3MXT A;  3IUE A;  4DDK A;  1N2J A;  3Q10 A;  4MQ6 A;  4DDM A;  4MUN A;  2A84 A;  3IOE A;  3LE8 A;  2RET A;  3COW A;  3IVX A;  3IVC A;  2G2S A;  3CFI A;  1N2I A;  4G5Y A;  3UY4 A;  4EFK A;  3IOC A;  3Q12 A;  3COV A;  2A52 A;  4MUH A;  3QTT A;  2OGF A;  3N8H A;  2A86 A;  5EXC A;  3CI0 I;  3CI0 K;  3COY A;  3HL6 A;  4FZJ A;  4MUK A;  2A54 A;  3AG5 A;  2EJC A;  2G5Z A;  4BHR A;  4MUI A;  3CFF L;  3COZ A;  3MUE A;  2GR7 A;  2GR8 A;  1UFV A;  3CFH L;  2I52 A;  1V8F A;  3IMG A;  4IXJ A;  5BW0 B;  2A50 A;  4G5F A;  3IMC A;  1MOP A; 
#chains in the Genus database with same CATH homology
 3CI0 K;  2RET A;  2GR7 A;  2LME A;  2GR8 A;  5BW0 B;  3EMO A;  3CI0 I;  3CFI A;  3CI0 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...