3ENBA

Crystal structure of prp8 core domain iv
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
219
Chain Sequence
b'LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
molecule tags Rna binding protein
source organism Homo sapiens
publication title Structural elucidation of a PRP8 core domain from the heart of the spliceosome.
pubmed doi rcsb
total genus 62
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3enbA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3enbA01
4JKFA 4JK7A 4ILJA 4JKAA 4JK8A 3SBTA 3E9OA 4JKBA 4JK9A 4ILGB 4JKDA 4JKEA 4ILHA 4JKGA 3SBGA 4JKCA 3ENBA 3E66A 3E9PA 3E9LA 4JKHA 4JKGB
chains in the Genus database with same CATH superfamily
3S9HA 3NAEA 4IZ9A 1NJYA 2YJEA 3T1AA 5GAEP 2HE7A 2P5GA 4CI6A 1QZ6A 5J2MA 3S41A 3LPTA 5IJMA 1JLCA 3SCXA 1OH7A 3PX0A 1ZBSA 1T7PA 2FF3B 3J7ZO 3SI6A 1W2BM 5C25A 1KBLA 2G8IA 2P9UA 2QXFA 2HHTA 3E66A 1RTIA 4O44A 1VSMA 3NF6A 5E41A 3RVCA 2IC3A 3LDNA 2D11A 3EO3A 2IDOA 4BE0A 1HKCA 3SQ2A 1M1KO 4KHUA 2VWJA 5AQMA 3VEYA 3L2UA 3PO5A 3OHRA 4NLBA 3AVBA 3DLEA 4M3TA 1HPMA 2WONA 4HWIA 3OYIA 2YNFA 4PL7A 4CEAA 3EZ5A 2YNHA 2Y1IA 4BRNA 1YITN 3UE5A 1H1VA 1XNQK 2BE2A 1FJGK 2QW9A 5KPZA 1NGBA 3C6UA 3L3UA 5I42A 3THWB 3D2EB 3ZSRA 3AVCA 1NK4A 4IFEA 3JXUA 4BQLA 4IEIA 4W5NA 4CGJA 1KTQA 1RT4A 4E1NA 3LDOA 3R3LA 4OPHA 4W5TA 3MEGA 3OS1A 2GEMA 3U3YA 3EPYA 5M1PA 4FVMA 3W3DA 4DV5K 3MEEA 4FWSA 4JI6K 3NGIA 4IOCL 1NK8A 2P1JA 5JLHA 1GLLO 4M7XA 3V1RA 1W7AA 1YIJN 2EMSA 4KKOA 4OKEA 3I55N 1WSEA 5LY3A 2VWBA 4BR7A 3CMAN 4AHVA 4M3RA 3OYJA 1ASUA 4RWTA 2YHAA 3CCSN 3G71N 1REVA 3OBYA 4CJQA 5CE3A 1Z25A 4JD2B 5M1NA 2O8CB 1KC7A 3SQ1A 3EKUA 5HBMA 4HCBA 4B8CA 4WQ4A 1TYQA 2QWRA 1NGHA 4KHSA 2F9WA 1NK5A 4V19S 4BE1A 3J7YP 2KZZA 3CJ7A 4LF9K 4ID5A 3RSEA 2WH5A 4CZGA 1J5EK 4LH4A 4M3ZA 4G1QA 1X3NA 4IFYA 4C8LA 3PO4A 1U04A 2O4GA 4ZHRA 1KSPA 1Y19B 4AHUA 4EHUA 1HMVA 1UAXA 2P9UB 2YKNA 4GMJB 3FFKB 5LL6Z 4BRDA 5JVLA 3VF6A 1X9WA 3E01A 2HW3A 2D0AA 4LFCK 1HYSA 3AARA 1X3MA 2FBTA 3L2WA 1A5WA 3AA4A 1VQ7N 1KRPA 4H0OA 3VETA 1EETA 5KQ8A 2FXUA 2VWKA 2Q97A 1ESVA 3VQEA 3O9SA 4M3XA 1IJJA 4WQ5C 4QS9A 2UUCK 4KH4A 3O3HA 4R79A 1MK7B 4FSVA 2VYPA 3A2FA 1RBSA 3HOTA 2DFFA 4QS7A 2BUPA 1P90A 3DRSA 4JI2K 3HO1A 4XH4A 1UA1A 1HNZK 3AVJA 4K0KK 4E7KA 5AZIB 3A5OC 3F9MA 3QICA 1HPZA 4BDPA 2DFEA 5HP1A 4BRCA 3CD6N 4A59A 3HP6A 1N32K 2ZGZA 1YTAA 3AY9A 1S22A 4JRPA 2JWKA 3SUPA 2WOMA 4M63C 2OANA 5AZJA 5IT9O 3C6HA 3NGYA 4XH5A 4JKBA 4Z4IA 2O8FB 3RMAA 2DPNA 3VPZA 1LV5A 2QWQA 4LFAK 2KQ2A 3J7AP 3RRGA 4CHYA 4YHHK 5GAGP 3O4WA 3C95A 2JWLA 3MX5A 3OVNA 4N47A 1RGIA 4O0IA 1BGXT 5E84A 1QQCA 2J4RA 3QEWA 1VSDA 3P4IA 5C10A 2GUIA 3O1BA 3RMDA 3RR8A 1TUYA 3ISNC 5KQDA 3O9UA 4C1NK 2ZJRL 4CFBA 1NK9A 1C1AA 1IKYA 5DMRA 4O55A 4CFAA 2A41A 2CB8A 3DI6A 4Y1DA 2P9KB 4E0DA 4KB1A 4BC4A 1TK5A 3VN5A 2Y1JA 4B9UA 4JYAK 3RTVA 3ZETB 4P7IA 3DLKA 2P9PB 4BGBA 3I0SA 4IDKA 1NLVA 4OJRA 1DIKA 4CIFA 4MLHA 4LF4K 1KAYA 4CK3A 5J2PA 2BTFA 4B9MA 3CXCM 3UKRA 1RBUA 2ZF5O 4CZLA 3A5MC 3MK6A 4O8KA 4DQRA 3V1OA 4ISEA 2OYQA 1NTIA 1JXEA 3BGRA 3TWHA 1NGFA 4JI8K 1YVNA 4N76A 3HPGA 1JCEA 3SV3A 3SQ0A 1ZBHA 4CEBA 4YFUA 1RBTA 1HB8A 3TPQA 1RCHA 5HOOA 3FZFA 1JL2A 3G10A 1QQOA 4FK2A 5KPRA 2KFNA 1XHXA 3N4PA 4CK1A 3FGUA 1Q86O 3PY8A 2A6AA 3DAWA 4RW9A 3U4LA 2Q0RA 2COPA 1RT3A 4DTNA 3OYCA 1BWFO 4Z4HA 4FPBA 1FKOA 4C8KA 3TAQA 3K9JA 2V52B 3MEDA 2WC9A 3A5LC 2FJ9A 4C8MA 3MWPA 5AFUH 3CJBA 1S72N 1RDUA 1Q7YO 4OO1J 1MWMA 4DS5A 1EP4A 3SUNA 2EX3A 3CCVN 1OH5A 1XNRK 4EAHD 5JS2A 1QSLA 4DSIA 4B3RK 1FKPA 3HL8A 1RT2A 3T69A 4YOWA 4OPKA 4DV1K 5AQHA 4CJEA 1GLFO 5GIPA 3KLHA 4HUFA 1D5AA 4JKGA 2VGMA 3P31A 2YHBA 1LAVA 4FJMA 2DTUA 1VSLA 4DQQA 2ETJA 2XY8A 1N5YA 1K8KA 3T3FA 5BN8A 1A5XA 3K59A 2HMPA 1SS6A 1ATRA 1HJRA 5AQOA 3LDPA 1TKDA 4FJGA 1BCMA 4DLGA 4DTXA 5MLCQ 1R59O 3H6EA 1RDBA 1JLFA 1Z26A 3CJCA 4CHNA 4CJWA 1N33K 4KAZA 3DYAA 4C8OA 3VEXA 3HZ6A 4ZRIA 3OY9A 3L2VA 1GOAA 3A0IX 4DV0K 5M1KA 3K5MA 1S1UA 1MIZB 1CXUA 1VSEA 2P9PA 1OKJA 2F9TA 4DTSA 3AA3A 1WBDA 1XHZA 4H5VA 3V6DA 4RW7A 2OZSA 3BUZB 5KGWA 4DR5K 4CGDA 3WXLA 3TR8A 3KWIA 3VF4A 4LY7A 3C94A 3NHGA 1JDEA 3AGRA 3QNNA 4OLAA 4BC3A 4FWOA 2F4VK 4JRQA 1HBKA 4OGCA 4JKHA 3LM2A 1YAGA 4FLTA 3E9OA 2P9IA 4F2SA 4M3YA 5BR8K 3KLGA 4DTJA 1CZAN 3WQUA 1X1PA 4BWJA 3CCQN 3M8SA 2G8KA 3KK1A 1C0TA 1SKWA 1EO1A 2VQEK 1GC6A 4HTLA 3KLIA 3DLLL 3CFRA 4U67L 3BY5A 3VMFB 1BO5O 5EXWA 3UKUA 3D2FA 4KFBA 4DR2K 3VGKA 1Q18A 1IBKK 4KHQA 4KBOA 4W5OA 3UKUB 4CJTA 1KFSA 4I7FA 2P9SA 4FZZA 3TTFA 4CF8A 5KTQA 3I0RA 3M5RA 3X23A 2YKMA 5C15A 5HL7L 3VA0A 2AEHA 1HLUA 3OW2M 5AQZA 1RNHA 4CJPA 4CZHA 1JLGA 2V7ZA 1NKEA 3FFIA 3U9DA 4FK0A 4CGFA 3ZSQA 4R5PA 3ZT2A 4NO7A 2Q1NA 1U48A 1GLAG 3MN7A 3LM9A 4B9VA 5AQGA 4ILJA 3IFRA 4FM0A 2AP1A 5FDLA 4DS4A 4YDUC 3QDKA 1TK8A 1NGAA 3H46O 3NE6A 2P9NA 4J8FA 3HSTB 3AVNA 3ITHA 3MMVA 3SBGA 1WSFA 4CJ5A 1GLCG 4DFPA 1J5OA 3AGKA 1S6QA 3ALYA 2X0SA 1IKVA 2P9NB 4FM1A 2LBBA 1T6DA 2ZPYA 2ABDA 4B9TA 2UYTA 4B9LA 1RT1A 1Q82O 3C7NB 3MDQA 1N36K 2ZJQL 2J0JA 3KK2A 3HVTA 4CHZA 3BP8A 3C0BA 1SKSA 3KJVA 2VG7A 4LF5K 4X62K 4FJXA 3QIJA 3VEWA 1XC3A 3SAFA 3M6GA 2VCPA 2W6KA 4CZEA 3OYLA 1KC8O 1BA0A 2HHVA 2Z1IA 4CYEA 4BG9A 4Q0BA 1KLMA 1LW0A 1OH6A 4YORA 2O8BB 3TABA 4FWRA 3H3NO 3L0QA 3OYHA 1RFQA 5AQNA 2I1KA 3P83D 5ADXA 4DV7K 2O8EA 1NGCA 5AQQA 4JI4K 1ZBIA 4RCHA 1RILA 4CFCA 3I8DA 2P5OA 1U4BA 2IAJA 3HI0A 4H4MA 2P9LB 2IOCA 4GNIA 3K2PA 3O8MA 3I56N 4CHOA 4CEOA 4PWDA 3L2RA 2AL6A 3MAQA 4FM2A 4CJUA 2JLEA 5AQSA 3D45A 1E4GT 4ISGA 4E7HA 1JLQA 3V9SA 4CESA 2XO7A 2D1KA 4PL8A 1U49A 3AO2A 4H0TB 2ITMA 4FZYA 4DSLA 4HUEA 1TKTA 4FWKA 4Z4FA 2D10A 4FJLA 4JKGB 2YHXA 2F8SA 4JHDB 1S3XA 1YVUA 3WXJA 3QLHA 3VF2A 3MCAB 4BACA 4FK4A 1ZXOA 4JHDA 5EU7A 2CGLA 5F0XA 3QB0A 3CC2N 3O9RA 3SUQA 2QXLA 2D2QA 4GXBA 4DQ8A 2O8DA 1G15A 4OKKA 1ST7A 3S3MA 3R9PA 2HF3A 3OYBA 4F3TA 2J0MA 1ASWA 3IMXA 5J2NA 3VTIA 2PFUA 4BC5A 2Z1JA 1DTQA 4IJNA 2GELA 3SMPA 3QEVA 2KTQA 5DK5A 3GE1A 4KH6A 3J80O 3ZT0A 4U7BA 4ZTJA 3VQBA 4JI1K 4H5TA 1VSHA 4FL9A 5J1EA 3OYKA 1WNSA 4YY3K 2UU9K 4DR1K 4DSKA 3KIOA 3P38A 3AVFA 5EX5A 3WEEA 3EYZA 2HVHA 2VG6A 3D6RA 3NF9A 5E26A 3VENA 4WQ5A 3O3GA 5SZTA 1NKCA 1S9EA 1HR0K 4CZIA 4CJ4A 4DWIA 3QMLA 4ELUA 3BDPA 2GWJA 1TAQA 4OPAA 3D0PA 1VQ8N 2CGJA 1BU6O 3VEZA 2ASPA 3V1QA 5I9EB 2PBDA 2YI1A 2QKBA 1FW6A 2FBVA 4JS4A 4KRFA 4ID1A 1YUWA 3AA2A 4X66K 2KZMA 2BH1A 4JK7A 3ZX2A 1LWEA 4DF4A 5AQRA 3P39A 4KHPK 4XH1A 4JN4A 5GIOA 1GLEG 2O8BA 4A5AA 2D4WA 2GBZA 4BREA 4KHWA 1VQKN 1B92A 4F8RA 1S1VA 4FW1A 2RKIA 1X9SA 2NRXA 3VQ9A 1GG3A 1SV5A 4JEPA 1LWFA 3DOLA 2HHHK 4WCEL 2AJQA 3IS9A 1SL2A 1NJWA 3OS2A 4GVMA 4FWLA 2NLXA 3PX4A 2J0KA 4LSLA 1WBBA 3TSPA 4LF8K 2OPSA 1QQMA 2GUPA 3AVLA 2NRWA 4E7IA 3ZCMA 5BPMA 1SZ2A 1I3AA 3C65A 5C12A 4QOZB 4KV8A 3L4IA 4FPAA 3ZYYX 3HPOA 5CHIA 1V4TA 3QIOA 3WA0A 4DQIA 4JLHA 1JL1A 3DLBA 1GLDG 1HNWK 3E9PA 4CIEA 4B3OA 4ZRKA 1JCGA 1RBVA 2IVPA 3U8ZA 4EIAA 