3ENBA

Crystal structure of prp8 core domain iv
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
219
Chain Sequence
LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural elucidation of a PRP8 core domain from the heart of the spliceosome.
pubmed doi rcsb
molecule keywords Pre-mRNA-processing-splicing factor 8
molecule tags Rna binding protein
source organism Homo sapiens
total genus 62
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3enbA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3enbA01
4JK8A 4JKFA 3E9OA 4JKEA 3E9PA 4JKGA 4JK9A 4ILJA 4ILHA 4JKCA 4ILGB 3SBTA 4JKBA 3E66A 4JKHA 3E9LA 3SBGA 4JKAA 4JKGB 4JK7A 3ENBA 4JKDA
chains in the Genus database with same CATH superfamily
1JL2A 3QERA 1BIUA 3AA3A 1QS4A 2IC3A 3LPUA 1IG8A 4BC2A 4FLTA 4LF9K 5KPRA 4GVEA 3MXJA 4FCYA 1ASVA 4AQYK 2O8CA 3QFPA 5AQMA 1I94K 2YHYA 3VQEA 1WLJA 3E66A 5M1NA 1WOQA 2E4LA 4CJ4A 2DFFA 4FJKA 4K0KK 1RDUA 4FWLA 4I6MB 2I7PA 1VSLA 1N32K 3FP5A 4DFJA 4DXAB 3DMJA 4M3TA 5C42A 4JI4K 2P9PA 4MLEA 3QNNA 4AHVA 1WSJA 2HHQA 2FDQA 2WTUA 2Q97A 2R82A 4B9LA 2QWOA 2QWMA 3FZMA 3SBGA 1TL3A 4EZ9A 1BU6O 3A5OC 1VSFA 1L3SA 1JL1A 5BN8A 2DFEA 1IKYA 1U45A 1GLFO 4JK8A 5E41A 3ENHA 2FBXA 4BRGA 4CIGA 1L3TA 2P9IA 2X74A 3ATUA 3VEXA 2YI1A 3WXJA 3ZLJA 4HDOA 3H3NO 3BUZB 4E0DA 1KVCA 1T6CA 2FSJA 3VF6A 1WBBA 3IVFA 3DJCA 4BC3A 1VSDA 1ZBIA 5KGXA 3UIQA 1G99A 3AAPA 3D2FB 3SI6A 2VCPA 5GINA 4W5RA 4B1YB 3K57A 3VETA 5KTQA 3SUPA 3A2FA 2NUBA 4I9QA 4IOXA 2FSNA 4GV9A 2QXLA 5E84A 3ZSOA 3THWA 1FK9A 2O8BA 4DTJA 4FWRA 4K8XA 4IFYA 1WSGA 3TAGA 1DTTA 3OYFA 4GV3A 1RILA 4CW7B 4AILC 2WOMA 1YVNA 3FZLA 5FDLA 1NK7A 3O9SA 4JN4A 3NVMA 5FPMA 4CHYA 4C8KA 3C65A 3HVTA 5AQJA 5A2QO 3DI6A 1HLUA 4PKHA 3OYGA 4CZKA 1IJJA 3LM2A 3K5LA 1S1XA 2FBYA 5JS2A 4DR6K 1GLCG 4BE0A 5BPMA 1T7PA 1KVBA 1QZ6A 4KTQA 3ZT1A 4B9QA 2VGMA 4DU4A 3QBXA 3MDQA 1M90O 4FSVA 5JVGL 4L3QA 2QKBA 4DFMA 1UA1A 1KAYA 2CGJA 3FLCO 1GLJO 3W3DA 1GC6A 4TSXA 4RWTA 5CY4A 4CJUA 1N8RO 3VQAA 2O4GA 4CF0A 4UY8O 2ZJQL 2V7YA 3V9ZA 4BGAA 1MIXA 3UKRB 4CIFA 2YVCA 1NM1A 3KD5E 3NBPA 5HL7L 3TWHA 1H1VA 4IDHA 1ACAA 3TU5A 4JI5K 5FRNA 1XQSC 4OGEA 2D4WA 4YOUA 2YKMA 1TL1A 3M8SA 3QEIA 1BIZA 3IDHA 1DEJA 3BF3A 3KKRA 4LF8K 4DS4A 3TABA 4ELTA 1A5WA 2YNFA 4W5NA 4KI4A 2DY4A 3H6EA 4BRHA 2A40A 4IZ9A 1CZBA 3NE6A 2F7TA 4H4MA 1N5YA 3QEVA 4B3MK 3PO5A 4CZEA 2P9UB 4MLHA 2LSNA 1QVFM 3TR8A 3VGLA 4DV5K 5D3GA 3SV4A 1TK0A 1U04A 2Q3SA 3HTVA 4BG8A 1I39A 5SWMA 1MK7B 4MO5A 4JEPA 1S1UA 3SBTA 1VAZA 4EZ6A 4FM2A 2RHKA 3AAQA 3QETA 4WF9L 3K5OA 3LPTA 5ADXH 4YOTA 1TKTA 4I2QA 5I42A 4DUYK 4JI2K 2HSTA 4CEAA 3HJFA 3DLGA 2YX6A 4RW4A 4DV6K 1MIZB 3EKUA 2F96A 5HRNA 3DRSA 1W7AA 3HRGA 4CJ3A 2Z1IA 1HB8A 1ILYA 1TVRA 4FJ7A 1OH7A 1K8AO 4IEEA 3KZBA 3IS9A 4CJPA 4LD0A 5LJVA 2ZGYA 1XC3A 4I2PA 3LZIA 3SUQA 3GOIA 4A61A 2XHBA 3SAHA 1BG3A 3AVLA 5IT9O 2XY7A 2YNGA 3CC7N 3SJJA 3CIPA 1VQLN 1Z26A 3EO3A 3HK2A 3LP3A 4CF8A 3H3OB 2V51B 1WAJA 4DTRA 3L2WA 2GUIA 4FOEA 1HNVA 3ZSVA 5JVHL 2D1KA 1XMQK 3V6DA 3KWGA 3FZHA 1JXEA 1JLFA 2CH6A 1NGDA 3MX2A 4KHSA 4CF9A 4E1MA 3CXCM 4FLXA 3HXMA 4RG8A 4M3UA 2D10A 5C2FA 1J54A 2ASOA 1NKBA 2NRZA 1E4GT 1D4XA 1JKHA 3IRXA 2OPSA 4DSIA 3FR0A 2AL6A 2QWRA 3DM2A 1RBVA 4ID5A 3VPZA 4ZHRA 3THYA 1E3MA 2HNDA 4KFBA 1VBGA 2HW3A 1D5AA 3IFRA 3CF5L 4FJHA 3CPWM 3DLKA 2HOEA 3S3NA 4NYNA 3RRHA 4DV1K 3HSCA 3L3VA 1BQMA 1W97L 3LP1A 5LJWA 2O8EB 2UUAK 2P5OA 1EF1A 3U9ZA 2BDPA 1KAZA 3M8QA 3O08A 3FFIA 1KLMA 2OA8A 1J53A 1T44A 4JS5A 3PLAA 1KLNA 4O5BA 4H0TB 1Z05A 2A41A 1F21A 5GADP 3PUFA 3NGZA 4KB1A 3R6MA 4N56A 5IWAK 4Z4FA 3J7AP 3EYZA 1GOBA 3KLFA 3CCSN 1HPZA 1YT3A 4LH4A 3AVFA 4CJWA 4CZFA 3NVKA 4BRAA 2VQFK 3AVAA 1SUQA 1RBUA 3LL3A 3LWMA 2F4VK 1RNHA 5AZJB 2YHAA 3CJ1A 1VBHA 4KHUA 3DXKB 4NB4A 4K8ZA 1JLBA 3SUOA 3WXIA 1EKEA 4LF7K 2PFUA 3SV3A 1C1AA 2WFBA 3HPOA 1HKGA 4K41A 1NGGA 1Z6RA 3CERA 2ZGZA 1LWFA 5JMVA 2GELA 5BR9A 2P51A 3ZT4A 5SZTA 4LSLA 3KKSA 5E26A 3FGUA 2HBKA 1U2VA 1JJ2M 4NO7A 4DB3A 5KPTA 2OPRA 2O8DA 1FW6A 3ZSRA 4OLAA 3B6PA 2VG7A 2IVNA 3SQ1A 2WC9A 5KQ8A 3AARA 1HNWK 4H5NA 1VQON 1NVLA 2G8WA 3GG4A 2FLOA 1RT3A 4KHPK 4JKDA 1NGJA 3TAEA 2ZQBA 4F3OA 2IGIA 4OKKA 1YIJN 1G15A 1TKXA 1T6DA 3BY5A 4B9VA 3C6HA 2R7YA 2HHTA 3VEYA 4M3WA 2AJQA 2ASPA 5AQNA 3V4IA 1RTDA 3NHGA 1Y19B 5C24A 5DMRA 4JRQA 4FWSA 4FW1A 3O3FA 4A5BA 3T1HK 4Z4EA 3ENBA 4BY9C 4YORA 3EZ5A 4K43A 3CJCA 1TYQA 2QWPA 3SZ2A 1ZC6A 3V9UA 4CEZA 1VQ8N 3TAMA 5LMNK 4PA1A 4PHTX 3ITHA 2CB8A 2IOCA 2CGLA 2HRJA 3W0LA 3ISNC 4Y1DA 3D45A 3OYCA 3QESA 3ALYA 2RPIA 1DIKA 4CGJA 3OYNA 2QTDA 5C25A 2XO7A 3BINA 4GY2B 2WONA 3KLHA 2KKZA 2AP1A 1U48A 2ITMA 4ZTJA 2KTQA 4B3TK 3P5JA 3ZX3A 3CCLN 1QSYA 1RCHA 2JWLA 4FJ8A 1OH8A 3ZSWA 4CZGA 1ZYQA 5KGWA 3AVBA 3MCPA 3D7EO 2OZSA 2KW4A 1BGXT 3D2EB 3WXLA 1KVAA 1Q86O 2QKKA 4H5RA 1P8ZA 1NGFA 3MX5A 4NLBA 1NGEA 3EY1A 1NK5A 2J4RA 4DR1K 4E7JA 1S5JA 2EHGA 1QQCA 3U8XA 1HNZK 3CFOA 2Q36A 2QK9A 3NH0A 3FFKB 2VQEK 1KCFA 2OZMA 3T3FA 1DLOA 3QIOA 1BA1A 2NLXA 3G0ZA 1O1WA 4A2AA 3MECA 4E19A 4CJ7A 1S3XA 4FW2A 3O5BA 4CFCA 3L6QA 4BRDA 4CBXA 5DM7L 1HKBA 5CHIA 1LW0A 2A3ZA 2HHHK 4CIEA 4BWJA 5BRHA 4CECA 4YOVA 2P9KA 4BDYA 3O3HA 5EVZA 2O8FA 1X9WA 2E8AA 2A1RA 4JNEA 1KTQA 3NCIA 4V19S 4DMNA 3SCXA 5AR0A 4FL9A 4FWMA 1S1TA 1HYVA 4MQ3A 1RT4A 1C0GA 1WSEA 1EQYA 4BRNA 4JKBA 1EWQA 4BRPA 1NBWA 2XRIA 4DQQA 1LWEA 4CVNE 3H1VX 3V81A 1TUYA 2YV0X 1Z25A 3VQ6A 2E88A 4O5FA 4JYAK 3L8BA 4B9NA 3HBTA 4B9UA 1ATRA 3SAGA 2J0MA 4HDQA 3G10A 3LDSA 2KFNA 4FZYA 3E9OA 4GV6A 4AH9A 1FJGK 1GC7A 3O9QA 3WEEA 4J8FA 1S1VA 3OS2A 1L5UA 3MXIA 3FE1A 4KRFA 4JKCA 3MWTA 4CJSA 3L2UA 1T03A 3O4NA 4LY7A 5J2MA 3U9DA 1BI4B 4CHZA 3GL1A 3THXA 4F3TA 4JD2B 3N4QA 4DR3K 1RDBA 1NJWA 1JXBA 3QEWA 1MA9B 3SUNA 4B8CA 1YHQN 4LF4K 2QWLA 4IG3A 1VQ4N 3QMLA 4O4GA 3DLHA 3RR8A 3VQCA 2F9WA 1ZBUA 2BTFA 1B9FA 3VA3A 2P9NA 3TANA 4DFKA 2HF4A 3I56N 1TKDA 3OTOK 3Q7BA 1K9MO 5C0YA 1J5OA 2YNIA 4DSJA 4M7XA 5HRRA 3ZX0A 3CYMA 5BREA 4BRFA 3AVNA 1QHAA 2WBNA 2F8TA 4CCHA 2HF3A 2X78A 3O8MA 4YOWA 1K8KA 4KKOA 3C7NA 3KK2A 1SL1A 1VHXA 4O44A 1ZBHA 1Q82O 4FVUA 4EKUA 1DGKN 4FJMA 3LAKA 1QQOA 1N34K 3HOTA 1X9JA 3JS6A 1NK8A 3I55N 3K5NA 1X3NA 2E1YA 3T1YK 1J19A 4ISEA 3VERA 2O8CB 5J2PA 3RMAA 3BF1A 1REVA 1LAWA 2OTJN 3UKUB 3VQ4A 5B8HA 4CZLA 4AHUA 2ITGA 4DKWA 3AA2A 3X23A 1BOTO 1YTUA 4Y0WA 3WUHA 4HCBA 1VQMN 2P9PB 2G8HA 4A2BA 1QSLA 1Y97A 3TSPA 4G1QA 4CJEA 3DRRA 3DLLL 4J2EA 4CHPA 4Z4CA 2A5XA 5KRSA 3O80A 4DTUA 3NMUA 2A6AA 3M8PA 3AA5X 4RW7A 4MO4A 1D8YA 3DXMB 3L2QA 2QXFA 4O55A 3HZ6A 2UXCK 5C15A 2CQUA 2PYLA 3SMPA 3SPYA 2GTDA 2HB5A 1MDUB 2RF2A 2P9IB 3PV8A 1S9EA 3MWPA 3DLBA 3ZSZA 4CGFA 5C10A 2QM1A 4PQUA 4F8RA 1KFSA 4FJGA 3ID6A 3ASMA 3MAQA 4KPYA 3L3UA 3CCRN 1C0FA 3K59A 3CCVN 5I3UA 5M1FA 4DS5A 1OH6A 5J2QA 3AO5A 2NRRA 3CJ9A 4U67L 1WAFA 4AHRA 1B92A 1YAGA 3VESA 5BPNA 2QWNA 3TTDA 5ADXA 2E1ZA 3V9XA 4BGBA 2X6SA 5AQOA 4YNQA 3PSFA 2BH1A 2G8IA 2GWKA 2O8BB 3P39A 