3ENBA

Crystal structure of prp8 core domain iv
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
219
Chain Sequence
LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural elucidation of a PRP8 core domain from the heart of the spliceosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Pre-mRNA-processing-splicing factor 8
total genus 62
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3enbA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3enbA01
4JKBA 4JKFA 4ILHA 3SBGA 4JK9A 4JK8A 3ENBA 4JKGA 4JK7A 4JKGB 4JKCA 4JKDA 4JKHA 4ILGB 3SBTA 4JKAA 4ILJA 3E66A 3E9PA 4JKEA 3E9OA 3E9LA
chains in the Genus database with same CATH superfamily
3EKUA 1VRUA 3GG4A 5CYQA 5E26A 5AFUH 1MDUB 3V1OA 1S6QA 5EY4A 2P9NA 1IKWA 4C8LA 5I9EB 3NH1A 2W42A 1VSMA 2UYTA 3ZT3A 4FJXA 1XMOK 4FW1A 3P83D 4M3RA 5T7BA 1EXQA 3ID8A 3BF3A 4FLUA 4F9OA 3MMVA 1CXUA 4JHDA 3KZBA 4YY3K 1VSDA 1FJGK 4YOXA 4N47A 4JKBA 3CFRA 4JN4A 3TAGA 4FJIA 1SKRA 4DV1K 4CJRA 4DWIA 1X9SA 3SQ1A 3SAGA 3EE9A 5EXWA 4F2SA 3C6HA 3P4IA 3HJFA 3NHGA 3VF2A 3MECA 3VQPA 3IUCA 4KI4A 2E2PA 1RT2A 1TAUA 2BH1A 2QTDA 5CZ1A 4CF2A 4JK9A 3VQ7A 2GV9A 4NO7A 3ZSRA 3K5MA 3ZSXA 2FSKA 3LM2A 4JKDA 4GKKK 1C0MA 1NGEA 2D1KA 3ZT1A 1OH5A 2WC9A 3J8AA 3U4LA 4JI8K 4XIUA 2Z1IA 1BA0A 4PA1A 4FLWA 1NK9A 3OY9A 3VQ5A 3AAQA 3C94A 3OYMA 3AA3A 3ZSWA 4DV7K 1TUUA 1J5OA 1ASVA 3R6MA 3RMAA 3LP3A 1NK7A 5MLCQ 5F1XA 1S1XA 3U3GA 1JL1A 3VQEA 1Q81O 3VA3A 4KHWA 3O3FA 3AGKA 1X3MA 4DUZK 3THYA 1GOBA 4FVMA 1GLLO 2OPSA 4CJQA 4DS5A 4M42A 4LFCK 3U7DA 4O8KA 1QZ6A 3L2VA 1BO5O 1KQSM 3UKRB 2IAJA 1U49A 1L3SA 1QSLA 2O8DB 3I33A 4NXMK 4JKFA 3VGKA 3FE1A 5BPNA 3HK2A 1DLOA 3RMBA 5HROA 4HUGA 3E01A 1WBDA 4CF8A 4QS8A 3F2KA 2QI2A 3TSQA 1NU0A 4ZRIA 1JXBA 2I7NA 2IOCA 1SKWA 3K0SA 4RG8A 5JVHL 3WXIA 2X6SA 4DV6K 1KSPA 3HVRA 1WSIA 1S1UA 1KLNA 3DXMA 2VGMA 2GWJA 3O3GA 1JXEA 3SAHA 1KFDA 1SAZA 4M3XA 2CGKA 3CFPA 2QEXN 2E4LA 1Q9XA 4FJGA 4FJLA 3FP5A 4IJAA 1XC3A 2E20A 4CI6A 4DFMA 4CGFA 3QETA 4NCGA 1JCEA 1MIZB 1T3VA 4E19A 2CGLA 5M1NA 3D2EA 4E7HA 1RTDA 4ELTA 4CIEA 5FPNA 1VQ4N 4NYNA 2QWPA 2YHWA 3JAMO 4BC4A 3ENOA 1Q8IA 3JSMA 3OVNA 4JRPA 3O6WA 3VEZA 2VYPA 3MEEA 1ZBLA 3SQ0A 3CMAN 4CHQA 4BRLA 1N5YA 4RTFD 4F7GA 3WQUA 3RSEA 4C1NK 1TGOA 4DFJA 3ZSZA 3SUPA 4FZYA 3G10A 3HYFA 4CGHA 4B3RK 4CIGA 1TKZA 3AVCA 3RR8A 4LF8K 1WUAA 3TWHA 5EX5A 4K42A 1NWKA 5GIPA 4BDYA 2YHYA 5AQLA 3U8ZA 1BIZA 3P39A 1U2VB 2A40A 5J2MA 3AVFA 3MN7A 2O8EB 4CZJA 3OYDA 2FBXA 4FLTA 2E2OA 1HQEA 3SMPA 1YUWA 3ZYYX 4E7JA 4FJ8A 1OVYA 1HQUA 3LP1A 1YJNN 4NCBA 3JS6A 4Q5VA 5HOOA 1BHLA 4AQYK 2J4RA 4Z4CA 1J9AA 4OLAA 2E2NA 1TK5A 1YVNA 3DXMB 3PZDA 5F0XA 4MFBA 1RDWX 4CK3A 4WCEL 3QBWA 4IO9L 2GBZA 2GELA 4CE9A 4CFBA 1N8RO 4J8FA 3THYB 4G9ZA 1TL1A 1D9FA 3O1BA 5LL6Z 3O5BA 1U47A 3WXKA 4AHVA 4WF9L 1NJZA 1KAZA 3CM5A 2GTDA 4IG3A 3OJUA 2UU9K 2E5LK 3UE5A 2WONA 4DR6K 5J2QA 3TSPA 3JXUA 4BRQA 4CHNA 3QESA 1KVCA 4IOXA 1O1WA 3OYHA 3PY8A 3FR0A 1I39A 4WQ5C 5M1FA 3I0RA 1X9JA 4CF9A 4LF6K 3G71N 4PWDA 5AQSA 2W6KA 2Q31A 4GKJK 3CCMN 5I42A 4KAZA 5AQUA 2KTQA 3WNEA 3EEQA 3G25A 1KCFA 3G4SN 3ULDA 2F8SA 3D0PA 3D7EO 1K6YA 5AQXA 5CE3A 1CZBA 1EETA 1G15A 3HM8A 4B9MA 4DF4A 4IOCL 4Z4GA 1VQNN 4KHYA 3AA5X 1VK0A 2KFNA 4CZIA 1LOTB 3NFAA 3HPGA 2X74A 1TKDA 1HPMA 1QQNA 3A2FA 2ZJQL 3HO1A 1K9MO 1DT9A 3CIPA 3CC7N 4B8AB 2ZD1A 1EKEA 2ABDA 5AQTA 2IGIA 3HI0A 2P9IB 3ZETB 3EO3A 5KPRA 3GDQA 4KPYA 4KTZA 4BREA 1TV6A 3T1HK 3LDNA 3NF8A 1MIXA 4E89A 5IT9O 1NJXA 1C0FA 1ATRA 1J19A 4MDAA 3KLHA 3PLAA 3DMJA 1VSHA 3CJ7A 1SL1A 1RT3A 4A59A 3V9SA 4MLHA 5LJVA 3WEEA 1YITN 2P9UB 5AQHA 3U8XA 3TAQA 4IKFA 5J2NA 4AHTA 1FW6A 2P9LA 5AQZA 4LF7K 1WNSA 4CBUA 2HW3A 3KD5E 3S3MA 5BN9A 4B1WB 3BY5A 3VESA 2Z1HA 3C6TA 1IJJA 1JKHA 4BROA 5AQJA 4DS4A 4JNEA 1I94K 4F3TA 4DSIA 3O9RA 3W0LA 2NZTA 4EZ9A 4A5BA 5KQDA 2AEHA 2ZGYA 2V7YA 3AVJA 2DPNA 4YHHK 5HLFA 3MXIA 4M3WA 1ZBUA 4KFBA 2IIRA 4DTNA 4BC3A 1N34K 1IO2A 2O8FB 1D4XA 3CQ8A 4FW2A 3ULEB 1Y97A 2YNHA 3RRHA 3QEPA 3E1YA 4ILHA 2EX3A 1NTIA 5B8HA 4LF4K 1WSEA 1HNIA 4B9VA 4LSLA 2CQUA 4FK4A 1WOQA 4H0OA 1DKGD 3CQXA 4FWOA 1HR0K 4UY8O 2P9PB 3AVLA 5AQOA 3O4WA 2F9WA 3OS0A 4IFVA 1QHAA 1WLJA 2Q2RA 1QS4A 4Y0WA 3MN6A 1LV5A 4DTUA 2YV0X 4A5AA 5DM6L 5GIOA 5JICA 4GMJB 3HBTA 4U67L 4DQPA 3FLCO 5C10A 4B3MK 3H1QA 3AVMA 3MN5A 3T3FA 1WBBA 4KHQA 1XNRK 3AGRA 1VQLN 4DU3A 2FLOA 4CHZA 1E4FT 1UOCA 5CZ2A 1QHTA 2GEMA 3CI5A 5AQVA 1UWBA 4FLZA 2NRWA 2RE2A 3F9KA 2VWBA 3SPYA 4DV4K 3VQBA 1BGXT 1HMVA 2R7YA 4CGJA 1VSFA 1JLGA 4OGCA 3PX0A 1TL3A 3AVAA 1HLUA 1KBLA 1HKCA 3ZEUA 1NGBA 4CEAA 5ADXH 1JJ2M 1Q9YA 3D45A 3U6FA 2RF2A 2FF3B 3V6DA 3CQYA 3BP8A 3L4QA 4OGEA 4H4MA 2FSNA 5AQGA 4EZ6A 5BRHA 3W3DA 5FRNA 1KD1O 4P7IA 1ACAA 4O8UA 4C1NI 1S1WA 4FK0A 3M3ZA 3ENHA 2F8TA 4A2AA 1BI4A 2NRXA 4E3SA 3V9WA 4F8RA 4AHUA 2A41A 5KRTA 2YX6A 3DI6A 1ATNA 5ELZA 5M1PA 3V4IA 4XH1A 4N76A 4FJMA 3Q7CA 4E7IA 1HKBA 4YDUC 5C2DA 1QVGM 5GAEP 1NNEA 4PL8A 4KB0A 4JK7A 4YOUA 2ZJRL 3QEIA 3O8MA 3UIQA 2O4IA 3IFRA 4CZMA 2NRRA 4FZZA 3FFKB 4O0JA 4CEZA 1S9EA 1EF1A 3KIOA 4KO0A 4EFHA 4KHPK 3RMCA 3HSCA 3H46O 1ESVA 4Z0UA 1N6QA 3UB5A 4IOAL 4ILJA 2ITGA 3OYEA 2NUBA 4CERA 1XI1A 4V19S 3DLBA 1RILA 4BRDA 3F9MA 4M3TA 2O8DA 1I3AA 4CZKA 1K8KB 4FJKA 1NGIA 1RGIA 4BQLA 4FJ5A 1LAVA 3J7YP 2P9UA 4E1MA 3VQ8A 1HJRA 1X9MA 1U04A 5A2QO 1NK0A 1C1AA 1QSSA 2COPA 4DTJA 4EAHD 4IDKA 4HUEA 3K5NA 5LY3A 4JI3K 3J7ZO 5HRRA 4HCCA 4JS4A 4QAGA 4GY2B 2B6AA 2QWNA 1JL2A 5SWMA 3QERA 4E7KA 4N5SA 3M8SA 4H4OA 1MU2A 1M90O 4FK2A 3SZ2A 4DSJA 3HZ6A 3OJSA 2V7ZA 2WH5A 1NMDA 2VQFK 1RT1A 1Q7YO 3IAYA 1BL3A 4BDPA 2P9SA 4CK2A 4CGIA 4CVNE 2DFEA 4JEPA 3NE6A 1ITGA 1VQON 1RTJA 1IG9A 4OO1J 5C25A 4AH9A 5BR9A 3IG1A 3RWUA 3DLRA 1BCMA 1NGFA 3K59A 1QSYA 2ZWHA 2KFZA 3GE1A 3KKSA 4B8CA 5GADP 2ASMA 4DR3K 2J0JA 4BC5A 1DTTA 1EP4A 4BE1A 3QEWA 4CIFA 1MK7B 4BR5A 2KKZA 1S1VA 1D5AA 4OPAA 1T05A 3PSIA 5AZIB 1KVAA 4H0YB 3RR7A 3TAPA 1XC9A 1HKGA 1Q86O 1LCUA 2CB8A 3N4PA 3LWLA 3ZSQA 4CD1A 3HM9A 3KLIA 3SBGA 4WQ4A 2ZGZA 4LH4A 4DR7K 3H3OB 4B9SA 5EOYA 4CBWA 2EWSA 2QKBA 3HTVA 1BIUA 1SUQA 4K8ZA 4I9QA 4CZEA 1TYQB 1VQ7N 3NDKA 2OYQA 3QIJA 1NJWA 1C0UA 3VGLA 4U7BA 3CJAA 4H5TA 4CJUA 1LWFA 3VQ9A 3ASMA 3DLEA 2E6MA 3HP9A 4H8KA 4IWVA 3AO2A 4EHUA 2UXCK 3TAMA 1SV5A 1BWFO 3BGRA 1KFSA 1RT6A 1QQCA 3O9TA 3N4QA 4I7FA 4M3UA 2JGUA 3K2PA 5C24A 4LFBK 4BRKA 5FROA 4DV0K 1L3UA 5AQRA 2HF3A 2HSTA 4BR0A 3D2FB 1RBRA 2F7TA 4FSVA 4CCHA 3CHWA 1Z26A 1LWEA 3DRRA 1YVUA 3HSTB 2Q0RA 1KC8O 1NG9A 1GGOA 2PBDA 2D0CA 4O0IA 3LZJA 2YNGA 1GLBG 1C1CA 3CCQN 3M8PA 4DTRA 1RBTA 4N41A 2OPQA 3V1QA 1S22A 4DQQA 3AV9A 1FK9A 4JKEA 1NVLA 3O9QA 3DOLA 3ULEA 4CEDA 3VF6A 1VQ5N 3ALYA 3DLKA 4JYAK 4KRFA 2BGGA 5GINA 3ISNC 5AJ3K 5M1OA 4B9LA 3KTQA 5TKYA 3BUZB 3ITHA 1FKPA 2QXLA 3K58A 3FGUA 2IDOA 4WFNL 4YFUA 1EWQA 1XUPO 4KTQA 1F21A 4ISFA 1UA1A 1QQOA 2JWKA 3QB0A 3VQDA 2HBKA 4FJNA 5M1QA 5C12A 3OS2A 5J1EA 4J2BA 1NGAA 4FWMA 4B1YB 1IKXA 3MAQA 