3EMTA

Crystal structure of the mimivirus ndk +kpn-r107g double mutant complexed with dgdp
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
QRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 39
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3emtA00
1HLWA 2B8QA 4UOFA 2HVDA 1NDCA 1EHWA 4S0MA 1NB2A 1F3FA 1NCLA 3GPAA 3EMTA 3ZTQA 1JXVA 4O0NA 3VGUA 3ZTSA 4C6AA 1S59A 3B6BA 2BX6A 1S5ZA 4FKYA 1NSKL 2DXEA 1BUXA 3BH7B 3FBBA 1VYAA 4ANEA 4UOGA 2DXFA 1WKJA 3FBFA 3Q86A 1WKKA 1BHNA 3MPDA 1MN7A 4ANDA 2NCKL 3VVTA 3ZTRA 3BBBA 1NDLA 3FBEA 3VGVA 3Q89A 3FC9A 3PRVA 3NGUA 4W98A 3WX8A 2VU5A 4UOHA 4DI6A 3Q8YA 3EE3A 1KDNA 3ELHA 3B54A 3EICA 3JS9A 5CAAA 5C7PA 3FKBA 3GP9A 4FKXA 4HR2A 2BEFA 1NDPA 3VGSA 3Q83A 3ENAA 1NDKA 1LEOA 3FCWA 3R9LA 5BXIA 3ZTPA 1B99A 1UCNA 4ANCA 1K44A 1W7WA 3EJMA 1NUEA 4CP5A 1S57A 1WKLA 4WBFA 3G2XA 1NPKA 2B8PA 1BE4A 2DY9A 1B4SA 4EK2A 2DYAA 3VGTA 1ZS6A 3EM1A 1NSQA 5CABA 3BBFA 3NGTA 3ETMA 3NGRA 1LWXA 3DDIA 3PJ9A 4DUTA 2AZ1A 1PAEX 2DXDA 2HVEA 3Q8VA 2AZ3A 3FBCA 1HIYA 3EVOA 3Q8UA 4DZ6A 1F6TA 3ZTOA 3BBCA 1PKUA 2ZUAA 4ENOA 3EVWA 1XQIA 5IOLA 3BH6B 1U8WA 3L7UA 3EVMA 4KPCA 3VVUA 1HHQA 3DKDA 3FCVA 4F36A 1NLKL 2CWKA 2HURA 1MN9A 3NGSA 1XIQA 1NHKL 1NSPA 4F4AA
chains in the Genus database with same CATH superfamily
5HP1B 4L74A 2H5JB 3IS9B 2KXNB 2R8KA 2ZBRA 3TEHB 3M4XA 2CG4A 4FVMA 3RW6A 5ETPA 1TK0A 2FJEB 2FQQB 1CJVB 3MCMA 4IFYB 4AQYF 5H9EK 4X4NA 1SCJB 2U2FA 1QE1A 1TL1A 2W2NP 3I55S 3AD8C 2DO0A 1S9FA 2CNNB 1GXUA 3EGZA 2W8LA 2HNDA 2IM0A 4LRAA 3KK3A 2HRTA 3QZ8A 3C15A 4ZJQA 4LJMA 1S12A 2OFGX 1FNXH 2E9RX 4ED7A 5EX3A 1QUPA 4NA2A 1FDNA 2OPPA 2PA8D 2RVJA 4ITSA 3UD4P 3AXMA 1GEHA 3I0SA 3BN7A 3CC4S 2CWXA 1KR4A 3MPVA 3DU6A 4C8KA 2YKMA 1KLMB 1D3WA 4I56A 3DLJA 4WTOB 1RCXB 1OS5A 2RSQA 4CLFA 1TL3A 1VGYA 2WZ1A 4E8UA 2JLEA 2QGFB 1FNMA 3PFOA 3W66A 2CQHA 2YNGB 4RW4A 4ZS6A 3DRPB 3PX6A 3RBEA 3CW2C 3EPIA 1Q78A 5D0GA 3HSZA 1U0HA 2GCFA 3CB4A 3HKWA 2HZAA 2D9OA 4AE5A 2D69A 4ZP6A 1SUQB 2V69A 5J1EB 5DJBA 4EYHB 1BLUA 3LP2A 1CEZA 3TZZA 4LF5J 3K8VA 3KMQA 3PNIA 5F9NA 3V81B 3G8SA 1IBLJ 5B09A 3BDPA 3CNQP 1RSCA 1SH2A 1NXIA 1HNXJ 1YJ7A 4P74A 3UWTA 4GKJF 1EKRA 5AE1A 4C3KA 4Q8FA 1IKYA 2J5AA 5HVGA 1XMBA 3F0NA 1ZPWX 5T14A 1VQ7S 6AT1B 1SIWB 1WSRA 2AP6A 4K5RA 4RW8A 2E5LF 4LF9J 1XN9A 3MTKA 3UDLA 1GQEA 3L7PA 1N52B 4CLSA 4Y3CA 5LMUJ 4R0EA 4XK8C 2OPSB 2IAJB 2O01C 2PEHA 3IBWA 3CCQS 2R7TA 4NLGA 2GJFA 3PCOB 2IDLA 2RQ4A 2R8JA 2AEJA 3CTRA 2I9SA 2ZM6F 4QYRA 2JEFA 3N6NA 2QSFA 3OFGA 4F4ZA 1Y0HA 4G65A 3MEGA 1WOOA 1RT1B 3VAGA 1TZ0A 2XYPB 2W7OA 4DV2F 2DCUB 2XMTA 3SCIE 2BQ3A 4IH5A 4B9SA 3T41A 3KG1A 2W7AA 3GSDA 2HQ3A 1ZOTA 3Q8QB 5B0EA 2RF2A 2WBRA 3NCRA 2VICA 3GFZA 5ETTA 3ZZRA 5ETQA 5LXYA 1S1TA 3H4BA 3SQGB 3HFVA 3QLHB 4XPEA 5JVGQ 1CPZA 4UTGA 3I6PA 4WFNQ 2V4JA 5EWFA 4Q7AA 3B78A 4QW8A 3ZZOA 3BQ0A 2GVZB 1Q1KA 2Q43A 3MD1A 3QGGA 2H54B 4DF8A 4HVZA 5H9EJ 1T05A 1HHTP 2ADCA 2VG6A 3TA1A 2PD1A 3JSBA 3ICLA 2MZQA 4EO6A 2SXLA 3HD1A 3DRRA 3WIUA 2W24A 2EFPA 2XO6A 3EZUA 4IOAQ 3TARA 4JI7F 2DNRA 2RHSB 3GLJA 2FTRA 3M8PB 1VK3A 2RF2B 3JTNA 4D3GA 1UA0A 4M5JA 4BC9A 2ATLA 1BQNB 1XMOJ 3OVSA 1FHTA 1SH3A 2HFVA 2W7PA 1CULB 1TUWA 2DNHA 3MEKA 2H51B 2MJNA 5M2UA 3TA2A 4S0MA 8ATCB 1KSPA 4ELUA 3MAAA 3QIDA 4V19X 2B4OA 2BW2A 1OIAA 2WVEA 3GPAA 3TO8A 4DZDA 4LQ9A 1T7PA 3EXCX 5K8MA 3P96A 3K5LA 3RB3A 1F3VA 1E6YA 3B6BA 5BYRA 3UW1A 3VAFA 4NLTA 4NWBA 4QIGA 4DV4F 2BJ7A 2OPSA 4MKAA 1VC6A 2V67A 2CQDA 4LIRA 3CMQA 4ANEA 1GFWB 1WC1A 4OI0A 2Z0GA 4FNIA 3CEDA 4ZPBA 4DL3A 1UVLA 4IOBA 3GV8B 4IQXA 2M7SA 4ANDA 1CBKA 1S4EA 2VFVA 1NDLA 2E7WA 2MSTA 3KLEB 3H90A 3I82A 1FJ7A 1MSWD 1SC6A 3A3OB 3OXLA 4IKAA 3PW4A 3RYLA 4OHYA 2G2OA 4DR4F 4F3QA 4I67A 1X9WA 3G6YA 4RWWA 4LR9A 4DL7A 2DNKA 5HVHA 5KFOA 3TRGA 3QRPA 5H1SV 3RB4A 4QW9A 5FJ4A 3TJ9A 3B54A 2PN6A 3CCWA 1WC6A 3H25A 1IBMJ 2XY7A 1FKOA 1ZA2B 3DRSB 5LSOA 2E1MC 4FXVA 3GIJA 1K73T 2X1FA 4OI1A 2JSXA 2DH7A 4M1KA 4NZ6A 4OI2A 2CQ4A 4H4OA 3GIKA 4DV4J 3WC0A 4Z37A 2HQCA 4CWBA 4J37A 4KFBA 1JLBB 1TL4A 2BJ1A 3GJSB 4DLGA 1R7IA 4YB1P 5CCLA 2BR0A 2DIVA 4Y2KA 1NUEA 2QX0A 2W2MP 2XTJP 3MEDA 4CP5A 3W2WA 3M2RB 1JNRB 1VIXA 3DGPA 4QIFA 3FFIB 1NK0A 2J9DE 5KFMA 3QATA 2RQCA 2DYAA 1WC5A 3VGTA 1RKJA 1S1VA 2UXBF 3PX4A 1VBYA 2BJDA 2R7SA 3S8SA 2HHSA 2FVCA 2HNZB 4WU2A 3H8YA 1WF2A 1RT7B 3O5TB 4FVCA 1FRJA 3MURP 2QA2A 3P45B 4KH1B 2G13A 5LSRA 4X4TA 1IR1A 4AUKA 2KU7A 5C42B 4LF4J 3NNHA 3ENQA 1KN6A 3H2VE 3JYTA 4QR0A 1IBMF 3I0RA 2G1HA 2YX4A 2HLUA 4IFYA 3B4DA 1K0TA 3DOMA 3ILIA 3ZZ0A 3NAIA 4NI2B 2OPRA 1WTFA 3OW2R 2XHWA 2LYVA 4WK3A 1Y4ZB 3EZOA 3GFYA 3IS9A 4YB6A 2DTJA 4TQSA 4DV5J 1U02A 2DIUA 2EKNA 1U7LA 3IFEA 1Z2ZA 3WX4A 1IKVA 1HPZA 3J81U 2PI4A 4TY9A 2W9BA 2VB6A 2AEMA 2F7VA 3D4JA 4X65J 1H7XA 3I5AA 1XQIA 3M30B 2JC1A 1SXLA 4KIAA 5F8MA 4RNMA 5HANA 4B9NA 2WW4A 5IQ6A 4J91A 3CC7S 2ASYA 3VQTA 4MKYA 2R2TA 5EUHA 2BE2B 2GIQA 1J5EF 2OH2A 2VFTA 2FHOB 3VR1A 1WHXA 2ALZA 1N48A 1S0OA 2XLJA 2HKEA 2LU1A 2J7KA 4RKUC 3BDEA 2BKPA 2KKHA 5L46A 1M0SA 3GQCA 3UCUP 2N7CA 3UNGC 2IC3B 4DR7F 1TAQA 2IM1A 2LP4A 4ZVEA 1RA6A 4P10A 3CC2S 4KHPF 1AT1B 4KJIA 2VH7A 4N5SA 3NMAA 1X7VA 2GV1A 2HRYA 1AUDA 2ZZMA 2C2MB 3MEDB 2R2UA 5G4DA 3PYDA 4CLTA 3CMES 3RG6A 1DTTA 2WVDA 2OEMA 1U2FA 2EXUA 4PXBA 3G71S 3OLAA 3AODA 1VQMS 2GNKA 2J8AA 2FLOA 2W2OP 1H98A 1HNWF 2K2PA 3BO2A 3D3BJ 2DGUA 5F8NA 5AE2A 1MROA 3MGJA 4K4XA 1QTMA 2PO4A 4R5PA 4QPTA 4NXNF 2J6SA 3EDQB 2FYXA 4K4VA 3KJQB 1YI2S 2MSSA 3JSYA 2ZVSA 4Q2MA 4KRWA 4EWTA 3SYZA 2IVFB 2AQ4A 1SH0A 3D67A 4K7QA 4F2RA 1VISA 2IMWP 3G8TA 2QLFB 5DDPC 2IJFA 1X4HA 4HHUA 5DDQC 3IWLA 3TX0A 4ES1A 1CJUB 5B0AA 2QL9B 1XK8A 1TKXB 1CSJA 2HVIA 4KHPJ 5M2PA 3FBEA 2QLBB 3A8KA 2A10A 1F2GA 3QBCA 2RQKA 4KGVB 4JV2A 4N76A 2MXYA 1S0VA 2D3OR 2NPIA 4X64J 2YTCA 3MMAA 3BSOA 1UVNA 3Q2TC 3MAQA 4DL2A 1T03B 1OWXA 1O6XA 1IR2A 2FB0A 2G4BA 2HHVA 3MR3A 3QT8A 3JQJA 1XEZA 1RWPB 4X4PA 2GC8A 1U1QA 3HVWA 2OI2A 1DTQA 2BJ8A 1E6YB 4QR2A 2XMWA 1NDPA 4CT9A 2CQ0A 4QWAA 2FJVA 4ZJOA 4DV1J 1FT8A 1VOMA 3I96A 2KYXA 5KFLA 3R1LA 2PMHA 4F02A 2XMUA 4ECTA 3IA0A 3FCWA 2FLLA 2N4DA 5CZXA 3K0JA 1RE1B 5DO2A 2QZ8A 1T9XA 3IBFB 1QD1A 3W9HA 4A47A 2J6UA 1EIYB 5T41A 1N32F 1WDTA 3N5FA 4QWCA 4JI4F 4J9VA 3VF0B 4EGLA 5ETNA 2YY3A 3M8PA 3MFHA 5HLFB 4RL1A 1KRPA 4NXMJ 4TLQA 2I5JB 3AB2B 5KAKA 4M94A 3EM1A 1I1GA 2GW8A 2HQDA 4GVBB 2F4VF 4NLDA 4YR3A 2KHDA 3NGTA 3W61A 3TQEA 4X4RA 1FRXA 2E5GA 2VG6B 3KLIB 1UW4A 1ZBTA 2PI5A 3GR0A 1UAWA 5DLFA 1PILA 2CQ1A 2GVZA 4TN2A 3V2UC 4DMZA 4M5MA 8AT1B 1KP6A 2L9NA 3MM7A 3RRGA 2H5IB 3P6YC 1N33J 3L4BC 5KG3A 2AHOB 1EETB 2E44A 3Q8VA 3TEGA 4EFAC 2JHEA 5DETA 3G6XA 2IRUA 1RLCL 2JNJA 1N5TA 1ICEB 1U2CA 2DCLA 2AJ4A 4C3LA 3K59A 2CADA 1TFWA 4Z2XA 1WG1A 4RNNA 2AX0A 3UFCX 4ZDNA 1DRZA 1ZAVA 5AJ3J 3FUYA 1OPZA 1D8YA 3H7HB 1WC4A 3MM6B 2GHWA 2ZUAA 1MMDA 3N0VA 3C14A 2YQ1A 3QPIA 4DFJA 5BJRA 2DNZA 5I3QA 1RADB 2HVHA 2GMHA 2RS8A 5FDLA 3UI3A 1K1QA 1H73A 2L08A 4KT0C 4L75A 4WFAQ 4ED6A 1TTHB 4UF4A 5HLFA 1RAAB 3TVKA 2WW8A 5L9NA 1CVJA 3DKDA 1Q8BA 1FTRA 2KVIA 3AJDA 1I94J 4JI5J 2C2EA 1VQ9S 4TQRA 2VJVA 1UPMB 3ILJA 2VDHA 3OBIA 5K5MA 4EYIB 4ED8A 4NEYA 4DWIA 1NH7A 2R4FA 3G82B 4K0KJ 4GKKF 3EUNA 1Y00A 4DCJB 4PPDA 3MI7X 1HBNB 1YJRA 2NQPA 3DLEA 3BGLA 1MWYA 2OAUA 1X5PA 3SIPB 1HLWA 2QV6A 3BPDA 3C16B 1TKTA 3SCKE 4NXMF 1S1WA 5KOXA 1R8HA 1TELA 4DXLA 3P49B 2Z57B 2UXCJ 1YRXA 2HFUA 3I9V9 3O1LA 5E5NA 5HAOA 1M5VC 1DQAA 3MMJA 3RAMA 2RMLA 1JX4A 2IYGA 1T03A 1S0NA 4HT5A 2AYBA 1J5OA 3LPEA 3UVJA 2IPOB 1LK5A 2MZRA 3JQKA 1XTZA 1DHMA 1T0TV 2CQBA 3CVKA 2JJ4D 3IAS9 2GGPB 2XHCA 4ZP7A 3IG1A 5IFMA 4L6V3 1TKXA 2BX6A 3GV5B 3FSYA 5ETKA 3FRZA 3M6WA 4C0HA 1L3UA 4DDFA 2NYHA 2OEKA 3CJ3A 2Y3YA 4ID5B 1IM6A 1Q53A 2V8DA 4MIWA 2XG8A 4W4MA 3EGNA 2DNMA 2PT0A 2YNGA 4ECWA 1PO6A 1S6QB 1DLOB 4OLPA 5KFZA 3KLFB 1DY3A 1ZM3A 2I0XA 4NEZA 2Y0BB 2CZVC 1U6BA 5KFEA 3BBBA 4IYQA 3PR5B 2HRUA 2OD4A 3VGVA 5I3UA 3Q24A 3ZNJ1 3M7VA 2G0IA 2GZOA 3PRVA 4O23A 4KV8A 1H7WA 4NE9C 4EMDA 3MHYA 3JSMA 4YR2A 2HNYB 3GIRA 3LAKA 3MM5B 4DQQA 2HPUA 4TNOA 1BQMA 1X4EA 4C11A 2B4UA 1IKWB 2BE9B 3EE3A 1F9HA 3O44A 4KV8B 4F04B 1IR0A 2DEJA 5K8PA 2HS3A 9RUBA 3KK2A 4A8YA 2RDDA 1OPIA 5I3UB 2BRLA 3CJTA 4DQRA 2KFZA 4DQIA 5HSPA 2PDAA 3KLFA 3PKYA 1LEOA 2O5DA 3FQLA 2HWHA 2HFZA 4KGZB 1C2PA 4CQ1A 4LF1A 1S6QA 2DRAA 2MLZA 3R5DA 4TU8A 4X66F 4OYWA 2GQCA 4IH6A 1WEXA 4JI3F 5A8WA 5ETSA 3UQSA 2BE2A 1PBAA 4XDCA 2BA9A 3SSSA 5KFPA 2OD6A 3J7A1 4PQUB 4KKOB 4AD6A 4Q0BA 3MAHA 1FX2A 2PC6A 3T9NA 1NAQA 1KONA 2LKZA 4PXCA 5CABA 2YQ0A 3NY0A 4UZCA 3QYYA 3UVJB 2W9BB 1OMSA 2LDIA 3OFFA 2GQ2A 1T9UA 2DNPA 4FYVB 3K58A 2VHGA 1R0AA 4RW7B 1JMTA 2LEAA 3PYEA 5BYSA 1RACB 4O0IA 4DOZA 2VOPA 4AXIA 2XC9A 1RT5A 5D4OA 1RHKB 2I38A 5D4LA 4Q2LA 5KFGA 1VQPS 1XJWB 1IBCB 1WUUA 2HVEA 3MCSA 2FZGB 3BEGB 4BCAA 2DRDA 2ROGA 1UJ6A 4P2XA 3US5A 5A8RA 4CM2A 1S6OA 3DLGB 5AE3A 2XMVA 3AFGA 5L1LA 1XNRF 3RAXA 3QRQA 1HI8A 2X1BA 5C42A 4B3RJ 3M8RA 1F0XA 3RR7A 1SKRA 4ZCIA 1Y3JA 4I7FA 1RYRA 2FJWA 1NK4A 4ELTA 1UJ5A 3N28A 3KKFA 3OVAA 5RUBA 5IM0B 3VZHA 2QA4G 1VQOS 2HNZA 3MM8A 5J2QB 2J0WA 1JXLA 2HBRB 3EVWA 3RBZA 2GS8A 4H4MB 1LWEA 2XZDB 3TQ1A 1SV5A 1FEHA 4C8LA 2CPXA 5CQGA 1U8WA 2DR6A 3FJ2A 3H5XA 2XMAA 3GMGA 4O44B 5C2CA 2JRSA 4FXDA 1XNQF 4DR2J 3KMSA 1VQKS 1ROFA 2W4DA 2Z4PA 3M32A 4X4VA 1U8SA 2B9EA 3TZWA 3TAPA 3KJVB 3T1HF 4Q43A 4ZPVR 3QFWA 1U2RA 3GYXB 4C98A 4LF4F 2CZ9A 4ZPWR 3GJQB 1EQ0A 3WQPA 5D4PA 2J9CA 2Z58B 4JI3J 4LF8J 4RZRA 2P9CA 1EETA 4NMLA 2P9GA 3F73A 3KNGA 2I2YA 1OSCA 3S6EA 2HG4A 2DH8A 5D6GA 1C1BA 2POKA 4WK1A 3R5JB 1S7IA 3AJ2A 2J9DA 2XS2A 3CWJA 3D66A 2WVCA 4ECQA 1YBAA 2OTJS 3BF4A 4DS4A 4ZP9A 5IT9U 5I3PA 2A2DA 4OFZA 2ZBPA 4GVBA 3GFHA 4OZ3A 3EWGA 4B3OB 3HHLA 4ZCKA 3MEEA 5HROB 2XM3A 1QDUB 4NYZA 1S59A 4C0OC 2B56A 1HBMA 2PMZD 3J7YI 1HMVA 4LFBF 2UV8A 3QGHA 3W63A 3K5OA 3M9OB 1BUXA 2CJ9A 3B4MA 1CC8A 1VYAA 2F3JA 1LW2A 3CCVS 4UOGA 2DR5A 3TAQA 2BBEA 1WKJA 2R8GA 2NSBA 2CZ4A 5K8NA 3DI6A 3FBFA 1Q4RA 4CRJA 1RABB 5CYQA 1C4CA 5LXRA 1FK9B 4DQSA 1F5AA 4ZVHA 2QA1A 4JUZA 2M2BA 1TL7A 3IO1A 3AY0A 2HFSA 1G4CA 2YXLA 3T6BA 1PCAA 4KO0A 3Q89A 1S9EB 5E33A 1KFSA 3AD9C 1R89A 4XIUA 2MKJA 4LFAF 2KZZA 2HLTA 3WX8A 1I51B 4NZ7A 5B0DA 5SUHA 3G96A 1M5KC 4IO1A 1LWCB 2CPIA 3UO0A 2YKOA 1HKAA 1KWMA 1XC9A 2ASJA 2YNHB 3K89A 2KT3A 3EICA 2ROEA 1EJ7L 4CT8A 5L9XA 4UQTA 3RB6A 1Q86T 1X4FA 3VGSA 3G8QA 4RJVA 4UUXA 3C3LA 3QRRA 3FEZA 2UUWA 1HNVB 4FDFA 1RWMB 2YKQA 3DRRB 5KT5A 3QJLA 2IJRA 1REVB 1N88A 2QSWA 1RWKB 5KFWA 1RHUB 3SMZA 3U1LA 1YZ6A 1LFWA 4QOTA 4UZBA 1N4LA 3C6UB 2VC1A 4CM0A 5D15A 1NPKA 4ICLA 5KFQA 2UUAF 2K7JA 4WFXA 4CLUA 3CJ8A 3KHHA 1YWXA 2ADBA 3NCQA 4PXEA 4ZPAA 4CO1A 