5AFUA 4DFKA 1ISNA 3CC7N 4YNQA 3CM6A 1XMQK 3O4QA 3TTCA 1K8KB 4CJFA 3WXKA 4WFBL 1OVYA 1S1TA 4BVPA 2D5RA 2YVCA 4BQZA 4LSNA 3KK7A 4RW6A 5F2RA 3O9TA 1VAZA 4IDHA 4FJ9A 2XHBA 3MN5A 5BN9A 4Z4EA 3PUFA 3ENOA 4I9QA 3LP2A 4K8ZA 2FBYA 4GKJK 3IDHA 4DR7K 1L5UA 2UUBK 3G4SN 4KTQA 3VOVA 2E4LA 2ZD1A 5LJVA 4F4KA 1W97L 4E3SA 1NU0A 3NMUA 3MXMA 3VGLA 2RHKA 1HUXA 2BDPA 4BRFA 3THVA 3R6MA 4F9OA 3TI0A 3BF3A 4NYNA 3B6PA 5KRTA 4DV2K 4CGHA 4NLCA 2A1SA 3ZDTA 4I6MA 3ZSVA 2P9IB 4CZKA 5DM6L 3LALA 2CH5A 4H5WA 4A2AA 3DXKB 4K43A 1QHTA 1KFDA 4FJ8A 1MU2A 3AAQA 1HX1A 3LP1A 4FLZA 3JS6A 3ATVA 1RT5A 3E1YA 3M8PA 4LF6K 3T1YK 2NRVA 2NRHA 2Q36A 5AQFA 5A2QO 3KTQA 5HRNA 3OYGA 1VRUA 3LPUA 4AH9A 1NNEA 4GW6A 3S3OA 1EWQA 1S6PA 2V51B 4DV6K 1SUQA 3H3OB 4CJRA 3VEVA 3QERA 4B1WB 1NK6A 3V81A 2EHGA 4KB0A 4N5SA 1JLBA 1U2VA 2ZJPL 2XY6A 1OH8A 5AQPA 2X78A 2UXDK 2D0PA 3H08A 3MWTA 5JVGL 4CF2A 2O4IA 1IV0A 3FE1A 3LDQA 1BUPA 3QBXA 2G8UA 3SNNA 4IXCA 3KD5E 1HYZA 4B9NA 4B1UB 3SMSA 5M1FA 2OPQA 4GV3A 2G8HA 4F2RA 2PZSA 3OJUA 2B5JA 4J2DA 3K5OA 5AQTA 2B6AA 1SL1A 3GBTA 2IVNA 4IO8A 1T05A 4DV4K 3CCEN 3O3FA 3EY1A 4FLWA 2EMTA 3B8AX 5AQYA 3GOIA 1HYVA 2ASMA 3J8AA 2I7PA 3FZHA 1KQSM 1S5JA 1XI1A 4B9SA 1SL0A 4FOEA 2Z1HA 4K25A 2WBNA 1TV6A 5JVHL 1L3VA 4DF8A 2E5LK 1UA0A 4H4OA 4FO0A 3CI5A 4K42A 1OVQA 3LWLA 2NRRA 4I2PA 5HRRA 2FLOA 1S1WA 1N34K 4WFAL 1Q9YA 2ZGYA 4CF1A 5CZ1A 4IWVA 3ZSYA 1NG9A 1BI4B 3TARA 4A61A 4CF9A 4NCAA 2HNYA 3EEQA 1IO2A 1D9DA 5ADXH 3RWUA 4F7GA 1VBGA 3LP3A 3U6FA 4CE9A 4CZFA 4CJSA 1HKGA 1WUAA 1VQ4N 3KVGA 3EL2A 1VQON 1D9FA 3ZX3A 2LSNA 3VQ8A 4CVNE 3V9XA 3AVHA 2WUSA 2G8FA 5BRFA 3OTOK 1VQ9N 3IAYA 3WXIA 3NF8A 1XQSC 5SWMA 1FK9A 2QWLA 1YI2N 4KPYA 2QWNA 2KLAA 3VQPA 3WUHA 3MN9A 3WQTA 5HLFA 5K14A 2HF4A 4CIGA 3V9WA 1TAUA 2P51A 3AVKA 3HBTA 3THWA 2XY5A 4BR0A 1GOCA 3RR7A 4CEEA 3BZCA 2HBMA 4FYDA 4ZRJA 3HM9A 3TANA 1K6YA 5BPLA 1IKXA 2E2OA 1EX4A 3JYTA 3L6QA 4WF9L 3CFOA 4GY2B 1K73O 4CEDA 3P5JA 5AZJB 5CYMA 4BROA 3OYFA 2FBXA 2A5XA 5AJ3K 1VQMN 1KVAA 1WLJA 4KHNA 5LJWA 1T8EA 1GGOA 3SBTA 3UB5A 1WB9A 3PSFA 2OTLN 3IRXA 2UXCK 2HHUA 3D7EO 4J2AA 4NXNK 4H5NA 1VQNN 5EVZA 3ZT3A 4FLVA 1IH7A 5M1OA 1U2VB 2QEXN 1KAXA 4JI0K 3NVMA 1Q9XA 1C1BA 1BL3A 5GADP 4CJVA 2HRJA 2OPPA 4NB4A 3BF1A 3TAGA 3NH1A 1C6VA 3AO3A 2NRTA 2E2QA 5HRSA 1T3VA 2A40A 2RPIA 3VEOA 3AVGA 4W5RA 3L2QA 3OA9A 4DTPA 4B3TK 1RTHA 1WSHA 3BEXA 2D0OA 4FJIA 3LP0A 1BCOA 1GOBA 4CZJA 3ATUA 3CJAA 5FPNA 4BWMA 4YOXA 3NGZA 4DFMA 4FJ7A 2GWKA 2W41A 2H3GX 2VGNA 3LZIA 2YV0X 3QINA 3R8EA 4DTUA 4BRKA 4O0JA 3QFUA 4MQ3A 1TKZA 3TAPA 1KVCA 1BQMA 4CFDA 4HVJA 1F21A 4JKCA 4DV3K 1ATNA 2NUBA 4GV6A 4H5RA 4CBUA 3MN6A 4LC9B 1ITGA 4M45A 1VSIA 4BRLA 2HB5A 5I3UA 2NZTA 2GX9A 3VERA 1CZ9A 3WXMB 3K9KA 3WNFA 5BR9A 1MDUB 2FC0A 2F8TA 4MDAA 3LL3A 1NOZA 1RDWX 4FWMA 1NGJA 4ELTA 4BDZA 3TSQA 2HHXA 4IG3A 3ENBA 2Q3SA 3F2KA 2HOEA 5C2FA 4NY0A 1L3SA 3TAMA 3O9QA 3PZDA 2FSNA 4DTOA 1ASVA 4NCGA 3TAEA 3AVAA 4BRGA 3V9ZA 1IBMK 1RBRA 5JS1A 4DU1A 1VQ6N 4DB3A 3EE8A 3SPZA 1Z6RA 3VQ5A 5KI6A 3TU5A 3JSMA 5HRPA 1NJXA 2HBJA 3FZLA 4CZMA 3A8YA 1JXBA 1NI2A 4DXAB 4YOYA 3QEXA 5FLXO 5GINA 4AHTA 3IUCA 2P9LA 2XRIA 3CPEA 3DRRA 3D2EA 5TKWA 1K8AO 3LDLA 4CW7B 4Z4CA 4EFHA 4CCHA 4PHTX 4BRQA 1NGGA 2OZMA 4X65K 3OYAA 2CH6A 5FPEA 5EY4A 2DIKA 1CZBA 1UOCA 3OS0A 3C6TA 1YXQA 4MDBA 3AO4A 5KPTA 3H1VX 4B08A 3TSUA 3U3GA 4DUZK 3KK3A 5KGXA 3K58A 1RTDA 3AA5X 2RN2A 3AVMA 2HHSA 4OX9K 2NRZA 3CG7A 3AU5A 5FPDA 1JJ2M 3FR0A 2PYLA 1TUUA 4CEZA 2HSTA 1VHXA 4RW8A 1IG8A 1TVRA 2E1YA 3NVKA 1S1XA 3FZMA 4QAGA 1VK0A 3K5LA 4J2EA 4WYBA 1H4RA 3MXIA 3F5TA 5BPNA 1ZBLA 3NBPA 3LZJA 3K57A 4CHQA 2HMIA 2RF2A 1M90O 4KI6A 4BVOA 4I2QA 1KCFA 4BRHA 4N56A 3O80A 4BDYA 5AQJA 1LAWA 1K9MO 3NH0A 3HPHA 1C0FA 3VTHA 1HRHA 3CERA 2DFHA 2F96A 2A1RA 5FPMA 4X64K 2A3ZA 3SV4A 3RSEB 1BG3A 3CC4N 3WEEB 3SK3A 2QK9A 4FLUA 2ZE2A 3CHWA 3NDKA 4GV9A 1DKGD 3AAPA 3QIPA 3T1HK 4B9QA 3E9LA 4E19A 1DTTA 3CIPA 3C7NA 3DMJA 3KWGA 3CJ9A 2CQUA 1VBHA 3SJJA 3O6WA 5M1QA 3PV8A 4KHYA 1TGOA 2X6NA 1NMNA 4KTWA 4B1VA 1SKRA 5J2QA 4CBWA 3VQ4A 4DG1A 1YJ9N 1ZBUA 1S9GA 2YNIA 4B1XB 2KKZA 4H8KA 4Y0WA 3CQYA 3EKSA 2RE2A 3CCMN 4IG0A 2E2PA 2X74A 3EE9A 2PY5A 3PIPL 4C1NI 5BRDA 3CCLN 1WOQA 4FWQA 4DQSA 4XEIA 4KREA 4PUOA 4Z4GA 4AHRA 4EP4A 4BGAA 2IS3A 2E6MA 1B9DA 3PIOL 5GAHP 3QEIA 1XMOK 2E8AA 2I7NA 5AZIA 4JD2A 2FSKA 4RW4A 2G8WA 1J53A 1GC7A 3HM8A 2QM1A 4LD0A 1SAZA 1TYQB 1G99A 4AQYK 1NJIO 1IBLK 2V7YA 4JNEA 3VESA 1SGHA 3IKMA 3VQAA 3C6AA 3HRGA 1IG9A 4XIUA 3ZEUB 5JICA 2FF6A 3Q7BA 3VGMA 4CJLA 5BREA 4YOTA 3ZSOA 4JI7K 2HVIA 1BI4A 1N6QA 3NCIA 3ZT4A 5C42A 1D4XA 3G6EN 3LDSA 3FLCO 4TKNA 2WFBA 4AHSA 3K0SA 4H0VB 1QVFM 1U45A 1LCUA 3WT0A 3S3NA 3TAFA 1RDDA 5C2DA 2IVOA 2E88A 4NXMK 4HDQA 3ASMA 4YL8A 3QESA 4H0YB 2Z1GA 4KI4A 3ZX0A 4OGEA 2UXBK 3U7DA 3RMBA 4CD1A 4JKAA 5JMVA 4FJKA 1MK9B 5TKYA 1C0GA 2FDQA 1RT6A 1P8ZA 4ICLA 1NMDA 3NF7A 4QS8A 2ATQA 3CM5A 5AQLA 4W5QA 4DUYK 1CLQA 1E3MA 4ILGB 5FRNA 3J81O 3PLAA 3T19A 4CK2A 2E1ZA 1EKEA 2R7YA 2HHQA 3CYMA 3O08A 3FZKA 5AQXA 3G9WA 4CGIA 3O1WA 1QTMA 1Y64A 3CPWM 3DXKA 4IKFA 4BY9C 1BHLA 4DLEA 4M3UA 3M3ZA 2D0BA 4F3OA 3KKRA 4DTRA 2B4JA 4PQUA 5EOYA 4B1YB 3THXB 4K8XA 5CYQA 2OPRA 1ZYQA 1WSIA 1WN7A 2ZM6K 3KHYA 1O1WA 4BR4A 3M1FA 2JGUA 2XY7A 1GLBG 1KLNA 3DM2A 4E1MA 1FXXA 2YHWA 1UWBA 4MFBA 3D2FB 3SZ2A 1BISA 1EQYA 2A42A 4RTFD 3QBWA 1BQNA 5AQIA 3THYB 5KRSA 3CCUN 1BOTO 2Q31A 2W6LA 2F7TA 4BG8A 4HTUA 4AF1A 4G9ZA 3A5NC 4FWNA 3KLEA 5D3GA 4PA1A 3O5BA 4DQPA 3VQCA 4AM7A 4CJKA 5LMUK 4DR6K 1JCFA 4WFNL 5FROA 4CECA 3DOKA 3SAGA 4CJ3A 2GTDA 2Q2RA 3OBWA 2UUAK 2X6SA 1C1CA 5CR4A 2GV9A 4WQ4C 4IBNA 4IFVA 3IG1A 1R0AA 1HB6A 1J6ZA 4Y1CA 4DCHA 1YF5L 1ACAA 4B1ZA 1LW2A 3G25A 4OVLA 3DLHA 4BR2A 3AO5A 3BZKA 5JLFA 4DFJA 3UKRB 1HQUA 3EZWA 3QNOA 4CHPA 2OA8A 4M41A 2I1JA 4MO4A 3SUOA 1QQNA 3HSCA 1C0MA 2BGGA 2FSJA 3SPYA 1W0HA 3CCJN 2CGKA 3I8BA 1DT9A 4FJJA 1TK0A 1Q8IA 1ILYA 3HK2A 3L3VA 4GVEA 1DEJA 5T7BA 2W42A 3L4QA 1VQ5N 1EF1A 4DU4A 1VQLN 3M8RA 1WSGA 4HCCA 2NNWA 4JKFA 2YHYA 5AQWA 4DHYA 2QWMA 1RDCA 1HKBA 4IO9L 3H45C 1WAJA 4J2BA 4CJ7A 4FW2A 1JLEA 3JAMO 4BC2A 5AQUA 3OYDA 3M8QA 2PAVA 4UQGA 4DSFA 3V4IA 1J54A 4YOVA 1EXQA 3VQQA 2OCEA 4YDUA 3WNHA 2O8EB 4HDOA 5AQKA 1NBWA 1L3UA 4BRMA 1NKBA 5LMNK 4RG8A 1XWLA 3VQ7A 4JK9A 4Z0UA 3F9KA 3KLFA 1BIZA 3AU4A 4FXDA 3MX2A 4A2BA 1ATSA 3CF5L 5HROA 3ID6A 4CERA 3I33A 4ELVA 4B3SK 1GLJO 1EWRA 3MECA 2D0CA 4M3WA 2HBLA 1BDGA 2HHWA 4O8UA 1LOTB 1XUPO 2KW4A 3RMCA 3SYZA 4PY5A 4WE1A 4EKUA 2P9SB 3WNGA 1JKHA 2YCHA 3OYEA 3HVRA 2HNZA 2O8DB 3G0ZA 3DWLA 1VSJA 3DRPA 4FOIA 4LH5A 4FJ5A 3N4QA 3OYNA 1V4SA 3ZSXA 1O13A 4O4GA 3NH2A 3P1GA 4CF0A 4DU3A 2E2NA 2P9KA 4FJNA 1KD1O 3ID8A 1CXQA 3CQ8A 3KZBA 3DLRA 3ZETA 3KD1E 3GL1A 4E1JA 2ITGA 2QWPA 1QE1A 4Z94A 2WTUA 3DXMB 1JLAA 3SLCA 1NM1A 3MXJA 4O5FA 3HTVA 2KHOA 3QO9A 1L3TA 4E7JA 4JAXA 4JV5K 4NCBA 1RTJA 3LWMA 4EZ6A 1YT3A 3CCRN 3SQ4A 4NYFA 3W0LA 4LFBK 1TL3A 3QETA 4I6MB 