3ENBA

Crystal structure of prp8 core domain iv
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
219
Chain Sequence
b'LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title Structural elucidation of a PRP8 core domain from the heart of the spliceosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 62
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3enbA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3enbA01
4JK8A 4ILHA 4JKGA 4JKCA 4JKGB 3SBTA 4JKAA 3ENBA 3E9PA 4JKHA 3E9LA 3E66A 4JKDA 3E9OA 4JKEA 3SBGA 4JK9A 4JKBA 4ILJA 4JKFA 4JK7A 4ILGB
chains in the Genus database with same CATH superfamily
3Q7CA 2G8VA 5JVHL 3HVTA 4IFEA 4OPJA 5CR4A 1RTIA 2Q36A 3OW2M 1QVGM 3L8BA 4CEZA 5FRNA 1YJWN 5AZJB 4FL9A 3I0RA 4B8AB 5SZTA 3QBWA 2KLAA 5AQYA 1EX4A 1W0HA 4EP5A 3QLHA 4MLEA 3O9UA 1VSIA 2NUBA 4H03B 3WXKA 1RT3A 4Z4CA 1VQPN 1YT3A 4IOCL 4H0PA 1BISA 3OS2A 3P5JA 4JK7A 4B9NA 3BGRA 1JCEA 2O8FA 1QSSA 4FLUA 4BRAA 3ZT3A 3CCLN 3WNFA 3NGZA 4DR1K 4M3WA 3D45A 2CH5A 3LDNA 4DWIA 1NGBA 4DTPA 1WAFA 1SV5A 3QEXA 2P9NB 4DV3K 1NJXA 2B4JA 4FW2A 4H0YB 1EKEA 3P1GA 2OANA 3VQ9A 2YNFA 1VQ8N 1VSMA 4JLHA 4NB4A 2COPA 3AO3A 4FJIA 4Z4GA 4FJLA 4G1QA 4JI4K 2V7ZA 4FPBA 5AQXA 1QSYA 4CF0A 4CZMA 4J2EA 4FW1A 2BDPA 3ISNC 5BR8K 2F4VK 1VBHA 1S1WA 4KH6A 1EETA 4FLWA 1IG9A 4BC4A 4E7HA 5AQKA 1BQNA 3GBTA 1GOBA 2IVPA 2G8HA 4HVJA 4QOZB 2Q2RA 1SKWA 1Z26A 4YOXA 1KQSM 1DGKN 4M3YA 5HBMA 1VQNN 5ADXA 5AQJA 2HNZA 2XO7A 1TK8A 3ZEUA 2J4RA 1HJRA 4LSNA 4DSEA 4BGBA 3JAMO 3KIOA 3DXKB 4C8NA 5AQMA 4DXAB 1WN7A 2P9PA 3ITHA 2WFBA 1LAWA 2WC9A 1SUQA 2P5OA 1VSFA 3CCEN 2UXCK 2ITMA 2BTFA 1U49A 2YVCA 2OPRA 3BF1A 2LBBA 4FWSA 3R8EA 4CESA 1ZXOA 4B1VA 3AVFA 4CJ4A 3K0SA 4CERA 2E4LA 3NF6A 1TGOA 2YHBA 5KI6A 4FYDA 3WNEA 4IEEA 4O5BA 4CEAA 3WXLA 1HQEA 4KO0A 1S72N 1HBKA 4BR2A 4B1WB 3EYZA 4LC9B 1S1VA 3TI0A 4F8RA 5F2RA 3DLHA 4H5VA 5JS2A 3O6WA 3P4IA 4OO1J 3U8ZA 2CH6A 1RTHA 2E2NA 4DQPA 1YI2N 4KHPK 3V1OA 4MO5A 4FLVA 1NVLA 1GLFO 3UE5A 1N34K 3VEXA 4EP4A 1P90A 3VQ5A 4CF1A 3OBWA 3ZYYX 3EKSA 3HO1A 5C42A 5KTQA 2QWPA 4OGEA 1NNEA 1H4RA 2RE2A 2OCEA 1MK7B 3G6EN 4EHTA 4IWVA 1HNZK 1O13A 3CI5A 4DS5A 3ZT4A 4FO0A 3H46O 4ELVA 4JI3K 2QWLA 1UA0A 2V7YA 3UKUA 3WUHA 3OYDA 2YJEA 1C1CA 1S22A 3PIOL 1B9FA 4A59A 4HUGA 3EO3A 4E7JA 3D7EO 5AQLA 1GLAG 2YNHA 3R9PA 3EE8A 4PKGA 3C6HA 4IOAL 2G8IA 4LY7A 2ZF5O 4U67L 4KHQA 4E1MA 3HOSA 2RHKA 2PZSA 4Q0BA 5HRNA 4CFDA 3T19A 1S6QA 1UA1A 3C6UA 3HK2A 2Q31A 5EX5A 3F9MA 1GC7A 4BR7A 4V19S 2P9IA 4C8LA 2E88A 3S3OA 4K8ZA 3OHRA 3MXMA 1SZ2A 5C2FA 1VRTA 2AA4A 3P83D 3DRRA 1WNSA 5HRRA 4C8KA 4CJTA 1S1UA 4JKGA 4E1NA 4PHTX 2D5RA 3OYKA 3VEYA 3EPYA 3EL2A 4NCGA 3MEGA 3MEEA 2QWNA 2Z1HA 3HPHA 2Q0UA 1BIZA 1EWRA 2IGIA 1HMVA 3U3GA 5FPDA 4DQIA 4WQ4A 1KFDA 4CK1A 3HRGA 1B92A 3CETA 3U7DA 3AO4A 1FK9A 4CEQA 3OS0A 4CFAA 3ZSQA 4ISFA 3CQYA 2JWKA 1TKDA 4EIAA 3M3ZA 3NVMA 2NRXA 3LANA 3PX6A 4CHNA 1BIUA 3THVA 3CM6A 3MXIA 4M3ZA 2VCPA 1VSHA 4I2QA 3O8MA 4BE2A 4CFCA 1ITGA 4O4GA 2W41A 3C95A 4AQYK 3VGLA 1T8EA 3VQCA 2GX9A 5MLCQ 2HOEA 4DV6K 2G8FA 3M8QA 1BDGA 4DU3A 3PO4A 4L8RB 4JI6K 1EWQA 5DM6L 2P9LB 2Q97A 1R59O 3KK2A 2XRIA 1K73O 4J2BA 4DQQA 4WFNL 3VESA 4DV2K 3AAPA 4H5WA 3EZ5A 3KK7A 2Y1IA 4EZ9A 3OYGA 4J2DA 4YOYA 3J8AA 4XH1A 3H1QA 2HBMA 3FR0A 3LPUA 1NOZA 1NGCA 2YX6A 1BL3A 1JLCA 4J8FA 1YTAA 2P9KB 5EVZA 1NK8A 1GG3A 4FWOA 1JLAA 3RSEB 3OS1A 1GLCG 1Y64A 3KLEA 4O8KA 3TR8A 4ILHA 1E3MA 3AO5A 2ZD1A 3AVNA 3VQAA 3FLCO 4NXMK 3V9UA 2IVNA 1MIZB 4AHCA 1RDWX 3VF4A 2Z1JA 3JYTA 1ASVA 3EZWA 3QO9A 1WSHA 2EX3A 1H1VA 2BH1A 3ZETA 1N36K 3M1FA 4CECA 4X65K 4BE0A 4MQ3A 3CFPA 4FK0A 1R0AA 2HHXA 2YHXA 4PQUA 4QS9A 1IKWA 