1D9DA 4AILC 2BANA 4DV2K 4DV3K 4BR2A 3H3NO 3AVGA 4CZFA 3PIPL 4H5NA 3QNOA 4FJJA 2YVCA 2UUBK 1BQMA 1JLEA 1UA0A 1ZYQA 3LAKA 4LF9K 1S9GA 3CPEA 2HNDA 1HB8A 4M45A 3ID6A 4FO0A 3SLCA 2RN2A 1GOCA 5ADXA 2KW4A 2ZJPL 3ZDTA 4YDUA 4BWJA 3ZX0A 1XHXA 4IO8A 5FPDA 4DTXA 1DEJA 1YXQA 4CF1A 3SCXA 1IBKK 1JCFA 1HNXK 3K57A 2VCPA 2OTLN 4FPBA 4C8OA 4EKUA 3M6GA 4K8XA 3SV3A 2VG7A 3LPTA 4NYFA 3ZT2A 3T7ZA 3GBTA 3UKUB 3H45C 4A2BA 4RWTA 2KLAA 5AQQA 4CEBA 2QWRA 4GV9A 4FCYA 3OW2M 4KBOA 2AA4A 5DM7L 1G99A 2PFUA 4B9QA 4CYEA 1T03A 1EX4A 2P5GA 3SK3A 1FKOA 4HTLA 3MWTA 3VGMA 4X65K 4HDOA 2JLEA 4KB1A 1KXPA 2O8FA 3NF9A 2NRZA 3PO4A 2KZZA 2AL6A 4GVEA 4I2PA 3O3HA 3VERA 4LD0A 3O4NA 2HHVA 4QOZB 4AF1A 4WYBA 1HB6A 4HDQA 2AP1A 4DSEA 4B9NA 3CMEN 3E9PA 3QBXA 1H1VA 2XY5A 3M5RA 4IZ9A 5AR0A 1ZBSA 4DR1K 2O8CB 3QEVA 4BE2A 1SQKA 4DSFA 5C2FA 1C1BA 1ZC6A 1GLDG 2CH6A 4CJPA 1SL0A 1NKEA 1TAQA 4O5BA 4ILGB 2QA4N 4M3YA 1ASUA 4JI1K 4O55A 2H3GX 2P9LB 1NBWA 3BDPA 1J54A 1ZXOA 2G8FA 2VG6A 3HT3A 3LWMA 1NM1A 3CF5L 3JYTA 4FWRA 1VSJA 3AVBA 3OYIA 2B5JA 3TAFA 3U3YA 4CJWA 3DRPA 1RFQA 5IWAK 1VHXA 4CZGA 1VRTA 3KK1A 1TK0A 4DXAB 4KH4A 4H0XB 4DV5K 3FZHA 4CFDA 1OH8A 4HUFA 4ICLA 1KTQA 5JVGL 2I7PA 3LL3A 1XHZA 1YF5L 4CJEA 1NLVA 2IS3A 1MK9B 2IVPA 3SJJA 2Y1JA 2CGJA 4DR2K 1U48A 5FLXO 2DTUA 1TKXA 4DR4K 5TKWA 4FOIA 2ZF5O 3KK3A 3WA0A 1BDGA 2I1JA 3F73A 4KHNA 1UAXA 4JS5A 4L3QA 3DJCA 5AQKA 3RRGA 1ZBHA 1W9HA 3HP6A 1RBUA 3NH2A 4YOTA 3OYBA 1B9FA 1IG8A 3NH0A 2HHTA 5LMNK 3MCAB 3TTCA 5SZTA 3CCRN 3ZSYA 4DMNA 3LZIA 3AY9A 4X66K 3AVHA 5LMUK 2OA8A 1HJOA 3S3OA 3CM6A 3TPQA 1RTHA 3A5LC 4JI5K 2D11A 2HE7A 4CEFA 2FC0A 3L2RA 1NKCA 5JLFA 4B9TA 4CJVA 4C8KA 4DTPA 1E4GT 2VWKA 3QFPA 1MA9B 2Q3SA 4W5TA 1YHQN 4Y1DA 3IKMA 1VQPN 4E1JA 2YHAA 2V52B 2YI1A 2UUCK 2XY8A 2P5OA 4ZTJA 4BG8A 4IFEA 5JS1A 1Y19B 5I3UA 1EO1A 3VEVA 3NF7A 5BREA 4BR4A 1IKYA 1T8EA 2HHXA 3CC2N 2RQ1A 1GLJO 2Q1NA 2ZQBA 3WT0A 4B1VA 2EHGA 1DGKN 1YIJN 4X62K 1NOZA 1DIKA 5CHIA 1E3MA 3C7NA 3AA2A 4BWMA 3THWB 4RW8A 4DB3A 3PV8A 4MO4A 1SGHA 4QS7A 4XH5A 4CFAA 4JI6K 2XY6A 1YJWN 2LBBA 1ZBFA 4OKEA 1B92A 1A5VA 4F3OA 3V81A 1VQ6N 2XRIA 3TU5A 1KAXA 5EU7A 3OYCA 2D4WA 4BRPA 4CF0A 5E84A 4FLXA 1QZ5A 3HPHA 1VQ9N 1RDUA 3AO3A 4NLCA 2D10A 2E1ZA 3FZMA 4H5WA 3P1GA 2RHKA 1ASWA 1GOAA 1A5WA 3AO1A 3CJ1A 2KHOA 3CCEN 1J6ZA 2NRVA 2DY4A 1J5EK 1XMQK 1XQSC 4H5RA 4H0PA 4ID1A 2Y1IA 4PKHA 1NOYA 3SPZA 1GG3A 3QFUA 4B1UB 1BI4B 4RW6A 1S5JA 1C0GA 5AZIA 3FLVA 4OPHA 1X9WA 1U2VA 1ILYA 4ID5A 3S3NA 4IEIA 2HHUA 4MQ3A 4B3OA 3H08A 4OJRA 1LWCA 3OYAA 3C7NB 1R0AA 1NGGA 4MDBA 4KTWA 1NI2A 4KI6A 3BF1A 5C15A 2VGNA 3LDSA 1S72N 3LANA 1BU6O 4BRGA 1IKVA 5KPTA 2P9SB 1Z25A 4KHSA 3E9OA 4AHRA 2B4JA 3WQTA 3HXMA 2P51A 3HOSA 2QW9A 4GV6A 3CXCM 3BEXA 5K14A 1NMNA 3OA9A 2E88A 2X6NA 5HBMA 3A8YA 5KGWA 3FZFA 4M7YA 4IJNA 4YL8A 3CJ9A 3K5LA 3NBPA 3UKRA 1TYQA 1Y64A 3QMLA 3E9LA 3RSEB 4CGGA 1T44A 2NRTA 3QINA 1NKBA 4FJ9A 4A61A 5EVZA 4BC2A 2O8EA 1U45A 2NRHA 4CHOA 1RDCA 4NCAA 3MN9A 5JLHA 5JVLA 3EZWA 4DSLA 2QWLA 4CJSA 5AZJA 3BINA 1BOTO 1RTIA 1E5WA 3VMFB 2DFHA 4FLYA 1W7AA 3MCPA 2HNZA 3NGYA 2Q0UA 4CJLA 4LC9B 4XH4A 4DSKA 4JKHA 3KLEA 1L5UA 3VEWA 5AQYA 1K8AO 4CJTA 1W0HA 3DXKB 4NLBA 3HVTA 5H1SQ 3CPWM 1C6VA 3L3UA 2D5RA 3FZKA 5CY4A 4CBXA 2HMIA 1WSHA 2A3ZA 1FXXA 2ASPA 3ZCMA 2VG5A 1R59O 4DKWA 5FPEA 4X64K 1H4RA 2YCHA 3ENBA 2YNIA 4DCHA 1N32K 3NGIA 3HPOA 3ZLJA 3BZKA 1VQMN 4L8RB 3THXA 4W5OA 3O80A 3MEDA 3NCIA 5GAGP 4QS9A 4HVJA 2GUIA 1NGDA 3K9JA 3CG7A 3AVKA 1ST7A 3TTFA 3AAPA 4YNQA 2YJEA 4A62A 3IDHA 3CYMA 1HYSA 1WN7A 1HNZK 3ZEUB 3FZLA 4DUYK 4G1QA 1K8KA 4JI2K 1Q18A 4YOYA 1JCGA 5AQPA 4PY5A 3A5OC 3LDPA 4BRCA 5HRPA 1RBSA 4AHCA 3OTOK 1JLBA 5AQWA 2GX9A 2NLXA 5AQFA 3QDKA 3VQAA 1QVFM 1YT3A 5F2RA 1S3XA 4CJ5A 3DM2A 3X23A 2J0MA 2P9PA 4KH5A 4E1NA 3QNNA 3L4IA 3AVNA 1SZ2A 4C8NA 1EWRA 4W5RA 3V9UA 1L3VA 4JK8A 1NJYA 4HCBA 4WE1A 1J53A 4JLHA 2UXBK 4HHTA 3MDQA 1VBGA 4I6MB 1K73O 4FLVA 4N56A 5AFUA 2E6LA 3O4QA 1YJ9N 4Z4IA 5E41A 3T1YK 4BE0A 2HHSA 2YHXA 3SUQA 3WXJA 4FZXC 3OYGA 1TVRA 4IBNA 3PVLA 1BCOA 5J2PA 5AQNA 1ATSA 2PAVA 3IRXA 4NY0A 2HVHA 2Q36A 1P90A 1VAZA 3O9SA 3R8EA 4BY9C 1HNVA 3C0BA 4O4GA 3HRGA 3MXMA 2I1KA 4CJ4A 1WSJA 2HVIA 1WSFA 4Z4FA 4JRQA 4DF8A 4ZRJA 2YKMA 3CERA 4MLEA 4PUOA 4Q0BA 1CXQA 5AZJB 4BRHA 4I6MA 3MXJA 4H03B 4FVUA 3HOTA 3LPUA 3L2WA 2JWLA 1DTQA 2AJQA 4GV3A 3SJHA 1B9DA 3EN9A 5BPLA 4M41A 3PIOL 1P8ZA 1T6DA 1N33K 4O5FA 2W40A 4JKGA 1SS6A 1M1KO 4JI0K 1REVA 3PX6A 4FYDA 1WAFA 2OZSA 1V4SA 1OH7A 1HNWK 3D6RA 1BG3A 4CEEA 4F2RA 3AU5A 3IVFA 1YTUA 2BE2A 4CEQA 2O8BA 4IDHA 4BRMA 3AARA 3IMXA 1KRPA 2E8AA 3MK6A 4BVPA 5LJWA 4EP5A 4CEOA 3VQ4A 5KQ8A 2P9IA 3ZETA 4H0VB 3I56N 3DAWA 3V9ZA 2W6LA 2ZE2A 4OLBA 4BACA 4JAXA 4BDZA 3L6QA 3OYFA 3DYAA 5FDLA 4QCLA 3M8QA 1YI2N 4DHYA 1U4BA 4DQIA 4CJFA 2D0PA 3J81O 1U6ZA 3QEXA 1Z05A 3LALA 4BR9A 3T69A 4C8MA 1GLEG 3EL2A 5KGXA 3KLFA 2ETJA 1NK8A 3KD1E 3L2UA 1QTMA 3ZX2A 3E66A 1WAJA 4DG1A 3PUFA 4K25A 1RT7A 2HF4A 4B9UA 2QM1A 2VWJA 4GW6A 2OZMA 3QIOA 4JD2B 3SUNA 3LP2A 3VEXA 3SUOA 1RBVA 1TUYA 1EQYA 5JS2A 4JV5K 1XWLA 2F96A 3DOKA 4GVMA 3WUHA 3LP0A 4YORA 1RNHA 1GLAG 4ELUA 4KV8A 2PY5A 4E0DA 1KC7A 1KAYA 4FWQA 3PSFA 4DFKA 1C0TA 4BR7A 4FXDA 4PQUA 2P1JA 1GC6A 4A57A 2O4GA 2VQEK 4HTUA 3ATVA 1S1TA 4BGAA 4BRAA 2HBJA 4W5NA 3KWGA 4E7LA 2GWKA 4OX9K 1LW0A 3ZT4A 3THWA 1OVQA 2QWMA 3I8DA 1T7PA 2E2QA 3I0SA 5KTQA 1V4TA 3WXLA 3K5OA 3SNNA 1LW2A 4IG0A 4AM6A 4J2DA 1HYZA 3CJCA 1NJIO 4CHYA 1JDEA 1YAGA 3CJBA 2X0SA 2DIKA 4GXBA 1NGHA 3LDQA 4RW4A 3MX2A 4CJKA 1A5XA 3WXMB 2G8HA 2QWOA 3L0QA 4YOWA 3KJVA 2G8VA 3G6EN 1BQNA 3EZ5A 4CGDA 4W5QA 3V9XA 4LFAK 1VSEA 4BVOA 3EPYA 3SBTA 4CJ7A 3OYKA 4O44A 3TAEA 1L3TA 1IBMK 3WNHA 3THVA 3SMSA 2NNWA 1YTAA 4FM0A 5C0YA 3PO5A 4H5VA 5JMVA 4I9LA 4FJHA 1GLCG 2YKNA 5GAHP 2FDQA 2HOEA 2DFFA 4DU1A 4EP4A 2YHBA 3QLHA 1RDBA 4H0TB 3OHRA 2OPRA 1T6CA 4WFBL 2BDPA 1OKJA 3DLHA 1IH7A 2YJFA 3VN5A 5BPMA 4ELVA 3SV4A 3FFIA 4Z4HA 4FPAA 2CH5A 1LAWA 3D2FA 2QKKA 3EYZA 2UUAK 3OBWA 2QXFA 3MEGA 3G0ZA 3EE8A 3VF4A 3C6UA 1JLFA 4R5PA 2F9TA 4OPKA 3AU4A 3CFOA 3G9WA 2HHHK 3OBYA 1CLQA 3M1FA 4B08A 1JLAA 4TSXA 3DLGA 1HPZA 4FWPA 4JI4K 4UQGA 3OYLA 3OYNA 2IVOA 2EMTA 4IEEA 4B1ZA 2Q97A 3B6PA 4ZHRA 3CCUN 2HRJA 4DLGA 2D2QA 2FXUA 4KKOA 4CW7B 3I55N 2X78A 2HBMA 3EY1A 3MWPA 2G8KA 4FL9A 1RCHA 2LSNA 3KLGA 4KHUA 4KH6A 1GC7A 4IXCA 1QE1A 4WFAL 4B3SK 1VQKN 4BRFA 4JI7K 2WTUA 3VPZA 2OANA 2ZPYA 1X3NA 3J80O 3A0IX 4CJ3A 3THXB 4OKKA 3ATUA 3QIPA 4Y1CA 3R1XA 1RDDA 5CYMA 1WB9A 2D0AA 3K9KA 5HRNA 2W41A 4OKJA 2R82A 3V1RA 2ZM6K 4BRIA 1VSKA 4F4KA 3P5JA 2HMPA 3ZX3A 3SAFA 4PHTX 4ZTFA 4DFPA 2XO7A 3S9HA 3SQ2A 4CZLA 4Z4EA 4C23A 4I2QA 1S6PA 4CECA 4MO5A 4IFYA 5DMRA 2Z1JA 1KLMA 1HX1A 1VQ8N 2G8WA 5BRFA 2E1YA 4CHPA 1TKTA 3VTIA 2G8IA 5AQMA 4R79A 3M8RA 2FBTA 1W2BM 3Q7BA 4DQRA 5KPZA 3CETA 3KK2A 5HP1A 3LAMA 2I5JA 2V51B 2A1SA 5CR4A 4Z94A 3NF6A 4LF5K 3TSUA 3TR8A 4DQSA 3NAEA 1HRHA 3KVGA 4NB4A 1X1PA 