2OTJN 4OKJA 3QEPA 5CY4A 3BINA 4FCYA 4E7LA 1DGKN 1D8YA 4FLXA 4BE2A 4DSJA 4DMNA 1N8RO 1KAZA 3U8XA 3RRHA 1T6CA 4KTZA 2YNGA 3U9ZA 4PKIA 3O4NA 4ILHA 4BR5A 1VQPN 1NGIA 1B9FA 4OLBA 4FVUA 1QS4A 1U47A 3ENHA 4B3MK 3ZSZA 4YOUA 4H0XB 1LWCA 3ZLJA 4C23A 1YHQN 4CBXA 2E20A 3IVFA 4KH5A 4MO5A 2W40A 4FWPA 2ZWHA 3THYA 1BA1A 3HYFA 3NFAA 5B8HA 1NGDA 1I94K 1ZBFA 2QKKA 4QCLA 2G8VA 5C24A 3UIQA 2ASOA 4CGGA 5IWAK 4EP5A 3ZSWA 3T7ZA 3GG4A 2HNDA 1IKWA 2Q0UA 2QTDA 1U6ZA 4M7YA 2PYJA 3TTDA 1NVLA 1NGEA 3GDQA 4JI5K 5AR0A 2YX6A 3ZEUA 3PX6A 3HT3A 4IOXA 2IGIA 4E89A 3F73A 2HBKA 2YJFA 4JS5A 3PSIA 3VA3A 1QZ5A 4DSEA 1YJWN 4UY8O 1NK7A 3FP5A 3ULDA 3EN9A 1RT7A 4EZ9A 4M42A 1VSFA 3OJSA 4JKEA 4A5BA 4IJAA 4HHTA 1RDAA 4BRIA 2I5JA 4FLYA 3AO1A 1MWKA 3LAMA 3HJFA 1QHAA 1HQEA 4K41A 1KVBA 1E5WA 4DTMA 2VQFK 3FLVA 2IIRA 3CETA 5CZ2A 2DY4A 1T44A 2BANA 4KO0A 4JKDA 4A57A 2E6LA 4O5BA 5ELZA 3L8BA 4HUGA 4CD3A 4BRAA 3K5NA 4BR9A 4GKKK 1NWKA 1C0UA 4PKGA 3R1XA 1BIUA 3CJ1A 4H0PA 3VQ6A 2ZQBA 4AHCA 4AILC 4FZXC 1QSYA 3CMEN 4H03B 1W9HA 3LAKA 1NOYA 5F1XA 3OYMA 3B6OA 1XC9A 4BRPA 3HXMA 4L8RB 1X9MA 4A62A 2QWOA 3DJCA 1J9AA 3HOSA 3THXA 4Q5VA 5C0YA 4DR3K 1DLOA 1WSJA 1QVGM 2VG5A 1YJNN 3ULEB 4LF7K 1MIXA 3AVIA 3PVLA 1QSSA 1HNVA 2AA4A 1VSKA 4C8NA 2KFZA 1NJZA 4TSXA 3ULEA 2QI2A 1YTUA 3MCPA 4ISFA 2RQ1A 1E4FT 1SQKA 4AM6A 4N41A 3AV9A 3SAHA 1J19A 3SJHA 3CFPA 3ZT1A 4DR4K 3VQDA 4JI3K 1TL1A 3WNEA 1Z05A 3CQXA 2EWSA 1HNIA 3QFPA 4L3QA 3DLGA 4IEEA 4I9LA 1KXPA 4B8AB 4CEQA 1HNXK 4JK8A 1VRTA 3V9UA 1WAFA 1TKXA 1HJOA 3Q7CA 2O8CA 4IOAL 5H1SQ 4PKHA 1X9JA 3LANA 4OPJA 3DXMA 4CEFA 3H1QA 1Q81O 1T03A 5FRMA 1Y97A 3KKSA 4FJHA 1ZC6A 1A5VA 2QA4N 4MLEA 4EHTA 4ZTFA 1I39A 1NK0A 3HP9A 5BRHA 1MA9B 4DKWA 5DM7L 2R82A 5AQVA 2O8FA
chains in the Genus database with same CATH topology
2NRRA 3O1WA 4IZ9A 1Y64A 3CPWM 2YJEA 3DXKA 5GAEP 2FLOA 4BY9C 2HE7A 1CZAN 4CI6A 1QZ6A 3WQUA 3M3ZA 3S41A 4WFAL 3CCQN 5IJMA 2ZGYA 5EOYA 4B1YB 1EO1A 1ZBSA 4IWVA 2FF3B 1GC6A 4HTLA 3DLLL 3J7ZO 1W2BM 4A61A 4U67L 3VMFB 1BO5O 1KBLA 3KHYA 5EXWA 2P9UA 3UKUA 3D2FA 3E66A 4BR4A 3M1FA 3VGKA 1Q18A 1GLBG 4KBOA 5ADXH 4F7GA 3RVCA 2YHWA 1VBGA 3UKUB 3D2FB 2P9SA 3LDNA 1EQYA 2A42A 4RTFD 2D11A 3QBWA 4CZFA 5AQIA 3TTFA 3EO3A 1HKGA 2ZJPL 1HKCA 3CCUN 1BOTO 1WUAA 2Q31A 1VQ4N 1M1KO 2F7TA 3KVGA 3EL2A 3M5RA 4BG8A 4AF1A 3X23A 5AQMA 1VQON 4G9ZA 3ZX3A 3A5NC 3VEYA 5C15A 5HL7L 2AEHA 1HLUA 4FWNA 3OW2M 5AQZA 4CZHA 2WUSA 3OHRA 4NLBA 2V7ZA 3O5BA 5BRFA 4AM7A 1VQ9N 3U9DA 3WXIA 1HPMA 1JCFA 1XQSC 4HWIA 4WFNL 4NO7A 2QWLA 1YI2N 4PL7A 2QWNA 3SAGA 2KLAA 2GTDA 2Q2RA 3OBWA 3WUHA 2Q1NA 3MN9A 1GLAG 3MN7A 3LM9A 3WQTA 5AQGA 4ILJA 3IFRA 4BRNA 2HF4A 2AP1A 5CR4A 4WQ4C 1YITN 3UE5A 3HBTA 1H1VA 4BR0A 4YDUC 1HB6A 2HBMA 4ZRJA 3QDKA 1NGAA 1J6ZA 3H46O 2P9NA 4J8FA 5BPLA 2QW9A 5KPZA 2E2OA 1NGBA 4DCHA 3MMVA 3D2EB 1YF5L 1ACAA 3SBGA 4B1ZA 3L6QA 4WF9L 3G25A 1GLCG 4GY2B 3JXUA 4IFEA 3AGKA 4BR2A 4BQLA 1K73O 2X0SA 2P9NB 5AZJB 4BROA 2LBBA 5JLFA 4IEIA 3UKRB 1T6DA 2ZPYA 2A5XA 1VQMN 3EZWA 2ABDA 5LJWA 1GGOA 3LDOA 3R3LA 2UYTA 3SBTA 2I1JA 4MO4A 4OPHA 1Q82O 3UB5A 1QQNA 2GEMA 3HSCA 2OTLN 3EPYA 5M1PA 3C7NB 3MDQA 3W3DA 2ZJQL 2FSJA 2J0JA 4FWSA 3BP8A 3CCJN 3C0BA 4IOCL 3D7EO 2CGKA 3I8BA 5JLHA 1GLLO 1DT9A 3QIJA 4H5NA 3VEWA 1VQNN 5EVZA 1XC3A 3SAFA 3M6GA 2VCPA 4M7XA 1ILYA 5M1OA 4CZEA 1KC8O 1BA0A 1U2VB 1YIJN 2EMSA 1DEJA 4GVEA 5AQVA 3L4QA 3I55N 1VQ5N 4CYEA 1EF1A 4BG9A 5LY3A 1KAXA 2VWBA 3NVMA 4BR7A 2QEXN 3CMAN 5GADP 1VQLN 2NNWA 4JKFA 4YORA 2YHYA 5AQWA 4DHYA 2QWMA 2HRJA 4RWTA 4NB4A 4FWRA 3H3NO 3L0QA 3BF1A 1HKBA 4IO9L 3CCSN 3H45C 1RFQA 3G71N 5AQNA 3OBYA 4CJ7A 2I1KA 5CE3A 2NRTA 4JD2B 4BC2A 5ADXA 5M1NA 2E2QA 5AQUA 1KC7A 1NGCA 3EKUA 1T3VA 2A40A 2PAVA 5AQQA 3VEOA 4WQ4A 4RCHA 1TYQA 4YOVA 2QWRA 1NGHA 3OA9A 4YDUA 2F9WA 4HDOA 5AQKA 1NBWA 3BEXA 2D0OA 4BRMA 3HI0A 2P9LB 4GNIA 4CZJA 3ATUA 3CJAA 3O8MA 5FPNA 4YOXA 3I56N 3CJ7A 2GWKA 2W41A 2H3GX 2AL6A 2VGNA 2WH5A 3RSEA 4CZGA 3R8EA 5AQSA 1X3NA 4BRKA 4JK9A 1E4GT 4ISGA 3QFUA 2D1KA 4PL8A 3AU4A 3MX2A 4A2BA 4JKCA 4GV6A 1ATNA 1ATSA 4H0TB 2ITMA 1Y19B 3CF5L 3ID6A 3I33A 4H5RA 4CBUA 4EHUA 4FWKA 3MN6A 4LC9B 1GLJO 4BRLA 2D10A 2P9UB 4JKGB 2YHXA 3FFKB 2NZTA 2GX9A 1BDGA 1S3XA 2HBLA 4JHDB 4O8UA 3WXJA 4BRDA 5JVLA 1LOTB 1XUPO 3VF6A 3VERA 3VF2A 3MCAB 3WXMB 4EKUA 2P9SB 3K9KA 1ZXOA 5BR9A 2YCHA 1MDUB 3AARA 4JHDA 1X3MA 2CGLA 4MDAA 3QB0A 5F0XA 1VQ7N 3DWLA 3LL3A 4H0OA 1RDWX 3VETA 5KQ8A 4FWMA 3CC2N 3O9RA 1NGJA 2FXUA 2QXLA 4FOIA 3N4QA 1V4SA 2D2QA 3TSQA 1O13A 4GXBA 1ESVA 2Q97A 3O9SA 4DQ8A 3ENBA 3F2KA 1ST7A 2HOEA 4NY0A 5C2FA 1IJJA 3O9QA 3R9PA 4WQ5C 2HF3A 4QS9A 3PZDA 2FSNA 2J0MA 2E2NA 2P9KA 3IMXA 4KH4A 1KD1O 3VTIA 2PFUA 3ID8A 4BC5A 4BRGA 4IJNA 3KZBA 4R79A 1MK7B 4FSVA 2VYPA 4DB3A 1VQ6N 3ZETA 3EE8A 3GL1A 2GELA 3SMPA 4E1JA 2QWPA 3HOTA 4QS7A 4Z94A 2BUPA 3DXMB 1P90A 1Z6RA 3GE1A 4KH6A 3SLCA 1NM1A 4U7BA 3TU5A 4XH4A 4O5FA 3HTVA 4H5TA 2KHOA 2HBJA 5AZIB 3A5OC 4FL9A 3FZLA 4CZMA 3F9MA 3A8YA 3QICA 1NI2A 4JAXA 4DXAB 4BRCA 4YOYA 5GINA 3CD6N 3P38A 3IUCA 2P9LA 5EX5A 3WEEA 3CPEA 4A59A 3CCRN 3D2EA 3W0LA 5TKWA 2ZGZA 3LDLA 1K8AO 3D6RA 3AY9A 1S22A 4I6MB 2JWKA 5E26A 2OTJN 3VENA 4WQ5A 4EFHA 3BINA 4PHTX 4M63C 5AZJA 2OANA 4BRQA 1DGKN 1NGGA 4CZIA 3QMLA 3C6HA 4XH5A 4JKBA 2CH6A 2GWJA 1KAZA 5FPEA 3U8XA 1N8RO 4OPAA 2DIKA 5EY4A 2DPNA 3VPZA 1T6CA 1VQ8N 2CGJA 1BU6O 2QWQA 3U9ZA 3VEZA 1YXQA 4MDBA 4PKIA 2ASPA 5I9EB 5KPTA 4ILHA 2PBDA 4BR5A 1VQPN 2YI1A 3H1VX 5GAGP 1NGIA 3O4WA 2JWLA 3MX5A 4FVUA 1YUWA 3TSUA 1RGIA 3ENHA 5E84A 2J4RA 4YOUA 4H0XB 2NRZA 2BH1A 3AU5A 5FPDA 3P4IA 1JJ2M 4JK7A 3ZX2A 3FR0A 5C10A 5AQRA 3P39A 1TUUA 3O1BA 4C23A 4XH1A 1YHQN 1TUYA 4JN4A 2HSTA 5GIOA 1GLEG 1IG8A 4CBXA 5KQDA 2E1YA 3O9UA 4C1NK 2E20A 3NVKA 3IVFA 2ZJRL 3FZMA 4KH5A 4MO5A 2W40A 4A5AA 2D4WA 4FWPA 4BREA 2ZWHA 1VQKN 1BA1A 4WYBA 2A41A 5B8HA 1NGDA 1H4RA 2CB8A 2NRXA 2P9KB 3F5TA 1GG3A 5BPNA 4BC4A 4JEPA 2ASOA 4WCEL 3ZETB 4FWLA 4P7IA 2P9PB 1M90O 2NLXA 4BVOA 4BGBA 4BRHA 2J0KA 3O80A 1NLVA 5AQJA 1K9MO 3T7ZA 1DIKA 1C0FA 3GG4A 3TSPA 3VTHA 1QQMA 3CERA 2GUPA 4MLHA 2Q0UA 1KAYA 2NRWA 2QTDA 1U6ZA 5FPMA 2BTFA 2A3ZA 1SZ2A 4M7YA 3C65A 5BPMA 5C12A 3CXCM 3TTDA 3RSEB 1NVLA 3L4IA 1BG3A 3CC4N 1NGEA 4FPAA 3ZYYX 3GDQA 3WEEB 3SK3A 3UKRA 5AR0A 2YX6A 2ZF5O 4CZLA 5CHIA 1V4TA 3A5MC 3CHWA 3MK6A 4O8KA 3ZEUA 3WA0A 4GV9A 4IOXA 1DKGD 4ISEA 1NTIA 1GLDG 3AAPA 4B9QA 3E9PA 3E9LA 1NGFA 1YVNA 4ZRKA 3CIPA 3C7NA 1JCGA 2IVPA 3U8ZA 3KWGA 2HBKA 4EIAA 3CJ9A 5AFUA 1ISNA 2CQUA 3CC7N 2YJFA 1JCEA 1VBHA 1QZ5A 1YJWN 4UY8O 3TTCA 3O6WA 1K8KB 5M1QA 3WXKA 1OVYA 4WFBL 3FP5A 4BVPA 1HB8A 2YVCA 3TPQA 4BQZA 5HOOA 3FZFA 3KK7A 3EN9A 4B1VA 4CBWA 1YJ9N 1QQOA 5F2RA 4JKEA 4A5BA 4IJAA 3O9TA 5KPRA 4B1XB 2KKZA 1VAZA 4IDHA 4Y0WA 3CQYA 3MN5A 5BN9A 3EKSA 3N4PA 4BRIA 3FGUA 3ENOA 1MWKA 1Q86O 2RE2A 3CCMN 2A6AA 3DAWA 3IDHA 3U4LA 2E2PA 2Q0RA 3EE9A 3G4SN 1QHAA 2COPA 4K41A 3VOVA 3PIPL 1E5WA 4C1NI 5LJVA 1BWFO 5BRDA 3CCLN 