1S1TB 1VR6A 4ZIVA 1C1CA 2BANA 4DV0F 3TW0A 1WF1A 5IV4A 4CDIA 1V5VA 2X7IA 3ETMA 1N0UA 1KD1T 5L39A 2F63A 1VRUB 2F8MA 2LXIA 3GYNA 3FDSA 3IP0A 4PYDA 4QYZJ 1X4GA 2RJZA 4DUTA 3E8OA 1RWVB 2FVSA 4P6QA 2RUSA 1S1XA 5HI7A 3LGHA 5KFVA 1P9QC 2MLXA 4LSLB 5DDOC 3KDNA 4P75A 1N5VA 2RD5C 1FWLA 3MEGB 4NPOA 2AZ3A 4X4QA 2W01A 2XGQA 3KXDA 3MECA 4L76A 5IV3A 4EBCA 1QLNA 5F9LA 1MU2B 4ES3A 3M2UA 4RW6B 5LL6d 2OJ3A 5HQMA 1YRTA 2IAJA 3CJQA 2ZDOA 3K7RA 4P2MA 2LEBA 1N5YA 4OMFG 3M6VA 3QWPA 2AJ2A 2KXFA 2LQ5A 3IM8A 4DCOB 2CPEA 2AWZA 3CD7A 1NK9A 2FHJA 2G0JA 2VUGA 3QFHA 1AW0A 2GHVC 3OR2B 4XAKA 4YB7A 2ZJPQ 1HWLA 4WZQA 2F4VJ 4HACA 2DHGA 1HHQA 1RXOB 2IIHA 3FCVA 4WU3A 2AGPA 3IWXA 4LUBA 4X4OA 2CG8A 2B6AB 4KR0B 1HNIB 1YX2A 3GTYX 1UVMA 3V4IA 4L3NA 3T6JA 1SJ4P 4PUOB 5J1NA 4K2XA 2VQFJ 3M8QB 5DM7Q 5B7WA 2VA3A 2HW3A 1ZYQA 3V6HA 3HKZD 2N3LA 2RRAA 4JI0J 2NLWA 2MKIA 3HVRA 3P5BP 4A4JA 2YX7A 1SQFA 4RBUA 1S79A 5KFJA 4DV6J 3AAWB 3D6TB 2FLNA 4F4WA 5A8KA 2JL9A 3BM7A 1S9GB 4M5NA 2K7KA 1SKWA 1XMQF 2JOQA 4B3MF 2BQRA 2XCPA 3ISZA 2GIRA 2MDAA 3TJAA 4F4KA 5C5JA 3CPWR 2D3ZA 3VGUA 3QIPA 4IH7A 2HHHJ 2VFRA 5KG4A 1J27A 3HHEA 4BS2A 1IBKJ 2XO7A 3SEOA 4ED4A 1L3SA 1DARA 2CAJA 2E1RA 2ZITA 4USKA 4DN0A 4YUDA 5F8GA 3THVA 3CDBA 3P8BB 1Z2LA 1NPRA 2QE5A 3OXGA 5T7LA 2BM1A 4IOCQ 3DRXA 5GAGU 1C0TA 5KFSA 1TU0B 2VFUA 3A12A 1BHNA 3H5UA 1X4BA 3GSIA 3LPYA 1S9GA 3HZGA 3NP5A 1XNRJ 2A6OA 1VRQC 3HJVA 1FKOB 3DRSA 4NLUA 5JXSA 4CH0S 4CTAB 4YHHJ 4EBDA 2N4CA 3D0GE 1FNOA 3B82A 1EB0A 1RCOB 2RT3A 2RKIA 3FZBA 2E66A 4FYXB 4XTTA 2VC0A 4ZVTB 4K4WA 1G6BA 4FYWB 1S49A 4ECYA 4ZN1A 3EZ5A 3GG0A 5E3RA 4J9QA 4ED1A 4LF6F 2ZH9A 1VQSA 2KJWA 1TQLA 3MDFA 3I32A 3TX8A 2E7VA 4OYIA 4PG4A 4ZA1A 2HHHF 2HQGA 2B6AA 3DMJA 1RT4A 4AL5A 5GAEI 2IY5B 1WTBA 2AX1A 3VAMA 2MQMA 3SCJE 4P7TA 2BM0A 1V9OA 3MXHP 1B70B 2DGWA 5L8RC 4H4KA 3Q8SB 4U6PA 1JJ2R 1K8AT 1NU4A 1RWXB 3CCUS 4CLKA 5GMDA 5ITHA 1W7WA 3NRBA 4XO0A 4J7CA 3DLHA 3BSCA 2V9KA 4DCPB 3IRWP 3NKYA 2JDJA 3NCPA 3RZAA 2CQGA 3MM9A 3GV7B 5E3QA 3THPA 4OL8A 2HFNA 1RT4B 5IC6B 1YK9A 1LW0B 1XBWA 4X84A 4EU0A 3CF5Q 2B9YA 3DDIA 1JLFA 4FYYB 2BJ3A 3PJ9A 4MT1A 4XDDA 2NPFA 1VQ8S 2JEIA 2DBBA 3VV2B 1WC3A 2KRRA 4LREA 1U1MA 4LFBJ 2KO1A 3DC2A 4NYOA 1VQLS 1FJCA 4DV7F 1SJ3P 4A8MP 2WRMA 3FBCA 1MWQA 4NLSA 4CZCA 5CD4A 5BYQA 1VBZA 3NL0A 2F8EX 4PAAA 3HM9A 1H2TZ 2HWTA 5J2MB 5DG7A 4CO3A 3TOQA 1S0MA 1YG0A 2RQMA 5A2QU 1X8DA 3MF5A 4LSNB 3IMQJ 4OQJA 1CQMA 2V4JB 1SJFA 3HCXA 2X3DA 1H0HB 5FLXY 3CCLS 2J0SD 2ZWOA 3BH6B 3OTOF 1KQSR 3QLHA 3SQGA 3R7NB 2E9TA 1A6LA 4LFAJ 2H9ZA 3OVBA 5EDWA 2LVWA 3X3UA 3T5HA 1S97A 1HYSB 4OYMA 2AU0A 2BYCA 2EI5A 2H1YA 1FI4A 4DR3J 3FK4A 4TVAB 5G0RB 3PIOQ 3RBDA 4USIA 4K4UA 3M1VA 4OZ1A 2C3UA 2QL5B 3DYAB 3I56S 5EX0A 4NLPA 3GILA 1WNEA 2E5HA 3R5AA 5DDRC 1S6PB 1PIEA 3D1HA 4WPAA 4B9LA 1KOOA 1A7GE 4X62F 2CQPA 1S9EA 5B0CA 3AA8A 2GJIA 2XWXA 2PGCA 4KGMA 3JQMA 4O4GA 1TL5A 1JLGA 4CO0A 4CLPA 2DH9A 4CLWA 3CIZA 1X60A 1NO8A 1KFDA 2XZWA 4J9NA 1HW9A 4ILRA 4J5OA 3SQOP 1RU1A 1FEEA 2OPQB 2VD3A 4GO5X 2WSFC 3QZ7A 3MR2A 1L3TA 4LMZA 4V19J 3HSDA 1L3VA 4HACB 1U24A 5F3TA 1UFKA 4ZHRB 4EZ9A 4F2SA 1AROP 1IQTA 1NKBA 1SQGA 3JSRA 1XERA 1HBMB 2QT7A 3R3TA 4J9LA 2DT9A 2FLPA 3V4MA 1RT2A 5JUMA 2FHJD 2MQ8A 1ITPA 1NHUA 2ZE2A 3JXOA 4ER8A 2I6WA 1HBUB 3FVYA 2AJ1A 3J7YU 1YBTA 2AGOA 1UVIA 1UJ4A 2Z30B 1CS4B 2ABYA 2JVOA 1X31C 4O3SA 3OHBA 4LF9F 1RBOB 5D77A 4OYZA 1HQEA 3HXMA 3QNWB 4OJHA 4G1QB 4RPFA 4USWA 4Z7CA 1RBLA 3ZXWA 1UWBB 3M05A 2APOA 1U1PA 4JI2F 4QWEA 1S76D 4UOHA 3DRPA 2KVQE 1S1XB 5HBMB 1U49A 3DLBA 4JI8J 1S6UA 2MY8A 2Q1LA 1LXJA 1NJZA 1VRUA 4JI6F 1P27B 1YJVA 3G4SS 3BKUA 1NK8A 3DU5A 1UEUA 3FKBA 1G2EA 4RBVA 1N56A 2V34A 2RHQB 2V4QA 2ALYB 5KFAA 1IM4A 2QJ3A 2BW7A 1V3ZA 1HNZJ 3ENAA 2D74B 4JP8A 1U1NA 5MLCV 3KDOA 2EW9A 1JIHA 2HGNA 3O3LA 4PWWA 4IO9Q 5E3AA 4ATNA 4I6AA 2W9AA 4ICLB 4DFKA 4DFPA 3PIPQ 3GZ7A 3T5KA 2EG1A 2O67A 4H4MA 3C6UA 1UA1A 2P5VA 1N34F 2WVBA 3G86A 2F1FA 1NK7A 2HAIA 3W9JA 4JYAF 4Y2CA 1NBEB 1ZS6A 1SKUB 1TKZA 3R27A 1QE1B 1T9TA 1RAEB 1UEKA 2ZBIA 5FIIA 2Y8WA 3OSNA 1R31A 4O3OA 1OYEA 2HK2A 3RRKA 2DEIA 4MIBA 4HT7A 4CYUB 1FDBA 3VQSA 1RHMB 1WHWA 3GE9A 3IXQA 5KFUA 4IFVA 5KFCA 4KTQA 2J76E 4DUYJ 1E6VA 3SFGA 2ZOGA 3LGNA 2WONA 5DS7A 1JK9B 1XMOF 3KK1A 1QAYA 2P2CB 4N47A 3WHIA 2OSQA 4HTIA 1F6TA 4MK7A 2CQ3A 3ZTOA 4CLZA 4Q0BB 3W8PA 1BGXT 1Y10A 2BJ9A 1JLEB 3THTA 3W65A 3OL8A 4PQUA 2KL8A 2PE8A 1N34J 5GMEA 2OMLA 5ETRA 4ENOA 2GQQA 1KEKA 1XMQJ 1JWWA 1B3TA 2HBQB 2HQFA 4TYBA 3BO4A 4HDGA 4KYZA 4PR6A 2HS4A 4F25A 1HMVB 4FN5A 3BGUA 4KB7A 4MYUA 4U96A 2XI2A 4DSLA 2FVRA 2WOMB 4ECSA 1Y9OA 3H4DA 3EGVA 1RHJB 4EO8A 4LF5F 1FFGB 3CCJS 1HNZF 1HQUB 3N5BA 2MQQA 3I4HX 3MMCB 4NLQA 2QC3A 1QSSA 3KK2B 2WB4A 2DR8A 1RISA 4LF2A 1NSPA 3G6VA 2AGQA 3ITHA 1TAUA 4F4YA 2UUBF 1MW7A 4ZPDA 4ED2A 3NMRA 3HHKA 5DM6Q 5KG2A 2AIRB 1CLFA 3PACA 2MLYA 2ZD1B 5F8HA 3SSQA 1YITS 2RUGA 5KG6A 1OY6A 2XWYA 2YX1A 4DR4J 1PYOB 4IG0A 4DX8H 1IUJA 2UUCJ 4O3QA 3WIVA 5B0FA 4OX9J 2YPYA 3CDAA 3LGMA 1HA1A 1DLOA 4I69A 2YNFA 3MUVP 2FJBB 1JXVA 3JTPA 4ZOSA 3PW7A 3H20A 5JVHQ 1R43A 1HARA 3H59A 4TY8B 3ZO7A 4DPUA 4NYPA 1UPPA 2CNOB 1S5ZA 1X0PA 5HMZA 4W90B 2W4PA 4FKYA 2B3TB 3OTCA 1N36J 2GGPA 3BH7B 3VCDA 1T9YA 2ACMA 2BRKA 5J2NA 1K47A 1RTIA 4JB8B 4PPZA 3BQ1A 1RYSA 1QSLA 1CQNA 2H4WB 4MJKA 3W64A 3KLVA 4LRDA 4URGA 2OHDA 4C7QA 2WBMA 3C19A 5ADZA 3P5TL 4A8FA 2ZZTA 2YVSA 3MTJA 1Q16B 3D6MB 1CJTB 1RLDA 4OI4A 1KTVA 3E3XA 3A8JA 4GMKA 4RW9B 1FCAA 2GA7A 3PVXA 2KJVA 5FLXU 2YPZA 3CMAS 4X4UA 2IA6A 3SFUA 4DI6A 1UVJA 3Q8YA 4F8RA 3NBPB 3K57A 1YKWA 2CPDA 4DSFA 3ELHA 2AKWB 3HHLD 4USTA 4GVLA 2VG5A 2UVRA 3KG0A 3DN9A 1VQNS 4FKXA 1HWJA 2DHXA 4I2PB 2CJKA 5AXKA 5J2NB 3SDEA 1JLQB 1N8RT 2RS2A 2OTLS 4B9UA 2MZJA 1WF0A 2W25A 2Q6CA 1HFEL 4K8RA 1Z4UA 1DJ0A 2G2ZA 1WACA 3EDRB 1OYDA 5EWGA 4NCGB 1B99A 1EP4B 4OX6A 2VODA 4QCLA 5F41A 3LA0A 3CD5A 3ZZTA 1FXLA 3CDWA 2AJ0A 1P6TA 3DM2A 2LQJA 2NUUG 4X65F 5EN1A 1YHQS 2YNFB 3NS6A 1TV6A 4YY3J 4YMEA 5GADI 3PW0A 1QAIA 2C2DA 2IM3A 5KFTA 4DBQA 4N77A 4LT6A 2O1PA 4WYWA 1NSQA 3R8YA 2DPJA 1FERA 3BBFA 4WE1A 3TI0A 1J5EJ 3FCHA 2OP5A 1LQ9A 1JLAA 2IBOA 2LA4A 3TUIC 1S1UB 4F7VA 4ECVA 3CCTA 4C11B 2RDIA 3ITHB 3LH2S 1AZSB 5ETVA 3KLIA 3JSMB 1RQ0A 4OZ5A 1RTDA 2OFHX 4QYZK 1HQUA 4KGKA 2V2QA 3AQOA 2M8HA 3HHLC 3OV7A 4R0JA 2B4PA 3D7SB 5E7OB 4LRCA 2V50A 3U27A 2WOMA 3BO3A 4AL6A 1F60B 3D0IE 3E01A 2G1DA 1K9MT 4LFCJ 1F5BA 1RAIB 2F9JA 1M5SA 1D9AA 5B08A 5HMXA 3MUMP 1IJEB 2ZNZA 4OJ1A 4N41A 1HWIA 4I64A 4DR1F 2BQUA 1WOPA 3HT0A 2UU9F 5HK4A 2IRYA 3AQPA 1FF2A 2BMBA 1EAYC 2RU3A 1WG5A 2JH3A 2H48B 1PYSB 3F44A 1F1BB 3GG1A 2Z2MA 1NLKL 3GONA 4J9UE 5HVFA 2FC9A 3KK1B 4JI6J 3GWCA 1KQFB 2ZOMA 1JB0C 1R0CB 2H4YB 2KYZA 3CDUA 3I87A 1P9YA 1E6VB 1T9WA 2EK6A 2GO8A 4HH0A 1VRTA 1M1GA 3ENWA 3MPWA 3IAM9 3N4WA 4I2QB 4LIWA 3VHQA 2R8HA 4MFBB 2BDPA 2BZ2A 4J9SA 2CFXA 3D1OA 3C16A 2XY5A 2NYIA 1HBOB 2HVDA 4ECZA 3TUZC 5F8IA 2A0FB 4Q45A 2EBEA 1TKZB 3EX7B 1OY9A 3DRYA 4OV1A 2OMOA 1IQZA 2MHNA 3KLGA 4DS5A 5D0HA 3U1NA 1A0OB 1C4AA 1JLCA 1NCLA 2JWNA 1FA0A 4DL6A 2HZVA 4LRBA 1UP1A 2QEXS 3OTOJ 5I4MA 3LTOA 1GX6A 3PJXA 4QQBA 1FESA 3BKTA 3MMBB 1GTEA 1H2VZ 2DXEA 1KQKA 1SKSA 2QO3A 1UETA 3C14B 3ET6B 3TZXA 3R97A 4MIAA 4U9RA 2KFNA 4FNHA 1RTDB 1MROB 2BXJA 4C8OA 4DUYF 3UD3P 1Q5YA 1VK8A 1KHVA 5JJBA 4B9MA 4DV5F 2EVZA 2Q6BA 3CE8A 2QLXA 5C2GA 1R8PA 1RWOB 1WG4A 2VF3A 3BR8A 3J80U 4NX9A 4DR5J 4DV3J 2Y1IA 3VAKA 4DV2J 4DX5A 2OLWA 1GXLA 3VAJA 1ZTWA 5HBMA 3D6HB 1TK5A 1GMWD 2AF6A 2R42A 3QO9A 3G9CA 1NJWA 4U7CA 4OZJA 1KKHA 3FGVA 2U1AA 4IG3A 3HT3A 4FS2A 2E5JA 1RT6A 2XYGB 3M8WA 1HQEB 2HZCA 1BMQB 1YBUA 4MKBA 4ZVRB 1D9DA 4OLOA 1CS4A 3AOCA 3OD2A 4P73A 2AMCB 2BEFA 2E5IA 3AH6A 1NJXA 1EP4A 1MLAA 2I5JA 1FD2A 2FHMA 2ZE2B 4LF7F 4I68A 1NDKA 2BE7D 4F0KA 3R9LA 2F4FA 3N6LA 4ZVPB 1Q8IA 2AW0A 1Q79A 3UR3C 1YJNS 3O8WA 1SVDA 2DJWA 3T19A 3CD6S 1MNEA 1XR6A 2F5GA 2M4MA 3DLKB 3MR7A 4DU8A 2QLWA 1Q0NA 4WKYA 3DHWC 2KFYA 2IJNA 3DLLQ 5A2QY 4AYBD 5D3GB 3AOAA 1FDAA 3QT5A 4QBUA 3OJUA 1S10A 1XWLA 4I0WA 3MR5A 2RIJA 5DLGA 4K4TA 2KI2A 4KHMA 4C3MA 3TJ8A 2C2OB 1LWXA 2YWKA 5LOQA 4MYTA 2Y1RI 3AT1B 3JAMY 1RTHA 4GC7A 4DL0C 1RT7A 2EK1A 2DGQA 4Y2IA 4ZLNA 3NLCA 3M1VB 4RU9A 2ATCB 2XSJB 4BWJA 3IR7B 4DG1A 3KUEA 5EHHA 3CJSA 3MZIA 4I1TA 5L38A 1YJTA 1TVRB 4E98A 2ZJRQ 3FFIA 1FJGJ 2DD8S 2CJBA 3D1QA 4O3PA 1R8BA 1P1LA 4X64F 3GJRB 4V1Ak 5DZ7A 3T9ZA 1U1OA 4YDXA 3NGKA 2WK4A 5E3PA 3WDOA 3QJJA 2CJAA 2QRRA 3ZZPA 2ZBCA 3BGRA 1JLBA 4DR1J 1I6JA 1FX4A 2JFDA 3C6TB 4KE5A 4NZ0A 4RNHA 5HMWA 2YKNA 3R7BB 3CCMS 1U47A 2GAGC 4DV1F 1RWNB 1M90T 2FJXA 1UFWA 2VG7A 4LF7J 1R8AA 1H72C 1D0EA 1RAHB 3IWNC 2WSCC 4NA3A 4RUHA 4IRKA 2ZM6J 1FVQA 1U6ZA 2FDNA 3BGRB 2R2SA 2BABA 5ETMA 3UDVA 2DHAA 2LXFA 3PG9A 4L72B 5IT0A 3P4UB 3LW5C 2WSEC 4UOFA 4ZVGA 1N54B 3N79A 2PFDA 2E5LJ 2ZH6A 2HMIB 4HKQA 1PJ6A 2BOPA 3I9ZA 1FJGF 3RB0A 1EHWA 1UWAA 2IC3A 2IVYA 4DL5A 1NK6A 1BC6A 3Q23A 3I5CA 3KG4A 2B9XA 1ACMB 4WP8A 3KJFB 2XCAA 1TFYA 3NOGA 4L73A 4GC6A 2C3OA 4YS2A 4QZVB 3M2VA 1JLEA 4UOCA 1NK5A 1HI1A 2DHHA 4CNZA 4ZCMA 1EARA 3BGOP 1TK8A 2PFFB 5KFIA 4UQGA 2YH1A 4FF1A 4C8MA 5DQIA 1LOUA 4OZ2A 2CPFA 3D9BA 3DMJB 1ZM2A 5KG5A 3NWGA 2NZCA 4JV5F 1WKKA 2XMMA 2BOAA 2CKWA 3NG8A 4JI7J 4G3IA 2KG1A 4NI2A 1T02A 3DOMB 4RX6A 2QA4S 2QN6B 2UVWA 2MY7A 1X4CA 3PKMA 1YDLA 1BQNA 1HR0F 1Z1ZA 3MPYA 3NOCA 1FKPB 1W25A 4W98A 4WP9A 3TVYA 3JYTB 1R27B 5F8JA 1RU2A 4CTAA 1SL0A 2VPZB 1QUVA 4EI2A 2ZWPA 3V6DB 2UU9J 5DG9A 1PSDA 5DGBA 5BR8J 1WJ9A 2V0NA 2DK2A 4K2JA 4GKKJ 4C4WA 4NLWA 4YB5A 4C97A 1HQ2A 1RUSA 5IWAJ 3WBZA 2E1CA 3PEHA 4FYDA 2ZDPA 4NLRA 3WZ0A 4C0BA 2DY1A 2V68A 2ZKTA 1N36F 3PEJA 2HHXA 2QYCA 2AEFA 3M2RA 5GMKa 5KT4A 4J9OA 5KFDA 1UCNA 4ANCA 1QAJA 3L7OA 2X51A 2CQ2A 3EJMA 4W92B 4WBFA 2RRBA 2HYIB 2IVMA 2DGXA 1OQ3A 2B8PA 4Z7YA 4HTJA 3PHTA 1TMJA 3QGPA 4H4OB 1UTAA 2W2PP 3A13A 3SBMA 5C25A 2AJQA 4DR2F 1PJ5A 3MOZA 4AQYJ 1HNWJ 1W26A 2K1RA 3A1YG 4MTPA 3CCSS 3HVTA 5HO4A 3Q8PB 4BLGA 3GYGA 3N6MA 3CUNA 4KHRA 3LAMA 2KH9A 5IXUA 3A4TA 1N5QA 2MZSA 5KFKA 1VIOA 4PUOA 1JLCB 4NLOA 1TUGB 5IWAF 3LALA 3HX9A 3ZZUA 1HNIA 3HULA 3UE2A 5D8HB 4OHWA 4WJBA 1O51A 1JJHA 4PG5A 3G6ES 1LV5A 2VQEJ 2XI3A 2R7VA 1VBXA 1Q8KA 3LO3A 1EZZB 1HR0J 3OR2A 1U0SA 5KT7A 5HL7Q 4ZLLA 2DKOB 1FD8A 4BDPA 3LP0B 2X1AA 2Z2YB 2IA0A 1YJUA 3LOUA 2VFSA 3CO0P 5BR8F 4NXNJ 2B7BB 2CUYA 3M8YA 1JLGB 1FRLA 1MU2A 3D5MA 2V8VA 4PABA 3HP6A 3V81A 1U1LA 2EKYA 4BWMA 4IDKA 1V3SA 5IS2A 2EPIA 1SUQA 3R5BA 3UCZP 2GAHC 1X5SA 2CPYA 2A18A 4FS1A 3GU0A 4ECXA 4LSLA 4OX8A 2M3DA 1WHVA 3EYZA 4QIVA 3BB5A 2LQBA 1F9FA 1NNDA 4RW4B 1CULA 2HEKA 3MCOA 3GJTB 1ELOA 3DOKA 3E01B 1YJWS 2HAFA 3PV8A 1F9EB 1KLMA 1QTNB 