2KQ2A 3C6AA 3I8BA 2FF6A 3RMDA 3L2QA 1WSGA 4FM1A 3TARA 4ZRKA 1NK4A 2QWQA 3CC4N 2HNYA 1IV0A 2P9NB 4K43A 4PKIA 3CCLN 4J2EA 3VENA 2D0BA 1GLFO 3VQ6A 1NGJA 2PYJA 3CCSN 1BUPA 4M63C 5BR8K 4ISGA 4FM2A 4YOVA 3NMUA 4K0KK 5D3GA 4JKAA 4BGBA 2YNFA 3PX4A 1W97L 1KVBA 2OPPA 3QICA 2G8UA 3CD6N 1CZAN 3J7AP 4J2AA 3B8AX 3AVIA 2HBLA 4FOEA 5HRSA 3TTDA 3TABA 4RW7A 1JLQA 5FRMA 3VA0A 2BTFA 1MWMA 4CD3A 4AHSA 4XEIA 1VSLA 2PZSA 2WOMA 3C65A 5FPMA 3A5NC 3TI0A 3WNGA 2FJ9A 3L8BA 5BN8A 3AO4A 5AQIA 4RW9A 4DQ8A 3L3VA 4CZHA 4WQ4C 1BA1A 3GOIA 4NXNK 3RVCA 4B3TK 1VBHA 1NGCA 3DRSA 4ISEA 4K41A 1BISA 4CESA 2HHQA 1VSIA 1Q82O 3LM9A 4DU4A 3CCJN 3SQ4A 4LSNA 1SL2A 2QK9A 1JLCA 3B6OA 2F4VK 3BZCA 1N36K 3VOVA 1OH6A 2FBYA 5DK5A 3VTHA 1RT4A 2FSJA 3O08A 3ZT0A 4JD2A 4JHDB 4JKGB 1NK6A 2HHWA 1IBLK 2WBNA 4JKCA 3VEOA 2IVNA 2ASOA 3HL8A 3WEEB 5KRSA 1RT5A 2HB5A 4FWSA 4EHTA 4LY7A 2IC3A 2P9KA 3R3LA 3P38A 3OYJA 3QO9A 2A42A 2WUSA 2PYLA 1SKSA 2UXDK 3MX5A 3OS1A 1XNQK 3H1VX 2O8BB 4EIAA 4FWKA 4RCHA 3TANA 1O13A 1MWKA 1Z6RA 2OCEA 2RKIA 3O1WA 3CCVN 3R9PA 4DR5K 2XHBA 4HWIA 3S41A 2ATQA 4WQ5A 3ZSVA 4PKGA 3VETA 2EMSA 4FWNA 4TKNA 4BRNA 4M3ZA 5M1KA 3A5MC 4FWLA 2ITMA 1TK8A 3RTVA 4OVLA 2A1RA 3LDOA 1CZ9A 2P9KB 4DTSA 5C42A 1ZBIA 3P31A 1HYVA 2XY7A 2O8CA 2A6AA 3U9ZA 1ISNA 3O9UA 2D0OA 3SI6A 3T19A 3NGZA 4GNIA 3UKUA 2J0KA 2Z1GA 5IJMA 2RPIA 3KWIA 4BG9A 3DLLL 4M7XA 4DTMA 3ZSOA 3U9DA 3SYZA 4CFCA 4DLEA 2WFBA 1RDAA 3F5TA 3H6EA 4BQZA 1HUXA 5BRDA 3D2EB 4CK1A 2GUPA 2OTJN 3KKRA 3VEYA 4B1XB 4PL7A 3EKSA 2KZMA 4AM7A 1D8YA 1HBKA 4OPJA 2BUPA 3NVKA 4DTOA 3KHYA 3DWLA 3T1AA 3NVMA 3C95A 1QQMA 3IS9A 4FJ7A 3LDLA 3GL1A 3KK7A 3DXKA 3VQCA 2FBVA 4LH5A 3WNFA 3AA4A 1NK5A 5HL7L 2A5XA 5KI6A 3VQQA 4KREA 3AO5A
chains in the Genus database with same CATH topology
4JD2B 3EKUA 2NRWA 2RE2A 1BDGA 3GG4A 5E26A 3VEXA 2I1JA 2VWBA 5AFUH 1MDUB 5EY4A 1TUYA 1EQYA 2P9NA 3WUHA 4L3QA 3DJCA 4YORA 5AQKA 5I9EB 1GLAG 2UYTA 1HLUA 1KBLA 1KC7A 1KAYA 4FWQA 1HKCA 3ID8A 3ZEUA 1NGBA 3BF3A 4YOTA 4BR7A 4F9OA 5ADXH 1GC6A 1JJ2M 3MMVA 4A57A 4JHDA 3KZBA 1IG8A 2FF3B 3CQYA 3BP8A 3ATVA 4YOXA 3L4QA 4JKBA 4BGAA 4BRAA 3MCAB 2HBJA 2FSNA 5AQGA 3TTCA 3CCRN 3KWGA 5BRHA 3W3DA 2GWKA 4JN4A 3AY9A 4P7IA 1KD1O 1ACAA 4O8UA 4C1NI 1HJOA 3ENHA 3M3ZA 2QWMA 3TPQA 3A5LC 4A2AA 2E2QA 2D11A 2HE7A 2NRXA 5JLFA 1V4TA 3WXLA 4AM6A 3SAGA 1E4GT 2A41A 3CJCA 3EE9A 1NJIO 5EXWA 3C6HA 3P4IA 3QFPA 2YX6A 1ATNA 5ELZA 1JDEA 1MA9B 5M1PA 3VF2A 1YAGA 3CJBA 3IUCA 2X0SA 1YHQN 2DIKA 4GXBA 2E2PA 3IKMA 1NGHA 3Q7CA 4XH1A 1VQPN 4E1JA 2BH1A 3LDQA 1HKBA 3MX2A 4YDUC 3DLLL 2QTDA 2V52B 5C2DA 5GAEP 1QVGM 3WXMB 2YI1A 4JK9A 2QWOA 4PL8A 3L0QA 4YOWA 4JK7A 4YOUA 2ZJRL 3O8MA 4NO7A 4BG8A 4IFEA 3IFRA 3G6EN 4CZMA 2FSKA 3LM2A 4JKDA 2NRRA 1Y19B 3FFKB 1NGEA 4BVOA 3EPYA 1EF1A 2D1KA 4EFHA 3SBTA 1EO1A 3VEVA 4CJ7A 2WC9A 3J8AA 3HSCA 3U4LA 5BREA 3H46O 1BA0A 4BR4A 1ESVA 3UB5A 3AAQA 4IOAL 4ILJA 3SMSA 2NNWA 3CC2N 1TUUA 4BRDA 5C0YA 3F9MA 3R6MA 2RQ1A 1GLJO 2Q1NA 3WT0A 4CZKA 1K8KB 4H5VA 4B1VA 1DGKN 5MLCQ 1NGIA 1RGIA 5JMVA 5F1XA 1YIJN 1DIKA 1GLCG 4BQLA 3C7NA 5CHIA 1Q81O 4DB3A 5GAHP 4MO4A 1SGHA 2P9UA 2FDQA 2HOEA 1X3MA 3AGKA 1GLLO 4QS7A 4XH5A 4H0TB 3OHRA 1T6CA 3U7DA 1YJWN 4O8KA 1QZ6A 2LBBA 2COPA 4WFBL 1OKJA 1BO5O 4EAHD 1KQSM 1VQ6N 2YJFA 3TU5A 5BPMA 1KAXA 3UKRB 2D4WA 4BRPA 5E84A 1QZ5A 5LY3A 4FPAA 3J7ZO 1VQ9N 1RDUA 3I33A 2CH5A 2D10A 2E1ZA 3D2FA 4JKFA 3FZMA 4H5WA 4NLCA 2RHKA 4GY2B 2QWNA 3OBWA 3VGKA 3FE1A 5BPNA 3CJ1A 2KHOA 3CCEN 1J6ZA 2NRVA 1M90O 1XQSC 4H5RA 4H0PA 3HZ6A 3F2KA 2QI2A 3EE8A 4PKHA 4QS8A 3TSQA 4ZRIA 3VF4A 2I7NA 2V7ZA 1GG3A 2F9TA 3AU4A 3QFUA 2WH5A 4B1UB 1NMDA 5JVHL 3WXIA 1Q7YO 3G9WA 3OBYA 3M1FA 1C0GA 2P9SA 5AZIA 4FWPA 4JEPA 1VQON 3FLVA 4OPHA 4OO1J 2IVOA 1U2VA 3DXMA 5BR9A 2VGMA 1ILYA 2GWJA 2EMTA 4IEEA 3SAHA 4IEIA 1SAZA 4B1ZA 2Q97A 1NGFA 2CGKA 3CCUN 2QEXN 3C7NB 2HRJA 2ZWHA 3GE1A 5GADP 2ASMA 2D2QA 3FP5A 2FXUA 1XC3A 2E20A 4IJAA 3I55N 4CI6A 2J0JA 1NGGA 4MDBA 2HBMA 4BC5A 3MWPA 1JCEA 4FL9A 1NI2A 1MK7B 4BR5A 1MIZB 1T3VA 2CGLA 5M1NA 3BF1A 2KKZA 2VGNA 3D2EA 5C15A 1S72N 5FPNA 4OPAA 1VQ4N 1BU6O 4KH6A 4BRGA 5AZIB 1GC7A 5KPTA 2P9SB 2QWPA 2YHWA 4IXCA 4H0YB 4BC4A 1HKGA 3ENOA 3E9OA 4WFAL 1Q86O 1VQKN 1LCUA 2CB8A 3N4PA 3O6WA 4BRFA 3WQTA 4CD1A 3VEZA 2VYPA 3VPZA 2OANA 2ZPYA 1X3NA 2QW9A 3SBGA 3HOSA 3A0IX 3BEXA 4WQ4A 3CXCM 4GV6A 3CMAN 2ZGZA 3H3OB 4BRLA 3ATUA 4RTFD 3OA9A 4F7GA 2EWSA 5EOYA 2E88A 3RSEA 3WQUA 4CBWA 3HTVA 4C1NK 3R1XA 3A8YA 3FZFA 4M7YA 3K9KA 4IJNA 1TYQB 4YL8A 4CZEA 1VQ7N 3CJ9A 3QIJA 2W41A 1WUAA 2R82A 5EX5A 3UKRA 4K42A 1TYQA 1Y64A 3VGLA 3CJAA 3QMLA 1NWKA 4H5TA 4BRIA 5GIPA 4U7BA 2HMPA 2YHYA 3ZX3A 3SAFA 5AQLA 3U8ZA 4PHTX 3P39A 3E9LA 4IWVA 4EHUA 1U2VB 3RSEB 2A40A 1BWFO 1T44A 2NRTA 4CZLA 3MN7A 5M1FA 4A61A 5EVZA 4BC2A 3O9TA 4C23A 3N4QA 2NRHA 4CZJA 2E2OA 4MO5A 4BRKA 3SMPA 1YUWA 3ZYYX 3MN9A 5JLHA 1OVYA 5JVLA 3EZWA 1HX1A 1YJNN 1VQ8N 3JS6A 5AQRA 2QWLA 5BRFA 2HF3A 2E1YA 2HSTA 5HOOA 4BR0A 3D2FB 3VTIA 2J4RA 5AZJA 3BINA 2F7TA 1BOTO 4FSVA 2E2NA 5AQMA 4R79A 1E5WA 1YVNA 3CHWA 3DXMB 3VMFB 3PZDA 5F0XA 3MCPA 2Q0UA 1RDWX 4LC9B 1W2BM 2Q0RA 1KC8O 3Q7BA 4WCEL 1GGOA 3QBWA 4XH4A 4IO9L 2PBDA 3CETA 5KPZA 4JKHA 2GELA 1N8RO 2V51B 3VEWA 4J8FA 5AQYA 5CR4A 4Z94A 1K8AO 4G9ZA 3TSUA 3DXKB 3O1BA 1GLBG 3KVGA 4NB4A 4NLBA 3C6AA 3I8BA 5H1SQ 3O5BA 2FF6A 3CPWM 3CCQN 3WXKA 3FZKA 4WF9L 1KAZA 4CBXA 1S22A 2A3ZA 2GTDA 4JKEA 2ASPA 4ZRKA 2QWQA 1NVLA 3O9QA 3CC4N 3ULEA 1VQ5N 3VF6A 3UE5A 1R59O 4DKWA 5FPEA 2P9NB 4K43A 4PKIA 3CCLN 3TSPA 3VENA 1H4RA 2YCHA 3JXUA 5GINA 3ENBA 4DCHA 5M1OA 4BRQA 1GLFO 1VQMN 4IOXA 1NGJA 5TKYA 3FR0A 3BUZB 3O80A 4WQ5C 1BUPA 1X9JA 5GAGP 4M63C 4QS9A 2QXLA 4ISGA 3G71N 3CCSN 4YOVA 1NGDA 3K9JA 3NMUA 3FGUA 5AQSA 4JKAA 4BGBA 2Q31A 1ST7A 3TTFA 4WFNL 3CCMN 3AAPA 5DM7L 1W97L 3QICA 5AQUA 1XUPO 3CD6N 3G25A 1CZAN 2YJEA 4ISFA 4A62A 3G4SN 1QQOA 2JWKA 3IDHA 3QB0A 2HBKA 3ZEUB 3FZLA 3B8AX 1K8KA 1Q18A 2HBLA 3D7EO 4FOEA 5AQXA 5M1QA 1JCGA 5C12A 1NGAA 5AQPA 5CE3A 4YOYA 3A5OC 3HM8A 3LDPA 4FWMA 3TTDA 4B1YB 4BRCA 4IOCL 2BTFA 1VQNN 1MWMA 4CD3A 4BR2A 3H3NO 5AQWA 2GX9A 2NLXA 5AQFA 4XEIA 4CZIA 4CZFA 3QDKA 1LOTB 1QVFM 3PIPL 5F2RA 1S3XA 3C65A 3X23A 5FPMA 4H5NA 3A5NC 2FJ9A 1HPMA 5BN8A 2YVCA 1QQNA 2J0MA 2P9PA 4KH5A 2ZJQL 5AQIA 3L4IA 4DQ8A 1K9MO 1DT9A 1SZ2A 4CZHA 3CIPA 4WQ4C 1BA1A 3GOIA 3CC7N 2ABDA 4JK8A 5AQTA 3HI0A 3CPEA 3RVCA 2P9IB 3ZETB 3EO3A 5KPRA 1HB8A 1VBHA 3GDQA 1NGCA 3ID6A 4ISEA 4K41A 4FO0A 4BREA 3MDQA 3SLCA 1VBGA 4I6MB 3LDNA 1K73O 5ADXA 2ZJPL 1MIXA 1Q82O 3ZDTA 3LM9A 4YDUA 5AFUA 3CCJN 1C0FA 1YJ9N 1ATRA 1J19A 3ZX0A 4MDAA 4IO8A 2YHXA 3WXJA 5FPDA 3PLAA 3VOVA 1DEJA 3PVLA 1YXQA 3CJ7A 2FSJA 3O08A 5AQNA 3VTHA 1ATSA 2PAVA 4A59A 4NY0A 1JCFA 4JD2A 2Q36A 1P90A 1VAZA 4MLHA 3O9SA 3WEEA 4JHDB 2P9UB 5AQHA 3R8EA 2VCPA 5LJVA 1YITN 3C0BA 4BY9C 3HRGA 3U8XA 4JKGB 2I1KA 2OTLN 2WBNA 4JKCA 3VEOA 2IVNA 2ASOA 4FPBA 3WEEB 4EKUA 4FWSA 3M6GA 4EHTA 2P9LA 