2RE2A 3KK1A 1GGOA 1JDEA 4NY0A 1T05A 4FJNA 3E9PA 3QINA 1VSEA 2UUCK 2IIRA 4WFNL 4WFBL 3NH1A 2Y1IA 3TARA 1JCFA 4DLEA 4CJVA 5JVLA 3O3GA 1EETA 4LF6K 1KC8O 3BP8A 4M3YA 3L4IA 3QIJA 4LFCK 4WFAL 1XMOK 4XEIA 4X64K 5H1SQ 2QEXN 1EO1A 3NF6A 3TTCA 4KH4A 2KZZA 4ID1A 1TK5A 5BPLA 1EX4A 1MWMA 3FZFA 3R3LA 3S3OA 2W42A 1YI2N 3TAPA 2NNWA 3F5TA 3THVA 3QEXA 2UU9K 3QB0A 2DIKA 3UE5A 4CHNA 4BR4A 1R0AA 4OX9K 1ITGA 4IFEA 2ATQA 4ZRKA 5HBMA 5JLFA 1UOCA 5AQWA 1HR0K 2VG6A 1U6ZA 3OYEA 3CG7A 3U3GA 1ASWA 4JI8K 4C8OA 4FJLA 2D5RA 4DSEA 3KWIA 4CGGA 1QQMA 4DV7K 3VQ5A 3CCMN 3Q7CA 1VQ5N 1C1BA 3CQXA 3MEDA 3P38A 1RT1A 2ABDA 5DK5A 3TPQA 5AQQA 4B1ZA 4OKEA 4WE1A 3E1YA 3P4IA 1OKJA 1CLQA 1ESVA 2RKIA 2ETJA 3DYAA 5LL6Z 3IKMA 1L3VA 2E2QA 3BGRA 1NKEA 3O1BA 2P9SA 3HPGA 2PAVA 2HHXA 4EHUA 3WA0A 4KB0A 3LDPA 4CK3A 3RRGA 4CEOA 1VSMA 1X9MA 4ELUA 4OPAA 2ZPYA 3AV9A 1FKPA 2QWQA 2VWKA 1S9GA 2P9LA 3D6RA 4QS9A 4HUGA 4FK0A 1HYSA 1Y64A 3G4SN 2OPPA 3J7ZO 3DRPA 3QNOA 4FWOA 4DV3K 1N36K 4EAHD 3OVNA 4X66K 4YY3K 2Z1JA 1SQKA 4JHDA 5FPNA 2ZWHA 2BE2A 1CZAN 4BDPA 4CERA 3ZSQA 4FK2A 2UYTA 3VQBA 4HWIA 1RT2A 5GAGP 5CE3A 3A0IX 4WQ5A 3SJHA 4IO9L 2HHVA 3I0RA 4FWPA 3CJBA 5AQHA 1DKGD 4Z0UA 4KAZA 3NF7A 4BR5A 3AVIA 4FLZA 4LC9B 4DFPA 4JI1K 3OHRA 3I8DA 4AHCA 3R8EA 1S1WA 2KZMA 2YNHA 5EX5A 1X1PA 5M1QA 4JAXA 1WSHA 3EKSA 4NLCA 3EPYA 3ZDTA 3JSMA 1K6YA 3C95A 2EWSA 4BREA 1N6QA 2PZSA 3OYMA 3AVKA 1KFDA 3O9RA 1GLLO 3H46O 4JKGB 1JLGA 4L8RB 1RDDA 3KLEA 2AEHA 2D0CA 1IKXA 2Q1NA 4CJ5A 5LMUK 4DQ8A 3O4QA 3OJUA 3TTFA 4ZRIA 2HHUA 4KH6A 3A8YA 3GE1A 3VMFB 4A59A 4WCEL 4RCHA 4F9OA 4F2RA 3HM8A 4CK1A 4B3SK 4NXNK 1RFQA 2HBLA 3V9WA 1S6PA 2JLEA 5HROA 2Q31A 4BRIA 4B9TA 4H5TA 4FM1A 5CR4A 3QFUA 4OVLA 4BVPA 3PO4A 5AZIB 4J2DA 5JLHA 2ZD1A 5C12A 1ZBLA 3MN9A 4FOIA 3MEGA 4O8KA 4YDUC 3ULEB 4DSLA 4KREA 2F9TA 4CE9A 4G9ZA 1YF5L 2IAJA 4MFBA 3CMAN 2HMIA 5FPEA 3J80O 3TAFA 4ZTFA 1LV5A 1BL3A 2KQ2A 1YVUA 3CC4N 4ILGB 1KBLA 1CXUA 2Q0RA 4A62A 1E4FT 3WXMB 2F8SA 4GNIA 3RMDA 3F2KA 1BO5O 3NH2A 3RR7A 1HNIA 2RQ1A 3IUCA 1VSIA 4C1NI 4BR2A 3ZT3A 5GAEP 3S3MA 4KO0A 5AQIA 4FWKA 3HSTB 1NGIA 3I8BA 3ZSXA 4CJTA 2GX9A 4IBNA 2FF3B 2AA4A 3K9JA 4CZHA 1NGCA 3KD1E 2EMTA 2E2OA 1JCGA 1C1CA 2D0AA 2X6NA 2O4IA 3A5MC 1UA0A 2VWJA 4DTPA 4IKFA 1ATSA 4N47A 1RTJA 3H1QA 3O9UA 1IV0A 2JGUA 3A5LC 4BRQA 2IVPA 3R9PA 3MN7A 4DTNA 4PKGA 3OY9A 3VN5A 3M8RA 3VGKA 3OYBA 2YHXA 4YDUA 3RTVA 3G9WA 3M3ZA 4QOZB 1IBMK 3FLVA 3ZSYA 3TI0A 4EIAA 3K0SA 3ZEUA 1T3VA 3VEWA 4R5PA 1NMDA 4AHTA 3M5RA 4DV0K 4CYEA 3C6TA 4OLBA 1TUUA 1C0TA 4LFBK 3F73A 1HJOA 5AQRA 4DV4K 3AO2A 4DSKA 1TKZA 3CJAA 1U2VB 3HPHA 3NF8A 4R79A 1GOAA 4BG9A 4DQIA 2BUPA 1NI2A 1XI1A 4OO1J 1JLCA 2PYJA 2O8DB 4FO0A 2D0PA 2D2QA 5HP1A 1XHXA 5M1PA 4E1NA 4AM6A 2G8KA 4FPAA 5LY3A 4IOAL 4RTFD 3T7ZA 5AFUA 4HVJA 2GBZA 4FLWA 1C0MA 1IKWA 4B1VA 2Z1HA 1BHLA 5TKYA 1VSHA 1XUPO 2Y1JA 4WQ4A 4DV2K 3ZYYX 1RTIA 1KAXA 3D0PA 1YJWN 4KBOA 3KLIA 4CEQA 1GLAG 4H0VB 3CM5A 2E5LK 2QA4N 2ZF5O 4E1JA 1ATNA 5M1OA 4O0IA 3AVHA 1J5EK 2UXBK 3MN5A 4U7BA 1OVYA 2QI2A 4IG0A 1V4TA 3VTHA 1YTAA 4H8KA 4BC4A 4FM0A 3OYDA 3OBWA 3P1GA 1LAVA 4QS8A 1U47A 1NK0A 1QTMA 4GKJK 3HI0A 3KHYA 4DQPA 3R1XA 2P1JA 3T69A 1ZBFA 3VQDA 2Q2RA 2OANA 4PL7A 3HYFA 3PX6A 5F0XA 3RWUA 3EN9A 4YHHK 2V52B 1Q9YA 4IFVA 2ZM6K 4P7IA 3I0SA 4XH1A 1HX1A 2E20A 5KQDA 4DF4A 4GKKK 1GOCA 5AQXA 4FPBA 5KPZA 5AFUH 1XNQK 3HT3A 4KV8A 1YUWA 2HNZA 5BN9A 4BR9A 1YITN 2E2NA 4XIUA 1HNXK 4EP5A 1SKRA 1VK0A 3PIPL 1D9FA 1HMVA 2YHWA 3RVCA 3SMSA 4OPJA 3LDQA 4F7GA 4DF8A 1BQNA 1GLDG 2KLAA 2X0SA 4I6MA 4H5VA 3VQ7A 2HVIA 4E7KA 1RBRA 3KJVA 4K25A 2HE7A 5AJ3K 3VQQA 3TSUA 3VF4A 4CZJA 1QSSA 2JWKA 4X62K 4W5QA 4CZMA 4AM7A 2H3GX 1IKVA 4CI6A 1V4SA 3J8AA 1HUXA 1WB9A 3P83D 1YJNN 4K42A 4FJIA 4CD1A 2NRXA 3NGIA 3RMCA 5MLCQ 4ILJA 5AQLA 2VGNA 2RN2A 2IDOA 4M42A 1QVGM 4E7LA 1XHZA 3LDLA 5HOOA 3CCJN 4JKAA 4JK7A 1WNSA 1QQNA 3VENA 4CEBA 4N76A 4W5OA 4CBUA 4DHYA 3G71N 2WUSA 4ISGA 3RSEB 2FJ9A 4NCAA 3D2FA 3CD6N 3ZT0A 4FWQA 3LM9A 4Z94A 1L3UA 4NYFA 3VGMA 1YXQA 4CJFA 1BISA 1NK9A 2P9KB 4UQGA 2A42A 3UKUA 3CQ8A 2OYQA 2O8FB 2I1KA 3WT0A 2GV9A 4CD3A 3K5MA 1SL2A 2NRVA 2CGKA 5FPDA 3ZETB 5ELZA 2CH5A 3FZKA 3WNHA 1Q9XA 2G8UA 4I9LA 5AQTA 2GUPA 3U8ZA 3IMXA 1J6ZA 3QIPA 4JRPA 1Q81O 1KQSM 4N5SA 4FXDA 4FYDA 3V1OA 4KHNA 3OYJA 4CK2A 3KTQA 2NRHA 4B1UB 3DXMA 2QW9A 3CFRA 3KLGA 1IBKK 4KH5A 3WEEB 4RW9A 1C6VA 4Z4HA 4W5TA 3CCUN 1GLEG 1ZBSA 4CJRA 4H0OA 4CEEA 3WNEA 3OYAA 1MWKA 2VG5A 2B4JA 3AY9A 2XY5A 4EP4A 1MK9B 1VQKN 1TAQA 3THXB 1KD1O 4LH5A 4YL8A 3ID8A 1HBKA 1NJZA 3C94A 3QICA 1M1KO 2NRWA 4C8MA 3PZDA 3MK6A 4E89A 3BZCA 2P9NB 1HRHA 2VYPA 4DSFA 4JLHA 4O8UA 2PBDA 3I33A 4H03B 3UKRA 4JKEA 1ISNA 4QAGA 3GDQA 3SQ2A 5AQKA 4LF5K 1ASUA 4YOXA 3IAYA 3HM9A 5K14A 2HNYA 1QE1A 5AQUA 3IG1A 1LCUA 1RBTA 3MCAB 1A5VA 2EX3A 2HHWA 1LW2A 1K8KB 4M7YA 3C7NB 3KK3A 3T1AA 4A57A 2FF6A 4FJ5A 4XH4A 1TV6A 4GW6A 1WSIA 1BWFO 3DAWA 5J2NA 4FVMA 4RW6A 3BZKA 5BR8K 3QEPA 1VSJA 3H08A 5AQFA 4J2AA 2P9UA 4H0XB 3OYLA 4DTXA 1HB6A 3LZJA 3JXUA 4IJAA 4OGCA 3LWLA 2BGGA 3NFAA 4CFBA 3WQTA 2W41A 4FK4A 3SPZA 4XH5A 3ATVA 1NU0A 3HP6A 3SQ4A 2YJEA 1QHTA 3M6GA 3THWB 3KK7A 3SAFA 1OH5A 4ZRJA 2FXUA 1YJ9N 2LBBA 3K2PA 3L2VA 5GIPA 4B1XB 3MEEA 1VQ7N 4DTSA 1VRTA 3WQUA 1NGAA 4M63C 1JLAA 4M3XA 4CGIA 1NWKA 3E9LA 3AVJA 1SL0A 1O13A 3DLRA 4B08A 4JI6K 3CI5A 3VA0A 4BQZA 2NRTA 3O6WA 1SKSA 1FKOA 4B9SA 5EOYA 1DT9A 1K73O 1NJXA 1SZ2A 4FLUA 4DLGA 1ZXOA 3V9SA 3B6OA 2DFHA 4H0YB 5J1EA 1VQNN 4GVMA 3CQYA 4WQ5C 1XNRK 3E01A 3F9KA 1S72N 4PKIA 4JS4A 4FJJA 2ZE2A 4A5AA 3SQ0A 1BUPA 1KXPA 2YCHA 3HOSA 4C8NA 1HJRA 4DR7K 3TAQA 5AQSA 5AQVA 3S9HA 3S41A 4IXCA 1JCEA 1J9AA 1WBDA 1NK4A 3LP2A 1T8EA 2ASMA 2D0BA 1NJYA 2J0KA 3AO3A 3CCEN 2YHBA 3VF2A 3SNNA 4CGHA 5GAHP 1Q7YO 4OKJA 3O4WA 3EE9A 2KFZA 1W9HA 4KHQA 2O8EA 4GXBA 3GBTA 3AVMA 3DLEA 2A1SA 2FBVA 4CHOA 1GLBG 1RDAA 3K58A 1TAUA 4JKGA 3CMEN 1UWBA 2J0JA 3G25A 4OJRA 3CCQN 4HUEA 4PL8A 1DTQA 3LANA 3PX0A 4CBWA 1B9DA 1QZ5A 4DU3A 2GEMA 1NOZA 1OVQA 3WXKA 3G6EN 4FJXA 1VQPN 3O9TA 4X65K 3M1FA 3NGYA 1RT6A 5GIOA 2B6AA 1WN7A 4DUZK 4B3RK 3EL2A 3OYKA 3SK3A 2FBTA 4JV5K 1RDWX 5AZIA 5C2DA 1EP4A 3AO1A 4FLVA 2VWBA 4FZZA 3VQ8A 3DWLA 4BROA 1W2BM 4OPKA 4QCLA 3CHWA 2ZJRL 1WSFA 4LFAK 2P9SB 3ULEA 1LOTB 1RT5A 3LDOA 5AZJA 1XC9A 1U4BA 1X9SA 3L0QA 4BACA 1KSPA 4DR4K 1IBLK 3DXKA 3PY8A 3ZT2A 3CPEA 2HHSA 4CJLA 3C6UA 2COPA 3TSQA 3AA4A 3OW2M 2P9LB 2HBJA 4B3OA 1Q18A 5IJMA 1ST7A 1BDGA 4F4KA 2OCEA 4KTWA 1IO2A 3C6AA 2OPQA 1U49A 4JI7K 3U4LA 3BEXA 4JHDB 3WNGA 1JLQA 5JICA 4CEDA 5AQPA 1RGIA 2EMSA 3LP0A 4M3RA 2GWJA 3A5NC 5KRTA 4J2BA 1P90A 4IEIA 1MU2A 4Q0BA 3RMBA 1IH7A 4ISFA 1RTHA 3QO9A 3UB5A 3OJSA 2W40A 4EHTA 3THYB 4FLYA 4IWVA 1N33K 1BA0A 4M3ZA 1XWLA 3PX4A 3QLHA 1W0HA 4CEFA 1RT7A 1D9DA 2XY6A 5BRDA 1X3MA 2UUBK 5AQZA 4BDZA 3L2RA 3CM6A 1HKCA 4CF1A 5CZ1A 5CYQA 4H0PA 3B8AX 3VQPA 3N4PA 3VEVA 4ELVA 4IO8A 4H5WA 5AQYA 2DTUA 4AHSA 1E5WA 3K9KA 5FROA 4BRKA 4CZIA 