4FPBA 1WOQA 3FLVA 4FWQA 2IIRA 3CETA 4XEIA 1W97L 3NMUA 3K9JA 1T44A 3VGLA 2RHKA 4JKDA 4A57A 4BGAA 2V52B 5ELZA 4CD3A 4BRAA 2WC9A 1HUXA 4BR9A 5GAHP 3PIOL 3A5LC 2FJ9A 2E8AA 4BRFA 2I7NA 3MWPA 4JD2A 5AZIA 5AFUH 2FSKA 3CJBA 1S72N 1RDUA 3R6MA 1Q7YO 4OO1J 4F9OA 1MWMA 1GC7A 1NWKA 3HM8A 4PKGA 2QM1A 3BF3A 3R1XA 1SAZA 1TYQB 3CJ1A 1G99A 4NLCA 3CCVN 4H0PA 1NJIO 4EAHD 2V7YA 4JNEA 3ZDTA 4I6MA 3CMEN 3VESA 1SGHA 2P9IB 3IKMA 4H03B 4CZKA 5DM6L 3C6AA 2CH5A 4H5WA 4A2AA 3DXKB 4K43A 3T69A 4YOWA 3HRGA 5AQXA 3ZEUB 5AQHA 5F1XA 5JICA 2FF6A 1HX1A 3AAQA 1GLFO 3Q7BA 3VGMA 5BREA 5GIPA 4YOTA 4BRPA 3JS6A 3ATVA 4JKGA 2QWOA 3DJCA 2VGMA 3E1YA 4A62A 3HOSA 3P31A 2NRVA 2NRHA 2Q36A 5C0YA 5AQFA 1QVGM 1D4XA 3G6EN 1YJNN 1K8KA 3ULEB 3FLCO 4TKNA 2WFBA 5BN8A 1MIXA 2V51B 3PVLA 2HMPA 4H0VB 3H3OB 2AA4A 1SS6A 1QVFM 1ATRA 1LCUA 3VEVA 3WT0A 4B1WB 5AQOA 3LDPA 2QI2A 3ULEA 5C2DA 3MCPA 4ISFA 2RQ1A 1E4FT 2IVOA 1SQKA 2E88A 1U2VA 4AM6A 5MLCQ 1R59O 3SAHA 1J19A 3SJHA 3H6EA 5AQPA 2D0PA 3CJCA 3MWTA 5JVGL 4HDQA 3FE1A 3LDQA 1BUPA 3QBXA 4YL8A 3VEXA 3HZ6A 4ZRIA 1Z05A 3CQXA 4H0YB 4IXCA 2EWSA 3QFPA 4L3QA 4IEEA 4B1UB 3SMSA 3ZX0A 3A0IX 5M1FA 3U7DA 1KXPA 4GV3A 4CD1A 4JKAA 5JMVA 5M1KA 4JK8A 1MK9B 5TKYA 1C0GA 1MIZB 5AQTA 2FDQA 2P9PA 1OKJA 1P8ZA 1NMDA 4QS8A 3GBTA 2IVNA 4IO8A 1HJOA 2F9TA 3Q7CA 4IOAL 5H1SQ 4PKHA 1X9JA 4H5VA 5AQLA 3CCEN 3BUZB 4ILGB 2EMTA 3B8AX 5AQYA 3DXMA 3WXLA 3GOIA 3H1QA 1Q81O 3KWIA 2ASMA 3VF4A 3J8AA 2I7PA 3PLAA 3FZHA 1KQSM 2E1ZA 1JDEA 3AGRA 1ZC6A 4FOEA 4FWOA 4K25A 4MLEA 2WBNA 4BC3A 1HBKA 4EHTA 2QA4N 5JVHL 4JKHA 5BRHA 3LM2A 1MA9B 1YAGA 4DKWA 2R82A 5DM7L 3E9OA 3O08A 4FO0A 3FZKA 2P9IA 3CI5A 4K42A 3G9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKF A;  4JK7 A;  4ILJ A;  4JKA A;  4JK8 A;  3SBT A;  3E9O A;  4JKB A;  4JK9 A;  4ILG B;  4JKD A;  4JKE A;  4ILH A;  4JKG A;  3SBG A;  4JKC A;  3ENB A;  3E66 A;  3E9P A;  3E9L A;  4JKH A;  4JKG B; 
#chains in the Genus database with same CATH topology
 3S9H A;  3NAE A;  4IZ9 A;  1NJY A;  2YJE A;  3T1A A;  5GAE P;  2HE7 A;  2P5G A;  4CI6 A;  1QZ6 A;  5J2M A;  3S41 A;  3LPT A;  5IJM A;  1JLC A;  3SCX A;  1OH7 A;  3PX0 A;  1ZBS A;  1T7P A;  2FF3 B;  3J7Z O;  3SI6 A;  1W2B M;  5C25 A;  1KBL A;  2G8I A;  2P9U A;  2QXF A;  2HHT A;  3E66 A;  1RTI A;  4O44 A;  1VSM A;  3NF6 A;  5E41 A;  3RVC A;  2IC3 A;  3LDN A;  2D11 A;  3EO3 A;  2IDO A;  4BE0 A;  1HKC A;  3SQ2 A;  1M1K O;  4KHU A;  2VWJ A;  5AQM A;  3VEY A;  3L2U A;  3PO5 A;  3OHR A;  4NLB A;  3AVB A;  3DLE A;  4M3T A;  1HPM A;  2WON A;  4HWI A;  3OYI A;  2YNF A;  4PL7 A;  4CEA A;  3EZ5 A;  2YNH A;  2Y1I A;  4BRN A;  1YIT N;  3UE5 A;  1H1V A;  1XNQ K;  2BE2 A;  1FJG K;  2QW9 A;  5KPZ A;  1NGB A;  3C6U A;  3L3U A;  5I42 A;  3THW B;  3D2E B;  3ZSR A;  3AVC A;  1NK4 A;  4IFE A;  3JXU A;  4BQL A;  4IEI A;  4W5N A;  4CGJ A;  1KTQ A;  1RT4 A;  4E1N A;  3LDO A;  3R3L A;  4OPH A;  4W5T A;  3MEG A;  3OS1 A;  2GEM A;  3U3Y A;  3EPY A;  5M1P A;  4FVM A;  3W3D A;  4DV5 K;  3MEE A;  4FWS A;  4JI6 K;  3NGI A;  4IOC L;  1NK8 A;  2P1J A;  5JLH A;  1GLL O;  4M7X A;  3V1R A;  1W7A A;  1YIJ N;  2EMS A;  4KKO A;  4OKE A;  3I55 N;  1WSE A;  5LY3 A;  2VWB A;  4BR7 A;  3CMA N;  4AHV A;  4M3R A;  3OYJ A;  1ASU A;  4RWT A;  2YHA A;  3CCS N;  3G71 N;  1REV A;  3OBY A;  4CJQ A;  5CE3 A;  1Z25 A;  4JD2 B;  5M1N A;  2O8C B;  1KC7 A;  3SQ1 A;  3EKU A;  5HBM A;  4HCB A;  4B8C A;  4WQ4 A;  1TYQ A;  2QWR A;  1NGH A;  4KHS A;  2F9W A;  1NK5 A;  4V19 S;  4BE1 A;  3J7Y P;  2KZZ A;  3CJ7 A;  4LF9 K;  4ID5 A;  3RSE A;  2WH5 A;  4CZG A;  1J5E K;  4LH4 A;  4M3Z A;  4G1Q A;  1X3N A;  4IFY A;  4C8L A;  3PO4 A;  1U04 A;  2O4G A;  4ZHR A;  1KSP A;  1Y19 B;  4AHU A;  4EHU A;  1HMV A;  1UAX A;  2P9U B;  2YKN A;  4GMJ B;  3FFK B;  5LL6 Z;  4BRD A;  5JVL A;  3VF6 A;  1X9W A;  3E01 A;  2HW3 A;  2D0A A;  4LFC K;  1HYS A;  3AAR A;  1X3M A;  2FBT A;  3L2W A;  1A5W A;  3AA4 A;  1VQ7 N;  1KRP A;  4H0O A;  3VET A;  1EET A;  5KQ8 A;  2FXU A;  2VWK A;  2Q97 A;  1ESV A;  3VQE A;  3O9S A;  4M3X A;  1IJJ A;  4WQ5 C;  4QS9 A;  2UUC K;  4KH4 A;  3O3H A;  4R79 A;  1MK7 B;  4FSV A;  2VYP A;  3A2F A;  1RBS A;  3HOT A;  2DFF A;  4QS7 A;  2BUP A;  1P90 A;  3DRS A;  4JI2 K;  3HO1 A;  4XH4 A;  1UA1 A;  1HNZ K;  3AVJ A;  4K0K K;  4E7K A;  5AZI B;  3A5O C;  3F9M A;  3QIC A;  1HPZ A;  4BDP A;  2DFE A;  5HP1 A;  4BRC A;  3CD6 N;  4A59 A;  3HP6 A;  1N32 K;  2ZGZ A;  1YTA A;  3AY9 A;  1S22 A;  4JRP A;  2JWK A;  3SUP A;  2WOM A;  4M63 C;  2OAN A;  5AZJ A;  5IT9 O;  3C6H A;  3NGY A;  4XH5 A;  4JKB A;  4Z4I A;  2O8F B;  3RMA A;  2DPN A;  3VPZ A;  1LV5 A;  2QWQ A;  4LFA K;  2KQ2 A;  3J7A P;  3RRG A;  4CHY A;  4YHH K;  5GAG P;  3O4W A;  3C95 A;  2JWL A;  3MX5 A;  3OVN A;  4N47 A;  1RGI A;  4O0I A;  1BGX T;  5E84 A;  1QQC A;  2J4R A;  3QEW A;  1VSD A;  3P4I A;  5C10 A;  2GUI A;  3O1B A;  3RMD A;  3RR8 A;  1TUY A;  3ISN C;  5KQD A;  3O9U A;  4C1N K;  2ZJR L;  4CFB A;  1NK9 A;  1C1A A;  1IKY A;  5DMR A;  4O55 A;  4CFA A;  2A41 A;  2CB8 A;  3DI6 A;  4Y1D A;  2P9K B;  4E0D A;  4KB1 A;  4BC4 A;  1TK5 A;  3VN5 A;  2Y1J A;  4B9U A;  4JYA K;  3RTV A;  3ZET B;  4P7I A;  3DLK A;  2P9P B;  4BGB A;  3I0S A;  4IDK A;  1NLV A;  4OJR A;  1DIK A;  4CIF A;  4MLH A;  4LF4 K;  1KAY A;  4CK3 A;  5J2P A;  2BTF A;  4B9M A;  3CXC M;  3UKR A;  1RBU A;  2ZF5 O;  4CZL A;  3A5M C;  3MK6 A;  4O8K A;  4DQR A;  3V1O A;  4ISE A;  2OYQ A;  1NTI A;  1JXE A;  3BGR A;  3TWH A;  1NGF A;  4JI8 K;  1YVN A;  4N76 A;  3HPG A;  1JCE A;  3SV3 A;  3SQ0 A;  1ZBH A;  4CEB A;  4YFU A;  1RBT A;  1HB8 A;  3TPQ A;  1RCH A;  5HOO A;  3FZF A;  1JL2 A;  3G10 A;  1QQO A;  4FK2 A;  5KPR A;  2KFN A;  1XHX A;  3N4P A;  4CK1 A;  3FGU A;  1Q86 O;  3PY8 A;  2A6A A;  3DAW A;  4RW9 A;  3U4L A;  2Q0R A;  2COP A;  1RT3 A;  4DTN A;  3OYC A;  1BWF O;  4Z4H A;  4FPB A;  1FKO A;  4C8K A;  3TAQ A;  3K9J A;  2V52 B;  3MED A;  2WC9 A;  3A5L C;  2FJ9 A;  4C8M A;  3MWP A;  5AFU H;  3CJB A;  1S72 N;  1RDU A;  1Q7Y O;  4OO1 J;  1MWM A;  4DS5 A;  1EP4 A;  3SUN A;  2EX3 A;  3CCV N;  1OH5 A;  1XNR K;  4EAH D;  5JS2 A;  1QSL A;  4DSI A;  4B3R K;  1FKP A;  3HL8 A;  1RT2 A;  3T69 A;  4YOW A;  4OPK A;  4DV1 K;  5AQH A;  4CJE A;  1GLF O;  5GIP A;  3KLH A;  4HUF A;  1D5A A;  4JKG A;  2VGM A;  3P31 A;  2YHB A;  1LAV A;  4FJM A;  2DTU A;  1VSL A;  4DQQ A;  2ETJ A;  2XY8 A;  1N5Y A;  1K8K A;  3T3F A;  5BN8 A;  1A5X A;  3K59 A;  2HMP A;  1SS6 A;  1ATR A;  1HJR A;  5AQO A;  3LDP A;  1TKD A;  4FJG A;  1BCM A;  4DLG A;  4DTX A;  5MLC Q;  1R59 O;  3H6E A;  1RDB A;  1JLF A;  1Z26 A;  3CJC A;  4CHN A;  4CJW A;  1N33 K;  4KAZ A;  3DYA A;  4C8O A;  3VEX A;  3HZ6 A;  4ZRI A;  3OY9 A;  3L2V A;  1GOA A;  3A0I X;  4DV0 K;  5M1K A;  3K5M A;  1S1U A;  1MIZ B;  1CXU A;  1VSE A;  2P9P A;  