1VDHA 2YKMB 4LBHA 3IM9A 4K59A 3SCLE 1NZ8A 3J7Z5 2OO4A 4HYKA 4LFCF 2UXBJ 4D3HA 4N8NA 4JI4J 4I6WA 3HFZB 5F8LA 5KTQA 1GMUA 4EEYA 1YGYA 4LBPA 1DQ8A 2ZOFA 3ZTQA 2EFGA 3K17A 1REGX 3GCXP 3IBCB 5ETLA 4CO4A 5DQGA 3KTQA 3H42A 3RTVA 3SV3A 1G3OA 2WCXA 3D0HE 3T1AA 2GVDB 5J2MA 4KPYA 1V5IB 2XYHB 1REVA 3W5XA 4DN9A 1AYEA 2OIHA 1HNVA 5CH7B 4NLVA 3TA0A 4IRCA 3OUYA 1YJ9S 4CLYA 3NEKA 3KUGA 1F5CA 1FE0A 3CDEA 4ZP8A 5CD4H 1N32J 1Y5NB 2J7WA 1NM2A 4DLEA 1T3NA 2IYIA 1VS3A 1CJVA 4O3RA 3HLUA 4HL9A 5GAHU 2YNHA 3PR4A 2GFFA 1WEZA 3UN3A 1LWCA 1RT1A 1GAOA 2GO9A 3PO4A 4ZN3A 1MWZA 1RK8A 1LWFA 4F67A 3FC9A 4OI6A 4QU7A 2C2ZB 3AHPA 3T5LA 2P9EA 5ETOA 1NZAA 2EFNA 2OGUA 5CYMB 2ZKUA 4QIWD 4CO5A 4C48A 4R8UB 3KJNB 1B0PA 1FK9A 1OQ6A 2XBPA 4CH7A 3PYFA 5E2QA 1RWUA 2NUHA 4ZLPA 3M2VB 1KVJA 4JI5F 3TAMB 2XB2D 2QMXA 1P8GA 4CH1A 1YZ7A 3Q2SC 1R3NA 3I4PA 1CJTA 1LKZA 3POTB 1UVKA 2C42A 4P71A 5AJ3F 2ZH8A 4E2FB 2KG0A 4EBEA 4DFMA 2FJDB 3RUBL 4J9KA 4ZK7M 5E3CA 1S57A 3Q8RB 2HMIA 2HBYB 2XMJA 5GAGI 3GIMA 1BE4A 2GMJA 4RUBA 3FSIA 4DR5F 5E0OA 3T3FA 3CULA 3H2UB 4N7TA 2DY9A 2KN4A 4ED0A 2QG9B 3UN5A 4EK2A 2L3MA 2V6AA 2UXCF 2R7XA 2GIFA 2IRXA 3GR1A 4LBIA 4OHVA 5J1EA 1NJIT 3FMBA 3JTOA 1FTCA 2RKIB 3KFWX 5C24A 3NXZA 2VA2A 4RUCA 1H6KX 4OIXA 3ZZZA 3PW5A 3CIMA 4OZNA 2NR0A 1C0UB 4OYPA 1H3DA 2M0GB 2YKNB 3AA9A 4ECUA 2LECA 5U47A 1VQYA 4XPCA 1FWPA 3NAHA 2ZHAA 3OR1A 3OR1B 1GMVA 2YWFA 2N7YA 1QAXA 3BGFA 5KFYA 7FD1A 5KT2A 2ZC3A 1OY8A 1R8CA 2Z2ZA 1A9NB 5H9FK 2P6SA 1V6HA 1B0VA 1F2HA 1FRIA 1GT8A 1I5OB 2RH3A 2ZD1A 3HSGA 3I0SB 5D0RA 3OTBA 2NREA 4JV1A 4DSIA 5GAEU 2OPPB 4DHVA 4YDDB 5C24B 7AT1B 4DX6A 1TVRA 3CCES 1LWEB 1RHQB 3CJ0A 5IOLA 2YWGA 5IZHA 2XSJA 1T95A 3OL6A 1YLXA 5IM0A 3HZEA 2C1EB 2HNDB 3KK3B 1D1UA 3VAHA 3BKFA 4U8VA 3PO5A 1RTHB 5LMUF 2FY1A 2UZAA 3ILOA 1H2UX 2VL1A 1NKCA 3H2LA 2CJXB 2EWHA 2CWKA 2C2RA 1TL1B 1Y5IB 5E41A 2CPHA 1MN9A 2BVZA 5CA5A 3POTA 2PIIA 2D7SA 2Q3PA 1DQ9A 4OHXA 5B0BA 2W2QP 1M5PC 5AXNA 1KLNA 5K14B 3C46A 2L9WA 2ASLA 2FPHX 4F4AA 1B7YB 2RDJA 1RT5B 5THWA 3FMWA 1SJ1A 4AT1B 4YP3A 3KLHA 2HSEB 2KHCA 3LUYA 2F65A 4H4KC 1SJRA 1SI9A 1T11A 3DLKA 1SB6A 4DUZJ 1FE4A 4R8UA 4LSZB 3R5GA 5I42B 2HIQA 2XY6A 3IGVA 3TVZA 4WZMA 2M8DB 4KKOA 1VHIA 4FF3A 1FFWB 1KOHA 1LWFB 4ZJLA 4IFVB 2DPIA 3UPFA 4URQU 3GIIA 1N5YB 3QGIA 4C6AA 5A8WB 4WTYA 1KNZA 2CIMA 2G0CA 4Q8EA 4PRFA 1FXRA 4H54A 4OI3A 4WIQA 1NSKL 2MQPA 4BC7A 4ELVA 5EGYA 5AXMA 3BPSP 1DFDA 2R8IA 3ZNUA 1JXEA 1WC0A 2VPYB 4YR0A 3GFXA 3SV4A 4PWDB 5K9FA 3OUYB 1X9MA 3X1LB 5KT3A 3R2DJ 3M9NB 4NL5A 4C8NA 2XULA 4UW2A 3LWMA 1L3KA 1MN7A 2G9OA 2V8HA 3O6QA 2M5YA 4HI1A 4NASA 2VASA 2YNIA 3L3CA 2VQEF 3DDNA 2HGLA 1BQMB 4RWXA 3BS9A 4JV0A 2R2RA 2NZ4A 2JC0A 2ZH5A 3HO1A 2LMIA 2FGCA 4AL7A 1FKAF 3NGUA 3PTWA 2CNKB 3TUJC 3I31A 8RUCA 3MUTP 3LWLA 3N9UC 5IQQA 3CSKA 3ETOA 1EKSA 3M8ZA 2QYGA 3R6LB 4ETXA 5LM7E 2MZ1A 1VFJA 2HBZB 5CAAA 1X4AA 5HMYA 3DOKB 1KQGB 2CXEA 3DGVA 1NPPA 2YNIB 3RGIA 4YEAA 1KHWA 1MMLA 2VIHA 4ZCLA 4WF9Q 2MJUA 2A2CA 1P1TA 4WFZA 4DL4A 1KTQA 1NJYA 2MPUA 1UWBA 3DOLA 2QLJB 3KLGB 1SL2A 4U8YA 4F3OA 3PY8A 1APSA 1EQMA 1NMEB 4G1QA 3ZFVA 3ZTPA 4DUZF 3TWZA 4PWDA 4JV5J 1AB8A 1QVGR 1IJFB 2DHSA 4LRFA 3FSXA 2MQLA 2WVFA 3A8IA 3G2XA 1J5OB 5K20B 1WELA 1ZPVA 1BQXA 1B4SA 2QMUB 4NRTA 1YIJS 2FD2A 1VRTB 2LEPA 4ID8A 4LR8A 1IBKF 2VOOA 4QJVA 1WOSA 2Q79A 4ES2A 4P2SA 3NGRA 2B51A 1DZ5A 3ENVA 2H3EB 2AZ1A 2B5JA 1HBNA 4WP3A 4K4YA 2OPQA 1RDRA 4O4RA 3DI6B 3G82A 7FDRA 3KLHB 2R7UA 3ONQA 4NLXA 3J81j 1T8EA 2V2VA 5DG8A 1AFJA 3ULHA 2NXEA 1R0BG 1RHRB 3P3DA 1JNZB 3AJ1A 5GVQA 2R9LA 4F4XA 3CXCR 5K14A 1VJQA 5A76A 3Q8UA 1U1KA 3HVTB 1U09A 3KHLA 5FDLB 2DITA 2D3UA 3BBCA 1S6PA 3PFEA 4QIEA 5HROA 1RT3A 1URNA 4B3OA 1VLYA 1S72S 2VKRA 5IT9Y 3W3SA 3JB9k 3DCAA 3RRHA 2RE1A 2DISA 1AZSA 4KPCA 4HI2A 1TMMA 3H98A 1HYSA 4NLYA 2DR7A 4DSEA 5A0YA 3W7BA 3NGSA 1JQGA 2VBWA 5CZVA 4RUAA 3KHRA 2MB0B 1AFIA 2DNLA 3TUPA 1IKXB 3MD3A 1RTJA 3MM7B 2EFOA 4TKTA 1KVIA 2J8SA 3RJMB 4L3KA 4HHJA 2B8QA 1O5JA 1HHSA 1IWAA 3L9ZA 4P52A 3OT9A 3BSNA 1Q7LB 2NXCA 2OKQA 3M32B 3UR0A 3T1YJ 2CNLB 1NDCA 2VPXB 4NCGA 4F0HA 1CJKA 4JI8F 2ZH3A 2W9CA 1FKPA 2RB7A 2JVRA 3DXSX 3SDEB 5HJYA 2J6TA 1HD0A 1RAGB 3VZIA 1UEVA 3FRYA 2LCWA 1Y11A 5KFFA 2FVQA 2B0GA 2RAQA 2VG5B 4PQAA 4I7FB 4UUWA 4U67Q 3TANA 3A3PB 2C3MA 2M70A 1NH8A 3L09A 2KXHA 2ERRA 1PC4A 2P8IA 3NBPA 2MKKA 1RAOA 3FBBA 2C22A 5LMNJ 2NS1B 2FHKA 4LQ3A 2M9KA 2DXFA 2GJ2A 1MG7A 5A8RB 2LDYA 2D3O1 2A3JA 4M5LA 1N33F 1ZETA 4DR7J 1YVFA 5MAOA 2KZMA 3MPDA 2ZH2A 2PA3A 4B08A 4JYAJ 1T94A 1TUVA 3CCRS 2KB2A 4RW7A 2FGOA 4ZPTR 1SC1B 2XLIA 4ZLJA 3HPOA 1Q82T 1XR5A 4FXWA 3CCZA 4M63A 3EPGA 3MMAB 6FD1A 3T1YF 2CPZA 4USJC 1NSAA 1TP7A 3LANA 9ATCB 1KBRA 2VDIA 2VU5A 2YWEA 4WFBQ 3QJPA 3IR5B 2P6TA 1B7FA 1K0VA 3CGIA 2CJYB 2VBYA 1GTHA 1S4FA 2D41A 3HJFA 3R7SB 4WCEQ 2FJAB 3LP1B 4QR1A 2EEYA 1FJEB 2B43A 1RAJA 4NA1A 1N6QA 4TLRA 1LK7A 4RO0A 3HMJG 4G1IA 1M1HA 4X62J 2B4VA 4K0KF 5LMNF 3D6FB 4IG0B 3E2EA 1K44A 4R5PB 5KT6A 3CD0A 3BQ2A 3V5RA 1QY7A 4GRSA 2GVDA 4RBTA 5F0WA 3VTIA 5K8OA 1C0TB 4K50A 2C28A 4DV6F 4B3RF 2NSCA 4WWSA 2HNYA 2CRLA 4DR6F 1RP5A 2DNNA 1YSJA 2DB1A 3CJKB 2YKPA 4Y6IA 3D2WA 5DRKA 1T3OA 3FEXB 3R6GB 2GMLA 3H40A 2VQFF 2YH0A 3KNAA 1R6VA 2BJEA 3PYGA 3U7JA 4PWUA 1FRHA 1U45A 2D9PA 3QAEA 4DG1B 2VZ9A 4ZKAA 3U1MA 2IHR1 3HHDA 1BD6A 2DNOA 1VMBA 1HIYA 4LR7A 4FZVA 5CHCB 2K06A 3OLBA 4ID5A 5A8KB 3EVOA 4DZ6A 2KTQA 2Z2LA 3W62A 4A8OA 4ETZA 2E1PA 3ZZYA 1UMJA 1X9SA 2BKNA 3IG1B 1VLOA 2L48A 2FVPA 2KM8C 4IDKB 1IWGA 1BWVA 1PKUA 3N01A 2UVUA 4CCHA 1I3OB 1D09B 2FIUA 4YHHF 4QWBA 3M8QA 2UUAJ 2WONB 3D54A 3HD2A 5LJ5Y 2AD9A 5D3GA 2HHUA 1IKVB 1HPZB 3L7UA 4M8LA 3G87A 4DJBA 3QT7A 5AXLA 3LP0A 3VVUA 3DFEA 4HLBA 4PXDA 3TNVA 1S1WB 1HL6A 1VHFA 4CYUA 4F0MA 4U95A 2OELA 2F40A 4WKRA 2HK3A 1VQ6S 1XIQA 3DLEB 3PRBA 2V63A 1ZA1B 3I0RB 1EX8A 1ZAWA 4MAKA 4P7VA 3PXGa 1OJ4A 5KFXA 3UNYA 1WSVA 4JBCA 4DPOA 2L41A 3MR6A 3D28A 1ZH5A 2R7WA 2L9DA 2B9WA 2RNEA 3HK2A 4J90A 3W2VA 2G2YA 3M2UB 2MKYA 4RW6A 4X4SA 4N56A 3KHGA 4RNOA 3W9IA 2VJUA 2PSZA 4M5GA 3MECB 1M5OC 4A8WA 1WEYA 1AXQA 4ECRA 1IVZA 1NB2A 1VBKA 2K1RB 1F3FA 4RLEA 2R7QA 2JFKA 4HDHA 3QQCD 2IFXA 4IG3B 3U02A 2ZJQQ 3EMTA 5C25B 1NB7A 2UVVA 3QO9B 4M5HA 4O0NA 4RU2A 1R6YA 3ZTSA 3NNCA 5KFNA 1T9VA 2NXJA 4OYXA 4PG6A 1WORA 4WXWA 2Y9HA 5AT1B 4IR1A 2BACA 1RJJA 1Q95G 1VI7A 3MCNA 4KFBB 3QT6A 1SPBP 1I94F 4MK8A 4PG7A 4AFFA 3K5PA 5D4NA 2MMYA 3NNAA 1GX5A 4QU6A 1L5UA 4X2BA 4CIOA 1B0TA 2HWIA 2J0XA 3MMBA 4JI0F 3NGDA 3BN4A 2FUG9 3F41A 2EFVA 3Q22A 3PW2A 1HD1A 2MKSA 2YWWA 2ZNYA 3PM9A 1HWUA 2HFOA 3L95X 3MPUB 3W5YA 3V6DA 2E7XA 3A8EA 3E51A 2UUTA 4AXJA 2MGZB 3KLEA 1UZHA 4P9SA 1RT2B 2VPWB 3UDEA 1KDNA 2EC2A 2OSRA 4BBYA 1S7HA 1VQ5S 2AV5A 4HH1A 2NXUA 1PAUB 2O66A 1PBUA 1Y3KA 2WB1D 5HATA 4EUVA 3M9MB 1X0FA 3GP9A 2VONA 1GH8A 2H5EA 1XNQJ 4TYAA 4Q5VA 3FZ2A 1DAXA 1KVKA 2XNRA 4M5KA 1M1KT 2M88A 4I2QA 3OJSA 4NCBA 1YQHA 3ISND 2OEJA 5KOWA 5BXIA 4ED5A 1HI0P 1S48A 4KO0B 2DNGA 3UN2A 4CO2A 2IDEA 2VBXA 2NXNA 3HSJA 4O4GB 4A8XA 1TR0A 3KWMA 1TL7B 5EWEA 2DNQA 1SQEA 2UUCF 1DTQB 2HHPA 2QL7B 2W4CA 1JJCB 4OJGA 4YN3B 5CYQB 4B3MJ 2J0QD 1RKIA 1NKEA 3V6KA 4DSJA 3MAAB 2AYEA 4G1PA 4WXOA 4ZITA 3R2CJ 1LW2B 2PMWA 3DYAA 2GHPA 2HGMA 2LLZA 4JOUA 2ZH1A 4TU7A 2MTLA 4KQZA 2DR9A 3W60A 4A8SA 2CJQA 2KM8B 2KDOA 2UV8G 2EC0A 3BYRA 3TP2A 4B9VA 3DHXA 3ZC4A 2ACYA 3MEEB 2YKAA 2MGZA 2DO4A 1CJUA 1PAEX 2CDQA 2WHOA 4DPXA 3K2YA 4FF4A 2ZC4A 5B0GA 2ZUGA 5SZTA 1NHVA 4P2FA 1Q8LA 4KH0B 3GCWP 5GAHI 1YTYA 3DNCA 3QWUA 2RRNA 1S77D 3J7AN 4C8ZA 3DXBA 4OV6A 2F8HA 6FDRA 3EXYA 5L1JA 3HF5A 3FEYB 4Q44A 1H74A 2R7OA 3FQKA 1TKDA 3J80Y 1KS2A 1C1BB 3FNNA 3H0PA 1WWHA 2VG7B 4X66J 1S99A 5DGAA 3MOJB 3IR6B 1JLAB 4YQWA 4NMXA 2FY8A 4F26A 3ADAC 3ISNC 3H5SA 3C6TA 1TV6B 3KJVA 2XSFA 3I5BA 2V2KA 3WC2A 1JLFB 3TR5A 1VC0A 3MWBA 3W5ZA 1LW0A 3PZPA 1O0PA 4B3SJ 2MZTA 2M52A 1Y7PA 2CYYA 3BSAA 3D3CJ 2AJFE 1RBAA 2ZEJA 4TU9A 2XQCA 1JLQA 4FPIA 1SV5B 4MMOA 1WD6A 1RAFB 3VAIA 3C2PA 3MM8B 4I2PA 5J2QA 3OFEA 2Z8QA 4DV7J 4KY3A 3W2VB 5FD1A 4J9PA 5F3ZA 1GMWA 1SBRA 4LVNP 1Q7YT 1NRKA 4ZVUB 4J9MA 3CJ4A 5HQLA 3OSPA 4PYAA 1U25A 2Y0SD 1B64A 2ILZA 1UZDA 4PG8A 4OZ0A 1PG5B 4Y0FA 3VWSA 5L1KA 2FZCB 2HQIA 4C8YA 5JMNA 2MQOA 4DV0J 2HHWA 1MMNA 2QFIA 4A8KA 3SI8A 4Y34A 5IC4B 5HQ8A 3SZ2A 1R0AB 2OPRB 1IBLF 3HHNB 3OFHA 1X5OA 4TXSA 4A46A 4YOEA 4IUFA 2J9EA 1OO0B 4DR3F 1RTIB 4CLLA 3T1HJ 4B3SF 3LP2B 1Y5LB 3M6XA 4HEA9 4OJ3A 3AXKA 5H9FJ 1WI6A 4B02A 4DPYA 4WYLA 1QJHA 3PX0A 4QWDA 1PGZA 1U0HB 2NCKL 3ZTRA 4LF8F 3BV8A 4RNFA 2V9WA 2Y1JA 3QAUA 3K8WA 2Z56B 4B3TF 1RB0A 4K5SA 4G6VB 1S1VB 3SXLA 3W1YC 1W2BR 5T7LB 4YFUA 1QM9A 1RT6B 1VCTA 2EG2A 1RTJB 2CPJA 4Y2MA 5A6PA 3H5YA 2ASDA 4K4SA 3DGPB 4MKVA 3CJ2A 1IKXA 4QPXA 1FRKA 4MH8A 3CJKA 2N82B 3JS9A 3W2WB 4ZMMA 3CJ5A 1SL1A 1VQ4S 3CT9A 3QMQA 3S1TA 4HR2A 5A0YB 5GADU 3OHAA 1IKWA 2HIYA 3QIPB 1WI8A 3HFKA 3PRDA 5IT4A 2PEBA 3VALA 1BY9A 1LFPA 2DNYA 3MM5A 2JEGA 1CG2A 2CDRB 1H38A 1DBDA 3AB4B 2ZBQA 4OYBA 1RGVA 2VKZG 3OTDA 4KAIA 3MMCA 4UT4A 2CVIA 4ALZA 2V8GA 3ET6A 3OQ2A 3UCGA 1RT3B 5D0EA 1IN0A 1WKLA 4MK9A 4BHQA 2K8GA 5LJ3Y 2MYFA 5DQHA 1N6QB 4ZVFA 2XS5A 4ED3A 3LP1A 3RAQA 4K4ZA 1VJWA 3NS5A 4OX9F 3SSRA 5LSLA 3V4IB 4JI2J 2C2KB 2YWHA 2E29A 1G1XA 5HP1A 1V3RA 1SC4B 1ZM4A 2ZH7A 4ZVQB 2UXDJ 2B5JB 3IGNA 1HBOA 3IRXA 2DGOA 2YBVA 2Q66A 3TZYA 2JEJA 5F0UA 5J2PB 2H65B 4MFBA 2MKCA 3KUHA 2V8PA 4B17A 2W8KA 2FZKB 1QSYA 4EZ6A 3EGWB 1TKTB 1J2VA 3BYPA 3A3NB 3NS7B 2HS0A 2CQCA 2XEXA 2AYGA 4ERDA 2DGTA 3UD5A 2CQIA 4OHZA 1ZZNA 5CCMA 2J7UA 3IC1A 3DOLB 5LT5A 2JZ5A 2DVIA 4DSKA 1FVSA 2C3PA 4DR6J 4FBTA 2A1BA 1FRMA 1URRA 2RU9A 4JI1J 1RZMA 4F36A 1JJ4A 2IBKA 3DDKA 4KC5A 2E9ZA 5KG7A 1RWWB 2LA6A 4C2MA 4M95A 3RBXA 4B9TA 2UXDF 2W9CB 2AYMA 5HN0A 2BV3A 3K5NA 2CVEA 4NOHA 1CJKB 1C1CB 2BANB 4ZVSB 4CI0B 2W1BA 2X1GA 3IN5A 2XNQA 1VC5A 1AUSL 2C3YA 2MKHA 4GKJJ 2V5HG 5KG0A 2VBZA 2IM2A 2QTWA 3MM6A 4M5IA 2JLGA 2Y1LB 2YQ3A 2ZHBA 3V6JA 1T05B 3OL9A 3J81Y 2V94A 4I4BA 3W8GA 4J9RA 2COLA 4I6YA 2A6MA 1QVFR 5J1PA 3OTEA 2MHEA 1LNQA 1JKHB 1S1UA 1ZM9A 4USUA 4NRUA 4N8OA 2I8EA 2DGVA 3NWRA 4PZVA 4WE1B 4M5DB 1U48A 4C9DA 2B7CB 2R7RA 4FF2A 2EBGA 3OXFA 3S01A 2AT1B 4U7UK 4ILMA 4ZPCA 3QSYB 1RTZA 3CO9A 3BR9A 3LF0A 4Y65A 2ROPA 2KT5A 3DM2B 4GO7X 1U4BA 1PJ7A 3B8HA 4Y00A 4NCAA 4FBUA 1Q81T 3OPKA 4DEZA 1HBUA 1YRUA 2DGSA 1IXKA 2JX2A 3Q0AA 3K5MA 1HNXF 2Y8YA 1ULRA 3Q86A 4E0DA 3RU0A 2ILYA 1FXDA 2DRBA 5DZ6A 2X3GA 3BJYA 5I42A 2UUBJ 5KFRA 3VVTA 4PCQA 4IR9A 1FFSB 4ZHRA 1FO1A 4KBIA 4OYAA 2LQ9A 2K3IA 1FDDA 3BREA 3BZQA 1U6FA 2MQNA 2WAQD 3PDNA 1N0VC 1N5SA 4Y28C 4FPRA 1SJQA 3T5JA 4OX7A 2XZTB 3KOAA 1GXTA 2R3VA 1OSDA 3M8SA 4JI1F 1UFLA 4RW8B 1W2IA 4RW9A 1GNKA 4ZIWA 5C7PA 4USMA 1IKYB 1SIZA 2O3DA 4P72A 1PYTA 4OYOA 4O3NA 3HHLB 3Q83A 2ZH4A 2QFJA 1ZAXA 1CC7A 2KT2A 2XMKA 4DF4A 2N3OA 3HI9A 2GX8A 1HWKA 1U26A 4OZLA 5G0RA 4DPTA 4U7UD 1RA7A 4DQPA 2ZVIA 4KGXB 2E1AA 2HVZA 4PKDB 2V4RA 4F50A 2FC8A 1WDDA 4M5DA 2HHTA 4ILLA 4USHA 2WTFA 4LVOP 2EFQA 3LQVA 3KYLA 4TY8A 1JKHA 5CXTA 3J7ZT 3GB0A 2HHQA 1NEEA 1UL3A 1PC5A 1GK8A 4A8QA 2BKOA 4LSNA 1TL3B 4KSEB 2V2ZA 2ZHOA 4USVA 5M2RA 1Q5VA 5KG1A 4LF6J 3MFIA 2BUNA 4R25A 2LU2A 3PHEA 1C0UA 2JLFA 3PJWA 1DURA 3O2IA 4HHHA 2QMWA 3AOBA 4O44A 1LXNA 2DXDA 3S7RA 3C8YA 1D9FA 2ZZNA 2F9DA 3CJRA 4WIIA 3TYTA 1UKUA 2QIFA 4URSA 4PEOA 2C2NA 4A48A 4CNYA 5CYJA 5KFHA 2VV5A 2IMOA 1DTTB 3C15B 1K1SA 2LFVA 3R1HA 2XLKA 5A6WA 2D1CA 2ZFHA 2LXUA 1O8BA 1KC8T 3RR8A 2RILA 1HW8A 2OUGA 4RR5A 4DV3F 1ZZFA 4WFYA 3ILLA 3JAMU 4DPWA 1G7CB 4F3MA 1SC3B 4FP9A 3DLGA 3HDSA 3M6UA 3MM9B 4DX7A 4YY3F 1U1RA 1X5TA 4UY85 3F56A 4ZVOB 4B3TJ 1ZTTA 3EVMA 3TAMA 2CA9A 1UW9A 5D78A 1XR7A 3OL7A 2XGPA 2UP1A 1BXNA 1BWEA 2XS7A 3QSIA 2MEWA 2HURA 2LQ8A 1AA1B 4DU7A 3AD7C 1M5HA 4UY8T 5KFBA 3UDCA 5L1IA 1NHKL 5J2PA 3RW7A 4IRDA 3HVAA 1X4DA 4Y2AA 1FWKA 1RI7A 3M30A 2K3KA 3IRXB 2I1RA 3R5CA 1D8ZA 4IQMA 5CYMA 5HJXA 3C66A 1WHYA 2KRBA 3D68A