4M41A 2I5JA 1HPMA 3CFPA 4E3SA 3HVRA 4DTMA 4CGDA 3AGRA 1HYZA 3OS0A 1NKCA 3DOKA 5M1KA 2KHOA 4WYBA 2ZJPL 4FJ9A 1FXXA 5HRPA 1VQ9N 3JAMO 3VEOA 4CFAA 4IJNA 5CYMA 1S6QA 4DTOA 2OTLN 1RDCA 4KI6A 4PUOA 4H4OA 4WQ4C 3OA9A 3MXMA 4LSNA 3HL8A 4F2SA 3EE8A 4NXMK 4N41A 3PIOL 4C23A 4HTUA 4NCBA 4CJKA 4YOYA 1SS6A 4KHWA 1I3AA 2Z1GA 4ICLA 1EWRA 4QS7A 4EFHA 2I7NA 3DOLA 4CFDA 4BWMA 3V1RA 3AGKA 5F1XA 3PVLA 2DPNA 4B9MA 1KRPA 3LDNA 4DR5K 2UXDK 4AF1A 5KI6A 4MDBA 3D2EA 3QBWA 1NNEA 2YJFA 2V7ZA 2W6KA 2FC0A 3ENOA 1CXQA 3L4QA 2E6MA 4GMJB 1RBSA 2IVOA 1NGHA 5T7BA 3NDKA 1CZ9A 5CZ2A 1NK6A 5FLXO 3LAMA 4E7HA 3CETA 3AVCA 1SGHA 4JK9A 2E6LA 3ZX2A 4CJQA 4BRMA 3VQ9A 1BCOA 4ILHA 3KVGA 4IOCL 3KIOA 3CJ7A 2E2PA 4BRCA 5I9EB 4JI0K 4MDAA 1SV5A 2D0OA 4HCCA 4JI3K 2IS3A 4BR7A 1TGOA 4BRLA 4DWIA 4BQLA 2NZTA 2PY5A 4C1NK 4Q5VA 3OS1A 4BR0A 1GG3A 3VOVA 3PSIA 4CESA 5TKWA 3ZEUB 3CC2N 4KHYA 4KTZA 5EY4A 3J81O 1JLEA 2HBMA 5F2RA 1TYQB 2XY8A 3OYHA 3OYIA 1VRUA 4RW8A 3AVGA 3HO1A 4Z4GA 2FSKA 2HMPA 1NTIA 5HRSA 1HQEA 2YKNA 2BANA 4JKFA 3NF9A 3VTIA 1NJIO 1WUAA 4DR2K 4CF2A 4DQSA 4DU1A 3U3YA 3OBYA 3H45C 4TKNA 4CHQA 3LALA 1Q8IA 2W6LA 1C0UA 1VSKA 5EXWA 4BVOA 1A5XA 3U6FA 1UAXA 4IDKA 1BCMA 4PWDA 4HTLA 3ZCMA 5FRMA 3O1WA 3F9MA 3QDKA 4Y1CA 5AQGA 5BRFA 4B1WB 2WH5A 3JYTA 3V1QA 1H4RA 5HLFA 4DCHA 3VEZA 4PY5A 1BI4A 4FWNA 3AU4A 1NOYA 3C0BA 4JD2A 1R59O 2Q0UA 5EU7A 1LWCA 3AU5A 3U7DA 4NCGA 4DQRA 4M45A 3J7YP 3MN6A 3RSEA 2G8FA 4OPHA 4HUFA 3BDPA 5JS1A 3EEQA 4O0JA 1NG9A 2P5GA 2B5JA 4BE1A 3HP9A 4YFUA 3EZWA 3WNFA 4HHTA 4BE2A 1NGBA 4Z4IA 1TK8A 1VQ6N 1IG9A 3ZETA 3NAEA 1KC7A 2I1JA 2G8VA 4DG1A 3SYZA 2HVHA 3ULDA 1S22A 1NMNA 3T19A 3SLCA 4E7IA 1SAZA 3P31A 4JKHA 4BC5A 1SKWA 1EXQA 2D11A 3AO4A 4C8LA 4FZXC 1NLVA 4I7FA 5DM6L 3MMVA 4B8AB 1HQUA
chains in the Genus database with same CATH topology
4K43A 3R8EA 3CJCA 1TYQA 2QWPA 3KK7A 5EX5A 1IG8A 1ZC6A 4BC2A 3SAFA 5M1QA 1VQ8N 5KPRA 4JAXA 4ZRJA 2FXUA 3EKSA 4GVEA 4NLCA 1YJ9N 4PHTX 2LBBA 2CB8A 3EPYA 5GIPA 2CGLA 3ZDTA 2HRJA 4B1XB 3QFPA 3W0LA 5AQMA 1VQ7N 2YHYA 3WQUA 2EWSA 1NGAA 4BREA 4M63C 1DIKA 1NWKA 3E66A 5M1NA 1WOQA 2QTDA 1GLLO 3O9RA 3BINA 3E9LA 3H46O 4JKGB 1RDUA 4FWLA 1O13A 4GY2B 4I6MB 2I7PA 3CI5A 2KKZA 2AEHA 2AP1A 2Q1NA 2ITMA 4BQZA 2NRTA 3O6WA 4DQ8A 3FP5A 3ZX3A 4DXAB 3TTFA 4ZRIA 5EOYA 4KH6A 2P9PA 4MLEA 3A8YA 3GE1A 3VMFB 3CCLN 4A59A 4WCEL 1DT9A 4RCHA 4F9OA 2JWLA 2FDQA 3HM8A 1K73O 1RFQA 2HBLA 2Q97A 1SZ2A 2Q31A 4BRIA 4CZGA 4H5TA 5CR4A 1ZXOA 3QFUA 2R82A 2QWOA 4BVPA 2QWMA 3MCPA 4H0YB 5AZIB 3FZMA 3SBGA 1VQNN 3CQYA 1BU6O 5JLHA 3A5OC 4WQ5C 5C12A 3D7EO 3MN9A 5BN8A 1S72N 1GLFO 4FOIA 4PKIA 4JK8A 4O8KA 4YDUC 3ENHA 3ULEB 4BRGA 3D2EB 3WXLA 1Q86O 4H5RA 2P9IA 1P8ZA 4A5AA 1NGFA 2F9TA 3ATUA 3VEXA 2YI1A 1BUPA 3WXJA 1KXPA 3MX5A 2YCHA 1NGEA 4NLBA 1YF5L 4G9ZA 4HDOA 3HOSA 3CMAN 2J4RA 5FPEA 3H3NO 3BUZB 2FSJA 1T6CA 3VF6A 3CC4N 4ILGB 1KBLA 3U8XA 2Q0RA 4A62A 3IVFA 1E4FT 3WXMB 3DJCA 4BC3A 2Q36A 4GNIA 5AQSA 5AQVA 3S41A 1G99A 3F2KA 3FFKB 3AAPA 3D2FB 4IXCA 1BO5O 1JCEA 2VCPA 3IUCA 2RQ1A 5GINA 4C1NI 4B1YB 3VETA 4BR2A 2ASMA 5GAEP 2J0KA 3CCEN 4IOXA 1BA1A 2NLXA 5AQIA 4FWKA 1NGIA 3I8BA 3VF2A 4A2AA 2GX9A 2FF3B 4CJ7A 5GAHP 2FSNA 1S3XA 4GV9A 2QXLA 5E84A 3O5BA 2AA4A 1Q7YO 3L6QA 4BRDA 3K9JA 4CZHA 4CBXA 3O4WA 5DM7L 1NGCA 4FWRA 1HKBA 5CHIA 2EMTA 2E2OA 2A3ZA 1JCGA 3EE9A 3A5MC 4GV3A 4GXBA 3GBTA 5BRHA 1YVNA 3FZLA 1ATSA 3O9SA 4JN4A 3NVMA 5FPMA 3H1QA 4YOVA 3C65A 2P9KA 3O9UA 1GLBG 5AQJA 5EVZA 2E8AA 3A5LC 4PKHA 1HLUA 4BRQA 2IVPA 4JKGA 3R9PA 4CZKA 3CMEN 3MN7A 2J0JA 1IJJA 3G25A 3LM2A 4JNEA 4PKGA 3CCQN 4FWMA 4FL9A 4PL8A 5AR0A 4CBWA 3VGKA 1QZ5A 1GLCG 1C0GA 5BPMA 1EQYA 1QZ6A 2YHXA 4YDUA 4BRNA 4JKBA 4B9QA 3G9WA 2GEMA 2VGMA 1NBWA 3M3ZA 4BRPA 3QBXA 3WXKA 3FLVA 3MDQA 3G6EN 4EIAA 3H1VX 1VQPN 3O9TA 4FSVA 5JVGL 1TUYA 3ZEUA 1M90O 2E88A 3M1FA 1T3VA 4L3QA 4O5FA 3VEWA 3HBTA 5GIOA 1NMDA 1ATRA 1KAYA 3M5RA 4CYEA 3EL2A 2CGJA 3SAGA 3FLCO 2J0MA 4HDQA 1GLJO 1GC6A 3W3DA 4RWTA 3SK3A 1N8RO 3E9OA 1RDWX 5AZIA 5C2DA 1TUUA 4GV6A 1GC7A 2VWBA 1HJOA 3O9QA 3WEEA 3DWLA 5AQRA 4BROA 1W2BM 4J8FA 3CHWA 4UY8O 2ZJRL 2ZJQL 3FE1A 2P9SB 2V7YA 4JKCA 3MWTA 1LOTB 3LDOA 3ULEA 5AZJA 3CJAA 1U2VB 4BGAA 1MIXA 4R79A 4BG9A 3UKRB 3L0QA 2BUPA 3DXKA 2YVCA 1NM1A 3U9DA 1NI2A 3CPEA 4OO1J 5HL7L 3GL1A 1H1VA 4FO0A 2D0PA 4IDHA 4JD2B 2COPA 1ACAA 3N4QA 3TU5A 2D2QA 1XQSC 3TSQA 5M1PA 4AM6A 1MA9B 3OW2M 4FPAA 2P9LB 1YHQN 2D4WA 2QWLA 4YOUA 2HBJA 5LY3A 1Q18A 1VQ4N 3QMLA 4RTFD 5IJMA 4IOAL 1ST7A 1BDGA 3T7ZA 2F9WA 5AFUA 3IDHA 1DEJA 3BF3A 2BTFA 3C6AA 2P9NA 3U4LA 3BEXA 2HF4A 3I56N 4JHDB 5JICA 3H6EA 4B1VA 4BRHA 3Q7BA 5AQPA 5TKYA 1RGIA 1K9MO 2EMSA 2A40A 5C0YA 1XUPO 4IZ9A 2GWJA 4WQ4A 3ZYYX 3A5NC 4M7XA 3ZX0A 5BREA 1KAXA 1YJWN 4BRFA 4KBOA 1P90A 2F7TA 4IEIA 1QHAA 1GLAG 2WBNA 4H0VB 4ISFA 2QA4N 2ZF5O 4CZEA 2P9UB 2HF3A 1ATNA 4MLHA 5M1OA 4E1JA 1QVFM 3O8MA 3MN5A 3UB5A 3VGLA 1OVYA 2QI2A 4U7BA 2W40A 4EHTA 1V4TA 4IWVA 1K8KA 4YOWA 3VTHA 3C7NA 1BA0A 4BC4A 3OBWA 1Q82O 3HTVA 4FVUA 4BG8A 4QS8A 1MK7B 4EKUA 5BRDA 1DGKN 1X3MA 4MO5A 3HI0A 3KHYA 4JEPA 5AQZA 3R1XA 3SBTA 1QQOA 1VAZA 1HKCA 3T69A 3HOTA 1X9JA 4H0PA 2Q2RA 3B8AX 2OANA 2RHKA 3JS6A 3AAQA 3N4PA 4PL7A 5F0XA 3I55N 4WF9L 1X3NA 2E1YA 1J19A 3EN9A 4ISEA 3VERA 3VEVA 5ADXH 4IO8A 3BF1A 4H5WA 4YOTA 2V52B 5AQYA 1E5WA 3K9KA 4P7IA 2HSTA 2OTJN 4XH1A 1HX1A 4BRKA 2E20A 2YX6A 3UKUB 1MIZB 3EKUA 4CZIA 5B8HA 4CZLA 3HRGA 5KQDA 1HPMA 1HB8A 4DKWA 1ILYA 5AQXA 3X23A 3AGRA 1BOTO 4FPBA 5KPZA 4Y0WA 1K8AO 5AFUH 4IEEA 3KZBA 3WUHA 5BN9A 1YUWA 4BR9A 1YITN 1VQMN 5LJVA 2P9PB 5M1KA 4A2BA 2KHOA 4WYBA 2ZGYA 1XC3A 3TSPA 2E2NA 2ZJPL 1VQ9N 3PIPL 3DLLL 2YHWA 3VEOA 4IJNA 3GOIA 3RVCA 3SMSA 4A61A 3SAHA 2A5XA 1BG3A 3O80A 2OTLN 3LDQA 3NMUA 2A6AA 4WQ4C 4F7GA 3CC7N 4MO4A 3OA9A 1GLDG 3CIPA 3DXMB 1VQLN 2KLAA 2X0SA 3EO3A 4I6MA 4H5VA 3HZ6A 3H3OB 2V51B 3EE8A 5C15A 2CQUA 4K25A 3SMPA 2HE7A 4FOEA 5JVHL 2D1KA 2GTDA 3KWGA 3FZHA 3TSUA 3VF4A 4CZJA 1MDUB 2CH6A 2JWKA 4C23A 1NGDA 3PIOL 3MX2A 2P9IB 4YOYA 3MWPA 1SS6A 3CXCM 5C10A 2QM1A 4CZMA 2D10A 4AM7A 2H3GX 3ID6A 4CI6A 1V4SA 3J8AA 5C2FA 1HUXA 2ASOA 3CCRN 1C0FA 2NRZA 1E4GT 1D4XA 1YJNN 4K42A 4QS7A 3CCVN 3FR0A 2I7NA 2AL6A 2QWRA 4EFHA 4CD1A 5M1FA 2NRXA 3AGKA 5F1XA 2NRRA 3PVLA 3CJ9A 2DPNA 4U67L 4ILJA 5MLCQ 5AQLA 2VGNA 3LDNA 4AF1A 1YAGA 3VESA 5BPNA 3VPZA 4MDBA 3D2EA 3QBWA 1QVGM 2YJFA 2QWNA 2V7ZA 3TTDA 5ADXA 2E1ZA 1VBGA 3LDLA 3ENOA 5AQOA 4BGBA 5HOOA 3L4QA 3IFRA 3CCJN 3CF5L 4JKAA 4JK7A 1NGHA 2IVOA 3CPWM 1QQNA 2HOEA 3VENA 2BH1A 2GWKA 4CBUA 3P39A 2RE2A 4DHYA 3G71N 1GGOA 2WUSA 3HSCA 4ISGA 3RSEB 1JDEA 4NY0A 3CETA 3E9PA 1SGHA 4JK9A 1W97L 5LJWA 2FJ9A 3ZX2A 2IIRA 3D2FA 3CD6N 4WFNL 4WFBL 4FWQA 3LM9A 4BRMA 4Z94A 1JCFA 3VGMA 1YXQA 1EF1A 4ILHA 3KVGA 5JVLA 3U9ZA 2P9KB 1KAZA 4IOCL 2A42A 3UKUA 3O08A 3BP8A 1KC8O 3CJ7A 2E2PA 4BRCA 2I1KA 3WT0A 4CD3A 3L4IA 5I9EB 4MDAA 3QIJA 2D0OA 2NRVA 2CGKA 1T44A 5FPDA 4WFAL 3ZETB 3PLAA 4BR7A 4XEIA 5ELZA 