1OKJ A;  2F9T A;  4DTS A;  3AA3 A;  1WBD A;  1XHZ A;  4H5V A;  3V6D A;  4RW7 A;  2OZS A;  3BUZ B;  5KGW A;  4DR5 K;  4CGD A;  3WXL A;  3TR8 A;  3KWI A;  3VF4 A;  4LY7 A;  3C94 A;  3NHG A;  1JDE A;  3AGR A;  3QNN A;  4OLA A;  4BC3 A;  4FWO A;  2F4V K;  4JRQ A;  1HBK A;  4OGC A;  4JKH A;  3LM2 A;  1YAG A;  4FLT A;  3E9O A;  2P9I A;  4F2S A;  4M3Y A;  5BR8 K;  3KLG A;  4DTJ A;  1CZA N;  3WQU A;  1X1P A;  4BWJ A;  3CCQ N;  3M8S A;  2G8K A;  3KK1 A;  1C0T A;  1SKW A;  1EO1 A;  2VQE K;  1GC6 A;  4HTL A;  3KLI A;  3DLL L;  3CFR A;  4U67 L;  3BY5 A;  3VMF B;  1BO5 O;  5EXW A;  3UKU A;  3D2F A;  4KFB A;  4DR2 K;  3VGK A;  1Q18 A;  1IBK K;  4KHQ A;  4KBO A;  4W5O A;  3UKU B;  4CJT A;  1KFS A;  4I7F A;  2P9S A;  4FZZ A;  3TTF A;  4CF8 A;  5KTQ A;  3I0R A;  3M5R A;  3X23 A;  2YKM A;  5C15 A;  5HL7 L;  3VA0 A;  2AEH A;  1HLU A;  3OW2 M;  5AQZ A;  1RNH A;  4CJP A;  4CZH A;  1JLG A;  2V7Z A;  1NKE A;  3FFI A;  3U9D A;  4FK0 A;  4CGF A;  3ZSQ A;  4R5P A;  3ZT2 A;  4NO7 A;  2Q1N A;  1U48 A;  1GLA G;  3MN7 A;  3LM9 A;  4B9V A;  5AQG A;  4ILJ A;  3IFR A;  4FM0 A;  2AP1 A;  5FDL A;  4DS4 A;  4YDU C;  3QDK A;  1TK8 A;  1NGA A;  3H46 O;  3NE6 A;  2P9N A;  4J8F A;  3HST B;  3AVN A;  3ITH A;  3MMV A;  3SBG A;  1WSF A;  4CJ5 A;  1GLC G;  4DFP A;  1J5O A;  3AGK A;  1S6Q A;  3ALY A;  2X0S A;  1IKV A;  2P9N B;  4FM1 A;  2LBB A;  1T6D A;  2ZPY A;  2ABD A;  4B9T A;  2UYT A;  4B9L A;  1RT1 A;  1Q82 O;  3C7N B;  3MDQ A;  1N36 K;  2ZJQ L;  2J0J A;  3KK2 A;  3HVT A;  4CHZ A;  3BP8 A;  3C0B A;  1SKS A;  3KJV A;  2VG7 A;  4LF5 K;  4X62 K;  4FJX A;  3QIJ A;  3VEW A;  1XC3 A;  3SAF A;  3M6G A;  2VCP A;  2W6K A;  4CZE A;  3OYL A;  1KC8 O;  1BA0 A;  2HHV A;  2Z1I A;  4CYE A;  4BG9 A;  4Q0B A;  1KLM A;  1LW0 A;  1OH6 A;  4YOR A;  2O8B B;  3TAB A;  4FWR A;  3H3N O;  3L0Q A;  3OYH A;  1RFQ A;  5AQN A;  2I1K A;  3P83 D;  5ADX A;  4DV7 K;  2O8E A;  1NGC A;  5AQQ A;  4JI4 K;  1ZBI A;  4RCH A;  1RIL A;  4CFC A;  3I8D A;  2P5O A;  1U4B A;  2IAJ A;  3HI0 A;  4H4M A;  2P9L B;  2IOC A;  4GNI A;  3K2P A;  3O8M A;  3I56 N;  4CHO A;  4CEO A;  4PWD A;  3L2R A;  2AL6 A;  3MAQ A;  4FM2 A;  4CJU A;  2JLE A;  5AQS A;  3D45 A;  1E4G T;  4ISG A;  4E7H A;  1JLQ A;  3V9S A;  4CES A;  2XO7 A;  2D1K A;  4PL8 A;  1U49 A;  3AO2 A;  4H0T B;  2ITM A;  4FZY A;  4DSL A;  4HUE A;  1TKT A;  4FWK A;  4Z4F A;  2D10 A;  4FJL A;  4JKG B;  2YHX A;  2F8S A;  4JHD B;  1S3X A;  1YVU A;  3WXJ A;  3QLH A;  3VF2 A;  3MCA B;  4BAC A;  4FK4 A;  1ZXO A;  4JHD A;  5EU7 A;  2CGL A;  5F0X A;  3QB0 A;  3CC2 N;  3O9R A;  3SUQ A;  2QXL A;  2D2Q A;  4GXB A;  4DQ8 A;  2O8D A;  1G15 A;  4OKK A;  1ST7 A;  3S3M A;  3R9P A;  2HF3 A;  3OYB A;  4F3T A;  2J0M A;  1ASW A;  3IMX A;  5J2N A;  3VTI A;  2PFU A;  4BC5 A;  2Z1J A;  1DTQ A;  4IJN A;  2GEL A;  3SMP A;  3QEV A;  2KTQ A;  5DK5 A;  3GE1 A;  4KH6 A;  3J80 O;  3ZT0 A;  4U7B A;  4ZTJ A;  3VQB A;  4JI1 K;  4H5T A;  1VSH A;  4FL9 A;  5J1E A;  3OYK A;  1WNS A;  4YY3 K;  2UU9 K;  4DR1 K;  4DSK A;  3KIO A;  3P38 A;  3AVF A;  5EX5 A;  3WEE A;  3EYZ A;  2HVH A;  2VG6 A;  3D6R A;  3NF9 A;  5E26 A;  3VEN A;  4WQ5 A;  3O3G A;  5SZT A;  1NKC A;  1S9E A;  1HR0 K;  4CZI A;  4CJ4 A;  4DWI A;  3QML A;  4ELU A;  3BDP A;  2GWJ A;  1TAQ A;  4OPA A;  3D0P A;  1VQ8 N;  2CGJ A;  1BU6 O;  3VEZ A;  2ASP A;  3V1Q A;  5I9E B;  2PBD A;  2YI1 A;  2QKB A;  1FW6 A;  2FBV A;  4JS4 A;  4KRF A;  4ID1 A;  1YUW A;  3AA2 A;  4X66 K;  2KZM A;  2BH1 A;  4JK7 A;  3ZX2 A;  1LWE A;  4DF4 A;  5AQR A;  3P39 A;  4KHP K;  4XH1 A;  4JN4 A;  5GIO A;  1GLE G;  2O8B A;  4A5A A;  2D4W A;  2GBZ A;  4BRE A;  4KHW A;  1VQK N;  1B92 A;  4F8R A;  1S1V A;  4FW1 A;  2RKI A;  1X9S A;  2NRX A;  3VQ9 A;  1GG3 A;  1SV5 A;  4JEP A;  1LWF A;  3DOL A;  2HHH K;  4WCE L;  2AJQ A;  3IS9 A;  1SL2 A;  1NJW A;  3OS2 A;  4GVM A;  4FWL A;  2NLX A;  3PX4 A;  2J0K A;  4LSL A;  1WBB A;  3TSP A;  4LF8 K;  2OPS A;  1QQM A;  2GUP A;  3AVL A;  2NRW A;  4E7I A;  3ZCM A;  5BPM A;  1SZ2 A;  1I3A A;  3C65 A;  5C12 A;  4QOZ B;  4KV8 A;  3L4I A;  4FPA A;  3ZYY X;  3HPO A;  5CHI A;  1V4T A;  3QIO A;  3WA0 A;  4DQI A;  4JLH A;  1JL1 A;  3DLB A;  1GLD G;  1HNW K;  3E9P A;  4CIE A;  4B3O A;  4ZRK A;  1JCG A;  1RBV A;  2IVP A;  3U8Z A;  4EIA A;  5AFU A;  4DFK A;  1ISN A;  3CC7 N;  4YNQ A;  3CM6 A;  1XMQ K;  3O4Q A;  3TTC A;  1K8K B;  4CJF A;  3WXK A;  4WFB L;  1OVY A;  1S1T A;  4BVP A;  2D5R A;  2YVC A;  4BQZ A;  4LSN A;  3KK7 A;  4RW6 A;  5F2R A;  3O9T A;  1VAZ A;  4IDH A;  4FJ9 A;  2XHB A;  3MN5 A;  5BN9 A;  4Z4E A;  3PUF A;  3ENO A;  4I9Q A;  3LP2 A;  4K8Z A;  2FBY A;  4GKJ K;  3IDH A;  4DR7 K;  1L5U A;  2UUB K;  3G4S N;  4KTQ A;  3VOV A;  2E4L A;  2ZD1 A;  5LJV A;  4F4K A;  1W97 L;  4E3S A;  1NU0 A;  3NMU A;  3MXM A;  3VGL A;  2RHK A;  1HUX A;  2BDP A;  4BRF A;  3THV A;  3R6M A;  4F9O A;  3TI0 A;  3BF3 A;  4NYN A;  3B6P A;  5KRT A;  4DV2 K;  4CGH A;  4NLC A;  2A1S A;  3ZDT A;  4I6M A;  3ZSV A;  2P9I B;  4CZK A;  5DM6 L;  3LAL A;  2CH5 A;  4H5W A;  4A2A A;  3DXK B;  4K43 A;  1QHT A;  1KFD A;  4FJ8 A;  1MU2 A;  3AAQ A;  1HX1 A;  3LP1 A;  4FLZ A;  3JS6 A;  3ATV A;  1RT5 A;  3E1Y A;  3M8P A;  4LF6 K;  3T1Y K;  2NRV A;  2NRH A;  2Q36 A;  5AQF A;  5A2Q O;  3KTQ A;  5HRN A;  3OYG A;  1VRU A;  3LPU A;  4AH9 A;  1NNE A;  4GW6 A;  3S3O A;  1EWQ A;  1S6P A;  2V51 B;  4DV6 K;  1SUQ A;  3H3O B;  4CJR A;  3VEV A;  3QER A;  4B1W B;  1NK6 A;  3V81 A;  2EHG A;  4KB0 A;  4N5S A;  1JLB A;  1U2V A;  2ZJP L;  2XY6 A;  1OH8 A;  5AQP A;  2X78 A;  2UXD K;  2D0P A;  3H08 A;  3MWT A;  5JVG L;  4CF2 A;  2O4I A;  1IV0 A;  3FE1 A;  3LDQ A;  1BUP A;  3QBX A;  2G8U A;  3SNN A;  4IXC A;  3KD5 E;  1HYZ A;  4B9N A;  4B1U B;  3SMS A;  5M1F A;  2OPQ A;  4GV3 A;  2G8H A;  4F2R A;  2PZS A;  3OJU A;  2B5J A;  4J2D A;  3K5O A;  5AQT A;  2B6A A;  1SL1 A;  3GBT A;  2IVN A;  4IO8 A;  1T05 A;  4DV4 K;  3CCE N;  3O3F A;  3EY1 A;  4FLW A;  2EMT A;  3B8A X;  5AQY A;  3GOI A;  1HYV A;  2ASM A;  3J8A A;  2I7P A;  3FZH A;  1KQS M;  1S5J A;  1XI1 A;  4B9S A;  1SL0 A;  4FOE A;  2Z1H A;  4K25 A;  2WBN A;  1TV6 A;  5JVH L;  1L3V A;  4DF8 A;  2E5L K;  1UA0 A;  4H4O A;  4FO0 A;  3CI5 A;  4K42 A;  1OVQ A;  3LWL A;  2NRR A;  4I2P A;  5HRR A;  2FLO A;  1S1W A;  1N34 K;  4WFA L;  1Q9Y A;  2ZGY A;  4CF1 A;  5CZ1 A;  4IWV A;  3ZSY A;  1NG9 A;  1BI4 B;  3TAR A;  4A61 A;  4CF9 A;  4NCA A;  2HNY A;  3EEQ A;  1IO2 A;  1D9D A;  5ADX H;  3RWU A;  4F7G A;  1VBG A;  3LP3 A;  3U6F A;  4CE9 A;  4CZF A;  4CJS A;  1HKG A;  1WUA A;  1VQ4 N;  3KVG A;  3EL2 A;  1VQO N;  1D9F A;  3ZX3 A;  2LSN A;  3VQ8 A;  4CVN E;  3V9X A;  3AVH A;  2WUS A;  2G8F A;  5BRF A;  3OTO K;  1VQ9 N;  3IAY A;  3WXI A;  3NF8 A;  1XQS C;  5SWM A;  1FK9 A;  2QWL A;  1YI2 