chains in the Genus database with same CATH topology
1HLWA 2B8QA 4UOFA 2HVDA 1NDCA 1EHWA 4S0MA 1NB2A 1F3FA 1NCLA 3GPAA 3EMTA 3ZTQA 1JXVA 4O0NA 3VGUA 3ZTSA 4C6AA 1S59A 3B6BA 2BX6A 1S5ZA 4FKYA 1NSKL 2DXEA 1BUXA 3BH7B 3FBBA 1VYAA 4ANEA 4UOGA 2DXFA 1WKJA 3FBFA 3Q86A 1WKKA 1BHNA 3MPDA 1MN7A 4ANDA 2NCKL 3VVTA 3ZTRA 3BBBA 1NDLA 3FBEA 3VGVA 3Q89A 3FC9A 3PRVA 3NGUA 4W98A 3WX8A 2VU5A 4UOHA 4DI6A 3Q8YA 3EE3A 1KDNA 3ELHA 3B54A 3EICA 3JS9A 5CAAA 5C7PA 3FKBA 3GP9A 4FKXA 4HR2A 2BEFA 1NDPA 3VGSA 3Q83A 3ENAA 1NDKA 1LEOA 3FCWA 3R9LA 5BXIA 3ZTPA 1B99A 1UCNA 4ANCA 1K44A 1W7WA 3EJMA 1NUEA 4CP5A 1S57A 1WKLA 4WBFA 3G2XA 1NPKA 2B8PA 1BE4A 2DY9A 1B4SA 4EK2A 2DYAA 3VGTA 1ZS6A 3EM1A 1NSQA 5CABA 3BBFA 3NGTA 3ETMA 3NGRA 1LWXA 3DDIA 3PJ9A 4DUTA 2AZ1A 1PAEX 2DXDA 2HVEA 3Q8VA 2AZ3A 3FBCA 1HIYA 3EVOA 3Q8UA 4DZ6A 1F6TA 3ZTOA 3BBCA 1PKUA 2ZUAA 4ENOA 3EVWA 1XQIA 5IOLA 3BH6B 1U8WA 3L7UA 3EVMA 4KPCA 3VVUA 1HHQA 3DKDA 3FCVA 4F36A 1NLKL 2CWKA 2HURA 1MN9A 3NGSA 1XIQA 1NHKL 1NSPA 4F4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HLW A;  2B8Q A;  4UOF A;  2HVD A;  1NDC A;  1EHW A;  4S0M A;  1NB2 A;  1F3F A;  1NCL A;  3GPA A;  3EMT A;  3ZTQ A;  1JXV A;  4O0N A;  3VGU A;  3ZTS A;  4C6A A;  1S59 A;  3B6B A;  2BX6 A;  1S5Z A;  4FKY A;  1NSK L;  2DXE A;  1BUX A;  3BH7 B;  3FBB A;  1VYA A;  4ANE A;  4UOG A;  2DXF A;  1WKJ A;  3FBF A;  3Q86 A;  1WKK A;  1BHN A;  3MPD A;  1MN7 A;  4AND A;  2NCK L;  3VVT A;  3ZTR A;  3BBB A;  1NDL A;  3FBE A;  3VGV A;  3Q89 A;  3FC9 A;  3PRV A;  3NGU A;  4W98 A;  3WX8 A;  2VU5 A;  4UOH A;  4DI6 A;  3Q8Y A;  3EE3 A;  1KDN A;  3ELH A;  3B54 A;  3EIC A;  3JS9 A;  5CAA A;  5C7P A;  3FKB A;  3GP9 A;  4FKX A;  4HR2 A;  2BEF A;  1NDP A;  3VGS A;  3Q83 A;  3ENA A;  1NDK A;  1LEO A;  3FCW A;  3R9L A;  5BXI A;  3ZTP A;  1B99 A;  1UCN A;  4ANC A;  1K44 A;  1W7W A;  3EJM A;  1NUE A;  4CP5 A;  1S57 A;  1WKL A;  4WBF A;  3G2X A;  1NPK A;  2B8P A;  1BE4 A;  2DY9 A;  1B4S A;  4EK2 A;  2DYA A;  3VGT A;  1ZS6 A;  3EM1 A;  1NSQ A;  5CAB A;  3BBF A;  3NGT A;  3ETM A;  3NGR A;  1LWX A;  3DDI A;  3PJ9 A;  4DUT A;  2AZ1 A;  1PAE X;  2DXD A;  2HVE A;  3Q8V A;  2AZ3 A;  3FBC A;  1HIY A;  3EVO A;  3Q8U A;  4DZ6 A;  1F6T A;  3ZTO A;  3BBC A;  1PKU A;  2ZUA A;  4ENO A;  3EVW A;  1XQI A;  5IOL A;  3BH6 B;  1U8W A;  3L7U A;  3EVM A;  4KPC A;  3VVU A;  1HHQ A;  3DKD A;  3FCV A;  4F36 A;  1NLK L;  2CWK A;  2HUR A;  1MN9 A;  3NGS A;  1XIQ A;  1NHK L;  1NSP A;  4F4A A; 
#chains in the Genus database with same CATH topology
 5HP1 B;  4L74 A;  2H5J B;  3IS9 B;  2KXN B;  2R8K A;  2ZBR A;  3TEH B;  3M4X A;  2CG4 A;  4FVM A;  3RW6 A;  5ETP A;  1TK0 A;  2FJE B;  2FQQ B;  1CJV B;  3MCM A;  4IFY B;  4AQY F;  5H9E K;  4X4N A;  1SCJ B;  2U2F A;  1QE1 A;  1TL1 A;  2W2N P;  3I55 S;  3AD8 C;  2DO0 A;  1S9F A;  2CNN B;  1GXU A;  3EGZ A;  2W8L A;  2HND A;  2IM0 A;  4LRA A;  3KK3 A;  2HRT A;  3QZ8 A;  3C15 A;  4ZJQ A;  4LJM A;  1S12 A;  2OFG X;  1FNX H;  2E9R X;  4ED7 A;  5EX3 A;  1QUP A;  4NA2 A;  1FDN A;  2OPP A;  2PA8 D;  2RVJ A;  4ITS A;  3UD4 P;  3AXM A;  1GEH A;  3I0S A;  3BN7 A;  3CC4 S;  2CWX A;  1KR4 A;  3MPV A;  3DU6 A;  4C8K A;  2YKM A;  1KLM B;  1D3W A;  4I56 A;  3DLJ A;  4WTO B;  1RCX B;  1OS5 A;  2RSQ A;  4CLF A;  1TL3 A;  1VGY A;  2WZ1 A;  4E8U A;  2JLE A;  2QGF B;  1FNM A;  3PFO A;  3W66 A;  2CQH A;  2YNG B;  4RW4 A;  4ZS6 A;  3DRP B;  3PX6 A;  3RBE A;  3CW2 C;  3EPI A;  1Q78 A;  5D0G A;  3HSZ A;  1U0H A;  2GCF A;  3CB4 A;  3HKW A;  2HZA A;  2D9O A;  4AE5 A;  2D69 A;  4ZP6 A;  1SUQ B;  2V69 A;  5J1E B;  5DJB A;  4EYH B;  1BLU A;  3LP2 A;  1CEZ A;  3TZZ A;  4LF5 J;  3K8V A;  3KMQ A;  3PNI A;  5F9N A;  3V81 B;  3G8S A;  1IBL J;  5B09 A;  3BDP A;  3CNQ P;  1RSC A;  1SH2 A;  1NXI A;  1HNX J;  1YJ7 A;  4P74 A;  3UWT A;  4GKJ F;  1EKR A;  5AE1 A;  4C3K A;  4Q8F A;  1IKY A;  2J5A A;  5HVG A;  1XMB A;  3F0N A;  1ZPW X;  5T14 A;  1VQ7 S;  6AT1 B;  1SIW B;  1WSR A;  2AP6 A;  4K5R A;  4RW8 A;  2E5L F;  4LF9 J;  1XN9 A;  3MTK A;  3UDL A;  1GQE A;  3L7P A;  1N52 B;  4CLS A;  4Y3C A;  5LMU J;  4R0E A;  4XK8 C;  2OPS B;  2IAJ B;  2O01 C;  2PEH A;  3IBW A;  3CCQ S;  2R7T A;  4NLG A;  2GJF A;  3PCO B;  2IDL A;  2RQ4 A;  2R8J A;  2AEJ A;  3CTR A;  2I9S A;  2ZM6 F;  4QYR A;  2JEF A;  3N6N A;  2QSF A;  3OFG A;  4F4Z A;  1Y0H A;  4G65 A;  3MEG A;  1WOO A;  1RT1 B;  3VAG A;  1TZ0 A;  2XYP B;  2W7O A;  4DV2 F;  2DCU B;  2XMT A;  3SCI E;  2BQ3 A;  4IH5 A;  4B9S A;  3T41 A;  3KG1 A;  2W7A A;  3GSD A;  2HQ3 A;  1ZOT A;  3Q8Q B;  5B0E A;  2RF2 A;  2WBR A;  3NCR A;  2VIC A;  3GFZ A;  5ETT A;  3ZZR A;  5ETQ A;  5LXY A;  1S1T A;  3H4B A;  3SQG B;  3HFV A;  3QLH B;  4XPE A;  5JVG Q;  1CPZ A;  4UTG A;  3I6P A;  4WFN Q;  2V4J A;  5EWF A;  4Q7A A;  3B78 A;  4QW8 A;  3ZZO A;  3BQ0 A;  2GVZ B;  1Q1K A;  2Q43 A;  3MD1 A;  3QGG A;  2H54 B;  4DF8 A;  4HVZ A;  5H9E J;  1T05 A;  1HHT P;  2ADC A;  2VG6 A;  3TA1 A;  2PD1 A;  3JSB A;  3ICL A;  2MZQ A;  4EO6 A;  2SXL A;  3HD1 A;  3DRR A;  3WIU A;  2W24 A;  2EFP A;  2XO6 A;  3EZU A;  4IOA Q;  3TAR A;  4JI7 F;  2DNR A;  2RHS B;  3GLJ A;  2FTR A;  3M8P B;  1VK3 A;  2RF2 B;  3JTN A;  4D3G A;  1UA0 A;  4M5J A;  4BC9 A;  2ATL A;  1BQN B;  1XMO J;  3OVS A;  1FHT A;  1SH3 A;  2HFV A;  2W7P A;  1CUL B;  1TUW A;  2DNH A;  3MEK A;  2H51 B;  2MJN A;  5M2U A;  3TA2 A;  4S0M A;  8ATC B;  1KSP A;  4ELU A;  3MAA A;  3QID A;  4V19 X;  2B4O A;  2BW2 A;  1OIA A;  2WVE A;  3GPA A;  3TO8 A;  4DZD A;  4LQ9 A;  1T7P A;  3EXC X;  5K8M A;  3P96 A;  3K5L A;  3RB3 A;  1F3V A;  1E6Y A;  3B6B A;  5BYR A;  3UW1 A;  3VAF A;  4NLT A;  4NWB A;  4QIG A;  4DV4 F;  2BJ7 A;  2OPS A;  4MKA A;  1VC6 A;  2V67 A;  2CQD A;  4LIR A;  3CMQ A;  4ANE A;  1GFW B;  1WC1 A;  4OI0 A;  2Z0G A;  4FNI A;  3CED A;  4ZPB A;  4DL3 A;  1UVL A;  4IOB A;  3GV8 B;  4IQX A;  2M7S A;  4AND A;  1CBK A;  1S4E A;  2VFV A;  1NDL A;  2E7W A;  2MST A;  3KLE B;  3H90 A;  3I82 A;  1FJ7 A;  1MSW D;  1SC6 A;  3A3O B;  3OXL A;  4IKA A;  3PW4 A;  3RYL A;  4OHY A;  2G2O A;  4DR4 F;  4F3Q A;  4I67 A;  1X9W A;  3G6Y A;  4RWW A;  4LR9 A;  4DL7 A;  2DNK A;  5HVH A;  5KFO A;  3TRG A;  3QRP A;  5H1S V;  3RB4 A;  4QW9 A;  5FJ4 A;  3TJ9 A;  3B54 A;  2PN6 A;  3CCW A;  1WC6 A;  3H25 A;  1IBM J;  2XY7 A;  1FKO A;  1ZA2 B;  3DRS B;  5LSO A;  2E1M C;  4FXV A;  3GIJ A;  1K73 T;  2X1F A;  4OI1 A;  2JSX A;  2DH7 A;  4M1K A;  4NZ6 A;  4OI2 A;  2CQ4 A;  4H4O A;  3GIK A;  4DV4 J;  3WC0 A;  4Z37 A;  2HQC A;  4CWB A;  4J37 A;  4KFB A;  1JLB B;  1TL4 A;  2BJ1 A;  3GJS B;  4DLG A;  1R7I A;  4YB1 P;  5CCL A;  2BR0 A;  2DIV A;  4Y2K A;  1NUE A;  2QX0 A;  2W2M P;  2XTJ P;  3MED A;  4CP5 A;  3W2W A;  3M2R B;  1JNR B;  1VIX A;  3DGP A;  4QIF A;  3FFI B;  1NK0 A;  2J9D E;  5KFM A;  3QAT A;  2RQC A;  2DYA A;  1WC5 A;  3VGT A;  1RKJ A;  1S1V A;  2UXB F;  3PX4 A;  1VBY A;  2BJD A;  2R7S A;  3S8S A;  2HHS A;  2FVC A;  2HNZ B;  4WU2 A;  3H8Y A;  1WF2 A;  1RT7 B;  3O5T B;  4FVC A;  1FRJ A;  3MUR P;  2QA2 A;  3P45 B;  4KH1 B;  2G13 A;  5LSR A;  4X4T A;  1IR1 A;  4AUK A;  2KU7 A;  5C42 B;  4LF4 J;  3NNH A;  3ENQ A;  1KN6 A;  3H2V E;  3JYT A;  4QR0 A;  1IBM F;  3I0R A;  2G1H A;  2YX4 A;  2HLU A;  4IFY A;  3B4D A;  1K0T A;  3DOM A;  3ILI A;  3ZZ0 A;  3NAI A;  4NI2 B;  2OPR A;  1WTF A;  3OW2 R;  2XHW A;  2LYV A;  4WK3 A;  1Y4Z B;  3EZO A;  3GFY A;  3IS9 A;  4YB6 A;  2DTJ A;  4TQS A;  4DV5 J;  1U02 A;  2DIU A;  2EKN A;  1U7L A;  3IFE A;  1Z2Z A;  3WX4 A;  1IKV A;  1HPZ A;  3J81 U;  2PI4 A;  4TY9 A;  2W9B A;  2VB6 A;  2AEM A;  2F7V A;  3D4J A;  4X65 J;  1H7X A;  3I5A A;  1XQI A;  3M30 B;  2JC1 A;  1SXL A;  4KIA A;  5F8M A;  4RNM A;  5HAN A;  4B9N A;  2WW4 A;  5IQ6 A;  4J91 A;  3CC7 S;  2ASY A;  3VQT A;  4MKY A;  2R2T A;  5EUH A;  2BE2 B;  2GIQ A;  1J5E F;  2OH2 A;  2VFT A;  2FHO B;  3VR1 A;  1WHX A;  2ALZ A;  1N48 A;  1S0O A;  2XLJ A;  2HKE A;  2LU1 A;  2J7K A;  4RKU C;  3BDE A;  2BKP A;  2KKH A;  5L46 A;  1M0S A;  3GQC A;  3UCU P;  2N7C A;  3UNG C;  2IC3 B;  4DR7 F;  1TAQ A;  2IM1 A;  2LP4 A;  4ZVE A;  1RA6 A;  4P10 A;  3CC2 S;  4KHP F;  1AT1 B;  4KJI A;  2VH7 A;  4N5S A;  3NMA A;  1X7V A;  2GV1 A;  2HRY A;  1AUD A;  2ZZM A;  2C2M B;  3MED B;  2R2U A;  5G4D A;  3PYD A;  4CLT A;  3CME S;  3RG6 A;  1DTT A;  2WVD A;  2OEM A;  1U2F A;  2EXU A;  4PXB A;  3G71 S;  3OLA A;  3AOD A;  1VQM S;  2GNK A;  2J8A A;  2FLO A;  2W2O P;  1H98 A;  1HNW F;  2K2P A;  3BO2 A;  3D3B J;  2DGU A;  5F8N A;  5AE2 A;  1MRO A;  3MGJ A;  4K4X A;  1QTM A;  2PO4 A;  4R5P A;  4QPT A;  4NXN F;  2J6S A;  3EDQ B;  2FYX A;  4K4V A;  3KJQ B;  1YI2 S;  2MSS A;  3JSY A;  2ZVS A;  4Q2M A;  4KRW A;  4EWT A;  3SYZ A;  2IVF B;  2AQ4 A;  1SH0 A;  3D67 A;  4K7Q A;  4F2R A;  1VIS A;  2IMW P;  3G8T A;  2QLF B;  5DDP C;  2IJF A;  1X4H A;  4HHU A;  5DDQ C;  3IWL A;  3TX0 A;  4ES1 A;  1CJU B;  5B0A A;  2QL9 B;  1XK8 A;  1TKX B;  1CSJ A;  2HVI A;  4KHP J;  5M2P A;  3FBE A;  2QLB B;  3A8K A;  2A10 A;  1F2G A;  3QBC A;  2RQK A;  4KGV B;  4JV2 A;  4N76 A;  2MXY A;  1S0V A;  2D3O R;  2NPI A;  4X64 J;  2YTC A;  3MMA A;  3BSO A;  1UVN A;  3Q2T C;  3MAQ A;  4DL2 A;  1T03 B;  1OWX A;  1O6X A;  1IR2 