4BRLA 2CH5A 4H0TB 3FZKA 4BQLA 1Z05A 2A41A 5H1SQ 2QEXN 1EO1A 2NZTA 3TTCA 5GADP 3R6MA 4KH4A 5AQTA 4C1NK 4BR0A 2GUPA 5BPLA 1GG3A 3U8ZA 1MWMA 1J6ZA 3FZFA 3IMXA 3R3LA 3VOVA 1Q81O 1KQSM 1YI2N 5TKWA 2NNWA 3ZEUB 3CC2N 3F5TA 3CCSN 3QB0A 5EY4A 2DIKA 3UE5A 2NRHA 2HBMA 4BR4A 4CZFA 3NVKA 5F2RA 4BRAA 1TYQB 4IFEA 5JLFA 4ZRKA 4B1UB 5AQWA 3DXMA 2QW9A 1U6ZA 3LL3A 4KH5A 2FSKA 3WEEB 3KWIA 2HMPA 3CCUN 1GLEG 1ZBSA 1NTIA 1QQMA 4H0OA 1MWKA 5AZJB 4JKFA 3CJ1A 1VBHA 3CCMN 3AY9A 3Q7CA 3VTIA 3DXKB 1MK9B 1NJIO 4NB4A 1WUAA 3CQXA 1VQ5N 1VQKN 3P38A 3WXIA 2ABDA 3OBYA 3TPQA 3H45C 5AQQA 4TKNA 4B1ZA 2PFUA 1KD1O 4YL8A 3ID8A 1HBKA 2WFBA 3E1YA 3P4IA 1HKGA 4K41A 1NGGA 1Z6RA 3CERA 2ZGZA 5EXWA 1OKJA 3QICA 5JMVA 4BVOA 1M1KO 1ESVA 2GELA 2NRWA 5BR9A 3PZDA 3MK6A 4HTLA 3IKMA 2E2QA 2P9NB 2VYPA 3O1WA 3O1BA 2P9SA 3F9MA 3QDKA 3FGUA 4O8UA 5E26A 5AQGA 2PAVA 5BRFA 4B1WB 2HBKA 1U2VA 2PBDA 3I33A 2WH5A 4H03B 4NO7A 1JJ2M 1H4RA 3UKRA 4DB3A 3WA0A 4DCHA 3LDPA 4EHUA 4JKEA 1ISNA 3VEZA 5KPTA 4FWNA 3AU4A 4OPAA 2ZPYA 3GDQA 3C0BA 4JD2A 1R59O 5AQKA 2IVNA 2Q0UA 2QWQA 4YOXA 2WC9A 3AU5A 3U7DA 2P9LA 3D6RA 4QS9A 5KQ8A 3MN6A 5AQUA 3RSEA 4OPHA 1LCUA 1Y64A 3MCAB 3G4SN 3AARA 3J7ZO 4H5NA 1K8KB 1NVLA 1VQON 4FWOA 3C7NB 4M7YA 4A57A 3GG4A 4EAHD 2FF6A 2FLOA 1SQKA 4JKDA 1NGJA 3EZWA 4JHDA 4XH4A 1BWFO 1NGBA 3DAWA 5FPNA 1YIJN 2ZWHA 1CZAN 1VQ6N 1T6DA 2UYTA 3C6HA 4HWIA 5GAGP 3VEYA 3ZETA 5CE3A 3A0IX 4WQ5A 2ASPA 5AQFA 5AQNA 3SJHA 4IO9L 1KC7A 2I1JA 2P9UA 4H0XB 4FWPA 1HB6A 1Y19B 3CJBA 1S22A 3JXUA 4IJAA 5AQHA 1DKGD 3WQTA 2W41A 4FWSA 3SLCA 1SAZA 3P31A 4JKHA 4BC5A 4BR5A 2D11A 4XH5A 3ATVA 4LC9B 1NLVA 4A5BA 3ENBA 4BY9C 5DM6L 2YJEA 3OHRA 3MMVA 4YORA 3M6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK8 A;  4JKF A;  3E9O A;  4JKE A;  3E9P A;  4JKG A;  4JK9 A;  4ILJ A;  4ILH A;  4JKC A;  4ILG B;  3SBT A;  4JKB A;  3E66 A;  4JKH A;  3E9L A;  3SBG A;  4JKA A;  4JKG B;  4JK7 A;  3ENB A;  4JKD A; 
#chains in the Genus database with same CATH topology
 1JL2 A;  3QER A;  1BIU A;  3AA3 A;  1QS4 A;  2IC3 A;  3LPU A;  1IG8 A;  4BC2 A;  4FLT A;  4LF9 K;  5KPR A;  4GVE A;  3MXJ A;  4FCY A;  1ASV A;  4AQY K;  2O8C A;  3QFP A;  5AQM A;  1I94 K;  2YHY A;  3VQE A;  1WLJ A;  3E66 A;  5M1N A;  1WOQ A;  2E4L A;  4CJ4 A;  2DFF A;  4FJK A;  4K0K K;  1RDU A;  4FWL A;  4I6M B;  2I7P A;  1VSL A;  1N32 K;  3FP5 A;  4DFJ A;  4DXA B;  3DMJ A;  4M3T A;  5C42 A;  4JI4 K;  2P9P A;  4MLE A;  3QNN A;  4AHV A;  1WSJ A;  2HHQ A;  2FDQ A;  2WTU A;  2Q97 A;  2R82 A;  4B9L A;  2QWO A;  2QWM A;  3FZM A;  3SBG A;  1TL3 A;  4EZ9 A;  1BU6 O;  3A5O C;  1VSF A;  1L3S A;  1JL1 A;  5BN8 A;  2DFE A;  1IKY A;  1U45 A;  1GLF O;  4JK8 A;  5E41 A;  3ENH A;  2FBX A;  4BRG A;  4CIG A;  1L3T A;  2P9I A;  2X74 A;  3ATU A;  3VEX A;  2YI1 A;  3WXJ A;  3ZLJ A;  4HDO A;  3H3N O;  3BUZ B;  4E0D A;  1KVC A;  1T6C A;  2FSJ A;  3VF6 A;  1WBB A;  3IVF A;  3DJC A;  4BC3 A;  1VSD A;  1ZBI A;  5KGX A;  3UIQ A;  1G99 A;  3AAP A;  3D2F B;  3SI6 A;  2VCP A;  5GIN A;  4W5R A;  4B1Y B;  3K57 A;  3VET A;  5KTQ A;  3SUP A;  3A2F A;  2NUB A;  4I9Q A;  4IOX A;  2FSN A;  4GV9 A;  2QXL A;  5E84 A;  3ZSO A;  3THW A;  1FK9 A;  2O8B A;  4DTJ A;  4FWR A;  4K8X A;  4IFY A;  1WSG A;  3TAG A;  1DTT A;  3OYF A;  4GV3 A;  1RIL A;  4CW7 B;  4AIL C;  2WOM A;  1YVN A;  3FZL A;  5FDL A;  1NK7 A;  3O9S A;  4JN4 A;  3NVM A;  5FPM A;  4CHY A;  4C8K A;  3C65 A;  3HVT A;  5AQJ A;  5A2Q O;  3DI6 A;  1HLU A;  4PKH A;  3OYG A;  4CZK A;  1IJJ A;  3LM2 A;  3K5L A;  1S1X A;  2FBY A;  5JS2 A;  4DR6 K;  1GLC G;  4BE0 A;  5BPM A;  1T7P A;  1KVB A;  1QZ6 A;  4KTQ A;  3ZT1 A;  4B9Q A;  2VGM A;  4DU4 A;  3QBX A;  3MDQ A;  1M90 O;  4FSV A;  5JVG L;  4L3Q A;  2QKB A;  4DFM A;  1UA1 A;  1KAY A;  2CGJ A;  3FLC O;  1GLJ O;  3W3D A;  1GC6 A;  4TSX A;  4RWT A;  5CY4 A;  4CJU A;  1N8R O;  3VQA A;  2O4G A;  4CF0 A;  4UY8 O;  2ZJQ L;  2V7Y A;  3V9Z A;  4BGA A;  1MIX A;  3UKR B;  4CIF A;  2YVC A;  1NM1 A;  3KD5 E;  3NBP A;  5HL7 L;  3TWH A;  1H1V A;  4IDH A;  1ACA A;  3TU5 A;  4JI5 K;  5FRN A;  1XQS C;  4OGE A;  2D4W A;  4YOU A;  2YKM A;  1TL1 A;  3M8S A;  3QEI A;  1BIZ A;  3IDH A;  1DEJ A;  3BF3 A;  3KKR A;  4LF8 K;  4DS4 A;  3TAB A;  4ELT A;  1A5W A;  2YNF A;  4W5N A;  4KI4 A;  2DY4 A;  3H6E A;  4BRH A;  2A40 A;  4IZ9 A;  1CZB A;  3NE6 A;  2F7T A;  4H4M A;  1N5Y A;  3QEV A;  4B3M K;  3PO5 A;  4CZE A;  2P9U B;  4MLH A;  2LSN A;  1QVF M;  3TR8 A;  3VGL A;  4DV5 K;  5D3G A;  3SV4 A;  1TK0 A;  1U04 A;  2Q3S A;  3HTV A;  4BG8 A;  1I39 A;  5SWM A;  1MK7 B;  4MO5 A;  4JEP A;  1S1U A;  3SBT A;  1VAZ A;  4EZ6 A;  4FM2 A;  2RHK A;  3AAQ A;  3QET A;  4WF9 L;  3K5O A;  3LPT A;  5ADX H;  4YOT A;  1TKT A;  4I2Q A;  5I42 A;  4DUY K;  4JI2 K;  2HST A;  4CEA A;  3HJF A;  3DLG A;  2YX6 A;  4RW4 A;  4DV6 K;  1MIZ B;  3EKU A;  2F96 A;  5HRN A;  3DRS A;  1W7A A;  3HRG A;  4CJ3 A;  2Z1I A;  1HB8 A;  1ILY A;  1TVR A;  4FJ7 A;  1OH7 A;  1K8A O;  4IEE A;  3KZB A;  3IS9 A;  4CJP A;  4LD0 A;  5LJV A;  2ZGY A;  1XC3 A;  4I2P A;  3LZI A;  3SUQ A;  3GOI A;  4A61 A;  2XHB A;  3SAH A;  1BG3 A;  3AVL A;  5IT9 O;  2XY7 A;  2YNG A;  3CC7 N;  3SJJ A;  3CIP A;  1VQL N;  1Z26 A;  3EO3 A;  3HK2 A;  3LP3 A;  4CF8 A;  3H3O B;  2V51 B;  1WAJ A;  4DTR A;  3L2W A;  2GUI A;  4FOE A;  1HNV A;  3ZSV A;  5JVH L;  2D1K A;  1XMQ K;  3V6D A;  3KWG A;  3FZH A;  1JXE A;  1JLF A;  2CH6 A;  1NGD A;  3MX2 A;  4KHS A;  4CF9 A;  4E1M A;  3CXC M;  4FLX A;  3HXM A;  4RG8 A;  4M3U A;  2D10 A;  5C2F A;  1J54 A;  2ASO A;  1NKB A;  2NRZ A;  1E4G T;  1D4X A;  1JKH A;  3IRX A;  2OPS A;  4DSI A;  3FR0 A;  2AL6 A;  2QWR A;  3DM2 A;  1RBV A;  4ID5 A;  3VPZ A;  4ZHR A;  3THY A;  1E3M A;  2HND A;  4KFB A;  1VBG A;  2HW3 A;  1D5A A;  3IFR A;  3CF5 L;  4FJH A;  3CPW M;  3DLK A;  2HOE A;  3S3N A;  4NYN A;  3RRH A;  4DV1 K;  3HSC A;  3L3V A;  1BQM A;  1W97 L;  3LP1 A;  5LJW A;  2O8E B;  2UUA K;  2P5O A;  1EF1 A;  3U9Z A;  2BDP A;  1KAZ A;  3M8Q A;  3O08 A;  3FFI A;  1KLM A;  2OA8 A;  1J53 A;  1T44 A;  4JS5 A;  3PLA A;  1KLN A;  4O5B A;  4H0T B;  1Z05 A;  2A41 A;  1F21 A;  5GAD P;  3PUF A;  3NGZ A;  4KB1 A;  3R6M A;  4N56 A;  5IWA K;  4Z4F A;  3J7A P;  3EYZ A;  1GOB A;  3KLF A;  3CCS N;  1HPZ A;  1YT3 A;  4LH4 A;  3AVF A;  4CJW A;  4CZF A;  3NVK A;  4BRA A;  2VQF K;  3AVA A;  1SUQ A;  1RBU A;  3LL3 A;  3LWM A;  2F4V K;  1RNH A;  5AZJ B;  2YHA A;  3CJ1 A;  1VBH A;  4KHU A;  3DXK B;  4NB4 A;  4K8Z A;  1JLB A;  3SUO A;  3WXI A;  1EKE A;  4LF7 K;  2PFU A;  3SV3 A;  1C1A A;  2WFB A;  3HPO A;  1HKG A;  4K41 A;  1NGG A;  1Z6R A;  3CER A;  2ZGZ A;  1LWF A;  5JMV A;  2GEL A;  5BR9 A;  2P51 A;  3ZT4 A;  5SZT A;  4LSL A;  3KKS A;  5E26 A;  3FGU A;  2HBK A;  1U2V A;  1JJ2 M;  4NO7 A;  4DB3 A;  5KPT A;  2OPR A;  2O8D A;  1FW6 A;  3ZSR