N;  4KPY A;  2QWN A;  2KLA A;  3VQP A;  3WUH A;  3MN9 A;  3WQT A;  5HLF A;  5K14 A;  2HF4 A;  4CIG A;  3V9W A;  1TAU A;  2P51 A;  3AVK A;  3HBT A;  3THW A;  2XY5 A;  4BR0 A;  1GOC A;  3RR7 A;  4CEE A;  3BZC A;  2HBM A;  4FYD A;  4ZRJ A;  3HM9 A;  3TAN A;  1K6Y A;  5BPL A;  1IKX A;  2E2O A;  1EX4 A;  3JYT A;  3L6Q A;  4WF9 L;  3CFO A;  4GY2 B;  1K73 O;  4CED A;  3P5J A;  5AZJ B;  5CYM A;  4BRO A;  3OYF A;  2FBX A;  2A5X A;  5AJ3 K;  1VQM N;  1KVA A;  1WLJ A;  4KHN A;  5LJW A;  1T8E A;  1GGO A;  3SBT A;  3UB5 A;  1WB9 A;  3PSF A;  2OTL N;  3IRX A;  2UXC K;  2HHU A;  3D7E O;  4J2A A;  4NXN K;  4H5N A;  1VQN N;  5EVZ A;  3ZT3 A;  4FLV A;  1IH7 A;  5M1O A;  1U2V B;  2QEX N;  1KAX A;  4JI0 K;  3NVM A;  1Q9X A;  1C1B A;  1BL3 A;  5GAD P;  4CJV A;  2HRJ A;  2OPP A;  4NB4 A;  3BF1 A;  3TAG A;  3NH1 A;  1C6V A;  3AO3 A;  2NRT A;  2E2Q A;  5HRS A;  1T3V A;  2A40 A;  2RPI A;  3VEO A;  3AVG A;  4W5R A;  3L2Q A;  3OA9 A;  4DTP A;  4B3T K;  1RTH A;  1WSH A;  3BEX A;  2D0O A;  4FJI A;  3LP0 A;  1BCO A;  1GOB A;  4CZJ A;  3ATU A;  3CJA A;  5FPN A;  4BWM A;  4YOX A;  3NGZ A;  4DFM A;  4FJ7 A;  2GWK A;  2W41 A;  2H3G X;  2VGN A;  3LZI A;  2YV0 X;  3QIN A;  3R8E A;  4DTU A;  4BRK A;  4O0J A;  3QFU A;  4MQ3 A;  1TKZ A;  3TAP A;  1KVC A;  1BQM A;  4CFD A;  4HVJ A;  1F21 A;  4JKC A;  4DV3 K;  1ATN A;  2NUB A;  4GV6 A;  4H5R A;  4CBU A;  3MN6 A;  4LC9 B;  1ITG A;  4M45 A;  1VSI A;  4BRL A;  2HB5 A;  5I3U A;  2NZT A;  2GX9 A;  3VER A;  1CZ9 A;  3WXM B;  3K9K A;  3WNF A;  5BR9 A;  1MDU B;  2FC0 A;  2F8T A;  4MDA A;  3LL3 A;  1NOZ A;  1RDW X;  4FWM A;  1NGJ A;  4ELT A;  4BDZ A;  3TSQ A;  2HHX A;  4IG3 A;  3ENB A;  2Q3S A;  3F2K A;  2HOE A;  5C2F A;  4NY0 A;  1L3S A;  3TAM A;  3O9Q A;  3PZD A;  2FSN A;  4DTO A;  1ASV A;  4NCG A;  3TAE A;  3AVA A;  4BRG A;  3V9Z A;  1IBM K;  1RBR A;  5JS1 A;  4DU1 A;  1VQ6 N;  4DB3 A;  3EE8 A;  3SPZ A;  1Z6R A;  3VQ5 A;  5KI6 A;  3TU5 A;  3JSM A;  5HRP A;  1NJX A;  2HBJ A;  3FZL A;  4CZM A;  3A8Y A;  1JXB A;  1NI2 A;  4DXA B;  4YOY A;  3QEX A;  5FLX O;  5GIN A;  4AHT A;  3IUC A;  2P9L A;  2XRI A;  3CPE A;  3DRR A;  3D2E A;  5TKW A;  1K8A O;  3LDL A;  4CW7 B;  4Z4C A;  4EFH A;  4CCH A;  4PHT X;  4BRQ A;  1NGG A;  2OZM A;  4X65 K;  3OYA A;  2CH6 A;  5FPE A;  5EY4 A;  2DIK A;  1CZB A;  1UOC A;  3OS0 A;  3C6T A;  1YXQ A;  4MDB A;  3AO4 A;  5KPT A;  3H1V X;  4B08 A;  3TSU A;  3U3G A;  4DUZ K;  3KK3 A;  5KGX A;  3K58 A;  1RTD A;  3AA5 X;  2RN2 A;  3AVM A;  2HHS A;  4OX9 K;  2NRZ A;  3CG7 A;  3AU5 A;  5FPD A;  1JJ2 M;  3FR0 A;  2PYL A;  1TUU A;  4CEZ A;  2HST A;  1VHX A;  4RW8 A;  1IG8 A;  1TVR A;  2E1Y A;  3NVK A;  1S1X A;  3FZM A;  4QAG A;  1VK0 A;  3K5L A;  4J2E A;  4WYB A;  1H4R A;  3MXI A;  3F5T A;  5BPN A;  1ZBL A;  3NBP A;  3LZJ A;  3K57 A;  4CHQ A;  2HMI A;  2RF2 A;  1M90 O;  4KI6 A;  4BVO A;  4I2Q A;  1KCF A;  4BRH A;  4N56 A;  3O80 A;  4BDY A;  5AQJ A;  1LAW A;  1K9M O;  3NH0 A;  3HPH A;  1C0F A;  3VTH A;  1HRH A;  3CER A;  2DFH A;  2F96 A;  2A1R A;  5FPM A;  4X64 K;  2A3Z A;  3SV4 A;  3RSE B;  1BG3 A;  3CC4 N;  3WEE B;  3SK3 A;  2QK9 A;  4FLU A;  2ZE2 A;  3CHW A;  3NDK A;  4GV9 A;  1DKG D;  3AAP A;  3QIP A;  3T1H K;  4B9Q A;  3E9L A;  4E19 A;  1DTT A;  3CIP A;  3C7N A;  3DMJ A;  3KWG A;  3CJ9 A;  2CQU A;  1VBH A;  3SJJ A;  3O6W A;  5M1Q A;  3PV8 A;  4KHY A;  1TGO A;  2X6N A;  1NMN A;  4KTW A;  4B1V A;  1SKR A;  5J2Q A;  4CBW A;  3VQ4 A;  4DG1 A;  1YJ9 N;  1ZBU A;  1S9G A;  2YNI A;  4B1X B;  2KKZ A;  4H8K A;  4Y0W A;  3CQY A;  3EKS A;  2RE2 A;  3CCM N;  4IG0 A;  2E2P A;  2X74 A;  3EE9 A;  2PY5 A;  3PIP L;  4C1N I;  5BRD A;  3CCL N;  1WOQ A;  4FWQ A;  4DQS A;  4XEI A;  4KRE A;  4PUO A;  4Z4G A;  4AHR A;  4EP4 A;  4BGA A;  2IS3 A;  2E6M A;  1B9D A;  3PIO L;  5GAH P;  3QEI A;  1XMO K;  2E8A A;  2I7N A;  5AZI A;  4JD2 A;  2FSK A;  4RW4 A;  2G8W A;  1J53 A;  1GC7 A;  3HM8 A;  2QM1 A;  4LD0 A;  1SAZ A;  1TYQ B;  1G99 A;  4AQY K;  1NJI O;  1IBL K;  2V7Y A;  4JNE A;  3VES A;  1SGH A;  3IKM A;  3VQA A;  3C6A A;  3HRG A;  1IG9 A;  4XIU A;  3ZEU B;  5JIC A;  2FF6 A;  3Q7B A;  3VGM A;  4CJL A;  5BRE A;  4YOT A;  3ZSO A;  4JI7 K;  2HVI A;  1BI4 A;  1N6Q A;  3NCI A;  3ZT4 A;  5C42 A;  1D4X A;  3G6E N;  3LDS A;  3FLC O;  4TKN A;  2WFB A;  4AHS A;  3K0S A;  4H0V B;  1QVF M;  1U45 A;  1LCU A;  3WT0 A;  3S3N A;  3TAF A;  1RDD A;  5C2D A;  2IVO A;  2E88 A;  4NXM K;  4HDQ A;  3ASM A;  4YL8 A;  3QES A;  4H0Y B;  2Z1G A;  4KI4 A;  3ZX0 A;  4OGE A;  2UXB K;  3U7D A;  3RMB A;  4CD1 A;  4JKA A;  5JMV A;  4FJK A;  1MK9 B;  5TKY A;  1C0G A;  2FDQ A;  1RT6 A;  1P8Z A;  4ICL A;  1NMD A;  3NF7 A;  4QS8 A;  2ATQ A;  3CM5 A;  5AQL A;  4W5Q A;  4DUY K;  1CLQ A;  1E3M A;  4ILG B;  5FRN A;  3J81 O;  3PLA A;  3T19 A;  4CK2 A;  2E1Z A;  1EKE A;  2R7Y A;  2HHQ A;  3CYM A;  3O08 A;  3FZK A;  5AQX A;  3G9W A;  4CGI A;  3O1W A;  1QTM A;  1Y64 A;  3CPW M;  3DXK A;  4IKF A;  4BY9 C;  1BHL A;  4DLE A;  4M3U A;  3M3Z A;  2D0B A;  4F3O A;  3KKR A;  4DTR A;  2B4J A;  4PQU A;  5EOY A;  4B1Y B;  3THX B;  4K8X A;  5CYQ A;  2OPR A;  1ZYQ A;  1WSI A;  1WN7 A;  2ZM6 K;  3KHY A;  1O1W A;  4BR4 A;  3M1F A;  2JGU A;  2XY7 A;  1GLB G;  1KLN A;  3DM2 A;  4E1M A;  1FXX A;  2YHW A;  1UWB A;  4MFB A;  3D2F B;  3SZ2 A;  1BIS A;  1EQY A;  2A42 A;  4RTF D;  3QBW A;  1BQN A;  5AQI A;  3THY B;  5KRS A;  3CCU N;  1BOT O;  2Q31 A;  2W6L A;  2F7T A;  4BG8 A;  4HTU A;  4AF1 A;  4G9Z A;  3A5N C;  4FWN A;  3KLE A;  5D3G A;  4PA1 A;  3O5B A;  4DQP A;  3VQC A;  4AM7 A;  4CJK A;  5LMU K;  4DR6 K;  1JCF A;  4WFN L;  5FRO A;  4CEC A;  3DOK A;  3SAG A;  4CJ3 A;  2GTD A;  2Q2R A;  3OBW A;  2UUA K;  2X6S A;  1C1C A;  5CR4 A;  2GV9 A;  4WQ4 C;  4IBN A;  4IFV A;  3IG1 A;  1R0A A;  1HB6 A;  1J6Z A;  4Y1C A;  4DCH A;  1YF5 L;  1ACA A;  4B1Z A;  1LW2 A;  3G25 A;  4OVL A;  3DLH A;  4BR2 A;  3AO5 A;  3BZK A;  5JLF A;  4DFJ A;  3UKR B;  1HQU A;  3EZW A;  3QNO A;  4CHP A;  2OA8 A;  4M41 A;  2I1J A;  4MO4 A;  3SUO A;  1QQN A;  3HSC A;  1C0M A;  2BGG A;  2FSJ A;  3SPY A;  1W0H A;  3CCJ N;  2CGK A;  3I8B A;  1DT9 A;  4FJJ A;  1TK0 A;  1Q8I A;  1ILY A;  3HK2 A;  3L3V A;  4GVE A;  1DEJ A;  5T7B A;  2W42 A;  3L4Q A;  1VQ5 N;  1EF1 A;  4DU4 A;  1VQL N;  3M8R A;  1WSG A;  4HCC A;  2NNW A;  4JKF A;  2YHY A;  5AQW A;  4DHY A;  2QWM A;  1RDC A;  1HKB A;  4IO9 L;  3H45 C;  1WAJ A;  4J2B A;  4CJ7 A;  4FW2 A;  1JLE A;  3JAM O;  4BC2 A;  5AQU A;  3OYD A;  3M8Q A;  2PAV A;  4UQG A;  4DSF A;  3V4I A;  1J54 A;  4YOV A;  1EXQ A;  3VQQ A;  2OCE A;  4YDU A;  3WNH A;  2O8E B;  4HDO A;  5AQK A;  1NBW A;  1L3U A;  4BRM A;  1NKB A;  5LMN K;  4RG8 A;  1XWL A;  3VQ7 A;  4JK9 A;  4Z0U A;  3F9K A;  3KLF A;  1BIZ A;  3AU4 A;  4FXD A;  3MX2 A;  4A2B