A;  2FB0 A;  2G4B A;  2HHV A;  3MR3 A;  3QT8 A;  3JQJ A;  1XEZ A;  1RWP B;  4X4P A;  2GC8 A;  1U1Q A;  3HVW A;  2OI2 A;  1DTQ A;  2BJ8 A;  1E6Y B;  4QR2 A;  2XMW A;  1NDP A;  4CT9 A;  2CQ0 A;  4QWA A;  2FJV A;  4ZJO A;  4DV1 J;  1FT8 A;  1VOM A;  3I96 A;  2KYX A;  5KFL A;  3R1L A;  2PMH A;  4F02 A;  2XMU A;  4ECT A;  3IA0 A;  3FCW A;  2FLL A;  2N4D A;  5CZX A;  3K0J A;  1RE1 B;  5DO2 A;  2QZ8 A;  1T9X A;  3IBF B;  1QD1 A;  3W9H A;  4A47 A;  2J6U A;  1EIY B;  5T41 A;  1N32 F;  1WDT A;  3N5F A;  4QWC A;  4JI4 F;  4J9V A;  3VF0 B;  4EGL A;  5ETN A;  2YY3 A;  3M8P A;  3MFH A;  5HLF B;  4RL1 A;  1KRP A;  4NXM J;  4TLQ A;  2I5J B;  3AB2 B;  5KAK A;  4M94 A;  3EM1 A;  1I1G A;  2GW8 A;  2HQD A;  4GVB B;  2F4V F;  4NLD A;  4YR3 A;  2KHD A;  3NGT A;  3W61 A;  3TQE A;  4X4R A;  1FRX A;  2E5G A;  2VG6 B;  3KLI B;  1UW4 A;  1ZBT A;  2PI5 A;  3GR0 A;  1UAW A;  5DLF A;  1PIL A;  2CQ1 A;  2GVZ A;  4TN2 A;  3V2U C;  4DMZ A;  4M5M A;  8AT1 B;  1KP6 A;  2L9N A;  3MM7 A;  3RRG A;  2H5I B;  3P6Y C;  1N33 J;  3L4B C;  5KG3 A;  2AHO B;  1EET B;  2E44 A;  3Q8V A;  3TEG A;  4EFA C;  2JHE A;  5DET A;  3G6X A;  2IRU A;  1RLC L;  2JNJ A;  1N5T A;  1ICE B;  1U2C A;  2DCL A;  2AJ4 A;  4C3L A;  3K59 A;  2CAD A;  1TFW A;  4Z2X A;  1WG1 A;  4RNN A;  2AX0 A;  3UFC X;  4ZDN A;  1DRZ A;  1ZAV A;  5AJ3 J;  3FUY A;  1OPZ A;  1D8Y A;  3H7H B;  1WC4 A;  3MM6 B;  2GHW A;  2ZUA A;  1MMD A;  3N0V A;  3C14 A;  2YQ1 A;  3QPI A;  4DFJ A;  5BJR A;  2DNZ A;  5I3Q A;  1RAD B;  2HVH A;  2GMH A;  2RS8 A;  5FDL A;  3UI3 A;  1K1Q A;  1H73 A;  2L08 A;  4KT0 C;  4L75 A;  4WFA Q;  4ED6 A;  1TTH B;  4UF4 A;  5HLF A;  1RAA B;  3TVK A;  2WW8 A;  5L9N A;  1CVJ A;  3DKD A;  1Q8B A;  1FTR A;  2KVI A;  3AJD A;  1I94 J;  4JI5 J;  2C2E A;  1VQ9 S;  4TQR A;  2VJV A;  1UPM B;  3ILJ A;  2VDH A;  3OBI A;  5K5M A;  4EYI B;  4ED8 A;  4NEY A;  4DWI A;  1NH7 A;  2R4F A;  3G82 B;  4K0K J;  4GKK F;  3EUN A;  1Y00 A;  4DCJ B;  4PPD A;  3MI7 X;  1HBN B;  1YJR A;  2NQP A;  3DLE A;  3BGL A;  1MWY A;  2OAU A;  1X5P A;  3SIP B;  1HLW A;  2QV6 A;  3BPD A;  3C16 B;  1TKT A;  3SCK E;  4NXM F;  1S1W A;  5KOX A;  1R8H A;  1TEL A;  4DXL A;  3P49 B;  2Z57 B;  2UXC J;  1YRX A;  2HFU A;  3I9V 9;  3O1L A;  5E5N A;  5HAO A;  1M5V C;  1DQA A;  3MMJ A;  3RAM A;  2RML A;  1JX4 A;  2IYG A;  1T03 A;  1S0N A;  4HT5 A;  2AYB A;  1J5O A;  3LPE A;  3UVJ A;  2IPO B;  1LK5 A;  2MZR A;  3JQK A;  1XTZ A;  1DHM A;  1T0T V;  2CQB A;  3CVK A;  2JJ4 D;  3IAS 9;  2GGP B;  2XHC A;  4ZP7 A;  3IG1 A;  5IFM A;  4L6V 3;  1TKX A;  2BX6 A;  3GV5 B;  3FSY A;  5ETK A;  3FRZ A;  3M6W A;  4C0H A;  1L3U A;  4DDF A;  2NYH A;  2OEK A;  3CJ3 A;  2Y3Y A;  4ID5 B;  1IM6 A;  1Q53 A;  2V8D A;  4MIW A;  2XG8 A;  4W4M A;  3EGN A;  2DNM A;  2PT0 A;  2YNG A;  4ECW A;  1PO6 A;  1S6Q B;  1DLO B;  4OLP A;  5KFZ A;  3KLF B;  1DY3 A;  1ZM3 A;  2I0X A;  4NEZ A;  2Y0B B;  2CZV C;  1U6B A;  5KFE A;  3BBB A;  4IYQ A;  3PR5 B;  2HRU A;  2OD4 A;  3VGV A;  5I3U A;  3Q24 A;  3ZNJ 1;  3M7V A;  2G0I A;  2GZO A;  3PRV A;  4O23 A;  4KV8 A;  1H7W A;  4NE9 C;  4EMD A;  3MHY A;  3JSM A;  4YR2 A;  2HNY B;  3GIR A;  3LAK A;  3MM5 B;  4DQQ A;  2HPU A;  4TNO A;  1BQM A;  1X4E A;  4C11 A;  2B4U A;  1IKW B;  2BE9 B;  3EE3 A;  1F9H A;  3O44 A;  4KV8 B;  4F04 B;  1IR0 A;  2DEJ A;  5K8P A;  2HS3 A;  9RUB A;  3KK2 A;  4A8Y A;  2RDD A;  1OPI A;  5I3U B;  2BRL A;  3CJT A;  4DQR A;  2KFZ A;  4DQI A;  5HSP A;  2PDA A;  3KLF A;  3PKY A;  1LEO A;  2O5D A;  3FQL A;  2HWH A;  2HFZ A;  4KGZ B;  1C2P A;  4CQ1 A;  4LF1 A;  1S6Q A;  2DRA A;  2MLZ A;  3R5D A;  4TU8 A;  4X66 F;  4OYW A;  2GQC A;  4IH6 A;  1WEX A;  4JI3 F;  5A8W A;  5ETS A;  3UQS A;  2BE2 A;  1PBA A;  4XDC A;  2BA9 A;  3SSS A;  5KFP A;  2OD6 A;  3J7A 1;  4PQU B;  4KKO B;  4AD6 A;  4Q0B A;  3MAH A;  1FX2 A;  2PC6 A;  3T9N A;  1NAQ A;  1KON A;  2LKZ A;  4PXC A;  5CAB A;  2YQ0 A;  3NY0 A;  4UZC A;  3QYY A;  3UVJ B;  2W9B B;  1OMS A;  2LDI A;  3OFF A;  2GQ2 A;  1T9U A;  2DNP A;  4FYV B;  3K58 A;  2VHG A;  1R0A A;  4RW7 B;  1JMT A;  2LEA A;  3PYE A;  5BYS A;  1RAC B;  4O0I A;  4DOZ A;  2VOP A;  4AXI A;  2XC9 A;  1RT5 A;  5D4O A;  1RHK B;  2I38 A;  5D4L A;  4Q2L A;  5KFG A;  1VQP S;  1XJW B;  1IBC B;  1WUU A;  2HVE A;  3MCS A;  2FZG B;  3BEG B;  4BCA A;  2DRD A;  2ROG A;  1UJ6 A;  4P2X A;  3US5 A;  5A8R A;  4CM2 A;  1S6O A;  3DLG B;  5AE3 A;  2XMV A;  3AFG A;  5L1L A;  1XNR F;  3RAX A;  3QRQ A;  1HI8 A;  2X1B A;  5C42 A;  4B3R J;  3M8R A;  1F0X A;  3RR7 A;  1SKR A;  4ZCI A;  1Y3J A;  4I7F A;  1RYR A;  2FJW A;  1NK4 A;  4ELT A;  1UJ5 A;  3N28 A;  3KKF A;  3OVA A;  5RUB A;  5IM0 B;  3VZH A;  2QA4 G;  1VQO S;  2HNZ A;  3MM8 A;  5J2Q B;  2J0W A;  1JXL A;  2HBR B;  3EVW A;  3RBZ A;  2GS8 A;  4H4M B;  1LWE A;  2XZD B;  3TQ1 A;  1SV5 A;  1FEH A;  4C8L A;  2CPX A;  5CQG A;  1U8W A;  2DR6 A;  3FJ2 A;  3H5X A;  2XMA A;  3GMG A;  4O44 B;  5C2C A;  2JRS A;  4FXD A;  1XNQ F;  4DR2 J;  3KMS A;  1VQK S;  1ROF A;  2W4D A;  2Z4P A;  3M32 A;  4X4V A;  1U8S A;  2B9E A;  3TZW A;  3TAP A;  3KJV B;  3T1H F;  4Q43 A;  4ZPV R;  3QFW A;  1U2R A;  3GYX B;  4C98 A;  4LF4 F;  2CZ9 A;  4ZPW R;  3GJQ B;  1EQ0 A;  3WQP A;  5D4P A;  2J9C A;  2Z58 B;  4JI3 J;  4LF8 J;  4RZR A;  2P9C A;  1EET A;  4NML A;  2P9G A;  3F73 A;  3KNG A;  2I2Y A;  1OSC A;  3S6E A;  2HG4 A;  2DH8 A;  5D6G A;  1C1B A;  2POK A;  4WK1 A;  3R5J B;  1S7I A;  3AJ2 A;  2J9D A;  2XS2 A;  3CWJ A;  3D66 A;  2WVC A;  4ECQ A;  1YBA A;  2OTJ S;  3BF4 A;  4DS4 A;  4ZP9 A;  5IT9 U;  5I3P A;  2A2D A;  4OFZ A;  2ZBP A;  4GVB A;  3GFH A;  4OZ3 A;  3EWG A;  4B3O B;  3HHL A;  4ZCK A;  3MEE A;  5HRO B;  2XM3 A;  1QDU B;  4NYZ A;  1S59 A;  4C0O C;  2B56 A;  1HBM A;  2PMZ D;  3J7Y I;  1HMV A;  4LFB F;  2UV8 A;  3QGH A;  3W63 A;  3K5O A;  3M9O B;  1BUX A;  2CJ9 A;  3B4M A;  1CC8 A;  1VYA A;  2F3J A;  1LW2 A;  3CCV S;  4UOG A;  2DR5 A;  3TAQ A;  2BBE A;  1WKJ A;  2R8G A;  2NSB A;  2CZ4 A;  5K8N A;  3DI6 A;  3FBF A;  1Q4R A;  4CRJ A;  1RAB B;  5CYQ A;  1C4C A;  5LXR A;  1FK9 B;  4DQS A;  1F5A A;  4ZVH A;  2QA1 A;  4JUZ A;  2M2B A;  1TL7 A;  3IO1 A;  3AY0 A;  2HFS A;  1G4C A;  2YXL A;  3T6B A;  1PCA A;  4KO0 A;  3Q89 A;  1S9E B;  5E33 A;  1KFS A;  3AD9 C;  1R89 A;  4XIU A;  2MKJ A;  4LFA F;  2KZZ A;  2HLT A;  3WX8 A;  1I51 B;  4NZ7 A;  5B0D A;  5SUH A;  3G96 A;  1M5K C;  4IO1 A;  1LWC B;  2CPI A;  3UO0 A;  2YKO A;  1HKA A;  1KWM A;  1XC9 A;  2ASJ A;  2YNH B;  3K89 A;  2KT3 A;  3EIC A;  2ROE A;  1EJ7 L;  4CT8 A;  5L9X A;  4UQT A;  3RB6 A;  1Q86 T;  1X4F A;  3VGS A;  3G8Q A;  4RJV A;  4UUX A;  3C3L A;  3QRR A;  3FEZ A;  2UUW A;  1HNV B;  4FDF A;  1RWM B;  2YKQ A;  3DRR B;  5KT5 A;  3QJL A;  2IJR A;  1REV B;  1N88 A;  2QSW A;  1RWK B;  5KFW A;  1RHU B;  3SMZ A;  3U1L A;  1YZ6 A;  1LFW A;  4QOT A;  4UZB A;  1N4L A;  3C6U B;  2VC1 A;  4CM0 A;  5D15 A;  1NPK A;  4ICL A;  5KFQ A;  2UUA F;  2K7J A;  4WFX A;  4CLU A;  3CJ8 A;  3KHH A;  1YWX A;  2ADB A;  3NCQ A;  4PXE A;  4ZPA A;  4CO1 A;  1S1T B;  1VR6 A;  4ZIV A;  1C1C A;  2BAN A;  4DV0 F;  3TW0 A;  1WF1 A;  5IV4 A;  4CDI A;  1V5V A;  2X7I A;  3ETM A;  1N0U A;  1KD1 T;  5L39 A;  2F63 A;  1VRU B;  2F8M A;  2LXI A;  3GYN A;  3FDS A;  3IP0 A;  4PYD A;  4QYZ J;  1X4G A;  2RJZ A;  4DUT A;  3E8O A;  1RWV B;  2FVS A;  4P6Q A;  2RUS A;  1S1X A;  5HI7 A;  3LGH A;  5KFV A;  1P9Q C;  2MLX A;  4LSL B;  5DDO C;  3KDN A;  4P75 A;  1N5V A;  2RD5 C;  1FWL A;  3MEG B;  4NPO A;  2AZ3 A;  4X4Q A;  2W01 A;  2XGQ A;  3KXD A;  3MEC A;  4L76 A;  5IV3 A;  4EBC A;  1QLN A;  5F9L A;  1MU2 B;  4ES3 A;  3M2U A;  4RW6 B;  5LL6 d;  2OJ3 A;  5HQM A;  1YRT A;  2IAJ A;  3CJQ A;  2ZDO A;  3K7R A;  4P2M A;  2LEB A;  1N5Y A;  4OMF G;  3M6V A;  3QWP A;  2AJ2 A;  2KXF A;  2LQ5 A;  3IM8 A;  4DCO B;  2CPE A;  2AWZ A;  3CD7 A;  1NK9 A;  2FHJ A;  2G0J A;  2VUG A;  3QFH A;  1AW0 A;  2GHV C;  3OR2 B;  4XAK A;  4YB7 A;  2ZJP Q;  1HWL A;  4WZQ A;  2F4V J;  4HAC A;  2DHG A;  1HHQ A;  1RXO B;  2IIH A;  3FCV A;  4WU3 A;  2AGP A;  3IWX A;  4LUB A;  4X4O A;  2CG8 A;  2B6A B;  4KR0 B;  1HNI B;  1YX2 A;  3GTY X;  1UVM A;  3V4I A;  4L3N A;  3T6J A;  1SJ4 P;  4PUO B;  5J1N A;  4K2X A;  2VQF J;  3M8Q B;  5DM7 Q;  5B7W A;  2VA3 A;  2HW3 A;  1ZYQ A;  3V6H A;  3HKZ D;  2N3L A;  2RRA A;  4JI0 J;  2NLW A;  2MKI A;  3HVR A;  3P5B P;  4A4J A;  2YX7 A;  1SQF A;  4RBU A;  1S79 A;  5KFJ A;  4DV6 J;  3AAW B;  3D6T B;  2FLN A;  4F4W A;  5A8K A;  2JL9 A;  3BM7 A;  1S9G B;  4M5N A;  2K7K A;  1SKW A;  1XMQ F;  2JOQ A;  4B3M F;  2BQR A;  2XCP A;  3ISZ A;  2GIR A;  2MDA A;  3TJA A;  4F4K A;  5C5J A;  3CPW R;  2D3Z A;  3VGU A;  3QIP A;  4IH7 A;  2HHH J;  2VFR A;  5KG4 A;  1J27 A;  3HHE A;  4BS2 A;  1IBK J;  2XO7 A;  3SEO A;  4ED4 A;  1L3S A;  1DAR A;  2CAJ A;  2E1R A;  2ZIT A;  4USK A;  4DN0 A;  4YUD A;  5F8G A;  3THV A;  3CDB A;  3P8B B;  1Z2L A;  1NPR A;  2QE5 A;  3OXG A;  5T7L A;  2BM1 A;  4IOC Q;  3DRX A;  5GAG U;  1C0T A;  5KFS A;  1TU0 B;  2VFU A;  3A12 A;  1BHN A;  3H5U A;  1X4B A;  3GSI A;  3LPY A;  1S9G A;  3HZG A;  3NP5 A;  1XNR J;  2A6O A;  1VRQ C;  3HJV A;  1FKO B;  3DRS A;  4NLU A;  5JXS A;  4CH0 S;  4CTA B;  4YHH J;  4EBD A;  2N4C A;  3D0G E;  1FNO A;  3B82 A;  1EB0 A;  1RCO B;  2RT3 A;  2RKI A;  3FZB A;  2E66 A;  4FYX B;  4XTT A;  2VC0 A;  4ZVT B;  4K4W A;  1G6B A;  4FYW B;  1S49 A;  4ECY A;  4ZN1 A;  3EZ5 A;  3GG0 A;  5E3R A;  4J9Q A;  4ED1 A;  4LF6 F;  2ZH9 A;  1VQS A;  2KJW A;  1TQL A;  3MDF A;  3I32 A;  3TX8 A;  2E7V A;  4OYI A;  4PG4 A;  4ZA1 A;  2HHH F;  2HQG A;  2B6A A;  3DMJ A;  1RT4 A;  4AL5 A;  5GAE I;  2IY5 B;  1WTB A;  2AX1 A;  3VAM A;  2MQM A;  3SCJ E;  4P7T A;  2BM0 A;  1V9O A;  3MXH P;  1B70 B;  2DGW A;  5L8R C;  4H4K A;  3Q8S B;  4U6P A;  1JJ2 R;  1K8A T;  1NU4 A;  1RWX B;  3CCU S;  4CLK A;  5GMD A;  5ITH A;  1W7W A;  3NRB A;  4XO0 A;  4J7C A;  3DLH A;  3BSC A;  2V9K A;  4DCP B;  3IRW P;  3NKY A;  2JDJ A;  3NCP A;  3RZA A;  2CQG A;  3MM9 A;  3GV7 B;  5E3Q A;  3THP A;  4OL8 A;  2HFN A;  1RT4 B;  5IC6 B;  1YK9 A;  1LW0 B;  1XBW A;  4X84 A;  4EU0 A;  3CF5 Q;  2B9Y A;  3DDI A;  1JLF A;  4FYY B;  2BJ3 A;  3PJ9 A;  4MT1 A;  4XDD A;  2NPF A;  1VQ8 S;  2JEI A;  2DBB A;  3VV2 B;  1WC3 A;  2KRR A;  4LRE A;  1U1M A;  4LFB J;  2KO1 A;  3DC2 A;  4NYO A;  1VQL S;  1FJC A;  4DV7 F;  1SJ3 P;  4A8M P;  2WRM A;  3FBC A;  1MWQ A;  4NLS A;  4CZC A;  