4RW4A 3GG4A 3AAQA 4WQ4C 2DTUA 4Q5VA 3C7NB 3AU5A 3LP2A 3FZMA 3S3MA 4LH4A 4CIFA 2VQEK 2OTJN 5BR9A 1C0TA 4ZRIA 3CC4N 2UYTA 1YVUA 3SV4A 5JLHA 1HLUA 3SAFA 4OX9K 1RT4A 3IS9A 3NGYA 2UUCK 4NLCA 4A57A 3NE6A 3K57A 1E4GT 3DWLA 2X6SA 4CCHA 2NZTA 1DEJA 3WT0A 3OYEA 3D0PA 3TAGA 5GIPA 4CJFA 4WQ5A 5IWAK 3ZSOA 2A5XA 4LFAK 2I7NA 4MDAA 3WXJA 3CF5L 3I8BA 1SL0A 3O3HA 4A62A 1HNIA 5KPRA 3VQ6A 4HHTA 4FM0A 1BO5O 1ZBHA 1VBGA 3TAQA 2DFEA 3T69A 4YOVA 2AEHA 1ZBSA 1ZYQA 1T6CA 3SLCA 3FZLA 1MIXA 1WSIA 3LDPA 3ZSYA 4IBNA 2KFNA 3ZSRA 5EY4A 2QTDA 3RMDA 3D2FA 1RDCA 3RMCA 1ESVA 3HZ6A 5AQWA 4WFBL 4N5SA 4JS4A 4PUOA 3RVCA 4A2AA 1L3SA 3CCMN 3AVGA 4BC2A 3IVFA 1OVQA 1JCGA 3DOKA 2E1YA 3K9JA 3ALYA 3SAGA 4BRDA 5AQOA 4O44A 1FJGK 1VK0A 1FKPA 4KTZA 1HPMA 3J81O 4JKBA 2HHSA 1X9JA 1XHZA 3NH1A 5C0YA 3MWTA 1KVCA 2P9SA 1J53A 5CY4A 5CYMA 5M1NA 3KJVA 4XEIA 5C2DA 5I3UA 3UIQA 3L6QA 1VSEA 3U9ZA 4N56A 2HBJA 2WBNA 4H8KA 3MMVA 3VQ7A 3NF8A 3ZT1A 1B9DA 3SV3A 2ETJA 2A1SA 1N33K 1KLNA 3BINA 4CFBA 2VGMA 4DR3K 2X6NA 3X23A 1ILYA 1XMOK 3T1YK 1QZ6A 1A5WA 2ZE2A 4DR4K 1G15A 2NLXA 3AVHA 3SJJA 1KVAA 4OPHA 4NY0A 4H4OA 4BREA 3MCAB 2BGGA 4FWKA 2KZZA 2NRHA 2HB5A 3HOTA 4DU1A 1E5WA 4O5FA 5EU7A 5C25A 4GVEA 5AQGA 3SNNA 1U2VB 3GOIA 4CGFA 3IRXA 4W5TA 4H0OA 2ATQA 1VAZA 4CK3A 3CJ9A 3U8XA 4CIEA 2D10A 1A5XA 3THYA 3HXMA 1FW6A 1ASUA 4DFPA 1BUPA 5JLFA 2JLEA 2DIKA 4YNQA 5FROA 2D2QA 5HL7L 4GV9A 1WSFA 1I3AA 1CZ9A 4IO9L 1MDUB 4CJVA 1L3VA 1RDBA 3P38A 2GELA 1W97L 3B6OA 3KLGA 1TVRA 2G8UA 3K58A 4HCBA 2O8EA 2KFZA 4JN4A 1S3XA 3ZSWA 5BRHA 4FXDA 3OVNA 5F0XA 4FJKA 3VOVA 3HM9A 1CXQA 1XWLA 3PVLA 5ELZA 4YHHK 1QQMA 1HNWK 2EWSA 3TWHA 1NJWA 5BRDA 3KD5E 4IZ9A 4LF9K 3AVAA 3KLIA 1K8KA 3QMLA 1NWKA 1JCFA 4C8OA 3AVIA 1W9HA 4BROA 4FJXA 4O0JA 2UXBK 3MWPA 3O9TA 4BG8A 4BRPA 3MK6A 1NK7A 3TTCA 4CHYA 4RW6A 3EN9A 2D4WA 3KWIA 1ST7A 1TL1A 3TTFA 4AHVA 1LAVA 3ULEA 3RWUA 1EO1A 1X3MA 2NRWA 5TKYA 3P39A 3QDKA 2YV0X 2ZQBA 2UXDK 4BG9A 1CZBA 1NMNA 3NVKA 3AY9A 4FJ8A 3NH2A 3RRGA 5J2PA 1NGFA 1RBUA 1T03A 4Z4EA 5J2NA 2HBKA 2WH5A 1J6ZA 1GGOA 3L4QA 4FZXC 1BI4B 5AQVA 4B1XB 3SMPA 3ID6A 2I1KA 1QHTA 3SPYA 3DOLA 1C0FA 1C1BA 3R3LA 1IV0A 2IIRA 4FVMA 2HW3A 1VQ7N 5AQNA 1OH8A 5HRPA 3OA9A 3OBYA 3VETA 4E89A 4BC3A 4IJNA 1RCHA 1UAXA 3VEVA 1LW2A 1DIKA 4OJRA 5T7BA 4K8XA 3LALA 3Q7BA 4BDYA 5AQSA 5AQPA 1S1TA 4JD2B 4Y0WA 2X78A 3ZSVA 5FPMA 3PUFA 5M1QA 3ZDTA 1D5AA 5KQDA 3G10A 4PL8A 2OPPA 3ZX0A 5AQQA 3PY8A 4WF9L 4DF4A 4BE1A 3VQDA 4MLHA 1K9MO 4JK8A 1L3UA 1WLJA 4GW6A 4CK2A 4YY3K 3KLFA 4Z4HA 3TU5A 3LDOA 5HRSA 2CQUA 4JS5A 4KHUA 1KAXA 4F3TA 4ZRJA 2O8CA 4BQLA 3TSPA 4OKEA 4M42A 3K5NA 1BU6O 1VRUA 1NK4A 2W6LA 2QKBA 3F9KA 3H3OB 4KKOA 2FBXA 1KVBA 2Q0RA 4M45A 1ZBFA 1NK0A 4KHSA 2Z1IA 1KAYA 1NG9A 3CCQN 3PZDA 4JKDA 4RW7A 4HTLA 4WCEL 4JNEA 4OKKA 2CGLA 2XY6A 1X3NA 3NHGA 3SZ2A 5LJVA 2X74A 1QQOA 3UB5A 3CQXA 2O8DB 2IC3A 5KRSA 2HNYA 4CJWA 1E4FT 1JL2A 2FSJA 3V1QA 4O8UA 3VF6A 1RDUA 2YHAA 4I9QA 2ZWHA 3O5BA 3OYFA 3VQ8A 1M1KO 2AP1A 1YIJN 3FP5A 4RW9A 3O3FA 2E2PA 4E0DA 2CGJA 3BF3A 1VQ9N 3K5LA 1J54A 4FSVA 4PA1A 2HF3A 3UKRB 3D2EA 2ABDA 5JS1A 2W6KA 3HPGA 4A2BA 4DQ8A 3VQEA 4PY5A 2ASMA 4BVPA 4CZFA 5GAEP 3V9SA 1S6PA 4RW8A 1W7AA 5AQHA 1FXXA 3LWMA 3LM2A 1YITN 1CXUA 2QK9A 4DSKA 2GWKA 3FZKA 3QB0A 1RT7A 1WOQA 3O4NA 1LWEA 3VTHA 4AM6A 4CZGA 4DG1A 4EZ6A 2PYJA 4K25A 4ZRKA 3K5OA 2IAJA 4FWMA 3VEWA 1WBBA 1EP4A 2ZM6K 4AHUA 3VQ4A 4DV1K 1DTQA 3CXCM 4GY2B 5AZJA 3FE1A 2B5JA 2H3GX 2D0AA 1MWMA 3ATVA 3IG1A 3W3DA 3O1WA 1OH7A 2NRZA 2A3ZA 2Y1JA 3NCIA 2BANA 3CERA 3AO2A 1IKYA 3FFKB 1S5JA 4B9TA 3PX4A 4GV3A 3AA2A 5DM7L 2QWRA 1KFSA 2HMIA 5K14A 3M5RA 4QCLA 5BN8A 4M3XA 4FPAA 1UOCA 4BRHA 4NYFA 4OPAA 