A;  4OLA A;  3B6P A;  2VG7 A;  2IVN A;  3SQ1 A;  2WC9 A;  5KQ8 A;  3AAR A;  1HNW K;  4H5N A;  1VQO N;  1NVL A;  2G8W A;  3GG4 A;  2FLO A;  1RT3 A;  4KHP K;  4JKD A;  1NGJ A;  3TAE A;  2ZQB A;  4F3O A;  2IGI A;  4OKK A;  1YIJ N;  1G15 A;  1TKX A;  1T6D A;  3BY5 A;  4B9V A;  3C6H A;  2R7Y A;  2HHT A;  3VEY A;  4M3W A;  2AJQ A;  2ASP A;  5AQN A;  3V4I A;  1RTD A;  3NHG A;  1Y19 B;  5C24 A;  5DMR A;  4JRQ A;  4FWS A;  4FW1 A;  3O3F A;  4A5B A;  3T1H K;  4Z4E A;  3ENB A;  4BY9 C;  4YOR A;  3EZ5 A;  4K43 A;  3CJC A;  1TYQ A;  2QWP A;  3SZ2 A;  1ZC6 A;  3V9U A;  4CEZ A;  1VQ8 N;  3TAM A;  5LMN K;  4PA1 A;  4PHT X;  3ITH A;  2CB8 A;  2IOC A;  2CGL A;  2HRJ A;  3W0L A;  3ISN C;  4Y1D A;  3D45 A;  3OYC A;  3QES A;  3ALY A;  2RPI A;  1DIK A;  4CGJ A;  3OYN A;  2QTD A;  5C25 A;  2XO7 A;  3BIN A;  4GY2 B;  2WON A;  3KLH A;  2KKZ A;  2AP1 A;  1U48 A;  2ITM A;  4ZTJ A;  2KTQ A;  4B3T K;  3P5J A;  3ZX3 A;  3CCL N;  1QSY A;  1RCH A;  2JWL A;  4FJ8 A;  1OH8 A;  3ZSW A;  4CZG A;  1ZYQ A;  5KGW A;  3AVB A;  3MCP A;  3D7E O;  2OZS A;  2KW4 A;  1BGX T;  3D2E B;  3WXL A;  1KVA A;  1Q86 O;  2QKK A;  4H5R A;  1P8Z A;  1NGF A;  3MX5 A;  4NLB A;  1NGE A;  3EY1 A;  1NK5 A;  2J4R A;  4DR1 K;  4E7J A;  1S5J A;  2EHG A;  1QQC A;  3U8X A;  1HNZ K;  3CFO A;  2Q36 A;  2QK9 A;  3NH0 A;  3FFK B;  2VQE K;  1KCF A;  2OZM A;  3T3F A;  1DLO A;  3QIO A;  1BA1 A;  2NLX A;  3G0Z A;  1O1W A;  4A2A A;  3MEC A;  4E19 A;  4CJ7 A;  1S3X A;  4FW2 A;  3O5B A;  4CFC A;  3L6Q A;  4BRD A;  4CBX A;  5DM7 L;  1HKB A;  5CHI A;  1LW0 A;  2A3Z A;  2HHH K;  4CIE A;  4BWJ A;  5BRH A;  4CEC A;  4YOV A;  2P9K A;  4BDY A;  3O3H A;  5EVZ A;  2O8F A;  1X9W A;  2E8A A;  2A1R A;  4JNE A;  1KTQ A;  3NCI A;  4V19 S;  4DMN A;  3SCX A;  5AR0 A;  4FL9 A;  4FWM A;  1S1T A;  1HYV A;  4MQ3 A;  1RT4 A;  1C0G A;  1WSE A;  1EQY A;  4BRN A;  4JKB A;  1EWQ A;  4BRP A;  1NBW A;  2XRI A;  4DQQ A;  1LWE A;  4CVN E;  3H1V X;  3V81 A;  1TUY A;  2YV0 X;  1Z25 A;  3VQ6 A;  2E88 A;  4O5F A;  4JYA K;  3L8B A;  4B9N A;  3HBT A;  4B9U A;  1ATR A;  3SAG A;  2J0M A;  4HDQ A;  3G10 A;  3LDS A;  2KFN A;  4FZY A;  3E9O A;  4GV6 A;  4AH9 A;  1FJG K;  1GC7 A;  3O9Q A;  3WEE A;  4J8F A;  1S1V A;  3OS2 A;  1L5U A;  3MXI A;  3FE1 A;  4KRF A;  4JKC A;  3MWT A;  4CJS A;  3L2U A;  1T03 A;  3O4N A;  4LY7 A;  5J2M A;  3U9D A;  1BI4 B;  4CHZ A;  3GL1 A;  3THX A;  4F3T A;  4JD2 B;  3N4Q A;  4DR3 K;  1RDB A;  1NJW A;  1JXB A;  3QEW A;  1MA9 B;  3SUN A;  4B8C A;  1YHQ N;  4LF4 K;  2QWL A;  4IG3 A;  1VQ4 N;  3QML A;  4O4G A;  3DLH A;  3RR8 A;  3VQC A;  2F9W A;  1ZBU A;  2BTF A;  1B9F A;  3VA3 A;  2P9N A;  3TAN A;  4DFK A;  2HF4 A;  3I56 N;  1TKD A;  3OTO K;  3Q7B A;  1K9M O;  5C0Y A;  1J5O A;  2YNI A;  4DSJ A;  4M7X A;  5HRR A;  3ZX0 A;  3CYM A;  5BRE A;  4BRF A;  3AVN A;  1QHA A;  2WBN A;  2F8T A;  4CCH A;  2HF3 A;  2X78 A;  3O8M A;  4YOW A;  1K8K A;  4KKO A;  3C7N A;  3KK2 A;  1SL1 A;  1VHX A;  4O44 A;  1ZBH A;  1Q82 O;  4FVU A;  4EKU A;  1DGK N;  4FJM A;  3LAK A;  1QQO A;  1N34 K;  3HOT A;  1X9J A;  3JS6 A;  1NK8 A;  3I55 N;  3K5N A;  1X3N A;  2E1Y A;  3T1Y K;  1J19 A;  4ISE A;  3VER A;  2O8C B;  5J2P A;  3RMA A;  3BF1 A;  1REV A;  1LAW A;  2OTJ N;  3UKU B;  3VQ4 A;  5B8H A;  4CZL A;  4AHU A;  2ITG A;  4DKW A;  3AA2 A;  3X23 A;  1BOT O;  1YTU A;  4Y0W A;  3WUH A;  4HCB A;  1VQM N;  2P9P B;  2G8H A;  4A2B A;  1QSL A;  1Y97 A;  3TSP A;  4G1Q A;  4CJE A;  3DRR A;  3DLL L;  4J2E A;  4CHP A;  4Z4C A;  2A5X A;  5KRS A;  3O80 A;  4DTU A;  3NMU A;  2A6A A;  3M8P A;  3AA5 X;  4RW7 A;  4MO4 A;  1D8Y A;  3DXM B;  3L2Q A;  2QXF A;  4O55 A;  3HZ6 A;  2UXC K;  5C15 A;  2CQU A;  2PYL A;  3SMP A;  3SPY A;  2GTD A;  2HB5 A;  1MDU B;  2RF2 A;  2P9I B;  3PV8 A;  1S9E A;  3MWP A;  3DLB A;  3ZSZ A;  4CGF A;  5C10 A;  2QM1 A;  4PQU A;  4F8R A;  1KFS A;  4FJG A;  3ID6 A;  3ASM A;  3MAQ A;  4KPY A;  3L3U A;  3CCR N;  1C0F A;  3K59 A;  3CCV N;  5I3U A;  5M1F A;  4DS5 A;  1OH6 A;  5J2Q A;  3AO5 A;  2NRR A;  3CJ9 A;  4U67 L;  1WAF A;  4AHR A;  1B92 A;  1YAG A;  3VES A;  5BPN A;  2QWN A;  3TTD A;  5ADX A;  2E1Z A;  3V9X A;  4BGB A;  2X6S A;  5AQO A;  4YNQ A;  3PSF A;  2BH1 A;  2G8I A;  2GWK A;  2O8B B;  3P39 A;  2RE2 A;  3KK1 A;  1GGO A;  1JDE A;  4NY0 A;  1T05 A;  4FJN A;  3E9P A;  3QIN A;  1VSE A;  2UUC K;  2IIR A;  4WFN L;  4WFB L;  3NH1 A;  2Y1I A;  3TAR A;  1JCF A;  4DLE A;  4CJV A;  5JVL A;  3O3G A;  1EET A;  4LF6 K;  1KC8 O;  3BP8 A;  4M3Y A;  3L4I A;  3QIJ A;  4LFC K;  4WFA L;  1XMO K;  4XEI A;  4X64 K;  5H1S Q;  2QEX N;  1EO1 A;  3NF6 A;  3TTC A;  4KH4 A;  2KZZ A;  4ID1 A;  1TK5 A;  5BPL A;  1EX4 A;  1MWM A;  3FZF A;  3R3L A;  3S3O A;  2W42 A;  1YI2 N;  3TAP A;  2NNW A;  3F5T A;  3THV A;  3QEX A;  2UU9 K;  3QB0 A;  2DIK A;  3UE5 A;  4CHN A;  4BR4 A;  1R0A A;  4OX9 K;  1ITG A;  4IFE A;  2ATQ A;  4ZRK A;  5HBM A;  5JLF A;  1UOC A;  5AQW A;  1HR0 K;  2VG6 A;  1U6Z A;  3OYE A;  3CG7 A;  3U3G A;  1ASW A;  4JI8 K;  4C8O A;  4FJL A;  2D5R A;  4DSE A;  3KWI A;  4CGG A;  1QQM A;  4DV7 K;  3VQ5 A;  3CCM N;  3Q7C A;  1VQ5 N;  1C1B A;  3CQX A;  3MED A;  3P38 A;  1RT1 A;  2ABD A;  5DK5 A;  3TPQ A;  5AQQ A;  4B1Z A;  4OKE A;  4WE1 A;  3E1Y A;  3P4I A;  1OKJ A;  1CLQ A;  1ESV A;  2RKI A;  2ETJ A;  3DYA A;  5LL6 Z;  3IKM A;  1L3V A;  2E2Q A;  3BGR A;  1NKE A;  3O1B A;  2P9S A;  3HPG A;  2PAV A;  2HHX A;  4EHU A;  3WA0 A;  4KB0 A;  3LDP A;  4CK3 A;  3RRG A;  4CEO A;  1VSM A;  1X9M A;  4ELU A;  4OPA A;  2ZPY A;  3AV9 A;  1FKP A;  2QWQ A;  2VWK A;  1S9G A;  2P9L A;  3D6R A;  4QS9 A;  4HUG A;  4FK0 A;  1HYS A;  1Y64 A;  3G4S N;  2OPP A;  3J7Z O;  3DRP A;  3QNO A;  4FWO A;  4DV3 K;  1N36 K;  4EAH D;  3OVN A;  4X66 K;  4YY3 K;  2Z1J A;  1SQK A;  4JHD A;  5FPN A;  2ZWH A;  2BE2 A;  1CZA N;  4BDP A;  4CER A;  3ZSQ A;  4FK2 A;  2UYT A;  3VQB A;  4HWI A;  1RT2 A;  5GAG P;  5CE3 A;  3A0I X;  4WQ5 A;  3SJH A;  4IO9 L;  2HHV A;  3I0R A;  4FWP A;  3CJB A;  5AQH A;  1DKG D;  4Z0U A;  4KAZ A;  3NF7 A;  4BR5 A;  3AVI A;  4FLZ A;  4LC9 B;  4DFP A;  4JI1 K;  3OHR A;  3I8D A;  4AHC A;  3R8E A;  1S1W A;  2KZM A;  2YNH A;  5EX5 A;  1X1P A;  5M1Q A;  4JAX A;  1WSH A;  3EKS A;  4NLC A;  3EPY A;  3ZDT A;  3JSM A;  1K6Y A;  3C95 A;  2EWS A;  4BRE A;  1N6Q A;  2PZS A;  3OYM A;  3AVK A;  1KFD A;  3O9R A;  1GLL O;  3H46 O;  4JKG B;  1JLG A;  4L8R B;  1RDD A;  3KLE A;  2AEH A;  2D0C A;  1IKX A;  2Q1N A;  4CJ5 A;  5LMU K;  4DQ8 A;  3O4Q A;  3OJU A;  3TTF A;  4ZRI A;  2HHU A;  4KH6 A;  3A8Y A;  3GE1 A;  3VMF B;  4A59 A;  4WCE L;  4RCH A;  4F9O A;  4F2R A;  3HM8 A;  4CK1 A;  4B3S K;  4NXN K;  1RFQ A;  2HBL A;  3V9W A;  1S6P A;  2JLE A;  5HRO A;  2Q31 A;  4BRI A;  4B9T A;  4H5T A;  4FM1 A;  5CR4 A;  3QFU A;  4OVL