A;  1ATS A;  3CF5 L;  5HRO A;  3ID6 A;  4CER A;  3I33 A;  4ELV A;  4B3S K;  1GLJ O;  1EWR A;  3MEC A;  2D0C A;  4M3W A;  2HBL A;  1BDG A;  2HHW A;  4O8U A;  1LOT B;  1XUP O;  2KW4 A;  3RMC A;  3SYZ A;  4PY5 A;  4WE1 A;  4EKU A;  2P9S B;  3WNG A;  1JKH A;  2YCH A;  3OYE A;  3HVR A;  2HNZ A;  2O8D B;  3G0Z A;  3DWL A;  1VSJ A;  3DRP A;  4FOI A;  4LH5 A;  4FJ5 A;  3N4Q A;  3OYN A;  1V4S A;  3ZSX A;  1O13 A;  4O4G A;  3NH2 A;  3P1G A;  4CF0 A;  4DU3 A;  2E2N A;  2P9K A;  4FJN A;  1KD1 O;  3ID8 A;  1CXQ A;  3CQ8 A;  3KZB A;  3DLR A;  3ZET A;  3KD1 E;  3GL1 A;  4E1J A;  2ITG A;  2QWP A;  1QE1 A;  4Z94 A;  2WTU A;  3DXM B;  1JLA A;  3SLC A;  1NM1 A;  3MXJ A;  4O5F A;  3HTV A;  2KHO A;  3QO9 A;  1L3T A;  4E7J A;  4JAX A;  4JV5 K;  4NCB A;  1RTJ A;  3LWM A;  4EZ6 A;  1YT3 A;  3CCR N;  3SQ4 A;  4NYF A;  3W0L A;  4LFB K;  1TL3 A;  3QET A;  4I6M B;  2OTJ N;  4OKJ A;  3QEP A;  5CY4 A;  3BIN A;  4FCY A;  4E7L A;  1DGK N;  1D8Y A;  4FLX A;  4BE2 A;  4DSJ A;  4DMN A;  1N8R O;  1KAZ A;  3U8X A;  3RRH A;  1T6C A;  4KTZ A;  2YNG A;  3U9Z A;  4PKI A;  3O4N A;  4ILH A;  4BR5 A;  1VQP N;  1NGI A;  1B9F A;  4OLB A;  4FVU A;  1QS4 A;  1U47 A;  3ENH A;  4B3M K;  3ZSZ A;  4YOU A;  4H0X B;  1LWC A;  3ZLJ A;  4C23 A;  1YHQ N;  4CBX A;  2E20 A;  3IVF A;  4KH5 A;  4MO5 A;  2W40 A;  4FWP A;  2ZWH A;  3THY A;  1BA1 A;  3HYF A;  3NFA A;  5B8H A;  1NGD A;  1I94 K;  1ZBF A;  2QKK A;  4QCL A;  2G8V A;  5C24 A;  3UIQ A;  2ASO A;  4CGG A;  5IWA K;  4EP5 A;  3ZSW A;  3T7Z A;  3GG4 A;  2HND A;  1IKW A;  2Q0U A;  2QTD A;  1U6Z A;  4M7Y A;  2PYJ A;  3TTD A;  1NVL A;  1NGE A;  3GDQ A;  4JI5 K;  5AR0 A;  2YX6 A;  3ZEU A;  3PX6 A;  3HT3 A;  4IOX A;  2IGI A;  4E89 A;  3F73 A;  2HBK A;  2YJF A;  4JS5 A;  3PSI A;  3VA3 A;  1QZ5 A;  4DSE A;  1YJW N;  4UY8 O;  1NK7 A;  3FP5 A;  3ULD A;  3EN9 A;  1RT7 A;  4EZ9 A;  4M42 A;  1VSF A;  3OJS A;  4JKE A;  4A5B A;  4IJA A;  4HHT A;  1RDA A;  4BRI A;  2I5J A;  4FLY A;  3AO1 A;  1MWK A;  3LAM A;  3HJF A;  1QHA A;  1HQE A;  4K41 A;  1KVB A;  1E5W A;  4DTM A;  2VQF K;  3FLV A;  2IIR A;  3CET A;  5CZ2 A;  2DY4 A;  1T44 A;  2BAN A;  4KO0 A;  4JKD A;  4A57 A;  2E6L A;  4O5B A;  5ELZ A;  3L8B A;  4HUG A;  4CD3 A;  4BRA A;  3K5N A;  4BR9 A;  4GKK K;  1NWK A;  1C0U A;  4PKG A;  3R1X A;  1BIU A;  3CJ1 A;  4H0P A;  3VQ6 A;  2ZQB A;  4AHC A;  4AIL C;  4FZX C;  1QSY A;  3CME N;  4H03 B;  1W9H A;  3LAK A;  1NOY A;  5F1X A;  3OYM A;  3B6O A;  1XC9 A;  4BRP A;  3HXM A;  4L8R B;  1X9M A;  4A62 A;  2QWO A;  3DJC A;  1J9A A;  3HOS A;  3THX A;  4Q5V A;  5C0Y A;  4DR3 K;  1DLO A;  1WSJ A;  1QVG M;  2VG5 A;  1YJN N;  3ULE B;  4LF7 K;  1MIX A;  3AVI A;  3PVL A;  1QSS A;  1HNV A;  2AA4 A;  1VSK A;  4C8N A;  2KFZ A;  1NJZ A;  4TSX A;  3ULE A;  2QI2 A;  1YTU A;  3MCP A;  4ISF A;  2RQ1 A;  1E4F T;  1SQK A;  4AM6 A;  4N41 A;  3AV9 A;  3SAH A;  1J19 A;  3SJH A;  3CFP A;  3ZT1 A;  4DR4 K;  3VQD A;  4JI3 K;  1TL1 A;  3WNE A;  1Z05 A;  3CQX A;  2EWS A;  1HNI A;  3QFP A;  4L3Q A;  3DLG A;  4IEE A;  4I9L A;  1KXP A;  4B8A B;  4CEQ A;  1HNX K;  4JK8 A;  1VRT A;  3V9U A;  1WAF A;  1TKX A;  1HJO A;  3Q7C A;  2O8C A;  4IOA L;  5H1S Q;  4PKH A;  1X9J A;  3LAN A;  4OPJ A;  3DXM A;  4CEF A;  3H1Q A;  1Q81 O;  1T03 A;  5FRM A;  1Y97 A;  3KKS A;  4FJH A;  1ZC6 A;  1A5V A;  2QA4 N;  4MLE A;  4EHT A;  4ZTF A;  1I39 A;  1NK0 A;  3HP9 A;  5BRH A;  1MA9 B;  4DKW A;  5DM7 L;  2R82 A;  5AQV A;  2O8F A; 
#chains in the Genus database with same CATH homology
 2NRR A;  3O1W A;  4IZ9 A;  1Y64 A;  3CPW M;  2YJE A;  3DXK A;  5GAE P;  2FLO A;  4BY9 C;  2HE7 A;  1CZA N;  4CI6 A;  1QZ6 A;  3WQU A;  3M3Z A;  3S41 A;  4WFA L;  3CCQ N;  5IJM A;  2ZGY A;  5EOY A;  4B1Y B;  1EO1 A;  1ZBS A;  4IWV A;  2FF3 B;  1GC6 A;  4HTL A;  3DLL L;  3J7Z O;  1W2B M;  4A61 A;  4U67 L;  3VMF B;  1BO5 O;  1KBL A;  3KHY A;  5EXW A;  2P9U A;  3UKU A;  3D2F A;  3E66 A;  4BR4 A;  3M1F A;  3VGK A;  1Q18 A;  1GLB G;  4KBO A;  5ADX H;  4F7G A;  3RVC A;  2YHW A;  1VBG A;  3UKU B;  3D2F B;  2P9S A;  3LDN A;  1EQY A;  2A42 A;  4RTF D;  2D11 A;  3QBW A;  4CZF A;  5AQI A;  3TTF A;  3EO3 A;  1HKG A;  2ZJP L;  1HKC A;  3CCU N;  1BOT O;  1WUA A;  2Q31 A;  1VQ4 N;  1M1K O;  2F7T A;  3KVG A;  3EL2 A;  3M5R A;  4BG8 A;  4AF1 A;  3X23 A;  5AQM A;  1VQO N;  4G9Z A;  3ZX3 A;  3A5N C;  3VEY A;  5C15 A;  5HL7 L;  2AEH A;  1HLU A;  4FWN A;  3OW2 M;  5AQZ A;  4CZH A;  2WUS A;  3OHR A;  4NLB A;  2V7Z A;  3O5B A;  5BRF A;  4AM7 A;  1VQ9 N;  3U9D A;  3WXI A;  1HPM A;  1JCF A;  1XQS C;  4HWI A;  4WFN L;  4NO7 A;  2QWL A;  1YI2 N;  4PL7 A;  2QWN A;  3SAG A;  2KLA A;  2GTD A;  2Q2R A;  3OBW A;  3WUH A;  2Q1N A;  3MN9 A;  1GLA G;  3MN7 A;  3LM9 A;  3WQT A;  5AQG A;  4ILJ A;  3IFR A;  4BRN A;  2HF4 A;  2AP1 A;  5CR4 A;  4WQ4 C;  1YIT N;  3UE5 A;  3HBT A;  1H1V A;  4BR0 A;  4YDU C;  1HB6 A;  2HBM A;  4ZRJ A;  3QDK A;  1NGA A;  1J6Z A;  3H46 O;  2P9N A;  4J8F A;  5BPL A;  2QW9 A;  5KPZ A;  2E2O A;  1NGB A;  4DCH A;  3MMV A;  3D2E B;  1YF5 L;  1ACA A;  3SBG A;  4B1Z A;  3L6Q A;  4WF9 L;  3G25 A;  1GLC G;  4GY2 B;  3JXU A;  4IFE A;  3AGK A;  4BR2 A;  4BQL A;  1K73 O;  2X0S A;  2P9N B;  5AZJ B;  4BRO A;  2LBB A;  5JLF A;  4IEI A;  3UKR B;  1T6D A;  2ZPY A;  2A5X A;  1VQM N;  3EZW A;  2ABD A;  5LJW A;  1GGO A;  3LDO A;  3R3L A;  2UYT A;  3SBT A;  2I1J A;  4MO4 A;  4OPH A;  1Q82 O;  3UB5 A;  1QQN A;  2GEM A;  3HSC A;  2OTL N;  3EPY A;  5M1P A;  3C7N B;  3MDQ A;  3W3D A;  2ZJQ L;  2FSJ A;  2J0J A;  4FWS A;  3BP8 A;  3CCJ N;  3C0B A;  4IOC L;  3D7E O;  2CGK A;  3I8B A;  5JLH A;  1GLL O;  1DT9 A;  3QIJ A;  4H5N A;  3VEW A;  1VQN N;  5EVZ A;  1XC3 A;  3SAF A;  3M6G A;  2VCP A;  4M7X A;  1ILY A;  5M1O A;  4CZE A;  1KC8 O;  1BA0 A;  1U2V B;  1YIJ N;  2EMS A;  1DEJ A;  4GVE A;  5AQV A;  3L4Q A;  3I55 N;  1VQ5 N;  4CYE A;  1EF1 A;  4BG9 A;  5LY3 A;  1KAX A;  2VWB A;  3NVM A;  4BR7 A;  2QEX N;  3CMA N;  5GAD P;  1VQL N;  2NNW A;  4JKF A;  4YOR A;  2YHY A;  5AQW A;  4DHY A;  2QWM A;  2HRJ A;  4RWT A;  4NB4 A;  4FWR A;  3H3N O;  3L0Q A;  3BF1 A;  1HKB A;  4IO9 L;  3CCS N;  3H45 C;  1RFQ A;  3G71 N;  5AQN A;  3OBY A;  4CJ7 A;  2I1K A;  5CE3 A;  2NRT A;  4JD2 B;  4BC2 A;  5ADX A;  5M1N A;  2E2Q A;  5AQU A;  1KC7 A;  1NGC A;  3EKU A;  1T3V A;  2A40 A;  2PAV A;  5AQQ A;  3VEO A;  4WQ4 A;  4RCH A;  1TYQ A;  4YOV A;  2QWR A;  1NGH A;  3OA9 A;  4YDU A;  2F9W A;  4HDO A;  5AQK A;  1NBW A;  3BEX A;  2D0O A;  4BRM A;  3HI0 A;  2P9L B;  4GNI A;  4CZJ A;  3ATU A;  3CJA A;  3O8M A;  5FPN A;  4YOX A;  3I56 N;  3CJ7 A;  2GWK A;  2W41 A;  2H3G X;  2AL6 A;  2VGN A;  2WH5 A;  3RSE A;  4CZG A;  3R8E A;  5AQS A;  1X3N A;  4BRK A;  4JK9 A;  1E4G T;  4ISG A;  3QFU A;  2D1K A;  4PL8 A;  3AU4 A;  