3THWB 3MCPA 3G4SN 1RFQA 3DI6A 2QM1A 4CZLA 4IG0A 1C1AA 1RNHA 4FLYA 4YOUA 2DPNA 3KKRA 1TV6A 3HI0A 3IUCA 4HUFA 1IH7A 2P9NA 3I56N 3M8RA 3HYFA 3LDLA 2WTUA 1TK0A 4HCCA 3DJCA 2EMTA 1IO2A 1HJOA 2IDOA 1J9AA 1JLFA 2OPSA 3L4IA 4HUEA 1SQKA 3NMUA 1JXBA 5GAHP 3F73A 5E26A 2A1RA 3BZCA 2P9UB 4FWPA 3AVKA 3KZBA 4KB1A 3SQ0A 3THXB 1VQON 3D2FB 4NLBA 4A5AA 5D3GA 4I6MA 4DKWA 4JRPA 4HTUA 4JK9A 5ADXH 1TAQA 5BPLA 1QQCA 3QFUA 4BRMA 5E41A 1U04A 4JI1K 2KHOA 5HOOA 1NK9A 1NLVA 2QA4N 4CEOA 1T6DA 4LF6K 1VSKA 1YF5L 1WSEA 4B9LA 1RDAA 3KWGA 3AGRA 3JS6A 4Z94A 4ICLA 4XH4A 4B1UB 4CD1A 3PSFA 4CJRA 2IVOA 4ELUA 3U6FA 1WBDA 4F9OA 3DXKA 1HNVA 3K2PA 2XHBA 4DSLA 3VMFB 4KV8A 3VGMA 4WE1A 1IBMK 5FPNA 2OZMA 3EY1A 4E7LA 1NJYA 4CBXA 1JJ2M 2F96A 2GUPA 3HPOA 4PKHA 2R82A 3QERA 2VGNA 2Q3SA 3C0BA 3VF2A 4DF8A 4LH5A 5GADP 2OPQA 2IS3A 2OA8A 4CGGA 1SKRA 5J2MA 2V51B 1RGIA 5AR0A 3WNHA 1W2BM 4FZZA 2FBVA 3VEOA 3CFRA 1TYQB 2HHQA 1NGIA 1NJZA 4M63C 2J0JA 1BCOA 4CGJA 3CC7N 3L2VA 2HNDA 3CYMA 4QAGA 1ZBIA 1CLQA 3O4QA 3VA0A 4DSIA 3LZJA 3LAMA 4K42A 2D0PA 1I39A 1ACAA 3LM9A 1U4BA 3A8YA 2P51A 4YOWA 3W0LA 5FLXO 2KTQA 1U45A 1NKCA 2KZMA 3HSCA 3OJSA 1WSJA 4I9LA 4HDOA 1BA0A 2G8WA 2RQ1A 2P1JA 3LDQA 1D9FA 2B6AA 4CYEA 3FFIA 4CZJA 4FLXA 4CW7B 5FDLA 1D8YA 4IG3A 2FXUA 4H4MA 3SAHA 4CHOA 2F8TA 4B9VA 4DFJA 5I42A 1VSLA 3AA3A 5EXWA 3SMSA 3BP8A 1ASWA 5AQFA 3AA5X 4G9ZA 3VQPA 3O80A 4CEEA 1BOTO 4W5RA 4DR2K 4GKJK 4GMJB 3TTDA 4JYAK 4ZHRA 1U48A 1Q18A 2FJ9A 5SWMA 4JHDB 1BHLA 3WQTA 3RMAA 4KHNA 3LL3A 4DR5K 3KLHA 5AFUA 1SS6A 4J2AA 4BQZA 3DLGA 5LMUK 1Q8IA 4NCBA 3DLLL 1JLGA 3B8AX 2CGKA 4CZHA 4ID5A 3LZIA 2A40A 3U9DA 4U7BA 2E1ZA 3DXMB 3BDPA 1ATSA 3CJAA 5BPNA 5GINA 4B1YB 3M8PA 2VG5A 2QEXN 5C12A 3CJCA 5BRFA 1Y97A 1BGXT 3QETA 4KBOA 3OYBA 1NKBA 1MWKA 4K0KK 4C1NK 2O8FB 4BR9A 1REVA 3SI6A 5TKWA 3FZHA 3QESA 3T1HK 2RPIA 1I94K 3PLAA 2JWLA 3OYMA 1KCFA 1QSLA 1Q81O 5LMNK 3A5NC 3LP0A 3ID8A 3ZLJA 2HSTA 4MDBA 1KC8O 3ASMA 1S1XA 4KH5A 3VENA 2D11A 4CJPA 4H5TA 5J1EA 2QKKA 1TUUA 1TUYA 2NNWA 5JMVA 1VSJA 4DV5K 4DUYK 1NTIA 4B3OA 1ZBLA 1Q9YA 2YJFA 1HYSA 4FOEA 5IJMA 1TKXA 3AA4A 3BEXA 4CBWA 1NU0A 2VG7A 3ZCMA 4M3UA 4ILJA 4Z4FA 4KTQA 3S3NA 3CC2N 5J2QA 5FRMA 4CJEA 1J5OA 3OYIA 1X9MA 3D6RA 3L2RA 1OH5A 5LL6Z 4BDPA 5AZIA 4M3TA 1IG8A 3IMXA 2FDQA 1XC9A 1HUXA 1HQUA 4WYBA 3MDQA 3ZEUB 4B9MA 3E9OA 2P9KA 3AVJA 3ULDA 2PFUA 3LP3A 4B9SA 2BE2A 2DFHA 4WQ5C 3G9WA 4GXBA 1KSPA 1LOTB 1UWBA 2RN2A 3VN5A 2KW4A 2F9TA 2P9PB 4DSFA 2FLOA 4CF9A 3KK1A 4JI8K 2I1JA 4FOIA 1M90O 4BY9C 4FJHA 3CM5A 3R1XA 2A6AA 4C1NI 1XMQK 3DLKA 4AM7A 4BRIA 3H1VX 3QEVA 4H5RA 3V9WA 3QFPA 2GWJA 1GLBG 4B1ZA 1KLMA 4DFKA 4PKIA 1RBTA 4DTUA 4LF8K 1MK9B 2WONA 2Z1GA 3S41A 4KRFA 4CEDA 2E2OA 4W5QA 2QWMA 3WXIA 4R5PA 3CCVN 1Q82O 4OPKA 1IBKK 2YHYA 3KK3A 3HJFA 4O0IA 3L0QA 3EE9A 5H1SQ 3ZT0A 4BR0A 3QEIA 1ATNA 4CZIA 2P5GA 4PWDA 1O1WA 1S9EA 3C7NA 3MX2A 1OKJA 2VWKA 2D0BA 4LD0A 4IDHA 4C23A 1T3VA 4JI5K 4R79A 4DTOA 5HLFA 3O9RA 3RR8A 1KBLA 1U47A 2HBLA 3R6MA 3ZX2A 4BDZA 2KQ2A 3OTOK 1T44A 1RT6A 4BRNA 3J7YP 3NBPA 1YAGA 3SQ1A 3A5MC 2ZJPL 2PAVA 4M41A 3TAEA 1VQ5N 2QW9A 1GLEG 4JI0K 5BPMA 4DB3A 3RRHA 1VSDA 4LF4K 3ZSXA 4BWMA 3MECA 2O8BA 4DV7K 5EOYA 3SUQA 4EHUA 1IKVA 5DMRA 4DTNA 1GOAA 2YKNA 2QWOA 4DTMA 4CHQA 4BWJA 4IFVA 3VTIA 4QS8A 3UKUB 2D0CA 1K8AO 1S9GA 2E20A 2IOCA 1LCUA 1YJ9N 3MEDA 3AVMA 4OKJA 3KD1E 3H45C 3T1AA 1Z05A 4ZTFA 4CZKA 4YL8A 1V4TA 1G99A 3CFOA 4CF2A 3O9SA 1Q7YO 1QZ5A 3WXMB 3G25A 1A5VA 1NGDA 3FLVA 4FJ5A 2D0OA 1J19A 3N4PA 4FZYA 1GLDG 1T05A 2P9IB 2X0SA 2E8AA 5GIOA 4BRKA 3ATUA 2ASOA 2ZGZA 1HX1A 2OTLN 5M1OA 1HRHA 1X9WA 4JKGB 1HKBA 3SBTA 4E7KA 1NGJA 2J0MA 3E9PA 3E66A 5KPTA 4KAZA 4GVMA 