A;  4BVP A;  3PO4 A;  5AZI B;  4J2D A;  5JLH A;  2ZD1 A;  5C12 A;  1ZBL A;  3MN9 A;  4FOI A;  3MEG A;  4O8K A;  4YDU C;  3ULE B;  4DSL A;  4KRE A;  2F9T A;  4CE9 A;  4G9Z A;  1YF5 L;  2IAJ A;  4MFB A;  3CMA N;  2HMI A;  5FPE A;  3J80 O;  3TAF A;  4ZTF A;  1LV5 A;  1BL3 A;  2KQ2 A;  1YVU A;  3CC4 N;  4ILG B;  1KBL A;  1CXU A;  2Q0R A;  4A62 A;  1E4F T;  3WXM B;  2F8S A;  4GNI A;  3RMD A;  3F2K A;  1BO5 O;  3NH2 A;  3RR7 A;  1HNI A;  2RQ1 A;  3IUC A;  1VSI A;  4C1N I;  4BR2 A;  3ZT3 A;  5GAE P;  3S3M A;  4KO0 A;  5AQI A;  4FWK A;  3HST B;  1NGI A;  3I8B A;  3ZSX A;  4CJT A;  2GX9 A;  4IBN A;  2FF3 B;  2AA4 A;  3K9J A;  4CZH A;  1NGC A;  3KD1 E;  2EMT A;  2E2O A;  1JCG A;  1C1C A;  2D0A A;  2X6N A;  2O4I A;  3A5M C;  1UA0 A;  2VWJ A;  4DTP A;  4IKF A;  1ATS A;  4N47 A;  1RTJ A;  3H1Q A;  3O9U A;  1IV0 A;  2JGU A;  3A5L C;  4BRQ A;  2IVP A;  3R9P A;  3MN7 A;  4DTN A;  4PKG A;  3OY9 A;  3VN5 A;  3M8R A;  3VGK A;  3OYB A;  2YHX A;  4YDU A;  3RTV A;  3G9W A;  3M3Z A;  4QOZ B;  1IBM K;  3FLV A;  3ZSY A;  3TI0 A;  4EIA A;  3K0S A;  3ZEU A;  1T3V A;  3VEW A;  4R5P A;  1NMD A;  4AHT A;  3M5R A;  4DV0 K;  4CYE A;  3C6T A;  4OLB A;  1TUU A;  1C0T A;  4LFB K;  3F73 A;  1HJO A;  5AQR A;  4DV4 K;  3AO2 A;  4DSK A;  1TKZ A;  3CJA A;  1U2V B;  3HPH A;  3NF8 A;  4R79 A;  1GOA A;  4BG9 A;  4DQI A;  2BUP A;  1NI2 A;  1XI1 A;  4OO1 J;  1JLC A;  2PYJ A;  2O8D B;  4FO0 A;  2D0P A;  2D2Q A;  5HP1 A;  1XHX A;  5M1P A;  4E1N A;  4AM6 A;  2G8K A;  4FPA A;  5LY3 A;  4IOA L;  4RTF D;  3T7Z A;  5AFU A;  4HVJ A;  2GBZ A;  4FLW A;  1C0M A;  1IKW A;  4B1V A;  2Z1H A;  1BHL A;  5TKY A;  1VSH A;  1XUP O;  2Y1J A;  4WQ4 A;  4DV2 K;  3ZYY X;  1RTI A;  1KAX A;  3D0P A;  1YJW N;  4KBO A;  3KLI A;  4CEQ A;  1GLA G;  4H0V B;  3CM5 A;  2E5L K;  2QA4 N;  2ZF5 O;  4E1J A;  1ATN A;  5M1O A;  4O0I A;  3AVH A;  1J5E K;  2UXB K;  3MN5 A;  4U7B A;  1OVY A;  2QI2 A;  4IG0 A;  1V4T A;  3VTH A;  1YTA A;  4H8K A;  4BC4 A;  4FM0 A;  3OYD A;  3OBW A;  3P1G A;  1LAV A;  4QS8 A;  1U47 A;  1NK0 A;  1QTM A;  4GKJ K;  3HI0 A;  3KHY A;  4DQP A;  3R1X A;  2P1J A;  3T69 A;  1ZBF A;  3VQD A;  2Q2R A;  2OAN A;  4PL7 A;  3HYF A;  3PX6 A;  5F0X A;  3RWU A;  3EN9 A;  4YHH K;  2V52 B;  1Q9Y A;  4IFV A;  2ZM6 K;  4P7I A;  3I0S A;  4XH1 A;  1HX1 A;  2E20 A;  5KQD A;  4DF4 A;  4GKK K;  1GOC A;  5AQX A;  4FPB A;  5KPZ A;  5AFU H;  1XNQ K;  3HT3 A;  4KV8 A;  1YUW A;  2HNZ A;  5BN9 A;  4BR9 A;  1YIT N;  2E2N A;  4XIU A;  1HNX K;  4EP5 A;  1SKR A;  1VK0 A;  3PIP L;  1D9F A;  1HMV A;  2YHW A;  3RVC A;  3SMS A;  4OPJ A;  3LDQ A;  4F7G A;  4DF8 A;  1BQN A;  1GLD G;  2KLA A;  2X0S A;  4I6M A;  4H5V A;  3VQ7 A;  2HVI A;  4E7K A;  1RBR A;  3KJV A;  4K25 A;  2HE7 A;  5AJ3 K;  3VQQ A;  3TSU A;  3VF4 A;  4CZJ A;  1QSS A;  2JWK A;  4X62 K;  4W5Q A;  4CZM A;  4AM7 A;  2H3G X;  1IKV A;  4CI6 A;  1V4S A;  3J8A A;  1HUX A;  1WB9 A;  3P83 D;  1YJN N;  4K42 A;  4FJI A;  4CD1 A;  2NRX A;  3NGI A;  3RMC A;  5MLC Q;  4ILJ A;  5AQL A;  2VGN A;  2RN2 A;  2IDO A;  4M42 A;  1QVG M;  4E7L A;  1XHZ A;  3LDL A;  5HOO A;  3CCJ N;  4JKA A;  4JK7 A;  1WNS A;  1QQN A;  3VEN A;  4CEB A;  4N76 A;  4W5O A;  4CBU A;  4DHY A;  3G71 N;  2WUS A;  4ISG A;  3RSE B;  2FJ9 A;  4NCA A;  3D2F A;  3CD6 N;  3ZT0 A;  4FWQ A;  3LM9 A;  4Z94 A;  1L3U A;  4NYF A;  3VGM A;  1YXQ A;  4CJF A;  1BIS A;  1NK9 A;  2P9K B;  4UQG A;  2A42 A;  3UKU A;  3CQ8 A;  2OYQ A;  2O8F B;  2I1K A;  3WT0 A;  2GV9 A;  4CD3 A;  3K5M A;  1SL2 A;  2NRV A;  2CGK A;  5FPD A;  3ZET B;  5ELZ A;  2CH5 A;  3FZK A;  3WNH A;  1Q9X A;  2G8U A;  4I9L A;  5AQT A;  2GUP A;  3U8Z A;  3IMX A;  1J6Z A;  3QIP A;  4JRP A;  1Q81 O;  1KQS M;  4N5S A;  4FXD A;  4FYD A;  3V1O A;  4KHN A;  3OYJ A;  4CK2 A;  3KTQ A;  2NRH A;  4B1U B;  3DXM A;  2QW9 A;  3CFR A;  3KLG A;  1IBK K;  4KH5 A;  3WEE B;  4RW9 A;  1C6V A;  4Z4H A;  4W5T A;  3CCU N;  1GLE G;  1ZBS A;  4CJR A;  4H0O A;  4CEE A;  3WNE A;  3OYA A;  1MWK A;  2VG5 A;  2B4J A;  3AY9 A;  2XY5 A;  4EP4 A;  1MK9 B;  1VQK N;  1TAQ A;  3THX B;  1KD1 O;  4LH5 A;  4YL8 A;  3ID8 A;  1HBK A;  1NJZ A;  3C94 A;  3QIC A;  1M1K O;  2NRW A;  4C8M A;  3PZD A;  3MK6 A;  4E89 A;  3BZC A;  2P9N B;  1HRH A;  2VYP A;  4DSF A;  4JLH A;  4O8U A;  2PBD A;  3I33 A;  4H03 B;  3UKR A;  4JKE A;  1ISN A;  4QAG A;  3GDQ A;  3SQ2 A;  5AQK A;  4LF5 K;  1ASU A;  4YOX A;  3IAY A;  3HM9 A;  5K14 A;  2HNY A;  1QE1 A;  5AQU A;  3IG1 A;  1LCU A;  1RBT A;  3MCA B;  1A5V A;  2EX3 A;  2HHW A;  1LW2 A;  1K8K B;  4M7Y A;  3C7N B;  3KK3 A;  3T1A A;  4A57 A;  2FF6 A;  4FJ5 A;  4XH4 A;  1TV6 A;  4GW6 A;  1WSI A;  1BWF O;  3DAW A;  5J2N A;  4FVM A;  4RW6 A;  3BZK A;  5BR8 K;  3QEP A;  1VSJ A;  3H08 A;  5AQF A;  4J2A A;  2P9U A;  4H0X B;  3OYL A;  4DTX A;  1HB6 A;  3LZJ A;  3JXU A;  4IJA A;  4OGC A;  3LWL A;  2BGG A;  3NFA A;  4CFB A;  3WQT A;  2W41 A;  4FK4 A;  3SPZ A;  4XH5 A;  3ATV A;  1NU0 A;  3HP6 A;  3SQ4 A;  2YJE A;  1QHT A;  3M6G A;  3THW B;  3KK7 A;  3SAF A;  1OH5 A;  4ZRJ A;  2FXU A;  1YJ9 N;  2LBB A;  3K2P A;  3L2V A;  5GIP A;  4B1X B;  3MEE A;  1VQ7 N;  4DTS A;  1VRT A;  3WQU A;  1NGA A;  4M63 C;  1JLA A;  4M3X A;  4CGI A;  1NWK A;  3E9L A;  3AVJ A;  1SL0 A;  1O13 A;  3DLR A;  4B08 A;  4JI6 K;  3CI5 A;  3VA0 A;  4BQZ A;  2NRT A;  3O6W A;  1SKS A;  1FKO A;  4B9S A;  5EOY A;  1DT9 A;  1K73 O;  1NJX A;  1SZ2 A;  4FLU A;  4DLG A;  1ZXO A;  3V9S A;  3B6O A;  2DFH A;  4H0Y B;  5J1E A;  1VQN N;  4GVM A;  3CQY A;  4WQ5 C;  1XNR K;  3E01 A;  3F9K A;  1S72 N;  4PKI A;  4JS4 A;  4FJJ A;  2ZE2 A;  4A5A A;  3SQ0 A;  1BUP A;  1KXP A;  2YCH A;  3HOS A;  4C8N A;  1HJR A;  4DR7 K;  3TAQ A;  5AQS A;  5AQV A;  3S9H A;  3S41 A;  4IXC A;  1JCE A;  1J9A A;  1WBD A;  1NK4 A;  3LP2 A;  1T8E A;  2ASM A;  2D0B A;  1NJY A;  2J0K A;  3AO3 A;  3CCE N;  2YHB A;  3VF2 A;  3SNN A;  4CGH A;  5GAH P;  1Q7Y O;  4OKJ A;  3O4W A;  3EE9 A;  2KFZ A;  1W9H A;  4KHQ A;  2O8E A;  4GXB A;  3GBT A;  3AVM A;  3DLE A;  2A1S A;  2FBV A;  4CHO A;  1GLB G;  1RDA A;  3K58 A;  1TAU A;  4JKG A;  3CME N;  1UWB A;  2J0J A;  3G25 A;  4OJR A;  3CCQ N;  4HUE A;  4PL8 A;  1DTQ A;  3LAN A;  3PX0 A;  4CBW A;  1B9D A;  1QZ5 A;  4DU3 A;  2GEM A;  1NOZ A;  1OVQ A;  3WXK A;  3G6E N;  4FJX A;  1VQP N;  3O9T A;  4X65 K;  3M1F A;  3NGY A;  1RT6 A;  5GIO A;  2B6A A;  1WN7 A;  4DUZ K;  4B3R K;  3EL2 A;  3OYK A;  3SK3 A;  2FBT A;  4JV5 K;  1RDW X;  5AZI A;  5C2D A;  1EP4 A;  3AO1 A;  4FLV A;  2VWB A;  4FZZ A;  3VQ8 A;  3DWL A;  4BRO A;  1W2B M;  4OPK A;  4QCL A;  3CHW A;  2ZJR L;  1WSF A;  4LFA K;  2P9S B;  3ULE A;  1LOT B;  1RT5 A;  3LDO A;  5AZJ A;  1XC9 A;  1U4B A;  1X9S A;  3L0Q A;  4BAC A;  1KSP A;  4DR4 K;  1IBL K;  3DXK A;  3PY8 A;  3ZT2 A;  3CPE A;  2HHS