5AQZA 4CBUA 3T7ZA 3GBTA 4ZRJA 3UKUB 3CERA 5BN9A 4MLEA 4B1WB 3H45C 3VESA 5AZJB 4BRHA 4I6MA 1IJJA 2P9KA 4H03B 4A2BA 3R3LA 4RWTA 3HOTA 4FVUA 3P38A 2KLAA 5AQJA 5AQQA 4BROA 2JWLA 2A42A 4JNEA 2WUSA 4GV3A 3O9RA 3W0LA 2NZTA 2QWRA 3SJHA 3MX5A 2QA4N 3OW2M 4GV9A 4KBOA 3H1VX 2AA4A 4EIAA 4FWKA 1G99A 4RCHA 4A5BA 2PFUA 3EN9A 4B9QA 5KQDA 4CYEA 2AEHA 1O13A 1MWKA 1Z6RA 5BPLA 3PIOL 1P8ZA 1T6DA 2ZGYA 3O1WA 3SK3A 4O5FA 2W40A 3CCVN 4JKGA 1SS6A 2V7YA 2DPNA 4HTLA 3R9PA 1M1KO 4HWIA 3MWTA 3S41A 4WQ5A 3VGMA 4HDOA 4PKGA 1KXPA 2IIRA 3VETA 2EMSA 4FWNA 4TKNA 2NRZA 1V4SA 4BC3A 4BRNA 2AL6A 4GVEA 3VERA 3D6RA 1BG3A 5M1KA 1D4XA 3A5MC 4FWLA 2ITMA 4AF1A 4WYBA 1HB6A 3AU5A 4HDQA 2AP1A 3IVFA 3LDOA 3E9PA 3QBXA 3CMEN 1H1VA 2P9KB 4IDHA 3ULEB 3P31A 3M5RA 3AARA 3IMXA 4IZ9A 1ZBSA 2E8AA 3MK6A 5AR0A 3E1YA 4BRMA 4ILHA 2A6AA 4BVPA 1SQKA 1ISNA 3U9ZA 5C2FA 5LJWA 3O9UA 2D0OA 1NTIA 5B8HA 5KQ8A 2P9IA 1ZC6A 4H0VB 3ZETA 3I56N 3DAWA 4GNIA 1GLDG 2CH6A 2CQUA 3UKUA 2J0KA 4ILGB 5IJMA 1WOQA 3KWIA 4BG9A 4H0OA 1DKGD 2P9LB 2H3GX 4JAXA 1NBWA 3L6QA 4M7XA 1ZXOA 3CQXA 3U9DA 4FWOA 4UY8O 1NM1A 2P9PB 5AQOA 1YI2N 3O4WA 3CF5L 2F9WA 2WFBA 4FWRA 4DHYA 1QHAA 3F5TA 2Q2RA 3H6EA 4BQZA 1HUXA 5BRDA 4Y0WA 2D0PA 3D2EB 3MN6A 1U6ZA 2GUPA 1RFQA 1Z05A 2OTJN 3VEYA 4B1XB 4CZGA 4A5AA 4BR9A 4PL7A 5GIOA 5DM6L 3EKSA 4AM7A 3T69A 4DXAB 1HBKA 4KH4A 2BUPA 5JICA 4H0XB 1GLEG 3FZHA 3HBTA 3EL2A 4U67L 3NVKA 3KHYA 3DWLA 3NVMA 3FLCO 5C10A 1QQMA 3H1QA 5JVGL 2I7PA 3LDLA 3LL3A 3GL1A 3KK7A 3MN5A 1YF5L 3AGRA 3DXKA 1VQLN 1NLVA 1MK9B 2IVPA 2FLOA 3ZX2A 3E66A 2CGJA 1E4FT 4K25A 5HL7L 2A5XA 5TKWA 4FOIA 2GEMA 2HF4A 2ZF5O 2QM1A 3CI5A 3WA0A 5AQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKB A;  4JKF A;  4ILH A;  3SBG A;  4JK9 A;  4JK8 A;  3ENB A;  4JKG A;  4JK7 A;  4JKG B;  4JKC A;  4JKD A;  4JKH A;  4ILG B;  3SBT A;  4JKA A;  4ILJ A;  3E66 A;  3E9P A;  4JKE A;  3E9O A;  3E9L A; 
#chains in the Genus database with same CATH topology
 3EKU A;  1VRU A;  3GG4 A;  5CYQ A;  5E26 A;  5AFU H;  1MDU B;  3V1O A;  1S6Q A;  5EY4 A;  2P9N A;  1IKW A;  4C8L A;  5I9E B;  3NH1 A;  2W42 A;  1VSM A;  2UYT A;  3ZT3 A;  4FJX A;  1XMO K;  4FW1 A;  3P83 D;  4M3R A;  5T7B A;  1EXQ A;  3ID8 A;  3BF3 A;  4FLU A;  4F9O A;  3MMV A;  1CXU A;  4JHD A;  3KZB A;  4YY3 K;  1VSD A;  1FJG K;  4YOX A;  4N47 A;  4JKB A;  3CFR A;  4JN4 A;  3TAG A;  4FJI A;  1SKR A;  4DV1 K;  4CJR A;  4DWI A;  1X9S A;  3SQ1 A;  3SAG A;  3EE9 A;  5EXW A;  4F2S A;  3C6H A;  3P4I A;  3HJF A;  3NHG A;  3VF2 A;  3MEC A;  3VQP A;  3IUC A;  4KI4 A;  2E2P A;  1RT2 A;  1TAU A;  2BH1 A;  2QTD A;  5CZ1 A;  4CF2 A;  4JK9 A;  3VQ7 A;  2GV9 A;  4NO7 A;  3ZSR A;  3K5M A;  3ZSX A;  2FSK A;  3LM2 A;  4JKD A;  4GKK K;  1C0M A;  1NGE A;  2D1K A;  3ZT1 A;  1OH5 A;  2WC9 A;  3J8A A;  3U4L A;  4JI8 K;  4XIU A;  2Z1I A;  1BA0 A;  4PA1 A;  4FLW A;  1NK9 A;  3OY9 A;  3VQ5 A;  3AAQ A;  3C94 A;  3OYM A;  3AA3 A;  3ZSW A;  4DV7 K;  1TUU A;  1J5O A;  1ASV A;  3R6M A;  3RMA A;  3LP3 A;  1NK7 A;  5MLC Q;  5F1X A;  1S1X A;  3U3G A;  1JL1 A;  3VQE A;  1Q81 O;  3VA3 A;  4KHW A;  3O3F A;  3AGK A;  1X3M A;  4DUZ K;  3THY A;  1GOB A;  4FVM A;  1GLL O;  2OPS A;  4CJQ A;  4DS5 A;  4M42 A;  4LFC K;  3U7D A;  4O8K A;  1QZ6 A;  3L2V A;  1BO5 O;  1KQS M;  3UKR B;  2IAJ A;  1U49 A;  1L3S A;  1QSL A;  2O8D B;  3I33 A;  4NXM K;  4JKF A;  3VGK A;  3FE1 A;  5BPN A;  3HK2 A;  1DLO A;  3RMB A;  5HRO A;  4HUG A;  3E01 A;  1WBD A;  4CF8 A;  4QS8 A;  3F2K A;  2QI2 A;  3TSQ A;  1NU0 A;  4ZRI A;  1JXB A;  2I7N A;  2IOC A;  1SKW A;  3K0S A;  4RG8 A;  5JVH L;  3WXI A;  2X6S A;  4DV6 K;  1KSP A;  3HVR A;  1WSI A;  1S1U A;  1KLN A;  3DXM A;  2VGM A;  2GWJ A;  3O3G A;  1JXE A;  3SAH A;  1KFD A;  1SAZ A;  4M3X A;  2CGK A;  3CFP A;  2QEX N;  2E4L A;  1Q9X A;  4FJG A;  4FJL A;  3FP5 A;  4IJA A;  1XC3 A;  2E20 A;  4CI6 A;  4DFM A;  4CGF A;  3QET A;  4NCG A;  1JCE A;  1MIZ B;  1T3V A;  4E19 A;  2CGL A;  5M1N A;  3D2E A;  4E7H A;  1RTD A;  4ELT A;  4CIE A;  5FPN A;  1VQ4 N;  4NYN A;  2QWP A;  2YHW A;  3JAM O;  4BC4 A;  3ENO A;  1Q8I A;  3JSM A;  3OVN A;  4JRP A;  3O6W A;  3VEZ A;  2VYP A;  3MEE A;  1ZBL A;  3SQ0 A;  3CMA N;  4CHQ A;  4BRL A;  1N5Y A;  4RTF D;  4F7G A;  3WQU A;  3RSE A;  4C1N K;  1TGO A;  4DFJ A;  3ZSZ A;  3SUP A;  4FZY A;  3G10 A;  3HYF A;  4CGH A;  4B3R K;  4CIG A;  1TKZ A;  3AVC A;  3RR8 A;  4LF8 K;  1WUA A;  3TWH A;  5EX5 A;  4K42 A;  1NWK A;  5GIP A;  4BDY A;  2YHY A;  5AQL A;  3U8Z A;  1BIZ A;  3P39 A;  1U2V B;  2A40 A;  5J2M A;  3AVF A;  3MN7 A;  2O8E B;  4CZJ A;  3OYD A;  2FBX A;  4FLT A;  2E2O A;  1HQE A;  3SMP A;  1YUW A;  3ZYY X;  4E7J A;  4FJ8 A;  1OVY A;  1HQU A;  3LP1 A;  1YJN N;  4NCB A;  3JS6 A;  4Q5V A;  5HOO A;  1BHL A;  4AQY K;  2J4R A;  4Z4C A;  1J9A A;  4OLA A;  2E2N A;  1TK5 A;  1YVN A;  3DXM B;  3PZD A;  5F0X A;  4MFB A;  1RDW X;  4CK3 A;  4WCE L;  3QBW A;  4IO9 L;  2GBZ A;  2GEL A;  4CE9 A;  4CFB A;  1N8R O;  4J8F A;  3THY B;  4G9Z A;  1TL1 A;  1D9F A;  3O1B A;  5LL6 Z;  3O5B A;  1U47 A;  3WXK A;  4AHV A;  4WF9 L;  1NJZ A;  1KAZ A;  3CM5 A;  2GTD A;  4IG3 A;  3OJU A;  2UU9 K;  2E5L K;  3UE5 A;  2WON A;  4DR6 K;  5J2Q A;  3TSP A;  3JXU A;  4BRQ A;  4CHN A;  3QES A;  1KVC A;  4IOX A;  1O1W A;  3OYH A;  3PY8 A;  3FR0 A;  1I39 A;  4WQ5 C;  5M1F A;  3I0R A;  1X9J A;  4CF9 A;  4LF6 K;  3G71 N;  4PWD A;  5AQS A;  2W6K A;  2Q31 A;  4GKJ K;  3CCM N;  5I42 A;  4KAZ A;  5AQU A;  2KTQ A;  3WNE A;  3EEQ A;  3G25 A;  1KCF A;  3G4S N;  3ULD A;  2F8S A;  3D0P A;  3D7E O;  1K6Y A;  5AQX A;  5CE3 A;  1CZB A;  1EET A;  1G15 A;  3HM8 A;  4B9M A;  4DF4 A;  4IOC L;  4Z4G A;  1VQN N;  4KHY A;  3AA5 X;  1VK0 A;  2KFN A;  4CZI A;  1LOT B;  3NFA A;  3HPG A;  2X74 A;  1TKD A;  1HPM A;  1QQN A;  3A2F A;  2ZJQ L;  3HO1 A;  1K9M O;  1DT9 A;  3CIP A;  3CC7 N;  4B8A B;  2ZD1 A;  1EKE A;  2ABD A;  5AQT A;  2IGI A;  3HI0 A;  2P9I B;  3ZET B;  3EO3 A;  5KPR A;  3GDQ A;  4KPY A;  4KTZ A;  4BRE A;  1TV6 A;  3T1H K;  3LDN A;  3NF8 A;  1MIX A;  4E89 A;  5IT9 O;  1NJX A;  1C0F A;  1ATR A;  1J19 A;  4MDA A;  3KLH A;  3PLA A;  3DMJ A;  1VSH A;  3CJ7 A;  1SL1 A;  1RT3 A;  4A59 A;  3V9S A;  4MLH A;  5LJV A;  3WEE A;  1YIT N;  2P9U B;  5AQH A;  3U8X A;  3TAQ A;  4IKF A;  5J2N A;  4AHT A;  1FW6 A;  2P9L A;  5AQZ A;  4LF7 K;  1WNS A;  4CBU A;  2HW3 A;  3KD5 E;  3S3M A;  5BN9 A;  4B1W B;  3BY5 A;  3VES A;  2Z1H A;  3C6T A;  1IJJ A;  1JKH A;  4BRO A;  5AQJ A;  4DS4 A;  4JNE A;  1I94 K;  4F3T A;  4DSI A;  3O9R A;  3W0L A;  2NZT A;  4EZ9 A;  4A5B A;  5KQD A;  2AEH A;  2ZGY A;  2V7Y A;  3AVJ A;  2DPN A;  4YHH K;  5HLF A;  3MXI A;  4M3W A;  1ZBU A;  4KFB A;  2IIR A;  4DTN A;  4BC3 A;  1N34 K;  1IO2 A;  2O8F B;  1D4X A;  3CQ8 A;  4FW2 A;  3ULE B;  1Y97 A;  2YNH A;  3RRH A;  