5CD4 A;  5BYQ A;  1VBZ A;  3NL0 A;  2F8E X;  4PAA A;  3HM9 A;  1H2T Z;  2HWT A;  5J2M B;  5DG7 A;  4CO3 A;  3TOQ A;  1S0M A;  1YG0 A;  2RQM A;  5A2Q U;  1X8D A;  3MF5 A;  4LSN B;  3IMQ J;  4OQJ A;  1CQM A;  2V4J B;  1SJF A;  3HCX A;  2X3D A;  1H0H B;  5FLX Y;  3CCL S;  2J0S D;  2ZWO A;  3BH6 B;  3OTO F;  1KQS R;  3QLH A;  3SQG A;  3R7N B;  2E9T A;  1A6L A;  4LFA J;  2H9Z A;  3OVB A;  5EDW A;  2LVW A;  3X3U A;  3T5H A;  1S97 A;  1HYS B;  4OYM A;  2AU0 A;  2BYC A;  2EI5 A;  2H1Y A;  1FI4 A;  4DR3 J;  3FK4 A;  4TVA B;  5G0R B;  3PIO Q;  3RBD A;  4USI A;  4K4U A;  3M1V A;  4OZ1 A;  2C3U A;  2QL5 B;  3DYA B;  3I56 S;  5EX0 A;  4NLP A;  3GIL A;  1WNE A;  2E5H A;  3R5A A;  5DDR C;  1S6P B;  1PIE A;  3D1H A;  4WPA A;  4B9L A;  1KOO A;  1A7G E;  4X62 F;  2CQP A;  1S9E A;  5B0C A;  3AA8 A;  2GJI A;  2XWX A;  2PGC A;  4KGM A;  3JQM A;  4O4G A;  1TL5 A;  1JLG A;  4CO0 A;  4CLP A;  2DH9 A;  4CLW A;  3CIZ A;  1X60 A;  1NO8 A;  1KFD A;  2XZW A;  4J9N A;  1HW9 A;  4ILR A;  4J5O A;  3SQO P;  1RU1 A;  1FEE A;  2OPQ B;  2VD3 A;  4GO5 X;  2WSF C;  3QZ7 A;  3MR2 A;  1L3T A;  4LMZ A;  4V19 J;  3HSD A;  1L3V A;  4HAC B;  1U24 A;  5F3T A;  1UFK A;  4ZHR B;  4EZ9 A;  4F2S A;  1ARO P;  1IQT A;  1NKB A;  1SQG A;  3JSR A;  1XER A;  1HBM B;  2QT7 A;  3R3T A;  4J9L A;  2DT9 A;  2FLP A;  3V4M A;  1RT2 A;  5JUM A;  2FHJ D;  2MQ8 A;  1ITP A;  1NHU A;  2ZE2 A;  3JXO A;  4ER8 A;  2I6W A;  1HBU B;  3FVY A;  2AJ1 A;  3J7Y U;  1YBT A;  2AGO A;  1UVI A;  1UJ4 A;  2Z30 B;  1CS4 B;  2ABY A;  2JVO A;  1X31 C;  4O3S A;  3OHB A;  4LF9 F;  1RBO B;  5D77 A;  4OYZ A;  1HQE A;  3HXM A;  3QNW B;  4OJH A;  4G1Q B;  4RPF A;  4USW A;  4Z7C A;  1RBL A;  3ZXW A;  1UWB B;  3M05 A;  2APO A;  1U1P A;  4JI2 F;  4QWE A;  1S76 D;  4UOH A;  3DRP A;  2KVQ E;  1S1X B;  5HBM B;  1U49 A;  3DLB A;  4JI8 J;  1S6U A;  2MY8 A;  2Q1L A;  1LXJ A;  1NJZ A;  1VRU A;  4JI6 F;  1P27 B;  1YJV A;  3G4S S;  3BKU A;  1NK8 A;  3DU5 A;  1UEU A;  3FKB A;  1G2E A;  4RBV A;  1N56 A;  2V34 A;  2RHQ B;  2V4Q A;  2ALY B;  5KFA A;  1IM4 A;  2QJ3 A;  2BW7 A;  1V3Z A;  1HNZ J;  3ENA A;  2D74 B;  4JP8 A;  1U1N A;  5MLC V;  3KDO A;  2EW9 A;  1JIH A;  2HGN A;  3O3L A;  4PWW A;  4IO9 Q;  5E3A A;  4ATN A;  4I6A A;  2W9A A;  4ICL B;  4DFK A;  4DFP A;  3PIP Q;  3GZ7 A;  3T5K A;  2EG1 A;  2O67 A;  4H4M A;  3C6U A;  1UA1 A;  2P5V A;  1N34 F;  2WVB A;  3G86 A;  2F1F A;  1NK7 A;  2HAI A;  3W9J A;  4JYA F;  4Y2C A;  1NBE B;  1ZS6 A;  1SKU B;  1TKZ A;  3R27 A;  1QE1 B;  1T9T A;  1RAE B;  1UEK A;  2ZBI A;  5FII A;  2Y8W A;  3OSN A;  1R31 A;  4O3O A;  1OYE A;  2HK2 A;  3RRK A;  2DEI A;  4MIB A;  4HT7 A;  4CYU B;  1FDB A;  3VQS A;  1RHM B;  1WHW A;  3GE9 A;  3IXQ A;  5KFU A;  4IFV A;  5KFC A;  4KTQ A;  2J76 E;  4DUY J;  1E6V A;  3SFG A;  2ZOG A;  3LGN A;  2WON A;  5DS7 A;  1JK9 B;  1XMO F;  3KK1 A;  1QAY A;  2P2C B;  4N47 A;  3WHI A;  2OSQ A;  4HTI A;  1F6T A;  4MK7 A;  2CQ3 A;  3ZTO A;  4CLZ A;  4Q0B B;  3W8P A;  1BGX T;  1Y10 A;  2BJ9 A;  1JLE B;  3THT A;  3W65 A;  3OL8 A;  4PQU A;  2KL8 A;  2PE8 A;  1N34 J;  5GME A;  2OML A;  5ETR A;  4ENO A;  2GQQ A;  1KEK A;  1XMQ J;  1JWW A;  1B3T A;  2HBQ B;  2HQF A;  4TYB A;  3BO4 A;  4HDG A;  4KYZ A;  4PR6 A;  2HS4 A;  4F25 A;  1HMV B;  4FN5 A;  3BGU A;  4KB7 A;  4MYU A;  4U96 A;  2XI2 A;  4DSL A;  2FVR A;  2WOM B;  4ECS A;  1Y9O A;  3H4D A;  3EGV A;  1RHJ B;  4EO8 A;  4LF5 F;  1FFG B;  3CCJ S;  1HNZ F;  1HQU B;  3N5B A;  2MQQ A;  3I4H X;  3MMC B;  4NLQ A;  2QC3 A;  1QSS A;  3KK2 B;  2WB4 A;  2DR8 A;  1RIS A;  4LF2 A;  1NSP A;  3G6V A;  2AGQ A;  3ITH A;  1TAU A;  4F4Y A;  2UUB F;  1MW7 A;  4ZPD A;  4ED2 A;  3NMR A;  3HHK A;  5DM6 Q;  5KG2 A;  2AIR B;  1CLF A;  3PAC A;  2MLY A;  2ZD1 B;  5F8H A;  3SSQ A;  1YIT S;  2RUG A;  5KG6 A;  1OY6 A;  2XWY A;  2YX1 A;  4DR4 J;  1PYO B;  4IG0 A;  4DX8 H;  1IUJ A;  2UUC J;  4O3Q A;  3WIV A;  5B0F A;  4OX9 J;  2YPY A;  3CDA A;  3LGM A;  1HA1 A;  1DLO A;  4I69 A;  2YNF A;  3MUV P;  2FJB B;  1JXV A;  3JTP A;  4ZOS A;  3PW7 A;  3H20 A;  5JVH Q;  1R43 A;  1HAR A;  3H59 A;  4TY8 B;  3ZO7 A;  4DPU A;  4NYP A;  1UPP A;  2CNO B;  1S5Z A;  1X0P A;  5HMZ A;  4W90 B;  2W4P A;  4FKY A;  2B3T B;  3OTC A;  1N36 J;  2GGP A;  3BH7 B;  3VCD A;  1T9Y A;  2ACM A;  2BRK A;  5J2N A;  1K47 A;  1RTI A;  4JB8 B;  4PPZ A;  3BQ1 A;  1RYS A;  1QSL A;  1CQN A;  2H4W B;  4MJK A;  3W64 A;  3KLV A;  4LRD A;  4URG A;  2OHD A;  4C7Q A;  2WBM A;  3C19 A;  5ADZ A;  3P5T L;  4A8F A;  2ZZT A;  2YVS A;  3MTJ A;  1Q16 B;  3D6M B;  1CJT B;  1RLD A;  4OI4 A;  1KTV A;  3E3X A;  3A8J A;  4GMK A;  4RW9 B;  1FCA A;  2GA7 A;  3PVX A;  2KJV A;  5FLX U;  2YPZ A;  3CMA S;  4X4U A;  2IA6 A;  3SFU A;  4DI6 A;  1UVJ A;  3Q8Y A;  4F8R A;  3NBP B;  3K57 A;  1YKW A;  2CPD A;  4DSF A;  3ELH A;  2AKW B;  3HHL D;  4UST A;  4GVL A;  2VG5 A;  2UVR A;  3KG0 A;  3DN9 A;  1VQN S;  4FKX A;  1HWJ A;  2DHX A;  4I2P B;  2CJK A;  5AXK A;  5J2N B;  3SDE A;  1JLQ B;  1N8R T;  2RS2 A;  2OTL S;  4B9U A;  2MZJ A;  1WF0 A;  2W25 A;  2Q6C A;  1HFE L;  4K8R A;  1Z4U A;  1DJ0 A;  2G2Z A;  1WAC A;  3EDR B;  1OYD A;  5EWG A;  4NCG B;  1B99 A;  1EP4 B;  4OX6 A;  2VOD A;  4QCL A;  5F41 A;  3LA0 A;  3CD5 A;  3ZZT A;  1FXL A;  3CDW A;  2AJ0 A;  1P6T A;  3DM2 A;  2LQJ A;  2NUU G;  4X65 F;  5EN1 A;  1YHQ S;  2YNF B;  3NS6 A;  1TV6 A;  4YY3 J;  4YME A;  5GAD I;  3PW0 A;  1QAI A;  2C2D A;  2IM3 A;  5KFT A;  4DBQ A;  4N77 A;  4LT6 A;  2O1P A;  4WYW A;  1NSQ A;  3R8Y A;  2DPJ A;  1FER A;  3BBF A;  4WE1 A;  3TI0 A;  1J5E J;  3FCH A;  2OP5 A;  1LQ9 A;  1JLA A;  2IBO A;  2LA4 A;  3TUI C;  1S1U B;  4F7V A;  4ECV A;  3CCT A;  4C11 B;  2RDI A;  3ITH B;  3LH2 S;  1AZS B;  5ETV A;  3KLI A;  3JSM B;  1RQ0 A;  4OZ5 A;  1RTD A;  2OFH X;  4QYZ K;  1HQU A;  4KGK A;  2V2Q A;  3AQO A;  2M8H A;  3HHL C;  3OV7 A;  4R0J A;  2B4P A;  3D7S B;  5E7O B;  4LRC A;  2V50 A;  3U27 A;  2WOM A;  3BO3 A;  4AL6 A;  1F60 B;  3D0I E;  3E01 A;  2G1D A;  1K9M T;  4LFC J;  1F5B A;  1RAI B;  2F9J A;  1M5S A;  1D9A A;  5B08 A;  5HMX A;  3MUM P;  1IJE B;  2ZNZ A;  4OJ1 A;  4N41 A;  1HWI A;  4I64 A;  4DR1 F;  2BQU A;  1WOP A;  3HT0 A;  2UU9 F;  5HK4 A;  2IRY A;  3AQP A;  1FF2 A;  2BMB A;  1EAY C;  2RU3 A;  1WG5 A;  2JH3 A;  2H48 B;  1PYS B;  3F44 A;  1F1B B;  3GG1 A;  2Z2M A;  1NLK L;  3GON A;  4J9U E;  5HVF A;  2FC9 A;  3KK1 B;  4JI6 J;  3GWC A;  1KQF B;  2ZOM A;  1JB0 C;  1R0C B;  2H4Y B;  2KYZ A;  3CDU A;  3I87 A;  1P9Y A;  1E6V B;  1T9W A;  2EK6 A;  2GO8 A;  4HH0 A;  1VRT A;  1M1G A;  3ENW A;  3MPW A;  3IAM 9;  3N4W A;  4I2Q B;  4LIW A;  3VHQ A;  2R8H A;  4MFB B;  2BDP A;  2BZ2 A;  4J9S A;  2CFX A;  3D1O A;  3C16 A;  2XY5 A;  2NYI A;  1HBO B;  2HVD A;  4ECZ A;  3TUZ C;  5F8I A;  2A0F B;  4Q45 A;  2EBE A;  1TKZ B;  3EX7 B;  1OY9 A;  3DRY A;  4OV1 A;  2OMO A;  1IQZ A;  2MHN A;  3KLG A;  4DS5 A;  5D0H A;  3U1N A;  1A0O B;  1C4A A;  1JLC A;  1NCL A;  2JWN A;  1FA0 A;  4DL6 A;  2HZV A;  4LRB A;  1UP1 A;  2QEX S;  3OTO J;  5I4M A;  3LTO A;  1GX6 A;  3PJX A;  4QQB A;  1FES A;  3BKT A;  3MMB B;  1GTE A;  1H2V Z;  2DXE A;  1KQK A;  1SKS A;  2QO3 A;  1UET A;  3C14 B;  3ET6 B;  3TZX A;  3R97 A;  4MIA A;  4U9R A;  2KFN A;  4FNH A;  1RTD B;  1MRO B;  2BXJ A;  4C8O A;  4DUY F;  3UD3 P;  1Q5Y A;  1VK8 A;  1KHV A;  5JJB A;  4B9M A;  4DV5 F;  2EVZ A;  2Q6B A;  3CE8 A;  2QLX A;  5C2G A;  1R8P A;  1RWO B;  1WG4 A;  2VF3 A;  3BR8 A;  3J80 U;  4NX9 A;  4DR5 J;  4DV3 J;  2Y1I A;  3VAK A;  4DV2 J;  4DX5 A;  2OLW A;  1GXL A;  3VAJ A;  1ZTW A;  5HBM A;  3D6H B;  1TK5 A;  1GMW D;  2AF6 A;  2R42 A;  3QO9 A;  3G9C A;  1NJW A;  4U7C A;  4OZJ A;  1KKH A;  3FGV A;  2U1A A;  4IG3 A;  3HT3 A;  4FS2 A;  2E5J A;  1RT6 A;  2XYG B;  3M8W A;  1HQE B;  2HZC A;  1BMQ B;  1YBU A;  4MKB A;  4ZVR B;  1D9D A;  4OLO A;  1CS4 A;  3AOC A;  3OD2 A;  4P73 A;  2AMC B;  2BEF A;  2E5I A;  3AH6 A;  1NJX A;  1EP4 A;  1MLA A;  2I5J A;  1FD2 A;  2FHM A;  2ZE2 B;  4LF7 F;  4I68 A;  1NDK A;  2BE7 D;  4F0K A;  3R9L A;  2F4F A;  3N6L A;  4ZVP B;  1Q8I A;  2AW0 A;  1Q79 A;  3UR3 C;  1YJN S;  3O8W A;  1SVD A;  2DJW A;  3T19 A;  3CD6 S;  1MNE A;  1XR6 A;  2F5G A;  2M4M A;  3DLK B;  3MR7 A;  4DU8 A;  2QLW A;  1Q0N A;  4WKY A;  3DHW C;  2KFY A;  2IJN A;  3DLL Q;  5A2Q Y;  4AYB D;  5D3G B;  3AOA A;  1FDA A;  3QT5 A;  4QBU A;  3OJU A;  1S10 A;  1XWL A;  4I0W A;  3MR5 A;  2RIJ A;  5DLG A;  4K4T A;  2KI2 A;  4KHM A;  4C3M A;  3TJ8 A;  2C2O B;  1LWX A;  2YWK A;  5LOQ A;  4MYT A;  2Y1R I;  3AT1 B;  3JAM Y;  1RTH A;  4GC7 A;  4DL0 C;  1RT7 A;  2EK1 A;  2DGQ A;  4Y2I A;  4ZLN A;  3NLC A;  3M1V B;  4RU9 A;  2ATC B;  2XSJ B;  4BWJ A;  3IR7 B;  4DG1 A;  3KUE A;  5EHH A;  3CJS A;  3MZI A;  4I1T A;  5L38 A;  1YJT A;  1TVR B;  4E98 A;  2ZJR Q;  3FFI A;  1FJG J;  2DD8 S;  2CJB A;  3D1Q A;  4O3P A;  1R8B A;  1P1L A;  4X64 F;  3GJR B;  4V1A k;  5DZ7 A;  3T9Z A;  1U1O A;  4YDX A;  3NGK A;  2WK4 A;  5E3P A;  3WDO A;  3QJJ A;  2CJA A;  2QRR A;  3ZZP A;  2ZBC A;  3BGR A;  1JLB A;  4DR1 J;  1I6J A;  1FX4 A;  2JFD A;  3C6T B;  4KE5 A;  4NZ0 A;  4RNH A;  5HMW A;  2YKN A;  3R7B B;  3CCM S;  1U47 A;  2GAG C;  4DV1 F;  1RWN B;  1M90 T;  2FJX A;  1UFW A;  2VG7 A;  4LF7 J;  1R8A A;  1H72 C;  1D0E A;  1RAH B;  3IWN C;  2WSC C;  4NA3 A;  4RUH A;  4IRK A;  2ZM6 J;  1FVQ A;  1U6Z A;  2FDN A;  3BGR B;  2R2S A;  2BAB A;  5ETM A;  3UDV A;  2DHA A;  2LXF A;  3PG9 A;  4L72 B;  5IT0 A;  3P4U B;  3LW5 C;  2WSE C;  4UOF A;  4ZVG A;  1N54 B;  3N79 A;  2PFD A;  2E5L J;  2ZH6 A;  2HMI B;  4HKQ A;  1PJ6 A;  2BOP A;  3I9Z A;  1FJG F;  3RB0 A;  1EHW A;  1UWA A;  2IC3 A;  2IVY A;  4DL5 A;  1NK6 A;  1BC6 A;  3Q23 A;  3I5C A;  3KG4 A;  2B9X A;  1ACM B;  4WP8 A;  3KJF B;  2XCA A;  1TFY A;  3NOG A;  4L73 A;  4GC6 A;  2C3O A;  4YS2 A;  4QZV B;  3M2V A;  1JLE A;  4UOC A;  1NK5 A;  1HI1 A;  2DHH A;  4CNZ A;  4ZCM A;  1EAR A;  3BGO P;  1TK8 A;  2PFF B;  5KFI A;  4UQG A;  2YH1 A;  4FF1 A;  4C8M A;  5DQI A;  1LOU A;  4OZ2 A;  2CPF A;  3D9B A;  3DMJ B;  1ZM2 A;  5KG5 A;  3NWG A;  2NZC A;  4JV5 F;  1WKK A;  2XMM A;  2BOA A;  2CKW A;  3NG8 A;  4JI7 J;  4G3I A;  2KG1 A;  4NI2 A;  1T02 A;  3DOM B;  4RX6 A;  2QA4 S;  2QN6 B;  2UVW A;  2MY7 A;  1X4C A;  3PKM A;  1YDL A;  1BQN A;  1HR0 F;  1Z1Z A;  3MPY A;  3NOC A;  1FKP B;  1W25 A;  4W98 A;  4WP9 A;  3TVY A;  3JYT B;  1R27 B;  5F8J A;  1RU2 A;  4CTA A;  