A;  4CJL A;  3C6U A;  2COP A;  3TSQ A;  3AA4 A;  3OW2 M;  2P9L B;  2HBJ A;  4B3O A;  1Q18 A;  5IJM A;  1ST7 A;  1BDG A;  4F4K A;  2OCE A;  4KTW A;  1IO2 A;  3C6A A;  2OPQ A;  1U49 A;  4JI7 K;  3U4L A;  3BEX A;  4JHD B;  3WNG A;  1JLQ A;  5JIC A;  4CED A;  5AQP A;  1RGI A;  2EMS A;  3LP0 A;  4M3R A;  2GWJ A;  3A5N C;  5KRT A;  4J2B A;  1P90 A;  4IEI A;  1MU2 A;  4Q0B A;  3RMB A;  1IH7 A;  4ISF A;  1RTH A;  3QO9 A;  3UB5 A;  3OJS A;  2W40 A;  4EHT A;  3THY B;  4FLY A;  4IWV A;  1N33 K;  1BA0 A;  4M3Z A;  1XWL A;  3PX4 A;  3QLH A;  1W0H A;  4CEF A;  1RT7 A;  1D9D A;  2XY6 A;  5BRD A;  1X3M A;  2UUB K;  5AQZ A;  4BDZ A;  3L2R A;  3CM6 A;  1HKC A;  4CF1 A;  5CZ1 A;  5CYQ A;  4H0P A;  3B8A X;  3VQP A;  3N4P A;  3VEV A;  4ELV A;  4IO8 A;  4H5W A;  5AQY A;  2DTU A;  4AHS A;  1E5W A;  3K9K A;  5FRO A;  4BRK A;  4CZI A;  4M41 A;  2I5J A;  1HPM A;  3CFP A;  4E3S A;  3HVR A;  4DTM A;  4CGD A;  3AGR A;  1HYZ A;  3OS0 A;  1NKC A;  3DOK A;  5M1K A;  2KHO A;  4WYB A;  2ZJP L;  4FJ9 A;  1FXX A;  5HRP A;  1VQ9 N;  3JAM O;  3VEO A;  4CFA A;  4IJN A;  5CYM A;  1S6Q A;  4DTO A;  2OTL N;  1RDC A;  4KI6 A;  4PUO A;  4H4O A;  4WQ4 C;  3OA9 A;  3MXM A;  4LSN A;  3HL8 A;  4F2S A;  3EE8 A;  4NXM K;  4N41 A;  3PIO L;  4C23 A;  4HTU A;  4NCB A;  4CJK A;  4YOY A;  1SS6 A;  4KHW A;  1I3A A;  2Z1G A;  4ICL A;  1EWR A;  4QS7 A;  4EFH A;  2I7N A;  3DOL A;  4CFD A;  4BWM A;  3V1R A;  3AGK A;  5F1X A;  3PVL A;  2DPN A;  4B9M A;  1KRP A;  3LDN A;  4DR5 K;  2UXD K;  4AF1 A;  5KI6 A;  4MDB A;  3D2E A;  3QBW A;  1NNE A;  2YJF A;  2V7Z A;  2W6K A;  2FC0 A;  3ENO A;  1CXQ A;  3L4Q A;  2E6M A;  4GMJ B;  1RBS A;  2IVO A;  1NGH A;  5T7B A;  3NDK A;  1CZ9 A;  5CZ2 A;  1NK6 A;  5FLX O;  3LAM A;  4E7H A;  3CET A;  3AVC A;  1SGH A;  4JK9 A;  2E6L A;  3ZX2 A;  4CJQ A;  4BRM A;  3VQ9 A;  1BCO A;  4ILH A;  3KVG A;  4IOC L;  3KIO A;  3CJ7 A;  2E2P A;  4BRC A;  5I9E B;  4JI0 K;  4MDA A;  1SV5 A;  2D0O A;  4HCC A;  4JI3 K;  2IS3 A;  4BR7 A;  1TGO A;  4BRL A;  4DWI A;  4BQL A;  2NZT A;  2PY5 A;  4C1N K;  4Q5V A;  3OS1 A;  4BR0 A;  1GG3 A;  3VOV A;  3PSI A;  4CES A;  5TKW A;  3ZEU B;  3CC2 N;  4KHY A;  4KTZ A;  5EY4 A;  3J81 O;  1JLE A;  2HBM A;  5F2R A;  1TYQ B;  2XY8 A;  3OYH A;  3OYI A;  1VRU A;  4RW8 A;  3AVG A;  3HO1 A;  4Z4G A;  2FSK A;  2HMP A;  1NTI A;  5HRS A;  1HQE A;  2YKN A;  2BAN A;  4JKF A;  3NF9 A;  3VTI A;  1NJI O;  1WUA A;  4DR2 K;  4CF2 A;  4DQS A;  4DU1 A;  3U3Y A;  3OBY A;  3H45 C;  4TKN A;  4CHQ A;  3LAL A;  1Q8I A;  2W6L A;  1C0U A;  1VSK A;  5EXW A;  4BVO A;  1A5X A;  3U6F A;  1UAX A;  4IDK A;  1BCM A;  4PWD A;  4HTL A;  3ZCM A;  5FRM A;  3O1W A;  3F9M A;  3QDK A;  4Y1C A;  5AQG A;  5BRF A;  4B1W B;  2WH5 A;  3JYT A;  3V1Q A;  1H4R A;  5HLF A;  4DCH A;  3VEZ A;  4PY5 A;  1BI4 A;  4FWN A;  3AU4 A;  1NOY A;  3C0B A;  4JD2 A;  1R59 O;  2Q0U A;  5EU7 A;  1LWC A;  3AU5 A;  3U7D A;  4NCG A;  4DQR A;  4M45 A;  3J7Y P;  3MN6 A;  3RSE A;  2G8F A;  4OPH A;  4HUF A;  3BDP A;  5JS1 A;  3EEQ A;  4O0J A;  1NG9 A;  2P5G A;  2B5J A;  4BE1 A;  3HP9 A;  4YFU A;  3EZW A;  3WNF A;  4HHT A;  4BE2 A;  1NGB A;  4Z4I A;  1TK8 A;  1VQ6 N;  1IG9 A;  3ZET A;  3NAE A;  1KC7 A;  2I1J A;  2G8V A;  4DG1 A;  3SYZ A;  2HVH A;  3ULD A;  1S22 A;  1NMN A;  3T19 A;  3SLC A;  4E7I A;  1SAZ A;  3P31 A;  4JKH A;  4BC5 A;  1SKW A;  1EXQ A;  2D11 A;  3AO4 A;  4C8L A;  4FZX C;  1NLV A;  4I7F A;  5DM6 L;  3MMV A;  4B8A B;  1HQU A; 
#chains in the Genus database with same CATH homology
 4K43 A;  3R8E A;  3CJC A;  1TYQ A;  2QWP A;  3KK7 A;  5EX5 A;  1IG8 A;  1ZC6 A;  4BC2 A;  3SAF A;  5M1Q A;  1VQ8 N;  5KPR A;  4JAX A;  4ZRJ A;  2FXU A;  3EKS A;  4GVE A;  4NLC A;  1YJ9 N;  4PHT X;  2LBB A;  2CB8 A;  3EPY A;  5GIP A;  2CGL A;  3ZDT A;  2HRJ A;  4B1X B;  3QFP A;  3W0L A;  5AQM A;  1VQ7 N;  2YHY A;  3WQU A;  2EWS A;  1NGA A;  4BRE A;  4M63 C;  1DIK A;  1NWK A;  3E66 A;  5M1N A;  1WOQ A;  2QTD A;  1GLL O;  3O9R A;  3BIN A;  3E9L A;  3H46 O;  4JKG B;  1RDU A;  4FWL A;  1O13 A;  4GY2 B;  4I6M B;  2I7P A;  3CI5 A;  2KKZ A;  2AEH A;  2AP1 A;  2Q1N A;  2ITM A;  4BQZ A;  2NRT A;  3O6W A;  4DQ8 A;  3FP5 A;  3ZX3 A;  4DXA B;  3TTF A;  4ZRI A;  5EOY A;  4KH6 A;  2P9P A;  4MLE A;  3A8Y A;  3GE1 A;  3VMF B;  3CCL N;  4A59 A;  4WCE L;  1DT9 A;  4RCH A;  4F9O A;  2JWL A;  2FDQ A;  3HM8 A;  1K73 O;  1RFQ A;  2HBL A;  2Q97 A;  1SZ2 A;  2Q31 A;  4BRI A;  4CZG A;  4H5T A;  5CR4 A;  1ZXO A;  3QFU A;  2R82 A;  2QWO A;  4BVP A;  2QWM A;  3MCP A;  4H0Y B;  5AZI B;  3FZM A;  3SBG A;  1VQN N;  3CQY A;  1BU6 O;  5JLH A;  3A5O C;  4WQ5 C;  5C12 A;  3D7E O;  3MN9 A;  5BN8 A;  1S72 N;  1GLF O;  4FOI A;  4PKI A;  4JK8 A;  4O8K A;  4YDU C;  3ENH A;  3ULE B;  4BRG A;  3D2E B;  3WXL A;  1Q86 O;  4H5R A;  2P9I A;  1P8Z A;  4A5A A;  1NGF A;  2F9T A;  3ATU A;  3VEX A;  2YI1 A;  1BUP A;  3WXJ A;  1KXP A;  3MX5 A;  2YCH A;  1NGE A;  4NLB A;  1YF5 L;  4G9Z A;  4HDO A;  3HOS A;  3CMA N;  2J4R A;  5FPE A;  3H3N O;  3BUZ B;  2FSJ A;  1T6C A;  3VF6 A;  3CC4 N;  4ILG B;  1KBL A;  3U8X A;  2Q0R A;  4A62 A;  3IVF A;  1E4F T;  3WXM B;  3DJC A;  4BC3 A;  2Q36 A;  4GNI A;  5AQS A;  5AQV A;  3S41 A;  1G99 A;  3F2K A;  3FFK B;  3AAP A;  3D2F B;  4IXC A;  1BO5 O;  1JCE A;  2VCP A;  3IUC A;  2RQ1 A;  5GIN A;  4C1N I;  4B1Y B;  3VET A;  4BR2 A;  2ASM A;  5GAE P;  2J0K A;  3CCE N;  4IOX A;  1BA1 A;  2NLX A;  5AQI A;  4FWK A;  1NGI A;  3I8B A;  3VF2 A;  4A2A A;  2GX9 A;  2FF3 B;  4CJ7 A;  5GAH P;  2FSN A;  1S3X A;  4GV9 A;  2QXL A;  5E84 A;  3O5B A;  2AA4 A;  1Q7Y O;  3L6Q A;  4BRD A;  3K9J A;  4CZH A;  4CBX A;  3O4W A;  5DM7 L;  1NGC A;  4FWR A;  1HKB A;  5CHI A;  2EMT A;  2E2O A;  2A3Z A;  1JCG A;  3EE9 A;  3A5M C;  4GV3 A;  4GXB A;  3GBT A;  5BRH A;  1YVN A;  3FZL A;  1ATS A;  3O9S A;  4JN4 A;  3NVM A;  5FPM A;  3H1Q A;  4YOV A;  3C65 A;  2P9K A;  3O9U A;  1GLB G;  5AQJ A;  5EVZ A;  2E8A A;  3A5L C;  4PKH A;  1HLU A;  4BRQ A;  2IVP A;  4JKG A;  3R9P A;  4CZK A;  3CME N;  3MN7 A;  2J0J A;  1IJJ A;  3G25 A;  3LM2 A;  4JNE A;  4PKG A;  3CCQ N;  4FWM A;  4FL9 A;  4PL8 A;  5AR0 A;  4CBW A;  3VGK A;  1QZ5 A;  1GLC G;  1C0G A;  5BPM A;  1EQY A;  1QZ6 A;  2YHX A;  4YDU A;  4BRN A;  4JKB A;  4B9Q A;  3G9W A;  2GEM A;  2VGM A;  1NBW A;  3M3Z A;  4BRP A;  3QBX A;  3WXK A;  3FLV A;  3MDQ A;  3G6E N;  4EIA A;  3H1V X;  1VQP N;  3O9T A;  4FSV A;  5JVG L;  1TUY A;  3ZEU A;  1M90 O;  2E88 A;  3M1F A;  1T3V A;  4L3Q A;  4O5F A;  3VEW A;  3HBT A;  5GIO A;  1NMD A;  1ATR A;  1KAY A;  3M5R A;  4CYE A;  3EL2 A;  2CGJ A;  3SAG A;  3FLC O;  2J0M A;  4HDQ A;  1GLJ O;  1GC6 A;  3W3D A;  4RWT A;  3SK3 A;  1N8R O;  3E9O A;  1RDW X;  5AZI A;  5C2D A;  1TUU A;  4GV6 A;  1GC7 A;  2VWB A;  1HJO A;  3O9Q