3QEP A;  3E1Y A;  4ILH A;  2EX3 A;  1NTI A;  5B8H A;  4LF4 K;  1WSE A;  1HNI A;  4B9V A;  4LSL A;  2CQU A;  4FK4 A;  1WOQ A;  4H0O A;  1DKG D;  3CQX A;  4FWO A;  1HR0 K;  4UY8 O;  2P9P B;  3AVL A;  5AQO A;  3O4W A;  2F9W A;  3OS0 A;  4IFV A;  1QHA A;  1WLJ A;  2Q2R A;  1QS4 A;  4Y0W A;  3MN6 A;  1LV5 A;  4DTU A;  2YV0 X;  4A5A A;  5DM6 L;  5GIO A;  5JIC A;  4GMJ B;  3HBT A;  4U67 L;  4DQP A;  3FLC O;  5C10 A;  4B3M K;  3H1Q A;  3AVM A;  3MN5 A;  3T3F A;  1WBB A;  4KHQ A;  1XNR K;  3AGR A;  1VQL N;  4DU3 A;  2FLO A;  4CHZ A;  1E4F T;  1UOC A;  5CZ2 A;  1QHT A;  2GEM A;  3CI5 A;  5AQV A;  1UWB A;  4FLZ A;  2NRW A;  2RE2 A;  3F9K A;  2VWB A;  3SPY A;  4DV4 K;  3VQB A;  1BGX T;  1HMV A;  2R7Y A;  4CGJ A;  1VSF A;  1JLG A;  4OGC A;  3PX0 A;  1TL3 A;  3AVA A;  1HLU A;  1KBL A;  1HKC A;  3ZEU A;  1NGB A;  4CEA A;  5ADX H;  1JJ2 M;  1Q9Y A;  3D45 A;  3U6F A;  2RF2 A;  2FF3 B;  3V6D A;  3CQY A;  3BP8 A;  3L4Q A;  4OGE A;  4H4M A;  2FSN A;  5AQG A;  4EZ6 A;  5BRH A;  3W3D A;  5FRN A;  1KD1 O;  4P7I A;  1ACA A;  4O8U A;  4C1N I;  1S1W A;  4FK0 A;  3M3Z A;  3ENH A;  2F8T A;  4A2A A;  1BI4 A;  2NRX A;  4E3S A;  3V9W A;  4F8R A;  4AHU A;  2A41 A;  5KRT A;  2YX6 A;  3DI6 A;  1ATN A;  5ELZ A;  5M1P A;  3V4I A;  4XH1 A;  4N76 A;  4FJM A;  3Q7C A;  4E7I A;  1HKB A;  4YDU C;  5C2D A;  1QVG M;  5GAE P;  1NNE A;  4PL8 A;  4KB0 A;  4JK7 A;  4YOU A;  2ZJR L;  3QEI A;  3O8M A;  3UIQ A;  2O4I A;  3IFR A;  4CZM A;  2NRR A;  4FZZ A;  3FFK B;  4O0J A;  4CEZ A;  1S9E A;  1EF1 A;  3KIO A;  4KO0 A;  4EFH A;  4KHP K;  3RMC A;  3HSC A;  3H46 O;  1ESV A;  4Z0U A;  1N6Q A;  3UB5 A;  4IOA L;  4ILJ A;  2ITG A;  3OYE A;  2NUB A;  4CER A;  1XI1 A;  4V19 S;  3DLB A;  1RIL A;  4BRD A;  3F9M A;  4M3T A;  2O8D A;  1I3A A;  4CZK A;  1K8K B;  4FJK A;  1NGI A;  1RGI A;  4BQL A;  4FJ5 A;  1LAV A;  3J7Y P;  2P9U A;  4E1M A;  3VQ8 A;  1HJR A;  1X9M A;  1U04 A;  5A2Q O;  1NK0 A;  1C1A A;  1QSS A;  2COP A;  4DTJ A;  4EAH D;  4IDK A;  4HUE A;  3K5N A;  5LY3 A;  4JI3 K;  3J7Z O;  5HRR A;  4HCC A;  4JS4 A;  4QAG A;  4GY2 B;  2B6A A;  2QWN A;  1JL2 A;  5SWM A;  3QER A;  4E7K A;  4N5S A;  3M8S A;  4H4O A;  1MU2 A;  1M90 O;  4FK2 A;  3SZ2 A;  4DSJ A;  3HZ6 A;  3OJS A;  2V7Z A;  2WH5 A;  1NMD A;  2VQF K;  1RT1 A;  1Q7Y O;  3IAY A;  1BL3 A;  4BDP A;  2P9S A;  4CK2 A;  4CGI A;  4CVN E;  2DFE A;  4JEP A;  3NE6 A;  1ITG A;  1VQO N;  1RTJ A;  1IG9 A;  4OO1 J;  5C25 A;  4AH9 A;  5BR9 A;  3IG1 A;  3RWU A;  3DLR A;  1BCM A;  1NGF A;  3K59 A;  1QSY A;  2ZWH A;  2KFZ A;  3GE1 A;  3KKS A;  4B8C A;  5GAD P;  2ASM A;  4DR3 K;  2J0J A;  4BC5 A;  1DTT A;  1EP4 A;  4BE1 A;  3QEW A;  4CIF A;  1MK7 B;  4BR5 A;  2KKZ A;  1S1V A;  1D5A A;  4OPA A;  1T05 A;  3PSI A;  5AZI B;  1KVA A;  4H0Y B;  3RR7 A;  3TAP A;  1XC9 A;  1HKG A;  1Q86 O;  1LCU A;  2CB8 A;  3N4P A;  3LWL A;  3ZSQ A;  4CD1 A;  3HM9 A;  3KLI A;  3SBG A;  4WQ4 A;  2ZGZ A;  4LH4 A;  4DR7 K;  3H3O B;  4B9S A;  5EOY A;  4CBW A;  2EWS A;  2QKB A;  3HTV A;  1BIU A;  1SUQ A;  4K8Z A;  4I9Q A;  4CZE A;  1TYQ B;  1VQ7 N;  3NDK A;  2OYQ A;  3QIJ A;  1NJW A;  1C0U A;  3VGL A;  4U7B A;  3CJA A;  4H5T A;  4CJU A;  1LWF A;  3VQ9 A;  3ASM A;  3DLE A;  2E6M A;  3HP9 A;  4H8K A;  4IWV A;  3AO2 A;  4EHU A;  2UXC K;  3TAM A;  1SV5 A;  1BWF O;  3BGR A;  1KFS A;  1RT6 A;  1QQC A;  3O9T A;  3N4Q A;  4I7F A;  4M3U A;  2JGU A;  3K2P A;  5C24 A;  4LFB K;  4BRK A;  5FRO A;  4DV0 K;  1L3U A;  5AQR A;  2HF3 A;  2HST A;  4BR0 A;  3D2F B;  1RBR A;  2F7T A;  4FSV A;  4CCH A;  3CHW A;  1Z26 A;  1LWE A;  3DRR A;  1YVU A;  3HST B;  2Q0R A;  1KC8 O;  1NG9 A;  1GGO A;  2PBD A;  2D0C A;  4O0I A;  3LZJ A;  2YNG A;  1GLB G;  1C1C A;  3CCQ N;  3M8P A;  4DTR A;  1RBT A;  4N41 A;  2OPQ A;  3V1Q A;  1S22 A;  4DQQ A;  3AV9 A;  1FK9 A;  4JKE A;  1NVL A;  3O9Q A;  3DOL A;  3ULE A;  4CED A;  3VF6 A;  1VQ5 N;  3ALY A;  3DLK A;  4JYA K;  4KRF A;  2BGG A;  5GIN A;  3ISN C;  5AJ3 K;  5M1O A;  4B9L A;  3KTQ A;  5TKY A;  3BUZ B;  3ITH A;  1FKP A;  2QXL A;  3K58 A;  3FGU A;  2IDO A;  4WFN L;  4YFU A;  1EWQ A;  1XUP O;  4KTQ A;  1F21 A;  4ISF A;  1UA1 A;  1QQO A;  2JWK A;  3QB0 A;  3VQD A;  2HBK A;  4FJN A;  5M1Q A;  5C12 A;  3OS2 A;  5J1E A;  4J2B A;  1NGA A;  4FWM A;  4B1Y B;  1IKX A;  3MAQ A;  1D9D A;  4AIL C;  2BAN A;  4DV2 K;  4DV3 K;  4BR2 A;  3H3N O;  3AVG A;  4CZF A;  3PIP L;  4H5N A;  3QNO A;  4FJJ A;  2YVC A;  2UUB K;  1BQM A;  1JLE A;  1UA0 A;  1ZYQ A;  3LAK A;  4LF9 K;  1S9G A;  3CPE A;  2HND A;  1HB8 A;  4M45 A;  3ID6 A;  4FO0 A;  3SLC A;  2RN2 A;  1GOC A;  5ADX A;  2KW4 A;  2ZJP L;  3ZDT A;  4YDU A;  4BWJ A;  3ZX0 A;  1XHX A;  4IO8 A;  5FPD A;  4DTX A;  1DEJ A;  1YXQ A;  4CF1 A;  3SCX A;  1IBK K;  1JCF A;  1HNX K;  3K57 A;  2VCP A;  2OTL N;  4FPB A;  4C8O A;  4EKU A;  3M6G A;  4K8X A;  3SV3 A;  2VG7 A;  3LPT A;  4NYF A;  3ZT2 A;  3T7Z A;  3GBT A;  3UKU B;  3H45 C;  4A2B A;  4RWT A;  2KLA A;  5AQQ A;  4CEB A;  2QWR A;  4GV9 A;  4FCY A;  3OW2 M;  4KBO A;  2AA4 A;  5DM7 L;  1G99 A;  2PFU A;  4B9Q A;  4CYE A;  1T03 A;  1EX4 A;  2P5G A;  3SK3 A;  1FKO A;  4HTL A;  3MWT A;  3VGM A;  4X65 K;  4HDO A;  2JLE A;  4KB1 A;  1KXP A;  2O8F A;  3NF9 A;  2NRZ A;  3PO4 A;  2KZZ A;  2AL6 A;  4GVE A;  4I2P A;  3O3H A;  3VER A;  4LD0 A;  3O4N A;  2HHV A;  4QOZ B;  4AF1 A;  4WYB A;  1HB6 A;  4HDQ A;  2AP1 A;  4DSE A;  4B9N A;  3CME N;  3E9P A;  3QBX A;  1H1V A;  2XY5 A;  3M5R A;  4IZ9 A;  5AR0 A;  1ZBS A;  4DR1 K;  2O8C B;  3QEV A;  4BE2 A;  1SQK A;  4DSF A;  5C2F A;  1C1B A;  1ZC6 A;  1GLD G;  2CH6 A;  4CJP A;  1SL0 A;  1NKE A;  1TAQ A;  4O5B A;  4ILG B;  2QA4 N;  4M3Y A;  1ASU A;  4JI1 K;  4O55 A;  2H3G X;  2P9L B;  1NBW A;  3BDP A;  1J54 A;  1ZXO A;  2G8F A;  2VG6 A;  3HT3 A;  3LWM A;  1NM1 A;  3CF5 L;  3JYT A;  4FWR A;  1VSJ A;  3AVB A;  3OYI A;  2B5J A;  3TAF A;  3U3Y A;  4CJW A;  3DRP A;  1RFQ A;  5IWA K;  1VHX A;  4CZG A;  1VRT A;  3KK1 A;  1TK0 A;  4DXA B;  4KH4 A;  4H0X B;  4DV5 K;  3FZH A;  4CFD A;  1OH8 A;  4HUF A;  4ICL A;  1KTQ A;  5JVG L;  2I7P A;  3LL3 A;  1XHZ A;  1YF5 L;  4CJE A;  1NLV A;  2IS3 A;  1MK9 B;  2IVP A;  3SJJ A;  2Y1J A;  2CGJ A;  4DR2 K;  1U48 A;  5FLX O;  2DTU A;  1TKX A;  4DR4 K;  5TKW A;  4FOI A;  2ZF5 O;  3KK3 A;  3WA0 A;  1BDG A;  2I1J A;  3F73 A;  4KHN A;  1UAX A;  4JS5 A;  4L3Q A;  3DJC A;  5AQK A;  3RRG A;  1ZBH A;  1W9H A;  3HP6 A;  1RBU A;  3NH2 A;  4YOT A;  3OYB A;  1B9F A;  1IG8 A;  3NH0 A;  2HHT A;  5LMN K;  3MCA B;  3TTC A;  5SZT A;  3CCR N;  3ZSY A;  4DMN A;  3LZI A;  3AY9 A;  4X66 K;  3AVH A;  5LMU K;  2OA8 A;  1HJO A;  3S3O A;  3CM6 A;  3TPQ A;  1RTH A;  3A5L C;  4JI5 K;  2D11 A;  2HE7 A;  4CEF A;  2FC0 A;  3L2R A;  1NKC A;  5JLF A;  4B9T A;  4CJV A;  4C8K A;  4DTP