3MX2 A;  4A2B A;  4JKC A;  4GV6 A;  1ATN A;  1ATS A;  4H0T B;  2ITM A;  1Y19 B;  3CF5 L;  3ID6 A;  3I33 A;  4H5R A;  4CBU A;  4EHU A;  4FWK A;  3MN6 A;  4LC9 B;  1GLJ O;  4BRL A;  2D10 A;  2P9U B;  4JKG B;  2YHX A;  3FFK B;  2NZT A;  2GX9 A;  1BDG A;  1S3X A;  2HBL A;  4JHD B;  4O8U A;  3WXJ A;  4BRD A;  5JVL A;  1LOT B;  1XUP O;  3VF6 A;  3VER A;  3VF2 A;  3MCA B;  3WXM B;  4EKU A;  2P9S B;  3K9K A;  1ZXO A;  5BR9 A;  2YCH A;  1MDU B;  3AAR A;  4JHD A;  1X3M A;  2CGL A;  4MDA A;  3QB0 A;  5F0X A;  1VQ7 N;  3DWL A;  3LL3 A;  4H0O A;  1RDW X;  3VET A;  5KQ8 A;  4FWM A;  3CC2 N;  3O9R A;  1NGJ A;  2FXU A;  2QXL A;  4FOI A;  3N4Q A;  1V4S A;  2D2Q A;  3TSQ A;  1O13 A;  4GXB A;  1ESV A;  2Q97 A;  3O9S A;  4DQ8 A;  3ENB A;  3F2K A;  1ST7 A;  2HOE A;  4NY0 A;  5C2F A;  1IJJ A;  3O9Q A;  3R9P A;  4WQ5 C;  2HF3 A;  4QS9 A;  3PZD A;  2FSN A;  2J0M A;  2E2N A;  2P9K A;  3IMX A;  4KH4 A;  1KD1 O;  3VTI A;  2PFU A;  3ID8 A;  4BC5 A;  4BRG A;  4IJN A;  3KZB A;  4R79 A;  1MK7 B;  4FSV A;  2VYP A;  4DB3 A;  1VQ6 N;  3ZET A;  3EE8 A;  3GL1 A;  2GEL A;  3SMP A;  4E1J A;  2QWP A;  3HOT A;  4QS7 A;  4Z94 A;  2BUP A;  3DXM B;  1P90 A;  1Z6R A;  3GE1 A;  4KH6 A;  3SLC A;  1NM1 A;  4U7B A;  3TU5 A;  4XH4 A;  4O5F A;  3HTV A;  4H5T A;  2KHO A;  2HBJ A;  5AZI B;  3A5O C;  4FL9 A;  3FZL A;  4CZM A;  3F9M A;  3A8Y A;  3QIC A;  1NI2 A;  4JAX A;  4DXA B;  4BRC A;  4YOY A;  5GIN A;  3CD6 N;  3P38 A;  3IUC A;  2P9L A;  5EX5 A;  3WEE A;  3CPE A;  4A59 A;  3CCR N;  3D2E A;  3W0L A;  5TKW A;  2ZGZ A;  3LDL A;  1K8A O;  3D6R A;  3AY9 A;  1S22 A;  4I6M B;  2JWK A;  5E26 A;  2OTJ N;  3VEN A;  4WQ5 A;  4EFH A;  3BIN A;  4PHT X;  4M63 C;  5AZJ A;  2OAN A;  4BRQ A;  1DGK N;  1NGG A;  4CZI A;  3QML A;  3C6H A;  4XH5 A;  4JKB A;  2CH6 A;  2GWJ A;  1KAZ A;  5FPE A;  3U8X A;  1N8R O;  4OPA A;  2DIK A;  5EY4 A;  2DPN A;  3VPZ A;  1T6C A;  1VQ8 N;  2CGJ A;  1BU6 O;  2QWQ A;  3U9Z A;  3VEZ A;  1YXQ A;  4MDB A;  4PKI A;  2ASP A;  5I9E B;  5KPT A;  4ILH A;  2PBD A;  4BR5 A;  1VQP N;  2YI1 A;  3H1V X;  5GAG P;  1NGI A;  3O4W A;  2JWL A;  3MX5 A;  4FVU A;  1YUW A;  3TSU A;  1RGI A;  3ENH A;  5E84 A;  2J4R A;  4YOU A;  4H0X B;  2NRZ A;  2BH1 A;  3AU5 A;  5FPD A;  3P4I A;  1JJ2 M;  4JK7 A;  3ZX2 A;  3FR0 A;  5C10 A;  5AQR A;  3P39 A;  1TUU A;  3O1B A;  4C23 A;  4XH1 A;  1YHQ N;  1TUY A;  4JN4 A;  2HST A;  5GIO A;  1GLE G;  1IG8 A;  4CBX A;  5KQD A;  2E1Y A;  3O9U A;  4C1N K;  2E20 A;  3NVK A;  3IVF A;  2ZJR L;  3FZM A;  4KH5 A;  4MO5 A;  2W40 A;  4A5A A;  2D4W A;  4FWP A;  4BRE A;  2ZWH A;  1VQK N;  1BA1 A;  4WYB A;  2A41 A;  5B8H A;  1NGD A;  1H4R A;  2CB8 A;  2NRX A;  2P9K B;  3F5T A;  1GG3 A;  5BPN A;  4BC4 A;  4JEP A;  2ASO A;  4WCE L;  3ZET B;  4FWL A;  4P7I A;  2P9P B;  1M90 O;  2NLX A;  4BVO A;  4BGB A;  4BRH A;  2J0K A;  3O80 A;  1NLV A;  5AQJ A;  1K9M O;  3T7Z A;  1DIK A;  1C0F A;  3GG4 A;  3TSP A;  3VTH A;  1QQM A;  3CER A;  2GUP A;  4MLH A;  2Q0U A;  1KAY A;  2NRW A;  2QTD A;  1U6Z A;  5FPM A;  2BTF A;  2A3Z A;  1SZ2 A;  4M7Y A;  3C65 A;  5BPM A;  5C12 A;  3CXC M;  3TTD A;  3RSE B;  1NVL A;  3L4I A;  1BG3 A;  3CC4 N;  1NGE A;  4FPA A;  3ZYY X;  3GDQ A;  3WEE B;  3SK3 A;  3UKR A;  5AR0 A;  2YX6 A;  2ZF5 O;  4CZL A;  5CHI A;  1V4T A;  3A5M C;  3CHW A;  3MK6 A;  4O8K A;  3ZEU A;  3WA0 A;  4GV9 A;  4IOX A;  1DKG D;  4ISE A;  1NTI A;  1GLD G;  3AAP A;  4B9Q A;  3E9P A;  3E9L A;  1NGF A;  1YVN A;  4ZRK A;  3CIP A;  3C7N A;  1JCG A;  2IVP A;  3U8Z A;  3KWG A;  2HBK A;  4EIA A;  3CJ9 A;  5AFU A;  1ISN A;  2CQU A;  3CC7 N;  2YJF A;  1JCE A;  1VBH A;  1QZ5 A;  1YJW N;  4UY8 O;  3TTC A;  3O6W A;  1K8K B;  5M1Q A;  3WXK A;  1OVY A;  4WFB L;  3FP5 A;  4BVP A;  1HB8 A;  2YVC A;  3TPQ A;  4BQZ A;  5HOO A;  3FZF A;  3KK7 A;  3EN9 A;  4B1V A;  4CBW A;  1YJ9 N;  1QQO A;  5F2R A;  4JKE A;  4A5B A;  4IJA A;  3O9T A;  5KPR A;  4B1X B;  2KKZ A;  1VAZ A;  4IDH A;  4Y0W A;  3CQY A;  3MN5 A;  5BN9 A;  3EKS A;  3N4P A;  4BRI A;  3FGU A;  3ENO A;  1MWK A;  1Q86 O;  2RE2 A;  3CCM N;  2A6A A;  3DAW A;  3IDH A;  3U4L A;  2E2P A;  2Q0R A;  3EE9 A;  3G4S N;  1QHA A;  2COP A;  4K41 A;  3VOV A;  3PIP L;  1E5W A;  4C1N I;  5LJV A;  1BWF O;  5BRD A;  3CCL N;  4FPB A;  1WOQ A;  3FLV A;  4FWQ A;  2IIR A;  3CET A;  4XEI A;  1W97 L;  3NMU A;  3K9J A;  1T44 A;  3VGL A;  2RHK A;  4JKD A;  4A57 A;  4BGA A;  2V52 B;  5ELZ A;  4CD3 A;  4BRA A;  2WC9 A;  1HUX A;  4BR9 A;  5GAH P;  3PIO L;  3A5L C;  2FJ9 A;  2E8A A;  4BRF A;  2I7N A;  3MWP A;  4JD2 A;  5AZI A;  5AFU H;  2FSK A;  3CJB A;  1S72 N;  1RDU A;  3R6M A;  1Q7Y O;  4OO1 J;  4F9O A;  1MWM A;  1GC7 A;  1NWK A;  3HM8 A;  4PKG A;  2QM1 A;  3BF3 A;  3R1X A;  1SAZ A;  1TYQ B;  3CJ1 A;  1G99 A;  4NLC A;  3CCV N;  4H0P A;  1NJI O;  4EAH D;  2V7Y A;  4JNE A;  3ZDT A;  4I6M A;  3CME N;  3VES A;  1SGH A;  2P9I B;  3IKM A;  4H03 B;  4CZK A;  5DM6 L;  3C6A A;  2CH5 A;  4H5W A;  4A2A A;  3DXK B;  4K43 A;  3T69 A;  4YOW A;  3HRG A;  5AQX A;  3ZEU B;  5AQH A;  5F1X A;  5JIC A;  2FF6 A;  1HX1 A;  3AAQ A;  1GLF O;  3Q7B A;  3VGM A;  5BRE A;  5GIP A;  4YOT A;  4BRP A;  3JS6 A;  3ATV A;  4JKG A;  2QWO A;  3DJC A;  2VGM A;  3E1Y A;  4A62 A;  3HOS A;  3P31 A;  2NRV A;  2NRH A;  2Q36 A;  5C0Y A;  5AQF A;  1QVG M;  1D4X A;  3G6E N;  1YJN N;  1K8K A;  3ULE B;  3FLC O;  4TKN A;  2WFB A;  5BN8 A;  1MIX A;  2V51 B;  3PVL A;  2HMP A;  4H0V B;  3H3O B;  2AA4 A;  1SS6 A;  1QVF M;  1ATR A;  1LCU A;  3VEV A;  3WT0 A;  4B1W B;  5AQO A;  3LDP A;  2QI2 A;  3ULE A;  5C2D A;  3MCP A;  4ISF A;  2RQ1 A;  1E4F T;  2IVO A;  1SQK A;  2E88 A;  1U2V A;  4AM6 A;  5MLC Q;  1R59 O;  3SAH A;  1J19 A;  3SJH A;  3H6E A;  5AQP A;  2D0P A;  3CJC A;  3MWT A;  5JVG L;  4HDQ A;  3FE1 A;  3LDQ A;  1BUP A;  3QBX A;  4YL8 A;  3VEX A;  3HZ6 A;  4ZRI A;  1Z05 A;  3CQX A;  4H0Y B;  4IXC A;  2EWS A;  3QFP A;  4L3Q A;  4IEE A;  4B1U B;  3SMS A;  3ZX0 A;  3A0I X;  5M1F A;  3U7D A;  1KXP A;  4GV3 A;  4CD1 A;  4JKA A;  5JMV A;  5M1K A;  4JK8 A;  1MK9 B;  5TKY A;  1C0G A;  1MIZ B;  5AQT A;  2FDQ A;  2P9P A;  1OKJ A;  1P8Z A;  1NMD A;  4QS8 A;  3GBT A;  2IVN A;  4IO8 A;  1HJO A;  2F9T A;  3Q7C A;  4IOA L;  5H1S Q;  4PKH A;  1X9J A;  4H5V A;  5AQL A;  3CCE N;  3BUZ B;  4ILG B;  2EMT A;  3B8A X;  5AQY A;  3DXM A;  3WXL A;  3GOI A;  3H1Q A;  1Q81 O;  3KWI A;  2ASM A;  3VF4 A;  3J8A A;  2I7P A;  3PLA A;  3FZH A;  1KQS M;  2E1Z A;  1JDE A;  3AGR A;  1ZC6 A;  4FOE A;  4FWO A;  4K25 A;  4MLE A;  2WBN A;  4BC3 A;  1HBK A;  4EHT A;  2QA4 N;  5JVH L;  4JKH A;  5BRH A;  3LM2 A;  1MA9 B;  1YAG A;  4DKW A;  2R82 A;  5DM7 L;  3E9O A;  3O08 A;  4FO0 A;  3FZK A;  2P9I A;  3CI5 A;  4K42 A;  3G9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...