3HT3A 1RTJA 2UUBK 4Z4IA 3HVRA 1RBRA 1BCMA 4X64K 1LWFA 3SBGA 1KC7A 4CHZA 4ISEA 4FJMA 3L3UA 5A2QO 4XIUA 3RR7A 4FJJA 2GTDA 3GL1A 4CJ7A 3FZFA 3CG7A 1XUPO 3QBXA 1U6ZA 1YVNA 3OJUA 1YUWA 5AQUA 4IO8A 3M6GA 2ZJRL 4CI6A 4C8MA 4BR4A 2KKZA 3ZT2A 1JLBA 1ZBUA 2EHGA 3SCXA 4YFUA 1ISNA 3O4WA 4I6MB 1KD1O 4CGIA 4FJ7A 3NDKA 4N41A 3N4QA 2NRVA 3V1RA 3S9HA 2QXFA 2YCHA 3V4IA 4CHPA 3K9KA 2I5JA 1RT2A 5CE3A 1Q86O 4K41A 4CJLA 4X66K 1X9SA 5DK5A 4MFBA 2GEMA 4BR5A 3MN5A 1X1PA 3QNNA 3NF9A 1U2VA 2FSNA 1SAZA 3CCUN 3A5LC 5FPEA 3JXUA 1NGEA 3CQ8A 4DHYA 1ATRA 3FGUA 2XY7A 4JV5K 1NM1A 4LF7K 3WEEA 2HE7A 2HMPA 3V9XA 4DLGA 4I7FA 1VQLN 4FK4A 4CF8A 4DS4A 5HP1A 1SL2A 4Z0UA 3VERA 1WAJA 3PSIA 3CMEN 4CD3A 3F2KA 3C65A 1Z25A 5KGXA 1CZAN 4W5NA 3V6DA 4KPYA 3LP1A 3TSUA 2I7PA 1N5YA 4M7YA 1NK5A 3DLEA 1TL3A 4AHTA 4B3TK 4DTXA 4NXNK 3G71N 1N8RO 1JXEA 2F7TA 3DRPA 4NCAA 5KPZA 4FWLA 4M7XA 1YXQA 4DMNA 2GBZA 2G8KA 3HP9A 4OLAA 1MU2A 3O9QA 2HHTA 3QICA 3M8SA 3LPTA 2YHWA 1NKEA 3G0ZA 1XNRK 2WUSA 3ZETB 3PO5A 4N47A 4H0TB 3LAKA 1QTMA 4BRGA 4YORA 1KXPA 1QE1A 4NO7A 3WNGA 3TAPA 1QVFM 4F4KA 1N6QA 4B08A 2YKMA 3SUPA 3MXJA 4JI2K 1HB6A 1WUAA 4FK2A 2OZSA 4E3SA 3RTVA 3AVCA 1K6YA 5C15A 3H3NO 3CMAN 2NRRA 2J0KA 3TSQA 1WB9A 4LFCK 2QI2A 3DRSA 3E1YA 4L3QA 3J80O 4B3RK 1EXQA 4M3RA 3SUNA 1Q9XA 1C6VA 1BI4A 4OGCA 1GLLO 3J7ZO 4CJQA 2YNIA 3SPZA 4H0VB 2E6MA 3E9LA 3AU4A 4KHYA 3LWLA 4F2RA 3U3YA 3TANA 3NH0A 4AILC 3DAWA 3O08A 4B3SK 1XC3A 4CZEA 1VHXA 3IAYA 3NAEA 3BUZB 1NBWA 4NYNA 1NMDA 1ZC6A 4JD2A 3NFAA 3CJBA 2A41A 4AH9A 3NGIA 1D4XA 2F9WA 3I55N 2WOMA 3CJ7A 4IKFA 2VG6A 4HDQA 4JI7K 1KTQA 1BA1A 1RT5A 1JKHA 1TKZA 4BRLA 3OYNA 4YDUA 3CCRN 5KQ8A 1TKTA 5AJ3K 3T7ZA 4DQRA 3MX5A 5M1KA 4MO4A 3CPWM 1LWCA 3SK3A 3VQBA 3U4LA 2AL6A 4KH4A 2RF2A 1RBSA 3I8DA 2EMSA 3QIPA 3SQ2A 4CBUA 3OYLA 4FWQA 5E84A 4BC5A 4IFYA 1HYZA 5AQZA 2FBTA 2PY5A 4N76A 4O55A 3KVGA 4IEIA 2Q1NA 3MN9A 2P9SB 1MA9B 2HHWA 5CZ1A 3L2UA 4DUZK 1DKGD 2XY5A 3A0IX 1XQSC 1DLOA 3VA3A 4AHSA 4ZTJA 4BGAA 4P7IA 2HF4A 1F21A 1HR0K 5C24A 4QS7A 3CCSN 4IXCA 2LSNA 3QNOA 1TAUA 4ISGA 2O8DA 2W40A 3HTVA 4B3MK 4H0XB 4F2SA 5M1PA 1XNQK 2A42A 3E01A 2AJQA 4BRFA 1NGAA 4DR6K 4OLBA 5AZIB 3KKSA 3CIPA 3HBTA 3A5OC 4LSLA 4FWNA 1YHQN 5BN9A 3AVBA 3UKRA 4A61A 1NJIO 4CJSA 5JVGL 4CGDA 5AQRA 2HRJA 4DR7K 3KHYA 4CVNE 1XHXA 4KREA 3DMJA 3HL8A 2R7YA 2E5LK 1L3TA 4KTWA 3MN6A 4FVUA 3THYB 1SKSA 4HWIA 1OH6A 4RG8A 3SQ4A 2W42A 4KI6A 4GNIA 5M1FA 3CD6N 4KB0A 1JLQA 2D1KA 1RBVA 2ASPA 2XY8A 3ENHA 1HPZA 2ZJQL 3QEWA 4JEPA 4IDKA 4DSJA 1NGHA 1RDDA 2O8EB 2UUAK 4JKFA 4EKUA 3JSMA 2RKIA 1D9DA 1YJNN 1T7PA 4F7GA 1N32K 4DTSA 3OYAA 4YDUC 5CYQA 3TAFA 5JICA 1BQMA 4DTRA 2E2QA 3BZKA 1K8KB 3C6AA 4AF1A 3DYAA 4AHRA 3QIOA 4FLTA 2HHHK 3DM2A 3OYJA 1RTDA 3C94A 2VWJA 1BG3A 1VQ4N 2HVIA 4EFHA 4LF5K 3THWA 5I9EB 3DLBA 4E1JA 1IJJA 4DCHA 5JVLA 3DLRA 3O3GA 3CJ1A 1HNXK 3ULEB 3ENOA 4CJUA 3AGKA 3WQUA 1LW0A 3HSTB 2O8BB 3I0SA 2VQFK 2F8SA 4LFBK 4DTJA 3IFRA 4BVOA 4DLEA 2DFFA 4JKEA 3MAQA 3ZX3A 1VQKN 2FF3B 3VQQA 4PL7A 1P8ZA 2NRTA 3K5MA 3QEPA 4UY8O 4E19A 4DU4A 2FC0A 3PIPL 4ILGB 1QS4A 1QHAA 1JLEA 1RT1A 5LY3A 4KI4A 4WFAL 3L3VA 1KRPA 2P9UA 4IJAA 2HHVA 4JKAA 3GDQA 1TK5A 4JKHA 5KRTA 3THXA 4CGHA 2ITGA 1OVYA 2FSKA 4CJ5A 3A2FA 1EF1A 1KAZA 5CZ2A 4FM2A 4ID1A 4XH5A 3SUOA 3TPQA 5C10A 2V52B 3WA0A 3TARA 3SJHA 4BRCA 4DFMA 1VQMN 5GAGP 4F3OA 3GE1A 4Y1DA 3SYZA 4RCHA 4W5OA 1EQYA 1GOCA 4Y1CA 3IKMA 2QWQA 4EAHD 3ENBA 2ZGYA 3AV9A 4CJKA 2P9LA 1DTTA 2E6LA 4FLZA 1HKGA 1BWFO 1L5UA 1C0UA 4IOXA 5AQTA 3HP6A 4KHWA 2VYPA 2PBDA 3VPZA 4KFBA 1RILA 3H6EA 3TAMA 1NGGA 1GC6A 4CEBA 1SGHA 1HKCA 4TSXA 5LJWA 1GLJO 1WSGA 3OYHA 2JGUA 3AVLA 1IBLK 1HYVA 3MN7A 