A;  1E4G T;  2VWK A;  3QFP A;  1MA9 B;  2Q3S A;  4W5T A;  1YHQ N;  4Y1D A;  3IKM A;  1VQP N;  4E1J A;  2YHA A;  2V52 B;  2YI1 A;  2UUC K;  2XY8 A;  2P5O A;  4ZTJ A;  4BG8 A;  4IFE A;  5JS1 A;  1Y19 B;  5I3U A;  1EO1 A;  3VEV A;  3NF7 A;  5BRE A;  4BR4 A;  1IKY A;  1T8E A;  2HHX A;  3CC2 N;  2RQ1 A;  1GLJ O;  2Q1N A;  2ZQB A;  3WT0 A;  4B1V A;  2EHG A;  1DGK N;  1YIJ N;  4X62 K;  1NOZ A;  1DIK A;  5CHI A;  1E3M A;  3C7N A;  3AA2 A;  4BWM A;  3THW B;  4RW8 A;  4DB3 A;  3PV8 A;  4MO4 A;  1SGH A;  4QS7 A;  4XH5 A;  4CFA A;  4JI6 K;  2XY6 A;  1YJW N;  2LBB A;  1ZBF A;  4OKE A;  1B92 A;  1A5V A;  4F3O A;  3V81 A;  1VQ6 N;  2XRI A;  3TU5 A;  1KAX A;  5EU7 A;  3OYC A;  2D4W A;  4BRP A;  4CF0 A;  5E84 A;  4FLX A;  1QZ5 A;  3HPH A;  1VQ9 N;  1RDU A;  3AO3 A;  4NLC A;  2D10 A;  2E1Z A;  3FZM A;  4H5W A;  3P1G A;  2RHK A;  1ASW A;  1GOA A;  1A5W A;  3AO1 A;  3CJ1 A;  2KHO A;  3CCE N;  1J6Z A;  2NRV A;  2DY4 A;  1J5E K;  1XMQ K;  1XQS C;  4H5R A;  4H0P A;  4ID1 A;  2Y1I A;  4PKH A;  1NOY A;  3SPZ A;  1GG3 A;  3QFU A;  4B1U B;  1BI4 B;  4RW6 A;  1S5J A;  1C0G A;  5AZI A;  3FLV A;  4OPH A;  1X9W A;  1U2V A;  1ILY A;  4ID5 A;  3S3N A;  4IEI A;  2HHU A;  4MQ3 A;  4B3O A;  3H08 A;  4OJR A;  1LWC A;  3OYA A;  3C7N B;  1R0A A;  1NGG A;  4MDB A;  4KTW A;  1NI2 A;  4KI6 A;  3BF1 A;  5C15 A;  2VGN A;  3LDS A;  1S72 N;  3LAN A;  1BU6 O;  4BRG A;  1IKV A;  5KPT A;  2P9S B;  1Z25 A;  4KHS A;  3E9O A;  4AHR A;  2B4J A;  3WQT A;  3HXM A;  2P51 A;  3HOS A;  2QW9 A;  4GV6 A;  3CXC M;  3BEX A;  5K14 A;  1NMN A;  3OA9 A;  2E88 A;  2X6N A;  5HBM A;  3A8Y A;  5KGW A;  3FZF A;  4M7Y A;  4IJN A;  4YL8 A;  3CJ9 A;  3K5L A;  3NBP A;  3UKR A;  1TYQ A;  1Y64 A;  3QML A;  3E9L A;  3RSE B;  4CGG A;  1T44 A;  2NRT A;  3QIN A;  1NKB A;  4FJ9 A;  4A61 A;  5EVZ A;  4BC2 A;  2O8E A;  1U45 A;  2NRH A;  4CHO A;  1RDC A;  4NCA A;  3MN9 A;  5JLH A;  5JVL A;  3EZW A;  4DSL A;  2QWL A;  4CJS A;  5AZJ A;  3BIN A;  1BOT O;  1RTI A;  1E5W A;  3VMF B;  2DFH A;  4FLY A;  1W7A A;  3MCP A;  2HNZ A;  3NGY A;  2Q0U A;  4CJL A;  4LC9 B;  4XH4 A;  4DSK A;  4JKH A;  3KLE A;  1L5U A;  3VEW A;  5AQY A;  1K8A O;  4CJT A;  1W0H A;  3DXK B;  4NLB A;  3HVT A;  5H1S Q;  3CPW M;  1C6V A;  3L3U A;  2D5R A;  3FZK A;  5CY4 A;  4CBX A;  2HMI A;  1WSH A;  2A3Z A;  1FXX A;  2ASP A;  3ZCM A;  2VG5 A;  1R59 O;  4DKW A;  5FPE A;  4X64 K;  1H4R A;  2YCH A;  3ENB A;  2YNI A;  4DCH A;  1N32 K;  3NGI A;  3HPO A;  3ZLJ A;  3BZK A;  1VQM N;  4L8R B;  3THX A;  4W5O A;  3O80 A;  3MED A;  3NCI A;  5GAG P;  4QS9 A;  4HVJ A;  2GUI A;  1NGD A;  3K9J A;  3CG7 A;  3AVK A;  1ST7 A;  3TTF A;  3AAP A;  4YNQ A;  2YJE A;  4A62 A;  3IDH A;  3CYM A;  1HYS A;  1WN7 A;  1HNZ K;  3ZEU B;  3FZL A;  4DUY K;  4G1Q A;  1K8K A;  4JI2 K;  1Q18 A;  4YOY A;  1JCG A;  5AQP A;  4PY5 A;  3A5O C;  3LDP A;  4BRC A;  5HRP A;  1RBS A;  4AHC A;  3OTO K;  1JLB A;  5AQW A;  2GX9 A;  2NLX A;  5AQF A;  3QDK A;  3VQA A;  1QVF M;  1YT3 A;  5F2R A;  1S3X A;  4CJ5 A;  3DM2 A;  3X23 A;  2J0M A;  2P9P A;  4KH5 A;  4E1N A;  3QNN A;  3L4I A;  3AVN A;  1SZ2 A;  4C8N A;  1EWR A;  4W5R A;  3V9U A;  1L3V A;  4JK8 A;  1NJY A;  4HCB A;  4WE1 A;  1J53 A;  4JLH A;  2UXB K;  4HHT A;  3MDQ A;  1VBG A;  4I6M B;  1K73 O;  4FLV A;  4N56 A;  5AFU A;  2E6L A;  3O4Q A;  1YJ9 N;  4Z4I A;  5E41 A;  3T1Y K;  4BE0 A;  2HHS A;  2YHX A;  3SUQ A;  3WXJ A;  4FZX C;  3OYG A;  1TVR A;  4IBN A;  3PVL A;  1BCO A;  5J2P A;  5AQN A;  1ATS A;  2PAV A;  3IRX A;  4NY0 A;  2HVH A;  2Q36 A;  1P90 A;  1VAZ A;  3O9S A;  3R8E A;  4BY9 C;  1HNV A;  3C0B A;  4O4G A;  3HRG A;  3MXM A;  2I1K A;  4CJ4 A;  1WSJ A;  2HVI A;  1WSF A;  4Z4F A;  4JRQ A;  4DF8 A;  4ZRJ A;  2YKM A;  3CER A;  4MLE A;  4PUO A;  4Q0B A;  1CXQ A;  5AZJ B;  4BRH A;  4I6M A;  3MXJ A;  4H03 B;  4FVU A;  3HOT A;  3LPU A;  3L2W A;  2JWL A;  1DTQ A;  2AJQ A;  4GV3 A;  3SJH A;  1B9D A;  3EN9 A;  5BPL A;  4M41 A;  3PIO L;  1P8Z A;  1T6D A;  1N33 K;  4O5F A;  2W40 A;  4JKG A;  1SS6 A;  1M1K O;  4JI0 K;  1REV A;  3PX6 A;  4FYD A;  1WAF A;  2OZS A;  1V4S A;  1OH7 A;  1HNW K;  3D6R A;  1BG3 A;  4CEE A;  4F2R A;  3AU5 A;  3IVF A;  1YTU A;  2BE2 A;  4CEQ A;  2O8B A;  4IDH A;  4BRM A;  3AAR A;  3IMX A;  1KRP A;  2E8A A;  3MK6 A;  4BVP A;  5LJW A;  4EP5 A;  4CEO A;  3VQ4 A;  5KQ8 A;  2P9I A;  3ZET A;  4H0V B;  3I56 N;  3DAW A;  3V9Z A;  2W6L A;  2ZE2 A;  4OLB A;  4BAC A;  4JAX A;  4BDZ A;  3L6Q A;  3OYF A;  3DYA A;  5FDL A;  4QCL A;  3M8Q A;  1YI2 N;  4DHY A;  1U4B A;  4DQI A;  4CJF A;  2D0P A;  3J81 O;  1U6Z A;  3QEX A;  1Z05 A;  3LAL A;  4BR9 A;  3T69 A;  4C8M A;  1GLE G;  3EL2 A;  5KGX A;  3KLF A;  2ETJ A;  1NK8 A;  3KD1 E;  3L2U A;  1QTM A;  3ZX2 A;  3E66 A;  1WAJ A;  4DG1 A;  3PUF A;  4K25 A;  1RT7 A;  2HF4 A;  4B9U A;  2QM1 A;  2VWJ A;  4GW6 A;  2OZM A;  3QIO A;  4JD2 B;  3SUN A;  3LP2 A;  3VEX A;  3SUO A;  1RBV A;  1TUY A;  1EQY A;  5JS2 A;  4JV5 K;  1XWL A;  2F96 A;  3DOK A;  4GVM A;  3WUH A;  3LP0 A;  4YOR A;  1RNH A;  1GLA G;  4ELU A;  4KV8 A;  2PY5 A;  4E0D A;  1KC7 A;  1KAY A;  4FWQ A;  3PSF A;  4DFK A;  1C0T A;  4BR7 A;  4FXD A;  4PQU A;  2P1J A;  1GC6 A;  4A57 A;  2O4G A;  2VQE K;  4HTU A;  3ATV A;  1S1T A;  4BGA A;  4BRA A;  2HBJ A;  4W5N A;  3KWG A;  4E7L A;  2GWK A;  4OX9 K;  1LW0 A;  3ZT4 A;  3THW A;  1OVQ A;  2QWM A;  3I8D A;  1T7P A;  2E2Q A;  3I0S A;  5KTQ A;  1V4T A;  3WXL A;  3K5O A;  3SNN A;  1LW2 A;  4IG0 A;  4AM6 A;  4J2D A;  1HYZ A;  3CJC A;  1NJI O;  4CHY A;  1JDE A;  1YAG A;  3CJB A;  2X0S A;  2DIK A;  4GXB A;  1NGH A;  3LDQ A;  4RW4 A;  3MX2 A;  4CJK A;  1A5X A;  3WXM B;  2G8H A;  2QWO A;  3L0Q A;  4YOW A;  3KJV A;  2G8V A;  3G6E N;  1BQN A;  3EZ5 A;  4CGD A;  4W5Q A;  3V9X A;  4LFA K;  1VSE A;  4BVO A;  3EPY A;  3SBT A;  4CJ7 A;  3OYK A;  4O44 A;  3TAE A;  1L3T A;  1IBM K;  3WNH A;  3THV A;  3SMS A;  2NNW A;  1YTA A;  4FM0 A;  5C0Y A;  3PO5 A;  4H5V A;  5JMV A;  4I9L A;  4FJH A;  1GLC G;  2YKN A;  5GAH P;  2FDQ A;  2HOE A;  2DFF A;  4DU1 A;  4EP4 A;  2YHB A;  3QLH A;  1RDB A;  4H0T B;  3OHR A;  2OPR A;  1T6C A;  4WFB L;  2BDP A;  1OKJ A;  3DLH A;  1IH7 A;  2YJF A;  3VN5 A;  5BPM A;  4ELV A;  3SV4 A;  3FFI A;  4Z4H A;  4FPA A;  2CH5 A;  1LAW A;  3D2F A;  2QKK A;  3EYZ A;  2UUA K;  3OBW A;  2QXF A;  3MEG A;  3G0Z A;  3EE8 A;  3VF4 A;  3C6U A;  1JLF A;  4R5P A;  2F9T A;  4OPK A;  3AU4 A;  3CFO A;  3G9W A;  2HHH K;  3OBY A;  1CLQ A;  3M1F A;  4B08 A;  1JLA A;  4TSX A;  3DLG A;  1HPZ A;  4FWP A;  4JI4 K;  4UQG A;  3OYL A;  3OYN A;  2IVO A;  2EMT A;  4IEE A;  4B1Z A;  2Q97 A;  3B6P A;  4ZHR A;  3CCU N;  2HRJ A;  4DLG A;  2D2Q A;  2FXU A;  4KKO A;  4CW7 B;  3I55 N;  2X78 A;  2HBM A;  3EY1 A;  3MWP A;  2G8K A;  4FL9 A;  1RCH A;  