1SL0 A;  2VPZ B;  1QUV A;  4EI2 A;  2ZWP A;  3V6D B;  2UU9 J;  5DG9 A;  1PSD A;  5DGB A;  5BR8 J;  1WJ9 A;  2V0N A;  2DK2 A;  4K2J A;  4GKK J;  4C4W A;  4NLW A;  4YB5 A;  4C97 A;  1HQ2 A;  1RUS A;  5IWA J;  3WBZ A;  2E1C A;  3PEH A;  4FYD A;  2ZDP A;  4NLR A;  3WZ0 A;  4C0B A;  2DY1 A;  2V68 A;  2ZKT A;  1N36 F;  3PEJ A;  2HHX A;  2QYC A;  2AEF A;  3M2R A;  5GMK a;  5KT4 A;  4J9O A;  5KFD A;  1UCN A;  4ANC A;  1QAJ A;  3L7O A;  2X51 A;  2CQ2 A;  3EJM A;  4W92 B;  4WBF A;  2RRB A;  2HYI B;  2IVM A;  2DGX A;  1OQ3 A;  2B8P A;  4Z7Y A;  4HTJ A;  3PHT A;  1TMJ A;  3QGP A;  4H4O B;  1UTA A;  2W2P P;  3A13 A;  3SBM A;  5C25 A;  2AJQ A;  4DR2 F;  1PJ5 A;  3MOZ A;  4AQY J;  1HNW J;  1W26 A;  2K1R A;  3A1Y G;  4MTP A;  3CCS S;  3HVT A;  5HO4 A;  3Q8P B;  4BLG A;  3GYG A;  3N6M A;  3CUN A;  4KHR A;  3LAM A;  2KH9 A;  5IXU A;  3A4T A;  1N5Q A;  2MZS A;  5KFK A;  1VIO A;  4PUO A;  1JLC B;  4NLO A;  1TUG B;  5IWA F;  3LAL A;  3HX9 A;  3ZZU A;  1HNI A;  3HUL A;  3UE2 A;  5D8H B;  4OHW A;  4WJB A;  1O51 A;  1JJH A;  4PG5 A;  3G6E S;  1LV5 A;  2VQE J;  2XI3 A;  2R7V A;  1VBX A;  1Q8K A;  3LO3 A;  1EZZ B;  1HR0 J;  3OR2 A;  1U0S A;  5KT7 A;  5HL7 Q;  4ZLL A;  2DKO B;  1FD8 A;  4BDP A;  3LP0 B;  2X1A A;  2Z2Y B;  2IA0 A;  1YJU A;  3LOU A;  2VFS A;  3CO0 P;  5BR8 F;  4NXN J;  2B7B B;  2CUY A;  3M8Y A;  1JLG B;  1FRL A;  1MU2 A;  3D5M A;  2V8V A;  4PAB A;  3HP6 A;  3V81 A;  1U1L A;  2EKY A;  4BWM A;  4IDK A;  1V3S A;  5IS2 A;  2EPI A;  1SUQ A;  3R5B A;  3UCZ P;  2GAH C;  1X5S A;  2CPY A;  2A18 A;  4FS1 A;  3GU0 A;  4ECX A;  4LSL A;  4OX8 A;  2M3D A;  1WHV A;  3EYZ A;  4QIV A;  3BB5 A;  2LQB A;  1F9F A;  1NND A;  4RW4 B;  1CUL A;  2HEK A;  3MCO A;  3GJT B;  1ELO A;  3DOK A;  3E01 B;  1YJW S;  2HAF A;  3PV8 A;  1F9E B;  1KLM A;  1QTN B;  1VDH A;  2YKM B;  4LBH A;  3IM9 A;  4K59 A;  3SCL E;  1NZ8 A;  3J7Z 5;  2OO4 A;  4HYK A;  4LFC F;  2UXB J;  4D3H A;  4N8N A;  4JI4 J;  4I6W A;  3HFZ B;  5F8L A;  5KTQ A;  1GMU A;  4EEY A;  1YGY A;  4LBP A;  1DQ8 A;  2ZOF A;  3ZTQ A;  2EFG A;  3K17 A;  1REG X;  3GCX P;  3IBC B;  5ETL A;  4CO4 A;  5DQG A;  3KTQ A;  3H42 A;  3RTV A;  3SV3 A;  1G3O A;  2WCX A;  3D0H E;  3T1A A;  2GVD B;  5J2M A;  4KPY A;  1V5I B;  2XYH B;  1REV A;  3W5X A;  4DN9 A;  1AYE A;  2OIH A;  1HNV A;  5CH7 B;  4NLV A;  3TA0 A;  4IRC A;  3OUY A;  1YJ9 S;  4CLY A;  3NEK A;  3KUG A;  1F5C A;  1FE0 A;  3CDE A;  4ZP8 A;  5CD4 H;  1N32 J;  1Y5N B;  2J7W A;  1NM2 A;  4DLE A;  1T3N A;  2IYI A;  1VS3 A;  1CJV A;  4O3R A;  3HLU A;  4HL9 A;  5GAH U;  2YNH A;  3PR4 A;  2GFF A;  1WEZ A;  3UN3 A;  1LWC A;  1RT1 A;  1GAO A;  2GO9 A;  3PO4 A;  4ZN3 A;  1MWZ A;  1RK8 A;  1LWF A;  4F67 A;  3FC9 A;  4OI6 A;  4QU7 A;  2C2Z B;  3AHP A;  3T5L A;  2P9E A;  5ETO A;  1NZA A;  2EFN A;  2OGU A;  5CYM B;  2ZKU A;  4QIW D;  4CO5 A;  4C48 A;  4R8U B;  3KJN B;  1B0P A;  1FK9 A;  1OQ6 A;  2XBP A;  4CH7 A;  3PYF A;  5E2Q A;  1RWU A;  2NUH A;  4ZLP A;  3M2V B;  1KVJ A;  4JI5 F;  3TAM B;  2XB2 D;  2QMX A;  1P8G A;  4CH1 A;  1YZ7 A;  3Q2S C;  1R3N A;  3I4P A;  1CJT A;  1LKZ A;  3POT B;  1UVK A;  2C42 A;  4P71 A;  5AJ3 F;  2ZH8 A;  4E2F B;  2KG0 A;  4EBE A;  4DFM A;  2FJD B;  3RUB L;  4J9K A;  4ZK7 M;  5E3C A;  1S57 A;  3Q8R B;  2HMI A;  2HBY B;  2XMJ A;  5GAG I;  3GIM A;  1BE4 A;  2GMJ A;  4RUB A;  3FSI A;  4DR5 F;  5E0O A;  3T3F A;  3CUL A;  3H2U B;  4N7T A;  2DY9 A;  2KN4 A;  4ED0 A;  2QG9 B;  3UN5 A;  4EK2 A;  2L3M A;  2V6A A;  2UXC F;  2R7X A;  2GIF A;  2IRX A;  3GR1 A;  4LBI A;  4OHV A;  5J1E A;  1NJI T;  3FMB A;  3JTO A;  1FTC A;  2RKI B;  3KFW X;  5C24 A;  3NXZ A;  2VA2 A;  4RUC A;  1H6K X;  4OIX A;  3ZZZ A;  3PW5 A;  3CIM A;  4OZN A;  2NR0 A;  1C0U B;  4OYP A;  1H3D A;  2M0G B;  2YKN B;  3AA9 A;  4ECU A;  2LEC A;  5U47 A;  1VQY A;  4XPC A;  1FWP A;  3NAH A;  2ZHA A;  3OR1 A;  3OR1 B;  1GMV A;  2YWF A;  2N7Y A;  1QAX A;  3BGF A;  5KFY A;  7FD1 A;  5KT2 A;  2ZC3 A;  1OY8 A;  1R8C A;  2Z2Z A;  1A9N B;  5H9F K;  2P6S A;  1V6H A;  1B0V A;  1F2H A;  1FRI A;  1GT8 A;  1I5O B;  2RH3 A;  2ZD1 A;  3HSG A;  3I0S B;  5D0R A;  3OTB A;  2NRE A;  4JV1 A;  4DSI A;  5GAE U;  2OPP B;  4DHV A;  4YDD B;  5C24 B;  7AT1 B;  4DX6 A;  1TVR A;  3CCE S;  1LWE B;  1RHQ B;  3CJ0 A;  5IOL A;  2YWG A;  5IZH A;  2XSJ A;  1T95 A;  3OL6 A;  1YLX A;  5IM0 A;  3HZE A;  2C1E B;  2HND B;  3KK3 B;  1D1U A;  3VAH A;  3BKF A;  4U8V A;  3PO5 A;  1RTH B;  5LMU F;  2FY1 A;  2UZA A;  3ILO A;  1H2U X;  2VL1 A;  1NKC A;  3H2L A;  2CJX B;  2EWH A;  2CWK A;  2C2R A;  1TL1 B;  1Y5I B;  5E41 A;  2CPH A;  1MN9 A;  2BVZ A;  5CA5 A;  3POT A;  2PII A;  2D7S A;  2Q3P A;  1DQ9 A;  4OHX A;  5B0B A;  2W2Q P;  1M5P C;  5AXN A;  1KLN A;  5K14 B;  3C46 A;  2L9W A;  2ASL A;  2FPH X;  4F4A A;  1B7Y B;  2RDJ A;  1RT5 B;  5THW A;  3FMW A;  1SJ1 A;  4AT1 B;  4YP3 A;  3KLH A;  2HSE B;  2KHC A;  3LUY A;  2F65 A;  4H4K C;  1SJR A;  1SI9 A;  1T11 A;  3DLK A;  1SB6 A;  4DUZ J;  1FE4 A;  4R8U A;  4LSZ B;  3R5G A;  5I42 B;  2HIQ A;  2XY6 A;  3IGV A;  3TVZ A;  4WZM A;  2M8D B;  4KKO A;  1VHI A;  4FF3 A;  1FFW B;  1KOH A;  1LWF B;  4ZJL A;  4IFV B;  2DPI A;  3UPF A;  4URQ U;  3GII A;  1N5Y B;  3QGI A;  4C6A A;  5A8W B;  4WTY A;  1KNZ A;  2CIM A;  2G0C A;  4Q8E A;  4PRF A;  1FXR A;  4H54 A;  4OI3 A;  4WIQ A;  1NSK L;  2MQP A;  4BC7 A;  4ELV A;  5EGY A;  5AXM A;  3BPS P;  1DFD A;  2R8I A;  3ZNU A;  1JXE A;  1WC0 A;  2VPY B;  4YR0 A;  3GFX A;  3SV4 A;  4PWD B;  5K9F A;  3OUY B;  1X9M A;  3X1L B;  5KT3 A;  3R2D J;  3M9N B;  4NL5 A;  4C8N A;  2XUL A;  4UW2 A;  3LWM A;  1L3K A;  1MN7 A;  2G9O A;  2V8H A;  3O6Q A;  2M5Y A;  4HI1 A;  4NAS A;  2VAS A;  2YNI A;  3L3C A;  2VQE F;  3DDN A;  2HGL A;  1BQM B;  4RWX A;  3BS9 A;  4JV0 A;  2R2R A;  2NZ4 A;  2JC0 A;  2ZH5 A;  3HO1 A;  2LMI A;  2FGC A;  4AL7 A;  1FKA F;  3NGU A;  3PTW A;  2CNK B;  3TUJ C;  3I31 A;  8RUC A;  3MUT P;  3LWL A;  3N9U C;  5IQQ A;  3CSK A;  3ETO A;  1EKS A;  3M8Z A;  2QYG A;  3R6L B;  4ETX A;  5LM7 E;  2MZ1 A;  1VFJ A;  2HBZ B;  5CAA A;  1X4A A;  5HMY A;  3DOK B;  1KQG B;  2CXE A;  3DGV A;  1NPP A;  2YNI B;  3RGI A;  4YEA A;  1KHW A;  1MML A;  2VIH A;  4ZCL A;  4WF9 Q;  2MJU A;  2A2C A;  1P1T A;  4WFZ A;  4DL4 A;  1KTQ A;  1NJY A;  2MPU A;  1UWB A;  3DOL A;  2QLJ B;  3KLG B;  1SL2 A;  4U8Y A;  4F3O A;  3PY8 A;  1APS A;  1EQM A;  1NME B;  4G1Q A;  3ZFV A;  3ZTP A;  4DUZ F;  3TWZ A;  4PWD A;  4JV5 J;  1AB8 A;  1QVG R;  1IJF B;  2DHS A;  4LRF A;  3FSX A;  2MQL A;  2WVF A;  3A8I A;  3G2X A;  1J5O B;  5K20 B;  1WEL A;  1ZPV A;  1BQX A;  1B4S A;  2QMU B;  4NRT A;  1YIJ S;  2FD2 A;  1VRT B;  2LEP A;  4ID8 A;  4LR8 A;  1IBK F;  2VOO A;  4QJV A;  1WOS A;  2Q79 A;  4ES2 A;  4P2S A;  3NGR A;  2B51 A;  1DZ5 A;  3ENV A;  2H3E B;  2AZ1 A;  2B5J A;  1HBN A;  4WP3 A;  4K4Y A;  2OPQ A;  1RDR A;  4O4R A;  3DI6 B;  3G82 A;  7FDR A;  3KLH B;  2R7U A;  3ONQ A;  4NLX A;  3J81 j;  1T8E A;  2V2V A;  5DG8 A;  1AFJ A;  3ULH A;  2NXE A;  1R0B G;  1RHR B;  3P3D A;  1JNZ B;  3AJ1 A;  5GVQ A;  2R9L A;  4F4X A;  3CXC R;  5K14 A;  1VJQ A;  5A76 A;  3Q8U A;  1U1K A;  3HVT B;  1U09 A;  3KHL A;  5FDL B;  2DIT A;  2D3U A;  3BBC A;  1S6P A;  3PFE A;  4QIE A;  5HRO A;  1RT3 A;  1URN A;  4B3O A;  1VLY A;  1S72 S;  2VKR A;  5IT9 Y;  3W3S A;  3JB9 k;  3DCA A;  3RRH A;  2RE1 A;  2DIS A;  1AZS A;  4KPC A;  4HI2 A;  1TMM A;  3H98 A;  1HYS A;  4NLY A;  2DR7 A;  4DSE A;  5A0Y A;  3W7B A;  3NGS A;  1JQG A;  2VBW A;  5CZV A;  4RUA A;  3KHR A;  2MB0 B;  1AFI A;  2DNL A;  3TUP A;  1IKX B;  3MD3 A;  1RTJ A;  3MM7 B;  2EFO A;  4TKT A;  1KVI A;  2J8S A;  3RJM B;  4L3K A;  4HHJ A;  2B8Q A;  1O5J A;  1HHS A;  1IWA A;  3L9Z A;  4P52 A;  3OT9 A;  3BSN A;  1Q7L B;  2NXC A;  2OKQ A;  3M32 B;  3UR0 A;  3T1Y J;  2CNL B;  1NDC A;  2VPX B;  4NCG A;  4F0H A;  1CJK A;  4JI8 F;  2ZH3 A;  2W9C A;  1FKP A;  2RB7 A;  2JVR A;  3DXS X;  3SDE B;  5HJY A;  2J6T A;  1HD0 A;  1RAG B;  3VZI A;  1UEV A;  3FRY A;  2LCW A;  1Y11 A;  5KFF A;  2FVQ A;  2B0G A;  2RAQ A;  2VG5 B;  4PQA A;  4I7F B;  4UUW A;  4U67 Q;  3TAN A;  3A3P B;  2C3M A;  2M70 A;  1NH8 A;  3L09 A;  2KXH A;  2ERR A;  1PC4 A;  2P8I A;  3NBP A;  2MKK A;  1RAO A;  3FBB A;  2C22 A;  5LMN J;  2NS1 B;  2FHK A;  4LQ3 A;  2M9K A;  2DXF A;  2GJ2 A;  1MG7 A;  5A8R B;  2LDY A;  2D3O 1;  2A3J A;  4M5L A;  1N33 F;  1ZET A;  4DR7 J;  1YVF A;  5MAO A;  2KZM A;  3MPD A;  2ZH2 A;  2PA3 A;  4B08 A;  4JYA J;  1T94 A;  1TUV A;  3CCR S;  2KB2 A;  4RW7 A;  2FGO A;  4ZPT R;  1SC1 B;  2XLI A;  4ZLJ A;  3HPO A;  1Q82 T;  1XR5 A;  4FXW A;  3CCZ A;  4M63 A;  3EPG A;  3MMA B;  6FD1 A;  3T1Y F;  2CPZ A;  4USJ C;  1NSA A;  1TP7 A;  3LAN A;  9ATC B;  1KBR A;  2VDI A;  2VU5 A;  2YWE A;  4WFB Q;  3QJP A;  3IR5 B;  2P6T A;  1B7F A;  1K0V A;  3CGI A;  2CJY B;  2VBY A;  1GTH A;  1S4F A;  2D41 A;  3HJF A;  3R7S B;  4WCE Q;  2FJA B;  3LP1 B;  4QR1 A;  2EEY A;  1FJE B;  2B43 A;  1RAJ A;  4NA1 A;  1N6Q A;  4TLR A;  1LK7 A;  4RO0 A;  3HMJ G;  4G1I A;  1M1H A;  4X62 J;  2B4V A;  4K0K F;  5LMN F;  3D6F B;  4IG0 B;  3E2E A;  1K44 A;  4R5P B;  5KT6 A;  3CD0 A;  3BQ2 A;  3V5R A;  1QY7 A;  4GRS A;  2GVD A;  4RBT A;  5F0W A;  3VTI A;  5K8O A;  1C0T B;  4K50 A;  2C28 A;  4DV6 F;  4B3R F;  2NSC A;  4WWS A;  2HNY A;  2CRL A;  4DR6 F;  1RP5 A;  2DNN A;  1YSJ A;  2DB1 A;  3CJK B;  2YKP A;  4Y6I A;  3D2W A;  5DRK A;  1T3O A;  3FEX B;  3R6G B;  2GML A;  3H40 A;  2VQF F;  2YH0 A;  3KNA A;  1R6V A;  2BJE A;  3PYG A;  3U7J A;  4PWU A;  1FRH A;  1U45 A;  2D9P A;  3QAE A;  4DG1 B;  2VZ9 A;  4ZKA A;  3U1M A;  2IHR 1;  3HHD A;  1BD6 A;  2DNO A;  1VMB A;  1HIY A;  4LR7 A;  4FZV A;  5CHC B;  2K06 A;  3OLB A;  4ID5 A;  5A8K B;  3EVO A;  4DZ6 A;  2KTQ A;  2Z2L A;  3W62 A;  4A8O A;  4ETZ A;  2E1P A;  3ZZY A;  1UMJ A;  1X9S A;  2BKN A;  3IG1 B;  1VLO A;  2L48 A;  2FVP A;  2KM8 C;  4IDK B;  1IWG A;  1BWV A;  1PKU A;  3N01 A;  2UVU A;  4CCH A;  1I3O B;  1D09 B;  2FIU A;  4YHH F;  4QWB A;  3M8Q A;  2UUA J;  2WON B;  3D54 A;  3HD2 A;  5LJ5 Y;  2AD9 A;  5D3G A;  2HHU A;  1IKV B;  1HPZ B;  3L7U A;  4M8L A;  3G87 A;  4DJB A;  3QT7 A;  5AXL A;  3LP0 A;  3VVU A;  3DFE A;  4HLB A;  4PXD A;  3TNV A;  1S1W B;  1HL6 A;  1VHF A;  4CYU A;  4F0M A;  4U95 A;  2OEL A;  2F40 A;  4WKR A;  2HK3 A;  1VQ6 S;  1XIQ A;  3DLE B;  3PRB A;  2V63 A;  1ZA1 B;  3I0R B;  1EX8 A;  1ZAW A;  4MAK A;  4P7V