3TABA 5AQIA 3ZSZA 4K43A 2YI1A 3VEZA 3PX0A 3P31A 3B6PA 4FWRA 1FKOA 1SL1A 1TYQA 1Z6RA 2VWBA 4FJ9A 5BREA 4RWTA 3IDHA 3RSEA 1NOYA 2O8CB 3J7AP 3F5TA 3OY9A 4CIGA 5IT9O 1C0MA 4X62K 3H08A 4B9QA 3KTQA 1YTUA 2O4GA 3CPEA 4FM1A 3AARA 3V9ZA 4BRQA 5F1XA 2UU9K 3BY5A 3L2WA 4DV0K 1NK6A 3VGKA 3RMBA 3K59A 5HROA 1XI1A 4I2PA 2FF6A 1HB8A 3V81A 1C0GA 1V4SA 2PYLA 4ELTA 3WEEB 4CEFA 4FJNA 3CHWA 4RTFD 3LDSA 4GKKK 4B8CA 2HVHA 5B8HA 4CJ3A 4H5NA 4OVLA 4B9UA 2CB8A 3I33A 4A5BA 3HM8A 4DV4K 4FJGA 2ZPYA 4FCYA 1Y19B 1DT9A 2BUPA 3PV8A 1JDEA 4UQGA 1QQNA 2OYQA 4GV6A 3EEQA 3D2EB 5CHIA 2QXLA 3NF7A 1IKXA 3CCJN 1J5EK 5AFUH 1LV5A 3T3FA 3AO1A 4JHDA 2FBYA 2HHUA 5KGWA 4JKCA 2DY4A 1JL1A 4TKNA 4JRQA 3C6TA 3QINA 1NI2A 2O4IA 3L2QA 4CE9A 3O1BA 2YNGA 4E7IA 3OYCA 4JAXA 2GUIA 1VQ6N 2GV9A 4DQSA 4BACA 4YOTA 3DXMA 3QIJA 3EKUA
chains in the Genus database with same CATH topology
3G71N 3Q7CA 4PKHA 1JCGA 5JVHL 2F7TA 2R82A 4IFEA 1N8RO 5CR4A 2VGNA 3C0BA 3VF2A 2E1YA 2Q36A 3K9JA 5KPZA 3SAGA 3OW2M 1QVGM 4BRDA 1YJWN 5AQOA 5AZJB 4FL9A 4FWLA 4M7XA 1YXQA 3QBWA 2KLAA 5GADP 5AQYA 4MLEA 3O9UA 2V51B 3O9QA 1RGIA 5AR0A 1HPMA 4H03B 3QICA 4JKBA 3WXKA 1VQPN 1W2BM 3VEOA 1X9JA 2YHWA 4H0PA 4IOCL 1TYQB 4JK7A 1JCEA 2WUSA 5C0YA 3ZETB 4H0TB 1NGIA 3MWTA 5M1NA 2P9SA 4BRAA 4M63C 2J0JA 4BRGA 4YORA 3CCLN 1KXPA 3CC7N 4NO7A 1QVFM 4XEIA 5C2DA 3L6QA 1HB6A 2CH5A 3LDNA 3U9ZA 1WUAA 4K42A 1NGBA 2D0PA 2HBJA 2WBNA 3MMVA 1ACAA 3LM9A 5C15A 3H3NO 3A8YA 3CMAN 2NRRA 2P9NB 2J0KA 4YOWA 3W0LA 3TSQA 3BINA 2VGMA 4H0YB 3X23A 3HSCA 1ILYA 2OANA 2QI2A 3E1YA 4HDOA 4L3QA 1BA0A 1QZ6A 2RQ1A 3LDQA 2NLXA 1VQ8N 4CYEA 4OPHA 4CZJA 4NY0A 4BREA 3MCAB 4NB4A 2COPA 1GLLO 4FWKA 3J7ZO 2NRHA 3HOTA 2FXUA 3SAHA 1E5WA 4O5FA 4H0VB 4GVEA 2V7ZA 4FPBA 5AQXA 5AQGA 3E9LA 5EXWA 3SMSA 4CZMA 4WFNL 3AU4A 1U2VB 3BP8A 3GOIA 5AQFA 4G9ZA 3O80A 4H0OA 1VBHA 4KH6A 1BOTO 1VAZA 3TTDA 4BC4A 3CJ9A 5AQKA 3GBTA 3U8XA 2IVPA 2Q2RA 2D10A 3DAWA 3O08A 4YOXA 1XC3A 1Q18A 4CZEA 1KQSM 1BUPA 2FJ9A 5JLFA 1DGKN 4JHDB 5ADXA 1VQNN 5AQJA 2DIKA 3BUZB 3WQTA 1NBWA 3LL3A 1NMDA 1ZC6A 4JD2A 3ZEUA 5AFUA 2D2QA 1SS6A 3CJBA 4BQZA 2A41A 5HL7L 4GV9A 4IO9L 1MDUB 2J4RA 3P38A 1D4XA 2GELA 2F9WA 4BGBA 3I55N 1W97L 3DLLL 3B8AX 3CJ7A 2CGKA 4CZHA 3DXKB 4JN4A 1S3XA 5BRHA 4HDQA 5AQMA 4DXAB 5F0XA 2P9PA 1BA1A 2A40A 3VOVA 4BRLA 4YDUA 3U9DA 5KQ8A 4U7BA 3CCRN 3PVLA 5ELZA 3T7ZA 2E1ZA 3DXMB 3MX5A 1QQMA 4MO4A 5M1KA 2WFBA 2EWSA 1ATSA 3CJAA 3CPWM 2WC9A 3SK3A 5BPNA 4B1YB 5GINA 3U4LA 5BRDA 2AL6A 4KH4A 3CCEN 4IZ9A 2QEXN 2ITMA 2BTFA 1K8KA 3QMLA 1NWKA 2YVCA 3BF1A 2LBBA 1JCFA 4FWSA 2EMSA 3R8EA 1ZXOA 4B1VA 5C12A 4BROA 4CBUA 3CJCA 5BRFA 4FWQA 3MWPA 3O9TA 5E84A 4BG8A 3MK6A 4BC5A 4BRPA 5AQZA 4KBOA 3TTCA 1MWKA 4C1NK 4IEEA 3KVGA 4IEIA 3WXLA 3EN9A 4BR9A 2D4WA 3KWIA 2Q1NA 1ST7A 2P9SB 3MN9A 1MA9B 3TTFA 5TKWA 3FZHA 3ULEA 1S72N 1HBKA 1X3MA 4BR2A 1EO1A 1DKGD 4B1WB 3A0IX 2NRWA 2JWLA 1XQSC 3PLAA 5TKYA 3P39A 4LC9B 1Q81O 4BGAA 3QDKA 4P7IA 2HF4A 3A5NC 5F2RA 4QS7A 3CCSN 3ID8A 4BG9A 4H5VA 4IXCA 2HSTA 4OO1J 3O6WA 3P4IA 4MDBA 3U8ZA 2CH6A 4ISGA 2E2NA 1KC8O 1YI2N 3NVKA 3AY9A 2W40A 3HTVA 4MO5A 1NVLA 1GLFO 4H0XB 4KH5A 3UE5A 1NGFA 3VEXA 3VENA 1P90A 2D11A 5M1PA 2A42A 2HBKA 4H5TA 3OBWA 4BRFA 1TUUA 3EKSA 1TUYA 2NNWA 3ZYYX 5JMVA 2WH5A 1NGAA 1J6ZA 2QWPA 5AZIB 1NTIA 1GGOA 3CIPA 3L4QA 3HBTA 4B1XB 5AQVA 1H4RA 2RE2A 3SMPA 3ID6A 2I1KA 2YJFA 4FOEA 3A5OC 1YHQN 4FWNA 1MK7B 5IJMA 5BN9A 3G6EN 1C0FA 4EHTA 3BEXA 4CBWA 3R3LA 4IWVA 3UKRA 1O13A 3CI5A 4A61A 2IIRA 4FO0A 1NJIO 3H46O 5JVGL 5AQRA 2HRJA 1VQ7N 2QWLA 3KHYA 5AQNA 2V7YA 4ILJA 3OA9A 3UKUA 3WUHA 2YJEA 3OBYA 3CC2N 1S22A 3VETA 4BC3A 4IJNA 3PIOL 4A59A 3VEVA 3D6RA 3MN6A 