2LSN A;  3KLG A;  4KHU A;  4KH6 A;  1GC7 A;  4IXC A;  1QE1 A;  4WFA L;  4B3S K;  1VQK N;  4BRF A;  4JI7 K;  2WTU A;  3VPZ A;  2OAN A;  2ZPY A;  1X3N A;  3J80 O;  3A0I X;  4CJ3 A;  3THX B;  4OKK A;  3ATU A;  3QIP A;  4Y1C A;  3R1X A;  1RDD A;  5CYM A;  1WB9 A;  2D0A A;  3K9K A;  5HRN A;  2W41 A;  4OKJ A;  2R82 A;  3V1R A;  2ZM6 K;  4BRI A;  1VSK A;  4F4K A;  3P5J A;  2HMP A;  3ZX3 A;  3SAF A;  4PHT X;  4ZTF A;  4DFP A;  2XO7 A;  3S9H A;  3SQ2 A;  4CZL A;  4Z4E A;  4C23 A;  4I2Q A;  1S6P A;  4CEC A;  4MO5 A;  4IFY A;  5DMR A;  2Z1J A;  1KLM A;  1HX1 A;  1VQ8 N;  2G8W A;  5BRF A;  2E1Y A;  4CHP A;  1TKT A;  3VTI A;  2G8I A;  5AQM A;  4R79 A;  3M8R A;  2FBT A;  1W2B M;  3Q7B A;  4DQR A;  5KPZ A;  3CET A;  3KK2 A;  5HP1 A;  3LAM A;  2I5J A;  2V51 B;  2A1S A;  5CR4 A;  4Z94 A;  3NF6 A;  4LF5 K;  3TSU A;  3TR8 A;  4DQS A;  3NAE A;  1HRH A;  3KVG A;  4NB4 A;  1X1P A;  2KQ2 A;  3C6A A;  3I8B A;  2FF6 A;  3RMD A;  3L2Q A;  1WSG A;  4FM1 A;  3TAR A;  4ZRK A;  1NK4 A;  2QWQ A;  3CC4 N;  2HNY A;  1IV0 A;  2P9N B;  4K43 A;  4PKI A;  3CCL N;  4J2E A;  3VEN A;  2D0B A;  1GLF O;  3VQ6 A;  1NGJ A;  2PYJ A;  3CCS N;  1BUP A;  4M63 C;  5BR8 K;  4ISG A;  4FM2 A;  4YOV A;  3NMU A;  4K0K K;  5D3G A;  4JKA A;  4BGB A;  2YNF A;  3PX4 A;  1W97 L;  1KVB A;  2OPP A;  3QIC A;  2G8U A;  3CD6 N;  1CZA N;  3J7A P;  4J2A A;  3B8A X;  3AVI A;  2HBL A;  4FOE A;  5HRS A;  3TTD A;  3TAB A;  4RW7 A;  1JLQ A;  5FRM A;  3VA0 A;  2BTF A;  1MWM A;  4CD3 A;  4AHS A;  4XEI A;  1VSL A;  2PZS A;  2WOM A;  3C65 A;  5FPM A;  3A5N C;  3TI0 A;  3WNG A;  2FJ9 A;  3L8B A;  5BN8 A;  3AO4 A;  5AQI A;  4RW9 A;  4DQ8 A;  3L3V A;  4CZH A;  4WQ4 C;  1BA1 A;  3GOI A;  4NXN K;  3RVC A;  4B3T K;  1VBH A;  1NGC A;  3DRS A;  4ISE A;  4K41 A;  1BIS A;  4CES A;  2HHQ A;  1VSI A;  1Q82 O;  3LM9 A;  4DU4 A;  3CCJ N;  3SQ4 A;  4LSN A;  1SL2 A;  2QK9 A;  1JLC A;  3B6O A;  2F4V K;  3BZC A;  1N36 K;  3VOV A;  1OH6 A;  2FBY A;  5DK5 A;  3VTH A;  1RT4 A;  2FSJ A;  3O08 A;  3ZT0 A;  4JD2 A;  4JHD B;  4JKG B;  1NK6 A;  2HHW A;  1IBL K;  2WBN A;  4JKC A;  3VEO A;  2IVN A;  2ASO A;  3HL8 A;  3WEE B;  5KRS A;  1RT5 A;  2HB5 A;  4FWS A;  4EHT A;  4LY7 A;  2IC3 A;  2P9K A;  3R3L A;  3P38 A;  3OYJ A;  3QO9 A;  2A42 A;  2WUS A;  2PYL A;  1SKS A;  2UXD K;  3MX5 A;  3OS1 A;  1XNQ K;  3H1V X;  2O8B B;  4EIA A;  4FWK A;  4RCH A;  3TAN A;  1O13 A;  1MWK A;  1Z6R A;  2OCE A;  2RKI A;  3O1W A;  3CCV N;  3R9P A;  4DR5 K;  2XHB A;  4HWI A;  3S41 A;  2ATQ A;  4WQ5 A;  3ZSV A;  4PKG A;  3VET A;  2EMS A;  4FWN A;  4TKN A;  4BRN A;  4M3Z A;  5M1K A;  3A5M C;  4FWL A;  2ITM A;  1TK8 A;  3RTV A;  4OVL A;  2A1R A;  3LDO A;  1CZ9 A;  2P9K B;  4DTS A;  5C42 A;  1ZBI A;  3P31 A;  1HYV A;  2XY7 A;  2O8C A;  2A6A A;  3U9Z A;  1ISN A;  3O9U A;  2D0O A;  3SI6 A;  3T19 A;  3NGZ A;  4GNI A;  3UKU A;  2J0K A;  2Z1G A;  5IJM A;  2RPI A;  3KWI A;  4BG9 A;  3DLL L;  4M7X A;  4DTM A;  3ZSO A;  3U9D A;  3SYZ A;  4CFC A;  4DLE A;  2WFB A;  1RDA A;  3F5T A;  3H6E A;  4BQZ A;  1HUX A;  5BRD A;  3D2E B;  4CK1 A;  2GUP A;  2OTJ N;  3KKR A;  3VEY A;  4B1X B;  4PL7 A;  3EKS A;  2KZM A;  4AM7 A;  1D8Y A;  1HBK A;  4OPJ A;  2BUP A;  3NVK A;  4DTO A;  3KHY A;  3DWL A;  3T1A A;  3NVM A;  3C95 A;  1QQM A;  3IS9 A;  4FJ7 A;  3LDL A;  3GL1 A;  3KK7 A;  3DXK A;  3VQC A;  2FBV A;  4LH5 A;  3WNF A;  3AA4 A;  1NK5 A;  5HL7 L;  2A5X A;  5KI6 A;  3VQQ A;  4KRE A;  3AO5 A; 
#chains in the Genus database with same CATH homology
 4JD2 B;  3EKU A;  2NRW A;  2RE2 A;  1BDG A;  3GG4 A;  5E26 A;  3VEX A;  2I1J A;  2VWB A;  5AFU H;  1MDU B;  5EY4 A;  1TUY A;  1EQY A;  2P9N A;  3WUH A;  4L3Q A;  3DJC A;  4YOR A;  5AQK A;  5I9E B;  1GLA G;  2UYT A;  1HLU A;  1KBL A;  1KC7 A;  1KAY A;  4FWQ A;  1HKC A;  3ID8 A;  3ZEU A;  1NGB A;  3BF3 A;  4YOT A;  4BR7 A;  4F9O A;  5ADX H;  1GC6 A;  1JJ2 M;  3MMV A;  4A57 A;  4JHD A;  3KZB A;  1IG8 A;  2FF3 B;  3CQY A;  3BP8 A;  3ATV A;  4YOX A;  3L4Q A;  4JKB A;  4BGA A;  4BRA A;  3MCA B;  2HBJ A;  2FSN A;  5AQG A;  3TTC A;  3CCR N;  3KWG A;  5BRH A;  3W3D A;  2GWK A;  4JN4 A;  3AY9 A;  4P7I A;  1KD1 O;  1ACA A;  4O8U A;  4C1N I;  1HJO A;  3ENH A;  3M3Z A;  2QWM A;  3TPQ A;  3A5L C;  4A2A A;  2E2Q A;  2D11 A;  2HE7 A;  2NRX A;  5JLF A;  1V4T A;  3WXL A;  4AM6 A;  3SAG A;  1E4G T;  2A41 A;  3CJC A;  3EE9 A;  1NJI O;  5EXW A;  3C6H A;  3P4I A;  3QFP A;  2YX6 A;  1ATN A;  5ELZ A;  1JDE A;  1MA9 B;  5M1P A;  3VF2 A;  1YAG A;  3CJB A;  3IUC A;  2X0S A;  1YHQ N;  2DIK A;  4GXB A;  2E2P A;  3IKM A;  1NGH A;  3Q7C A;  4XH1 A;  1VQP N;  4E1J A;  2BH1 A;  3LDQ A;  1HKB A;  3MX2 A;  4YDU C;  3DLL L;  2QTD A;  2V52 B;  5C2D A;  5GAE P;  1QVG M;  3WXM B;  2YI1 A;  4JK9 A;  2QWO A;  4PL8 A;  3L0Q A;  4YOW A;  4JK7 A;  4YOU A;  2ZJR L;  3O8M A;  4NO7 A;  4BG8 A;  4IFE A;  3IFR A;  3G6E N;  4CZM A;  2FSK A;  3LM2 A;  4JKD A;  2NRR A;  1Y19 B;  3FFK B;  1NGE A;  4BVO A;  3EPY A;  1EF1 A;  2D1K A;  4EFH A;  3SBT A;  1EO1 A;  3VEV A;  4CJ7 A;  2WC9 A;  3J8A A;  3HSC A;  3U4L A;  5BRE A;  3H46 O;  1BA0 A;  4BR4 A;  1ESV A;  3UB5 A;  3AAQ A;  4IOA L;  4ILJ A;  3SMS A;  2NNW A;  3CC2 N;  1TUU A;  4BRD A;  5C0Y A;  3F9M A;  3R6M A;  2RQ1 A;  1GLJ O;  2Q1N A;  3WT0 A;  4CZK A;  1K8K B;  4H5V A;  4B1V A;  1DGK N;  5MLC Q;  1NGI A;  1RGI A;  5JMV A;  5F1X A;  1YIJ N;  1DIK A;  1GLC G;  4BQL A;  3C7N A;  5CHI A;  1Q81 O;  4DB3 A;  5GAH P;  4MO4 A;  1SGH A;  2P9U A;  2FDQ A;  2HOE A;  1X3M A;  3AGK A;  1GLL O;  4QS7 A;  4XH5 A;  4H0T B;  3OHR A;  1T6C A;  3U7D A;  1YJW N;  4O8K A;  1QZ6 A;  2LBB A;  2COP A;  4WFB L;  1OKJ A;  1BO5 O;  4EAH D;  1KQS M;  1VQ6 N;  2YJF A;  3TU5 A;  5BPM A;  1KAX A;  3UKR B;  2D4W A;  4BRP A;  5E84 A;  1QZ5 A;  5LY3 A;  4FPA A;  3J7Z O;  1VQ9 N;  1RDU A;  3I33 A;  2CH5 A;  2D10 A;  2E1Z A;  3D2F A;  4JKF A;  3FZM A;  4H5W A;  4NLC A;  2RHK A;  4GY2 B;  2QWN A;  3OBW A;  3VGK A;  3FE1 A;  5BPN A;  3CJ1 A;  2KHO A;  3CCE N;  1J6Z A;  2NRV A;  1M90 O;  1XQS C;  4H5R A;  4H0P A;  3HZ6 A;  3F2K A;  2QI2 A;  3EE8 A;  4PKH A;  4QS8 A;  3TSQ A;  4ZRI A;  3VF4 A;  2I7N A;  2V7Z A;  1GG3 A;  2F9T A;  3AU4 A;  3QFU A;  2WH5 A;  4B1U B;  1NMD A;  5JVH L;  3WXI A;  1Q7Y O;  3G9W A;  3OBY A;  3M1F A;  1C0G A;  2P9S A;  5AZI A;  4FWP A;  4JEP A;  1VQO N;  3FLV A;  4OPH A;  4OO1 J;  2IVO A;  1U2V A;  3DXM A;  5BR9 A;  2VGM A;  1ILY A;  2GWJ A;  2EMT A;  4IEE A;  3SAH A;  4IEI A;  1SAZ A;  4B1Z A;  2Q97 A;  1NGF A;  2CGK A;  3CCU N;  2QEX N;  3C7N B;  2HRJ A;  2ZWH A;  3GE1 A;  5GAD P;  2ASM A;  2D2Q A;  3FP5 A;  2FXU A;  1XC3 A;  2E20 A;  4IJA A;  3I55 N;  4CI6 A;  2J0J A;  1NGG A;  4MDB A;  2HBM A;  4BC5 A;  3MWP A;  1JCE A;  4FL9 A;  1NI2 A;  1MK7 B;  