A;  3WEE A;  3DWL A;  5AQR A;  4BRO A;  1W2B M;  4J8F A;  3CHW A;  4UY8 O;  2ZJR L;  2ZJQ L;  3FE1 A;  2P9S B;  2V7Y A;  4JKC A;  3MWT A;  1LOT B;  3LDO A;  3ULE A;  5AZJ A;  3CJA A;  1U2V B;  4BGA A;  1MIX A;  4R79 A;  4BG9 A;  3UKR B;  3L0Q A;  2BUP A;  3DXK A;  2YVC A;  1NM1 A;  3U9D A;  1NI2 A;  3CPE A;  4OO1 J;  5HL7 L;  3GL1 A;  1H1V A;  4FO0 A;  2D0P A;  4IDH A;  4JD2 B;  2COP A;  1ACA A;  3N4Q A;  3TU5 A;  2D2Q A;  1XQS C;  3TSQ A;  5M1P A;  4AM6 A;  1MA9 B;  3OW2 M;  4FPA A;  2P9L B;  1YHQ N;  2D4W A;  2QWL A;  4YOU A;  2HBJ A;  5LY3 A;  1Q18 A;  1VQ4 N;  3QML A;  4RTF D;  5IJM A;  4IOA L;  1ST7 A;  1BDG A;  3T7Z A;  2F9W A;  5AFU A;  3IDH A;  1DEJ A;  3BF3 A;  2BTF A;  3C6A A;  2P9N A;  3U4L A;  3BEX A;  2HF4 A;  3I56 N;  4JHD B;  5JIC A;  3H6E A;  4B1V A;  4BRH A;  3Q7B A;  5AQP A;  5TKY A;  1RGI A;  1K9M O;  2EMS A;  2A40 A;  5C0Y A;  1XUP O;  4IZ9 A;  2GWJ A;  4WQ4 A;  3ZYY X;  3A5N C;  4M7X A;  3ZX0 A;  5BRE A;  1KAX A;  1YJW N;  4BRF A;  4KBO A;  1P90 A;  2F7T A;  4IEI A;  1QHA A;  1GLA G;  2WBN A;  4H0V B;  4ISF A;  2QA4 N;  2ZF5 O;  4CZE A;  2P9U B;  2HF3 A;  1ATN A;  4MLH A;  5M1O A;  4E1J A;  1QVF M;  3O8M A;  3MN5 A;  3UB5 A;  3VGL A;  1OVY A;  2QI2 A;  4U7B A;  2W40 A;  4EHT A;  1V4T A;  4IWV A;  1K8K A;  4YOW A;  3VTH A;  3C7N A;  1BA0 A;  4BC4 A;  3OBW A;  1Q82 O;  3HTV A;  4FVU A;  4BG8 A;  4QS8 A;  1MK7 B;  4EKU A;  5BRD A;  1DGK N;  1X3M A;  4MO5 A;  3HI0 A;  3KHY A;  4JEP A;  5AQZ A;  3R1X A;  3SBT A;  1QQO A;  1VAZ A;  1HKC A;  3T69 A;  3HOT A;  1X9J A;  4H0P A;  2Q2R A;  3B8A X;  2OAN A;  2RHK A;  3JS6 A;  3AAQ A;  3N4P A;  4PL7 A;  5F0X A;  3I55 N;  4WF9 L;  1X3N A;  2E1Y A;  1J19 A;  3EN9 A;  4ISE A;  3VER A;  3VEV A;  5ADX H;  4IO8 A;  3BF1 A;  4H5W A;  4YOT A;  2V52 B;  5AQY A;  1E5W A;  3K9K A;  4P7I A;  2HST A;  2OTJ N;  4XH1 A;  1HX1 A;  4BRK A;  2E20 A;  2YX6 A;  3UKU B;  1MIZ B;  3EKU A;  4CZI A;  5B8H A;  4CZL A;  3HRG A;  5KQD A;  1HPM A;  1HB8 A;  4DKW A;  1ILY A;  5AQX A;  3X23 A;  3AGR A;  1BOT O;  4FPB A;  5KPZ A;  4Y0W A;  1K8A O;  5AFU H;  4IEE A;  3KZB A;  3WUH A;  5BN9 A;  1YUW A;  4BR9 A;  1YIT N;  1VQM N;  5LJV A;  2P9P B;  5M1K A;  4A2B A;  2KHO A;  4WYB A;  2ZGY A;  1XC3 A;  3TSP A;  2E2N A;  2ZJP L;  1VQ9 N;  3PIP L;  3DLL L;  2YHW A;  3VEO A;  4IJN A;  3GOI A;  3RVC A;  3SMS A;  4A61 A;  3SAH A;  2A5X A;  1BG3 A;  3O80 A;  2OTL N;  3LDQ A;  3NMU A;  2A6A A;  4WQ4 C;  4F7G A;  3CC7 N;  4MO4 A;  3OA9 A;  1GLD G;  3CIP A;  3DXM B;  1VQL N;  2KLA A;  2X0S A;  3EO3 A;  4I6M A;  4H5V A;  3HZ6 A;  3H3O B;  2V51 B;  3EE8 A;  5C15 A;  2CQU A;  4K25 A;  3SMP A;  2HE7 A;  4FOE A;  5JVH L;  2D1K A;  2GTD A;  3KWG A;  3FZH A;  3TSU A;  3VF4 A;  4CZJ A;  1MDU B;  2CH6 A;  2JWK A;  4C23 A;  1NGD A;  3PIO L;  3MX2 A;  2P9I B;  4YOY A;  3MWP A;  1SS6 A;  3CXC M;  5C10 A;  2QM1 A;  4CZM A;  2D10 A;  4AM7 A;  2H3G X;  3ID6 A;  4CI6 A;  1V4S A;  3J8A A;  5C2F A;  1HUX A;  2ASO A;  3CCR N;  1C0F A;  2NRZ A;  1E4G T;  1D4X A;  1YJN N;  4K42 A;  4QS7 A;  3CCV N;  3FR0 A;  2I7N A;  2AL6 A;  2QWR A;  4EFH A;  4CD1 A;  5M1F A;  2NRX A;  3AGK A;  5F1X A;  2NRR A;  3PVL A;  3CJ9 A;  2DPN A;  4U67 L;  4ILJ A;  5MLC Q;  5AQL A;  2VGN A;  3LDN A;  4AF1 A;  1YAG A;  3VES A;  5BPN A;  3VPZ A;  4MDB A;  3D2E A;  3QBW A;  1QVG M;  2YJF A;  2QWN A;  2V7Z A;  3TTD A;  5ADX A;  2E1Z A;  1VBG A;  3LDL A;  3ENO A;  5AQO A;  4BGB A;  5HOO A;  3L4Q A;  3IFR A;  3CCJ N;  3CF5 L;  4JKA A;  4JK7 A;  1NGH A;  2IVO A;  3CPW M;  1QQN A;  2HOE A;  3VEN A;  2BH1 A;  2GWK A;  4CBU A;  3P39 A;  2RE2 A;  4DHY A;  3G71 N;  1GGO A;  2WUS A;  3HSC A;  4ISG A;  3RSE B;  1JDE A;  4NY0 A;  3CET A;  3E9P A;  1SGH A;  4JK9 A;  1W97 L;  5LJW A;  2FJ9 A;  3ZX2 A;  2IIR A;  3D2F A;  3CD6 N;  4WFN L;  4WFB L;  4FWQ A;  3LM9 A;  4BRM A;  4Z94 A;  1JCF A;  3VGM A;  1YXQ A;  1EF1 A;  4ILH A;  3KVG A;  5JVL A;  3U9Z A;  2P9K B;  1KAZ A;  4IOC L;  2A42 A;  3UKU A;  3O08 A;  3BP8 A;  1KC8 O;  3CJ7 A;  2E2P A;  4BRC A;  2I1K A;  3WT0 A;  4CD3 A;  3L4I A;  5I9E B;  4MDA A;  3QIJ A;  2D0O A;  2NRV A;  2CGK A;  1T44 A;  5FPD A;  4WFA L;  3ZET B;  3PLA A;  4BR7 A;  4XEI A;  5ELZ A;  4BRL A;  2CH5 A;  4H0T B;  3FZK A;  4BQL A;  1Z05 A;  2A41 A;  5H1S Q;  2QEX N;  1EO1 A;  2NZT A;  3TTC A;  5GAD P;  3R6M A;  4KH4 A;  5AQT A;  4C1N K;  4BR0 A;  2GUP A;  5BPL A;  1GG3 A;  3U8Z A;  1MWM A;  1J6Z A;  3FZF A;  3IMX A;  3R3L A;  3VOV A;  1Q81 O;  1KQS M;  1YI2 N;  5TKW A;  2NNW A;  3ZEU B;  3CC2 N;  3F5T A;  3CCS N;  3QB0 A;  5EY4 A;  2DIK A;  3UE5 A;  2NRH A;  2HBM A;  4BR4 A;  4CZF A;  3NVK A;  5F2R A;  4BRA A;  1TYQ B;  4IFE A;  5JLF A;  4ZRK A;  4B1U B;  5AQW A;  3DXM A;  2QW9 A;  1U6Z A;  3LL3 A;  4KH5 A;  2FSK A;  3WEE B;  3KWI A;  2HMP A;  3CCU N;  1GLE G;  1ZBS A;  1NTI A;  1QQM A;  4H0O A;  1MWK A;  5AZJ B;  4JKF A;  3CJ1 A;  1VBH A;  3CCM N;  3AY9 A;  3Q7C A;  3VTI A;  3DXK B;  1MK9 B;  1NJI O;  4NB4 A;  1WUA A;  3CQX A;  1VQ5 N;  1VQK N;  3P38 A;  3WXI A;  2ABD A;  3OBY A;  3TPQ A;  3H45 C;  5AQQ A;  4TKN A;  4B1Z A;  2PFU A;  1KD1 O;  4YL8 A;  3ID8 A;  1HBK A;  2WFB A;  3E1Y A;  3P4I A;  1HKG A;  4K41 A;  1NGG A;  1Z6R A;  3CER A;  2ZGZ A;  5EXW A;  1OKJ A;  3QIC A;  5JMV A;  4BVO A;  1M1K O;  1ESV A;  2GEL A;  2NRW A;  5BR9 A;  3PZD A;  3MK6 A;  4HTL A;  3IKM A;  2E2Q A;  2P9N B;  2VYP A;  3O1W A;  3O1B A;  2P9S A;  3F9M A;  3QDK A;  3FGU A;  4O8U A;  5E26 A;  5AQG A;  2PAV A;  5BRF A;  4B1W B;  2HBK A;  1U2V A;  2PBD A;  3I33 A;  2WH5 A;  4H03 B;  4NO7 A;  1JJ2 M;  1H4R A;  3UKR A;  4DB3 A;  3WA0 A;  4DCH A;  3LDP A;  4EHU A;  4JKE A;  1ISN A;  3VEZ A;  5KPT A;  4FWN A;  3AU4 A;  4OPA A;  2ZPY A;  3GDQ A;  3C0B A;  4JD2 A;  1R59 O;  5AQK A;  2IVN A;  2Q0U A;  2QWQ A;  4YOX A;  2WC9 A;  3AU5 A;  3U7D A;  2P9L A;  3D6R A;  4QS9 A;  5KQ8 A;  3MN6 A;  5AQU A;  3RSE A;  4OPH A;  1LCU A;  1Y64 A;  3MCA B;  3G4S N;  3AAR A;  3J7Z O;  4H5N A;  1K8K B;  1NVL A;  1VQO N;  4FWO A;  3C7N B;  4M7Y A;  4A57 A;  3GG4 A;  4EAH D;  2FF6 A;  2FLO A;  1SQK A;  4JKD A;  1NGJ A;  3EZW A;  4JHD A;  4XH4 A;  1BWF O;  1NGB A;  3DAW A;  5FPN A;  1YIJ N;  2ZWH A;  1CZA N;  1VQ6 N;  1T6D A;  2UYT A;  3C6H A;  4HWI A;  5GAG P;  3VEY A;  3ZET A;  5CE3 A;  3A0I X;  4WQ5 A;  2ASP A;  5AQF A;  5AQN A;  3SJH A;  4IO9 L;  1KC7 A;  2I1J A;  2P9U A;  4H0X B;  4FWP A;  1HB6 A;  1Y19 B;  3CJB A;  1S22 A;  3JXU A;  4IJA A;  5AQH A;  1DKG D;  3WQT A;  2W41 A;  4FWS A;  3SLC A;  1SAZ A;  3P31 A;  4JKH A;  4BC5 A;  4BR5 A;  2D11 A;  4XH5 A;  3ATV A;  4LC9 B;  1NLV A;  4A5B A;  3ENB A;  4BY9 C;  5DM6 L;  2YJE A;  3OHR A;  3MMV A;  4YOR A;  3M6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...