4FVUA 1DIKA 3EO3A 4HWIA 3D7EO 5AQLA 5AZIA 1GLAG 3R9PA 1IG8A 3EE8A 3IMXA 3C6HA 3Q7BA 2FDQA 4PKGA 4IOAL 4GNIA 5AQSA 2ZF5O 5AQPA 5M1FA 4U67L 1HUXA 4WYBA 3CD6N 3MDQA 4JD2B 3ZEUB 2D1KA 3HOSA 2RHKA 2ASPA 4Y0WA 3ENHA 2ZJQL 5FPMA 4JEPA 3E9OA 2P9KA 5M1QA 3ZDTA 2PFUA 2Q31A 5EX5A 5KQDA 3F9MA 3G9WA 1GC7A 4GXBA 1NGHA 1LOTB 4PL8A 4WQ5C 4BR7A 3ZX0A 4JKFA 4EKUA 2P9IA 5AQQA 2E88A 3OHRA 4WF9L 1SZ2A 5C2FA 2F9TA 4MLHA 2P9PB 1YJNN 2FLOA 1K9MO 4JK8A 2AA4A 2I1JA 4FOIA 1M90O 4BY9C 4F7GA 3R1XA 2A6AA 4C1NI 4JKGA 4AM7A 3TU5A 4BRIA 3H1VX 4PHTX 3LDOA 4H5RA 2CQUA 4YDUC 3VEYA 3EPYA 3QFPA 2GWJA 1GLBG 4B1ZA 5JICA 3EL2A 2E2QA 4PKIA 1KAXA 1K8KB 3C6AA 4AF1A 2QWNA 1MK9B 2Q0UA 5FPDA 3S41A 2E2OA 4ZRJA 1BG3A 4WQ4A 4BQLA 1VQ4N 2QWMA 3HRGA 3TSPA 3CETA 3WXIA 4EFHA 3CCVN 1Q82O 3U7DA 2YHYA 5I9EB 1BU6O 4E1JA 3L0QA 1IJJA 3EE9A 5JVLA 3H3OB 4DCHA 4BR0A 5H1SQ 1ATNA 4CZIA 4ISFA 3C7NA 3CQYA 3CJ1A 2Q0RA 1OKJA 3MX2A 3ULEB 2JWKA 3ENOA 4EIAA 3AGKA 3M3ZA 4IDHA 3NVMA 1T3VA 3WQUA 4C23A 2NRXA 4R79A 1KAYA 3CCQN 3PZDA 4JKDA 3O9RA 3IFRA 4HTLA 4WCEL 4BVOA 4JNEA 2CGLA 4JKEA 1X3NA 1KBLA 2HBLA 3R6MA 3ZX2A 2VCPA 5LJVA 1QQOA 3UB5A 1T44A 3ZX3A 3O8MA 2FF3B 4PL7A 3CQXA 1P8ZA 2NRTA 4BRNA 1VQKN 4UY8O 1YAGA 3A5MC 2ZJPL 2PAVA 2W41A 3PIPL 4ILGB 1QHAA 1VQ5N 1E4FT 2QW9A 2FSJA 1GLEG 4O8UA 3VGLA 5BPMA 3VF6A 4DB3A 1RDUA 5LY3A 2GX9A 4WFAL 5MLCQ 2HOEA 3IVFA 2ZWHA 3O5BA 1M1KO 2AP1A 1YIJN 3FP5A 1BDGA 2P9UA 4IJAA 2E2PA 4JKAA 2CGJA 3BF3A 3GDQA 4JKHA 5EOYA 1VQ9N 4FSVA 4EHUA 1OVYA 2FSKA 2P9LB 2HF3A 5DM6L 2Q97A 3UKRB 1EF1A 1KAZA 3D2EA 2ABDA 4A2BA 1R59O 2QWOA 1K73O 4DQ8A 4XH5A 3VTIA 3TPQA 5C10A 2V52B 3WA0A 4QS8A 3UKUB 3SJHA 2ASMA 3VESA 4BVPA 1K8AO 3AAPA 4H5WA 4BRCA 2E20A 3KK7A 1LCUA 4CZFA 5GAEP 1YJ9N 1VQMN 5GAGP 4YOYA 3J8AA 3GE1A 5AQHA 4XH1A 4RCHA 1EQYA 3H1QA 2HBMA 1YITN 3H45C 3LM2A 1Z05A 3FR0A 3IKMA 4CZKA 4YL8A 1NGCA 2QWQA 4EAHD 3ENBA 1V4TA 1G99A 2YX6A 2ZGYA 2GWKA 3O9SA 1Q7YO 1QZ5A 3WXMB 2P9LA 3FZKA 3G25A 1NGDA 3QB0A 1WOQA 3FLVA 4J8FA 3VTHA 4AM6A 4CZGA 2P9KB 1HKGA 1BWFO 2D0OA 5EVZA 1J19A 3N4PA 4IOXA 5AQTA 1GG3A 2VYPA 4ZRKA 2PBDA 4FWOA 4K25A 1GLDG 4FWMA 3H6EA 3VPZA 3VEWA 2P9IB 2X0SA 3RSEB 1NGGA 2E8AA 5GIOA 1GC6A 1SGHA 4BRKA 1HKCA 1GLCG 1Y64A 3ATUA 5LJWA 1GLJO 2ASOA 1HX1A 2ZGZA 4O8KA 3CXCM 2OTLN 5M1OA 4ILHA 4GY2B 5AZJA 3FE1A 2H3GX 3MN7A 1MWMA 3FLCO 3ATVA 5AQIA 4JKGB 1HKBA 3SBTA 1NGJA 4K43A 2IVNA 1MIZB 2J0MA 3E9PA 2YI1A 3O1WA 3E66A 1RDWX 3W3DA 5KPTA 3VF4A 3VEZA 2NRZA 2A3ZA 3P31A 3EZWA 4FWRA 3CERA 3SBGA 1KC7A 3FFKB 1TYQA 4GV3A 4ISEA 5DM7L 2QWRA 1H1VA 1Z6RA 2BH1A 2VWBA 5BREA 3ZETA 3M5RA 3M1FA 4RWTA 3IDHA 3RSEA 5BN8A 3F5TA 4FPAA 2GTDA 4BRHA 3GL1A 4OPAA 2YHXA 3MCPA 4CJ7A 3FZFA 4QS9A 3G4SN 1RFQA 1XUPO 3QBXA 1U6ZA 1YVNA 4B9QA 2QM1A 3GG4A 4CZLA 1YUWA 3AAQA 4WQ4C 5AQUA 4IO8A 3M6GA 2ZJRL 4CI6A 3C7NB 4BR4A 3AU5A 4YOUA 3CPEA 2DPNA 2KKZA 3FZMA 3AARA 4BRQA 3HI0A 3IUCA 5F1XA 2OTJN 5BR9A 2P9NA 4ZRIA 3I56N 3CC4N 2UYTA 1ISNA 3VGKA 3O4WA 3LDLA 5JLHA 1HLUA 4I6MB 3SAFA 2FF6A 1KD1O 1HB8A 1C0GA 3DJCA 2EMTA 1HJOA 1V4SA 3N4QA 4NLCA 4A57A 2NRVA 3WEEB 2YCHA 3K9KA 1E4GT 3DWLA 3L4IA 5CE3A 2NZTA 1DEJA 3CHWA 4RTFD 1SQKA 3WT0A 4K41A 1Q86O 5B8HA 3NMUA 4H5NA 5GAHP 5GIPA 2CB8A 2GEMA 4WQ5A 5E26A 4BR5A 3MN5A 2A5XA 3I33A 4A5BA 2I7NA 3HM8A 4MDAA 1U2VA 2FSNA 2P9UB 3WXJA 2ZPYA 4FWPA 3CF5L 1SAZA 3I8BA 3KZBA 3CCUN 1Y19B 3A5LC 4A62A 5FPEA 1VQON 1DT9A 3D2FB 5KPRA 4NLBA 2BUPA 4A5AA 1JDEA 4I6MA 1QQNA 4DKWA 3JXUA 4GV6A 1NGEA 4JK9A 3D2EB 5CHIA 4DHYA 1ATRA 1BO5O 3FGUA 1VBGA 2QXLA 5ADXH 1NM1A 5BPLA 3CCJN 3WEEA 2HE7A 3QFUA 3T69A 4BRMA 2HMPA 2KHOA 2AEHA 5AFUH 5HOOA 4YOVA 1ZBSA 1NLVA 1T6CA 4JHDA 3SLCA 3FZLA 2QA4N 