A;  3PXG a;  1OJ4 A;  5KFX A;  3UNY A;  1WSV A;  4JBC A;  4DPO A;  2L41 A;  3MR6 A;  3D28 A;  1ZH5 A;  2R7W A;  2L9D A;  2B9W A;  2RNE A;  3HK2 A;  4J90 A;  3W2V A;  2G2Y A;  3M2U B;  2MKY A;  4RW6 A;  4X4S A;  4N56 A;  3KHG A;  4RNO A;  3W9I A;  2VJU A;  2PSZ A;  4M5G A;  3MEC B;  1M5O C;  4A8W A;  1WEY A;  1AXQ A;  4ECR A;  1IVZ A;  1NB2 A;  1VBK A;  2K1R B;  1F3F A;  4RLE A;  2R7Q A;  2JFK A;  4HDH A;  3QQC D;  2IFX A;  4IG3 B;  3U02 A;  2ZJQ Q;  3EMT A;  5C25 B;  1NB7 A;  2UVV A;  3QO9 B;  4M5H A;  4O0N A;  4RU2 A;  1R6Y A;  3ZTS A;  3NNC A;  5KFN A;  1T9V A;  2NXJ A;  4OYX A;  4PG6 A;  1WOR A;  4WXW A;  2Y9H A;  5AT1 B;  4IR1 A;  2BAC A;  1RJJ A;  1Q95 G;  1VI7 A;  3MCN A;  4KFB B;  3QT6 A;  1SPB P;  1I94 F;  4MK8 A;  4PG7 A;  4AFF A;  3K5P A;  5D4N A;  2MMY A;  3NNA A;  1GX5 A;  4QU6 A;  1L5U A;  4X2B A;  4CIO A;  1B0T A;  2HWI A;  2J0X A;  3MMB A;  4JI0 F;  3NGD A;  3BN4 A;  2FUG 9;  3F41 A;  2EFV A;  3Q22 A;  3PW2 A;  1HD1 A;  2MKS A;  2YWW A;  2ZNY A;  3PM9 A;  1HWU A;  2HFO A;  3L95 X;  3MPU B;  3W5Y A;  3V6D A;  2E7X A;  3A8E A;  3E51 A;  2UUT A;  4AXJ A;  2MGZ B;  3KLE A;  1UZH A;  4P9S A;  1RT2 B;  2VPW B;  3UDE A;  1KDN A;  2EC2 A;  2OSR A;  4BBY A;  1S7H A;  1VQ5 S;  2AV5 A;  4HH1 A;  2NXU A;  1PAU B;  2O66 A;  1PBU A;  1Y3K A;  2WB1 D;  5HAT A;  4EUV A;  3M9M B;  1X0F A;  3GP9 A;  2VON A;  1GH8 A;  2H5E A;  1XNQ J;  4TYA A;  4Q5V A;  3FZ2 A;  1DAX A;  1KVK A;  2XNR A;  4M5K A;  1M1K T;  2M88 A;  4I2Q A;  3OJS A;  4NCB A;  1YQH A;  3ISN D;  2OEJ A;  5KOW A;  5BXI A;  4ED5 A;  1HI0 P;  1S48 A;  4KO0 B;  2DNG A;  3UN2 A;  4CO2 A;  2IDE A;  2VBX A;  2NXN A;  3HSJ A;  4O4G B;  4A8X A;  1TR0 A;  3KWM A;  1TL7 B;  5EWE A;  2DNQ A;  1SQE A;  2UUC F;  1DTQ B;  2HHP A;  2QL7 B;  2W4C A;  1JJC B;  4OJG A;  4YN3 B;  5CYQ B;  4B3M J;  2J0Q D;  1RKI A;  1NKE A;  3V6K A;  4DSJ A;  3MAA B;  2AYE A;  4G1P A;  4WXO A;  4ZIT A;  3R2C J;  1LW2 B;  2PMW A;  3DYA A;  2GHP A;  2HGM A;  2LLZ A;  4JOU A;  2ZH1 A;  4TU7 A;  2MTL A;  4KQZ A;  2DR9 A;  3W60 A;  4A8S A;  2CJQ A;  2KM8 B;  2KDO A;  2UV8 G;  2EC0 A;  3BYR A;  3TP2 A;  4B9V A;  3DHX A;  3ZC4 A;  2ACY A;  3MEE B;  2YKA A;  2MGZ A;  2DO4 A;  1CJU A;  1PAE X;  2CDQ A;  2WHO A;  4DPX A;  3K2Y A;  4FF4 A;  2ZC4 A;  5B0G A;  2ZUG A;  5SZT A;  1NHV A;  4P2F A;  1Q8L A;  4KH0 B;  3GCW P;  5GAH I;  1YTY A;  3DNC A;  3QWU A;  2RRN A;  1S77 D;  3J7A N;  4C8Z A;  3DXB A;  4OV6 A;  2F8H A;  6FDR A;  3EXY A;  5L1J A;  3HF5 A;  3FEY B;  4Q44 A;  1H74 A;  2R7O A;  3FQK A;  1TKD A;  3J80 Y;  1KS2 A;  1C1B B;  3FNN A;  3H0P A;  1WWH A;  2VG7 B;  4X66 J;  1S99 A;  5DGA A;  3MOJ B;  3IR6 B;  1JLA B;  4YQW A;  4NMX A;  2FY8 A;  4F26 A;  3ADA C;  3ISN C;  3H5S A;  3C6T A;  1TV6 B;  3KJV A;  2XSF A;  3I5B A;  2V2K A;  3WC2 A;  1JLF B;  3TR5 A;  1VC0 A;  3MWB A;  3W5Z A;  1LW0 A;  3PZP A;  1O0P A;  4B3S J;  2MZT A;  2M52 A;  1Y7P A;  2CYY A;  3BSA A;  3D3C J;  2AJF E;  1RBA A;  2ZEJ A;  4TU9 A;  2XQC A;  1JLQ A;  4FPI A;  1SV5 B;  4MMO A;  1WD6 A;  1RAF B;  3VAI A;  3C2P A;  3MM8 B;  4I2P A;  5J2Q A;  3OFE A;  2Z8Q A;  4DV7 J;  4KY3 A;  3W2V B;  5FD1 A;  4J9P A;  5F3Z A;  1GMW A;  1SBR A;  4LVN P;  1Q7Y T;  1NRK A;  4ZVU B;  4J9M A;  3CJ4 A;  5HQL A;  3OSP A;  4PYA A;  1U25 A;  2Y0S D;  1B64 A;  2ILZ A;  1UZD A;  4PG8 A;  4OZ0 A;  1PG5 B;  4Y0F A;  3VWS A;  5L1K A;  2FZC B;  2HQI A;  4C8Y A;  5JMN A;  2MQO A;  4DV0 J;  2HHW A;  1MMN A;  2QFI A;  4A8K A;  3SI8 A;  4Y34 A;  5IC4 B;  5HQ8 A;  3SZ2 A;  1R0A B;  2OPR B;  1IBL F;  3HHN B;  3OFH A;  1X5O A;  4TXS A;  4A46 A;  4YOE A;  4IUF A;  2J9E A;  1OO0 B;  4DR3 F;  1RTI B;  4CLL A;  3T1H J;  4B3S F;  3LP2 B;  1Y5L B;  3M6X A;  4HEA 9;  4OJ3 A;  3AXK A;  5H9F J;  1WI6 A;  4B02 A;  4DPY A;  4WYL A;  1QJH A;  3PX0 A;  4QWD A;  1PGZ A;  1U0H B;  2NCK L;  3ZTR A;  4LF8 F;  3BV8 A;  4RNF A;  2V9W A;  2Y1J A;  3QAU A;  3K8W A;  2Z56 B;  4B3T F;  1RB0 A;  4K5S A;  4G6V B;  1S1V B;  3SXL A;  3W1Y C;  1W2B R;  5T7L B;  4YFU A;  1QM9 A;  1RT6 B;  1VCT A;  2EG2 A;  1RTJ B;  2CPJ A;  4Y2M A;  5A6P A;  3H5Y A;  2ASD A;  4K4S A;  3DGP B;  4MKV A;  3CJ2 A;  1IKX A;  4QPX A;  1FRK A;  4MH8 A;  3CJK A;  2N82 B;  3JS9 A;  3W2W B;  4ZMM A;  3CJ5 A;  1SL1 A;  1VQ4 S;  3CT9 A;  3QMQ A;  3S1T A;  4HR2 A;  5A0Y B;  5GAD U;  3OHA A;  1IKW A;  2HIY A;  3QIP B;  1WI8 A;  3HFK A;  3PRD A;  5IT4 A;  2PEB A;  3VAL A;  1BY9 A;  1LFP A;  2DNY A;  3MM5 A;  2JEG A;  1CG2 A;  2CDR B;  1H38 A;  1DBD A;  3AB4 B;  2ZBQ A;  4OYB A;  1RGV A;  2VKZ G;  3OTD A;  4KAI A;  3MMC A;  4UT4 A;  2CVI A;  4ALZ A;  2V8G A;  3ET6 A;  3OQ2 A;  3UCG A;  1RT3 B;  5D0E A;  1IN0 A;  1WKL A;  4MK9 A;  4BHQ A;  2K8G A;  5LJ3 Y;  2MYF A;  5DQH A;  1N6Q B;  4ZVF A;  2XS5 A;  4ED3 A;  3LP1 A;  3RAQ A;  4K4Z A;  1VJW A;  3NS5 A;  4OX9 F;  3SSR A;  5LSL A;  3V4I B;  4JI2 J;  2C2K B;  2YWH A;  2E29 A;  1G1X A;  5HP1 A;  1V3R A;  1SC4 B;  1ZM4 A;  2ZH7 A;  4ZVQ B;  2UXD J;  2B5J B;  3IGN A;  1HBO A;  3IRX A;  2DGO A;  2YBV A;  2Q66 A;  3TZY A;  2JEJ A;  5F0U A;  5J2P B;  2H65 B;  4MFB A;  2MKC A;  3KUH A;  2V8P A;  4B17 A;  2W8K A;  2FZK B;  1QSY A;  4EZ6 A;  3EGW B;  1TKT B;  1J2V A;  3BYP A;  3A3N B;  3NS7 B;  2HS0 A;  2CQC A;  2XEX A;  2AYG A;  4ERD A;  2DGT A;  3UD5 A;  2CQI A;  4OHZ A;  1ZZN A;  5CCM A;  2J7U A;  3IC1 A;  3DOL B;  5LT5 A;  2JZ5 A;  2DVI A;  4DSK A;  1FVS A;  2C3P A;  4DR6 J;  4FBT A;  2A1B A;  1FRM A;  1URR A;  2RU9 A;  4JI1 J;  1RZM A;  4F36 A;  1JJ4 A;  2IBK A;  3DDK A;  4KC5 A;  2E9Z A;  5KG7 A;  1RWW B;  2LA6 A;  4C2M A;  4M95 A;  3RBX A;  4B9T A;  2UXD F;  2W9C B;  2AYM A;  5HN0 A;  2BV3 A;  3K5N A;  2CVE A;  4NOH A;  1CJK B;  1C1C B;  2BAN B;  4ZVS B;  4CI0 B;  2W1B A;  2X1G A;  3IN5 A;  2XNQ A;  1VC5 A;  1AUS L;  2C3Y A;  2MKH A;  4GKJ J;  2V5H G;  5KG0 A;  2VBZ A;  2IM2 A;  2QTW A;  3MM6 A;  4M5I A;  2JLG A;  2Y1L B;  2YQ3 A;  2ZHB A;  3V6J A;  1T05 B;  3OL9 A;  3J81 Y;  2V94 A;  4I4B A;  3W8G A;  4J9R A;  2COL A;  4I6Y A;  2A6M A;  1QVF R;  5J1P A;  3OTE A;  2MHE A;  1LNQ A;  1JKH B;  1S1U A;  1ZM9 A;  4USU A;  4NRU A;  4N8O A;  2I8E A;  2DGV A;  3NWR A;  4PZV A;  4WE1 B;  4M5D B;  1U48 A;  4C9D A;  2B7C B;  2R7R A;  4FF2 A;  2EBG A;  3OXF A;  3S01 A;  2AT1 B;  4U7U K;  4ILM A;  4ZPC A;  3QSY B;  1RTZ A;  3CO9 A;  3BR9 A;  3LF0 A;  4Y65 A;  2ROP A;  2KT5 A;  3DM2 B;  4GO7 X;  1U4B A;  1PJ7 A;  3B8H A;  4Y00 A;  4NCA A;  4FBU A;  1Q81 T;  3OPK A;  4DEZ A;  1HBU A;  1YRU A;  2DGS A;  1IXK A;  2JX2 A;  3Q0A A;  3K5M A;  1HNX F;  2Y8Y A;  1ULR A;  3Q86 A;  4E0D A;  3RU0 A;  2ILY A;  1FXD A;  2DRB A;  5DZ6 A;  2X3G A;  3BJY A;  5I42 A;  2UUB J;  5KFR A;  3VVT A;  4PCQ A;  4IR9 A;  1FFS B;  4ZHR A;  1FO1 A;  4KBI A;  4OYA A;  2LQ9 A;  2K3I A;  1FDD A;  3BRE A;  3BZQ A;  1U6F A;  2MQN A;  2WAQ D;  3PDN A;  1N0V C;  1N5S A;  4Y28 C;  4FPR A;  1SJQ A;  3T5J A;  4OX7 A;  2XZT B;  3KOA A;  1GXT A;  2R3V A;  1OSD A;  3M8S A;  4JI1 F;  1UFL A;  4RW8 B;  1W2I A;  4RW9 A;  1GNK A;  4ZIW A;  5C7P A;  4USM A;  1IKY B;  1SIZ A;  2O3D A;  4P72 A;  1PYT A;  4OYO A;  4O3N A;  3HHL B;  3Q83 A;  2ZH4 A;  2QFJ A;  1ZAX A;  1CC7 A;  2KT2 A;  2XMK A;  4DF4 A;  2N3O A;  3HI9 A;  2GX8 A;  1HWK A;  1U26 A;  4OZL A;  5G0R A;  4DPT A;  4U7U D;  1RA7 A;  4DQP A;  2ZVI A;  4KGX B;  2E1A A;  2HVZ A;  4PKD B;  2V4R A;  4F50 A;  2FC8 A;  1WDD A;  4M5D A;  2HHT A;  4ILL A;  4USH A;  2WTF A;  4LVO P;  2EFQ A;  3LQV A;  3KYL A;  4TY8 A;  1JKH A;  5CXT A;  3J7Z T;  3GB0 A;  2HHQ A;  1NEE A;  1UL3 A;  1PC5 A;  1GK8 A;  4A8Q A;  2BKO A;  4LSN A;  1TL3 B;  4KSE B;  2V2Z A;  2ZHO A;  4USV A;  5M2R A;  1Q5V A;  5KG1 A;  4LF6 J;  3MFI A;  2BUN A;  4R25 A;  2LU2 A;  3PHE A;  1C0U A;  2JLF A;  3PJW A;  1DUR A;  3O2I A;  4HHH A;  2QMW A;  3AOB A;  4O44 A;  1LXN A;  2DXD A;  3S7R A;  3C8Y A;  1D9F A;  2ZZN A;  2F9D A;  3CJR A;  4WII A;  3TYT A;  1UKU A;  2QIF A;  4URS A;  4PEO A;  2C2N A;  4A48 A;  4CNY A;  5CYJ A;  5KFH A;  2VV5 A;  2IMO A;  1DTT B;  3C15 B;  1K1S A;  2LFV A;  3R1H A;  2XLK A;  5A6W A;  2D1C A;  2ZFH A;  2LXU A;  1O8B A;  1KC8 T;  3RR8 A;  2RIL A;  1HW8 A;  2OUG A;  4RR5 A;  4DV3 F;  1ZZF A;  4WFY A;  3ILL A;  3JAM U;  4DPW A;  1G7C B;  4F3M A;  1SC3 B;  4FP9 A;  3DLG A;  3HDS A;  3M6U A;  3MM9 B;  4DX7 A;  4YY3 F;  1U1R A;  1X5T A;  4UY8 5;  3F56 A;  4ZVO B;  4B3T J;  1ZTT A;  3EVM A;  3TAM A;  2CA9 A;  1UW9 A;  5D78 A;  1XR7 A;  3OL7 A;  2XGP A;  2UP1 A;  1BXN A;  1BWE A;  2XS7 A;  3QSI A;  2MEW A;  2HUR A;  2LQ8 A;  1AA1 B;  4DU7 A;  3AD7 C;  1M5H A;  4UY8 T;  5KFB A;  3UDC A;  5L1I A;  1NHK L;  5J2P A;  3RW7 A;  4IRD A;  3HVA A;  1X4D A;  4Y2A A;  1FWK A;  1RI7 A;  3M30 A;  2K3K A;  3IRX B;  2I1R A;  3R5C A;  1D8Z A;  4IQM A;  5CYM A;  5HJX A;  3C66 A;  1WHY A;  2KRB A;  3D68 A; 
#chains in the Genus database with same CATH homology
 1HLW A;  2B8Q A;  4UOF A;  2HVD A;  1NDC A;  1EHW A;  4S0M A;  1NB2 A;  1F3F A;  1NCL A;  3GPA A;  3EMT A;  3ZTQ A;  1JXV A;  4O0N A;  3VGU A;  3ZTS A;  4C6A A;  1S59 A;  3B6B A;  2BX6 A;  1S5Z A;  4FKY A;  1NSK L;  2DXE A;  1BUX A;  3BH7 B;  3FBB A;  1VYA A;  4ANE A;  4UOG A;  2DXF A;  1WKJ A;  3FBF A;  3Q86 A;  1WKK A;  1BHN A;  3MPD A;  1MN7 A;  4AND A;  2NCK L;  3VVT A;  3ZTR A;  3BBB A;  1NDL A;  3FBE A;  3VGV A;  3Q89 A;  3FC9 A;  3PRV A;  3NGU A;  4W98 A;  3WX8 A;  2VU5 A;  4UOH A;  4DI6 A;  3Q8Y A;  3EE3 A;  1KDN A;  3ELH A;  3B54 A;  3EIC A;  3JS9 A;  5CAA A;  5C7P A;  3FKB A;  3GP9 A;  4FKX A;  4HR2 A;  2BEF A;  1NDP A;  3VGS A;  3Q83 A;  3ENA A;  1NDK A;  1LEO A;  3FCW A;  3R9L A;  5BXI A;  3ZTP A;  1B99 A;  1UCN A;  4ANC A;  1K44 A;  1W7W A;  3EJM A;  1NUE A;  4CP5 A;  1S57 A;  1WKL A;  4WBF A;  3G2X A;  1NPK A;  2B8P A;  1BE4 A;  2DY9 A;  1B4S A;  4EK2 A;  2DYA A;  3VGT A;  1ZS6 A;  3EM1 A;  1NSQ A;  5CAB A;  3BBF A;  3NGT A;  3ETM A;  3NGR A;  1LWX A;  3DDI A;  3PJ9 A;  4DUT A;  2AZ1 A;  1PAE X;  2DXD A;  2HVE A;  3Q8V A;  2AZ3 A;  3FBC A;  1HIY A;  3EVO A;  3Q8U A;  4DZ6 A;  1F6T A;  3ZTO A;  3BBC A;  1PKU A;  2ZUA A;  4ENO A;  3EVW A;  1XQI A;  5IOL A;  3BH6 B;  1U8W A;  3L7U A;  3EVM A;  4KPC A;  3VVU A;  1HHQ A;  3DKD A;  3FCV A;  4F36 A;  1NLK L;  2CWK A;  2HUR A;  1MN9 A;  3NGS A;  1XIQ A;  1NHK L;  1NSP A;  4F4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...