4BR5 A;  1MIZ B;  1T3V A;  2CGL A;  5M1N A;  3BF1 A;  2KKZ A;  2VGN A;  3D2E A;  5C15 A;  1S72 N;  5FPN A;  4OPA A;  1VQ4 N;  1BU6 O;  4KH6 A;  4BRG A;  5AZI B;  1GC7 A;  5KPT A;  2P9S B;  2QWP A;  2YHW A;  4IXC A;  4H0Y B;  4BC4 A;  1HKG A;  3ENO A;  3E9O A;  4WFA L;  1Q86 O;  1VQK N;  1LCU A;  2CB8 A;  3N4P A;  3O6W A;  4BRF A;  3WQT A;  4CD1 A;  3VEZ A;  2VYP A;  3VPZ A;  2OAN A;  2ZPY A;  1X3N A;  2QW9 A;  3SBG A;  3HOS A;  3A0I X;  3BEX A;  4WQ4 A;  3CXC M;  4GV6 A;  3CMA N;  2ZGZ A;  3H3O B;  4BRL A;  3ATU A;  4RTF D;  3OA9 A;  4F7G A;  2EWS A;  5EOY A;  2E88 A;  3RSE A;  3WQU A;  4CBW A;  3HTV A;  4C1N K;  3R1X A;  3A8Y A;  3FZF A;  4M7Y A;  3K9K A;  4IJN A;  1TYQ B;  4YL8 A;  4CZE A;  1VQ7 N;  3CJ9 A;  3QIJ A;  2W41 A;  1WUA A;  2R82 A;  5EX5 A;  3UKR A;  4K42 A;  1TYQ A;  1Y64 A;  3VGL A;  3CJA A;  3QML A;  1NWK A;  4H5T A;  4BRI A;  5GIP A;  4U7B A;  2HMP A;  2YHY A;  3ZX3 A;  3SAF A;  5AQL A;  3U8Z A;  4PHT X;  3P39 A;  3E9L A;  4IWV A;  4EHU A;  1U2V B;  3RSE B;  2A40 A;  1BWF O;  1T44 A;  2NRT A;  4CZL A;  3MN7 A;  5M1F A;  4A61 A;  5EVZ A;  4BC2 A;  3O9T A;  4C23 A;  3N4Q A;  2NRH A;  4CZJ A;  2E2O A;  4MO5 A;  4BRK A;  3SMP A;  1YUW A;  3ZYY X;  3MN9 A;  5JLH A;  1OVY A;  5JVL A;  3EZW A;  1HX1 A;  1YJN N;  1VQ8 N;  3JS6 A;  5AQR A;  2QWL A;  5BRF A;  2HF3 A;  2E1Y A;  2HST A;  5HOO A;  4BR0 A;  3D2F B;  3VTI A;  2J4R A;  5AZJ A;  3BIN A;  2F7T A;  1BOT O;  4FSV A;  2E2N A;  5AQM A;  4R79 A;  1E5W A;  1YVN A;  3CHW A;  3DXM B;  3VMF B;  3PZD A;  5F0X A;  3MCP A;  2Q0U A;  1RDW X;  4LC9 B;  1W2B M;  2Q0R A;  1KC8 O;  3Q7B A;  4WCE L;  1GGO A;  3QBW A;  4XH4 A;  4IO9 L;  2PBD A;  3CET A;  5KPZ A;  4JKH A;  2GEL A;  1N8R O;  2V51 B;  3VEW A;  4J8F A;  5AQY A;  5CR4 A;  4Z94 A;  1K8A O;  4G9Z A;  3TSU A;  3DXK B;  3O1B A;  1GLB G;  3KVG A;  4NB4 A;  4NLB A;  3C6A A;  3I8B A;  5H1S Q;  3O5B A;  2FF6 A;  3CPW M;  3CCQ N;  3WXK A;  3FZK A;  4WF9 L;  1KAZ A;  4CBX A;  1S22 A;  2A3Z A;  2GTD A;  4JKE A;  2ASP A;  4ZRK A;  2QWQ A;  1NVL A;  3O9Q A;  3CC4 N;  3ULE A;  1VQ5 N;  3VF6 A;  3UE5 A;  1R59 O;  4DKW A;  5FPE A;  2P9N B;  4K43 A;  4PKI A;  3CCL N;  3TSP A;  3VEN A;  1H4R A;  2YCH A;  3JXU A;  5GIN A;  3ENB A;  4DCH A;  5M1O A;  4BRQ A;  1GLF O;  1VQM N;  4IOX A;  1NGJ A;  5TKY A;  3FR0 A;  3BUZ B;  3O80 A;  4WQ5 C;  1BUP A;  1X9J A;  5GAG P;  4M63 C;  4QS9 A;  2QXL A;  4ISG A;  3G71 N;  3CCS N;  4YOV A;  1NGD A;  3K9J A;  3NMU A;  3FGU A;  5AQS A;  4JKA A;  4BGB A;  2Q31 A;  1ST7 A;  3TTF A;  4WFN L;  3CCM N;  3AAP A;  5DM7 L;  1W97 L;  3QIC A;  5AQU A;  1XUP O;  3CD6 N;  3G25 A;  1CZA N;  2YJE A;  4ISF A;  4A62 A;  3G4S N;  1QQO A;  2JWK A;  3IDH A;  3QB0 A;  2HBK A;  3ZEU B;  3FZL A;  3B8A X;  1K8K A;  1Q18 A;  2HBL A;  3D7E O;  4FOE A;  5AQX A;  5M1Q A;  1JCG A;  5C12 A;  1NGA A;  5AQP A;  5CE3 A;  4YOY A;  3A5O C;  3HM8 A;  3LDP A;  4FWM A;  3TTD A;  4B1Y B;  4BRC A;  4IOC L;  2BTF A;  1VQN N;  1MWM A;  4CD3 A;  4BR2 A;  3H3N O;  5AQW A;  2GX9 A;  2NLX A;  5AQF A;  4XEI A;  4CZI A;  4CZF A;  3QDK A;  1LOT B;  1QVF M;  3PIP L;  5F2R A;  1S3X A;  3C65 A;  3X23 A;  5FPM A;  4H5N A;  3A5N C;  2FJ9 A;  1HPM A;  5BN8 A;  2YVC A;  1QQN A;  2J0M A;  2P9P A;  4KH5 A;  2ZJQ L;  5AQI A;  3L4I A;  4DQ8 A;  1K9M O;  1DT9 A;  1SZ2 A;  4CZH A;  3CIP A;  4WQ4 C;  1BA1 A;  3GOI A;  3CC7 N;  2ABD A;  4JK8 A;  5AQT A;  3HI0 A;  3CPE A;  3RVC A;  2P9I B;  3ZET B;  3EO3 A;  5KPR A;  1HB8 A;  1VBH A;  3GDQ A;  1NGC A;  3ID6 A;  4ISE A;  4K41 A;  4FO0 A;  4BRE A;  3MDQ A;  3SLC A;  1VBG A;  4I6M B;  3LDN A;  1K73 O;  5ADX A;  2ZJP L;  1MIX A;  1Q82 O;  3ZDT A;  3LM9 A;  4YDU A;  5AFU A;  3CCJ N;  1C0F A;  1YJ9 N;  1ATR A;  1J19 A;  3ZX0 A;  4MDA A;  4IO8 A;  2YHX A;  3WXJ A;  5FPD A;  3PLA A;  3VOV A;  1DEJ A;  3PVL A;  1YXQ A;  3CJ7 A;  2FSJ A;  3O08 A;  5AQN A;  3VTH A;  1ATS A;  2PAV A;  4A59 A;  4NY0 A;  1JCF A;  4JD2 A;  2Q36 A;  1P90 A;  1VAZ A;  4MLH A;  3O9S A;  3WEE A;  4JHD B;  2P9U B;  5AQH A;  3R8E A;  2VCP A;  5LJV A;  1YIT N;  3C0B A;  4BY9 C;  3HRG A;  3U8X A;  4JKG B;  2I1K A;  2OTL N;  2WBN A;  4JKC A;  3VEO A;  2IVN A;  2ASO A;  4FPB A;  3WEE B;  4EKU A;  4FWS A;  3M6G A;  4EHT A;  2P9L A;  5AQZ A;  4CBU A;  3T7Z A;  3GBT A;  4ZRJ A;  3UKU B;  3CER A;  5BN9 A;  4MLE A;  4B1W B;  3H45 C;  3VES A;  5AZJ B;  4BRH A;  4I6M A;  1IJJ A;  2P9K A;  4H03 B;  4A2B A;  3R3L A;  4RWT A;  3HOT A;  4FVU A;  3P38 A;  2KLA A;  5AQJ A;  5AQQ A;  4BRO A;  2JWL A;  2A42 A;  4JNE A;  2WUS A;  4GV3 A;  3O9R A;  3W0L A;  2NZT A;  2QWR A;  3SJH A;  3MX5 A;  2QA4 N;  3OW2 M;  4GV9 A;  4KBO A;  3H1V X;  2AA4 A;  4EIA A;  4FWK A;  1G99 A;  4RCH A;  4A5B A;  2PFU A;  3EN9 A;  4B9Q A;  5KQD A;  4CYE A;  2AEH A;  1O13 A;  1MWK A;  1Z6R A;  5BPL A;  3PIO L;  1P8Z A;  1T6D A;  2ZGY A;  3O1W A;  3SK3 A;  4O5F A;  2W40 A;  3CCV N;  4JKG A;  1SS6 A;  2V7Y A;  2DPN A;  4HTL A;  3R9P A;  1M1K O;  4HWI A;  3MWT A;  3S41 A;  4WQ5 A;  3VGM A;  4HDO A;  4PKG A;  1KXP A;  2IIR A;  3VET A;  2EMS A;  4FWN A;  4TKN A;  2NRZ A;  1V4S A;  4BC3 A;  4BRN A;  2AL6 A;  4GVE A;  3VER A;  3D6R A;  1BG3 A;  5M1K A;  1D4X A;  3A5M C;  4FWL A;  2ITM A;  4AF1 A;  4WYB A;  1HB6 A;  3AU5 A;  4HDQ A;  2AP1 A;  3IVF A;  3LDO A;  3E9P A;  3QBX A;  3CME N;  1H1V A;  2P9K B;  4IDH A;  3ULE B;  3P31 A;  3M5R A;  3AAR A;  3IMX A;  4IZ9 A;  1ZBS A;  2E8A A;  3MK6 A;  5AR0 A;  3E1Y A;  4BRM A;  4ILH A;  2A6A A;  4BVP A;  1SQK A;  1ISN A;  3U9Z A;  5C2F A;  5LJW A;  3O9U A;  2D0O A;  1NTI A;  5B8H A;  5KQ8 A;  2P9I A;  1ZC6 A;  4H0V B;  3ZET A;  3I56 N;  3DAW A;  4GNI A;  1GLD G;  2CH6 A;  2CQU A;  3UKU A;  2J0K A;  4ILG B;  5IJM A;  1WOQ A;  3KWI A;  4BG9 A;  4H0O A;  1DKG D;  2P9L B;  2H3G X;  4JAX A;  1NBW A;  3L6Q A;  4M7X A;  1ZXO A;  3CQX A;  3U9D A;  4FWO A;  4UY8 O;  1NM1 A;  2P9P B;  5AQO A;  1YI2 N;  3O4W A;  3CF5 L;  2F9W A;  2WFB A;  4FWR A;  4DHY A;  1QHA A;  3F5T A;  2Q2R A;  3H6E A;  4BQZ A;  1HUX A;  5BRD A;  4Y0W A;  2D0P A;  3D2E B;  3MN6 A;  1U6Z A;  2GUP A;  1RFQ A;  1Z05 A;  2OTJ N;  3VEY A;  4B1X B;  4CZG A;  4A5A A;  4BR9 A;  4PL7 A;  5GIO A;  5DM6 L;  3EKS A;  4AM7 A;  3T69 A;  4DXA B;  1HBK A;  4KH4 A;  2BUP A;  5JIC A;  4H0X B;  1GLE G;  3FZH A;  3HBT A;  3EL2 A;  4U67 L;  3NVK A;  3KHY A;  3DWL A;  3NVM A;  3FLC O;  5C10 A;  1QQM A;  3H1Q A;  5JVG L;  2I7P A;  3LDL A;  3LL3 A;  3GL1 A;  3KK7 A;  3MN5 A;  1YF5 L;  3AGR A;  3DXK A;  1VQL N;  1NLV A;  1MK9 B;  2IVP A;  2FLO A;  3ZX2 A;  3E66 A;  2CGJ A;  1E4F T;  4K25 A;  5HL7 L;  2A5X A;  5TKW A;  4FOI A;  2GEM A;  2HF4 A;  2ZF5 O;  2QM1 A;  3CI5 A;  3WA0 A;  5AQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...