1VQLN 1T6DA 1MIXA 1YF5L 3LDPA 3KWGA 4JKCA 3VERA 3CMEN 4CD3A 4TKNA 3AGRA 3F2KA 3JS6A 3C65A 5EY4A 4Z94A 1CZAN 2QTDA 4XH4A 4B1UB 1NI2A 4CD1A 3TSUA 2IVOA 3D2FA 2I7PA 4F9OA 3DXKA 3O1BA 1ESVA 3HZ6A 5AQWA 4JAXA 4WFBL 4M7YA 3VMFB 1VQ6N 3VGMA 3RVCA 4A2AA 5FPNA 3CCMN 4CBXA 4YOTA 1JJ2M 3DXMA 3QIJA 4BC2A 2GUPA 3EKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK8 A;  4ILH A;  4JKG A;  4JKC A;  4JKG B;  3SBT A;  4JKA A;  3ENB A;  3E9P A;  4JKH A;  3E9L A;  3E66 A;  4JKD A;  3E9O A;  4JKE A;  3SBG A;  4JK9 A;  4JKB A;  4ILJ A;  4JKF A;  4JK7 A;  4ILG B; 
#chains in the Genus database with same CATH topology
 3Q7C A;  2G8V A;  5JVH L;  3HVT A;  4IFE A;  4OPJ A;  5CR4 A;  1RTI A;  2Q36 A;  3OW2 M;  1QVG M;  3L8B A;  4CEZ A;  5FRN A;  1YJW N;  5AZJ B;  4FL9 A;  3I0R A;  4B8A B;  5SZT A;  3QBW A;  2KLA A;  5AQY A;  1EX4 A;  1W0H A;  4EP5 A;  3QLH A;  4MLE A;  3O9U A;  1VSI A;  2NUB A;  4H03 B;  3WXK A;  1RT3 A;  4Z4C A;  1VQP N;  1YT3 A;  4IOC L;  4H0P A;  1BIS A;  3OS2 A;  3P5J A;  4JK7 A;  4B9N A;  3BGR A;  1JCE A;  2O8F A;  1QSS A;  4FLU A;  4BRA A;  3ZT3 A;  3CCL N;  3WNF A;  3NGZ A;  4DR1 K;  4M3W A;  3D45 A;  2CH5 A;  3LDN A;  4DWI A;  1NGB A;  4DTP A;  1WAF A;  1SV5 A;  3QEX A;  2P9N B;  4DV3 K;  1NJX A;  2B4J A;  4FW2 A;  4H0Y B;  1EKE A;  3P1G A;  2OAN A;  3VQ9 A;  2YNF A;  1VQ8 N;  1VSM A;  4JLH A;  4NB4 A;  2COP A;  3AO3 A;  4FJI A;  4Z4G A;  4FJL A;  4G1Q A;  4JI4 K;  2V7Z A;  4FPB A;  5AQX A;  1QSY A;  4CF0 A;  4CZM A;  4J2E A;  4FW1 A;  2BDP A;  3ISN C;  5BR8 K;  2F4V K;  1VBH A;  1S1W A;  4KH6 A;  1EET A;  4FLW A;  1IG9 A;  4BC4 A;  4E7H A;  5AQK A;  1BQN A;  3GBT A;  1GOB A;  2IVP A;  2G8H A;  4HVJ A;  4QOZ B;  2Q2R A;  1SKW A;  1Z26 A;  4YOX A;  1KQS M;  1DGK N;  4M3Y A;  5HBM A;  1VQN N;  5ADX A;  5AQJ A;  2HNZ A;  2XO7 A;  1TK8 A;  3ZEU A;  2J4R A;  1HJR A;  4LSN A;  4DSE A;  4BGB A;  3JAM O;  3KIO A;  3DXK B;  4C8N A;  5AQM A;  4DXA B;  1WN7 A;  2P9P A;  3ITH A;  2WFB A;  1LAW A;  2WC9 A;  1SUQ A;  2P5O A;  1VSF A;  3CCE N;  2UXC K;  2ITM A;  2BTF A;  1U49 A;  2YVC A;  2OPR A;  3BF1 A;  2LBB A;  4FWS A;  3R8E A;  4CES A;  1ZXO A;  4B1V A;  3AVF A;  4CJ4 A;  3K0S A;  4CER A;  2E4L A;  3NF6 A;  1TGO A;  2YHB A;  5KI6 A;  4FYD A;  3WNE A;  4IEE A;  4O5B A;  4CEA A;  3WXL A;  1HQE A;  4KO0 A;  1S72 N;  1HBK A;  4BR2 A;  4B1W B;  3EYZ A;  4LC9 B;  1S1V A;  3TI0 A;  4F8R A;  5F2R A;  3DLH A;  4H5V A;  5JS2 A;  3O6W A;  3P4I A;  4OO1 J;  3U8Z A;  2CH6 A;  1RTH A;  2E2N A;  4DQP A;  1YI2 N;  4KHP K;  3V1O A;  4MO5 A;  4FLV A;  1NVL A;  1GLF O;  3UE5 A;  1N34 K;  3VEX A;  4EP4 A;  1P90 A;  3VQ5 A;  4CF1 A;  3OBW A;  3ZYY X;  3EKS A;  3HO1 A;  5C42 A;  5KTQ A;  2QWP A;  4OGE A;  1NNE A;  1H4R A;  2RE2 A;  2OCE A;  1MK7 B;  3G6E N;  4EHT A;  4IWV A;  1HNZ K;  1O13 A;  3CI5 A;  4DS5 A;  3ZT4 A;  4FO0 A;  3H46 O;  4ELV A;  4JI3 K;  2QWL A;  1UA0 A;  2V7Y A;  3UKU A;  3WUH A;  3OYD A;  2YJE A;  1C1C A;  1S22 A;  3PIO L;  1B9F A;  4A59 A;  4HUG A;  3EO3 A;  4E7J A;  3D7E O;  5AQL A;  1GLA G;  2YNH A;  3R9P A;  3EE8 A;  4PKG A;  3C6H A;  4IOA L;  2G8I A;  4LY7 A;  2ZF5 O;  4U67 L;  4KHQ A;  4E1M A;  3HOS A;  2RHK A;  2PZS A;  4Q0B A;  5HRN A;  4CFD A;  3T19 A;  1S6Q A;  1UA1 A;  3C6U A;  3HK2 A;  2Q31 A;  5EX5 A;  3F9M A;  1GC7 A;  4BR7 A;  4V19 S;  2P9I A;  4C8L A;  2E88 A;  3S3O A;  4K8Z A;  3OHR A;  3MXM A;  1SZ2 A;  5C2F A;  1VRT A;  2AA4 A;  3P83 D;  3DRR A;  1WNS A;  5HRR A;  4C8K A;  4CJT A;  1S1U A;  4JKG A;  4E1N A;  4PHT X;  2D5R A;  3OYK A;  3VEY A;  3EPY A;  3EL2 A;  4NCG A;  3MEG A;  3MEE A;  2QWN A;  2Z1H A;  3HPH A;  2Q0U A;  1BIZ A;  1EWR A;  2IGI A;  1HMV A;  3U3G A;  5FPD A;  4DQI A;  4WQ4 A;  1KFD A;  4CK1 A;  3HRG A;  1B92 A;  3CET A;  3U7D A;  3AO4 A;  1FK9 A;  4CEQ A;  3OS0 A;  4CFA A;  3ZSQ A;  4ISF A;  3CQY A;  2JWK A;  1TKD A;  4EIA A;  3M3Z A;  3NVM A;  2NRX A;  3LAN A;  3PX6 A;  4CHN A;  1BIU A;  3THV A;  3CM6 A;  3MXI A;  4M3Z A;  2VCP A;  1VSH A;  4I2Q A;  3O8M A;  4BE2 A;  4CFC A;  1ITG A;  4O4G A;  2W41 A;  3C95 A;  4AQY K;  3VGL A;  1T8E A;  3VQC A;  2GX9 A;  5MLC Q;  2HOE A;  4DV6 K;  2G8F A;  3M8Q A;  1BDG A;  4DU3 A;  3PO4 A;  4L8R B;  4JI6 K;  1EWQ A;  5DM6 L;  2P9L B;  2Q97 A;  1R59 O;  3KK2 A;  2XRI A;  1K73 O;  4J2B A;  4DQQ A;  4WFN L;  3VES A;  4DV2 K;  3AAP A;  4H5W A;  3EZ5 A;  3KK7 A;  2Y1I A;  4EZ9 A;  3OYG A;  4J2D A;  4YOY A;  3J8A A;  4XH1 A;  3H1Q A;  2HBM A;  3FR0 A;  3LPU A;  1NOZ A;  1NGC A;  2YX6 A;  1BL3 A;  1JLC A;  4J8F A;  1YTA A;  2P9K B;  5EVZ A;  1NK8 A;  1GG3 A;  4FWO A;  1JLA A;  3RSE B;  3OS1 A;  1GLC G;  1Y64 A;  3KLE A;  4O8K A;  3TR8 A;  4ILH A;  1E3M A;  3AO5 A;  2ZD1 A;  3AVN A;  3VQA A;  3FLC O;  4NXM K;  3V9U A;  2IVN A;  1MIZ B;  4AHC A;  1RDW X;  3VF4 A;  2Z1J A;  3JYT A;  1ASV A;  3EZW A;  3QO9 A;  1WSH A;  2EX3 A;  1H1V A;  2BH1 A;  3ZET A;  1N36 K;  3M1F A;  4CEC A;  4X65 K;  4BE0 A;  4MQ3 A;  3CFP A;  4FK0 A;  1R0A A;  2HHX A;  2YHX A;  4PQU A;  4QS9 A;  1IKW A;  4RW4 A;  3GG4 A;  3AAQ A;  4WQ4 C;  2DTU A;  4Q5V A;  3C7N B;  3AU5 A;  3LP2 A;  3FZM A;  3S3M A;  4LH4 A;  4CIF A;  2VQE K;  2OTJ N;  5BR9 A;  1C0T A;  4ZRI A;  3CC4 N;  2UYT A;  1YVU A;  3SV4 A;  5JLH A;  1HLU A;  3SAF A;  4OX9 K;  1RT4 A;  3IS9 A;  3NGY A;  2UUC K;  4NLC A;  4A57 A;  3NE6 A;  3K57 A;  1E4G T;  3DWL A;  2X6S A;  4CCH A;  2NZT A;  1DEJ A;  3WT0 A;  3OYE A;  3D0P A;  3TAG A;  5GIP A;  4CJF A;  4WQ5 A;  5IWA K;  3ZSO A;  2A5X A;  4LFA K;  2I7N A;  4MDA A;  3WXJ A;  3CF5 L;  3I8B A;  1SL0 A;  3O3H A;  4A62 A;  1HNI A;  5KPR A;  3VQ6 A;  4HHT A;  4FM0 A;  1BO5 O;  1ZBH A;  1VBG A;  3TAQ A;  2DFE A;  3T69 A;  4YOV A;  2AEH A;  1ZBS A;  1ZYQ A;  1T6C A;  3SLC A;  3FZL A;  1MIX A;  1WSI A;  3LDP A;  3ZSY A;  4IBN A;  2KFN A;  3ZSR A;  5EY4 A;  2QTD A;  3RMD A;  3D2F A;  1RDC A;  3RMC A;  1ESV A;  3HZ6 A;  5AQW A;  4WFB L;  4N5S A;  4JS4 A;  4PUO A;  3RVC A;  4A2A A;  1L3S A;  3CCM N;  3AVG A;  4BC2 A;  3IVF A;  1OVQ A;  1JCG A;  3DOK A;  2E1Y A;  3K9J A;  3ALY A;  3SAG A;  4BRD A;  5AQO A;  4O44 A;  1FJG K;  1VK0 A;  1FKP A;  4KTZ A;  1HPM A;  3J81 O;  4JKB A;  2HHS A;  1X9J A;  1XHZ A;  3NH1 A;  5C0Y A;  3MWT A;  1KVC A;  2P9S A;  1J53 A;  5CY4 A;  5CYM A;  5M1N A;  3KJV A;  4XEI A;  5C2D A;  5I3U A;  3UIQ A;  3L6Q A;  1VSE A;  3U9Z A;  4N56 A;  2HBJ A;  2WBN A;  4H8K A;  3MMV A;  3VQ7 A;  3NF8 A;  3ZT1 A;  1B9D A;  3SV3 A;  2ETJ A;  2A1S A;  1N33 K;  1KLN A;  3BIN A;  4CFB A;  2VGM A;  4DR3 K;  2X6N A;  3X23 A;  1ILY A;  1XMO K;  3T1Y K;  1QZ6 A;  1A5W A;  2ZE2 A;  4DR4 K;  1G15 A;  2NLX A;  3AVH A;  3SJJ A;  1KVA A;  4OPH A;  4NY0 A;  4H4O A;  4BRE A;  3MCA B;  2BGG A;  4FWK A;  2KZZ A;  2NRH A;  2HB5 A;  3HOT A;  4DU1 A;  1E5W A;  4O5F A;  5EU7 A;  5C25 A;  4GVE A;  5AQG A;  3SNN A;  1U2V B;  3GOI A;  4CGF A;  3IRX A;  4W5T A;  4H0O A;  2ATQ A;  1VAZ A;  4CK3 A;  3CJ9 A;  3U8X A;  4CIE A;  2D10 A;  1A5X A;  3THY A;  3HXM A;  1FW6 A;  1ASU A;  4DFP A;  1BUP A;  5JLF A;  2JLE A;  2DIK A;  4YNQ A;  5FRO A;  2D2Q A;  5HL7 L;  4GV9 A;  1WSF A;  1I3A A;  1CZ9 A;  4IO9 L;  1MDU B;  4CJV A;  1L3V A;  1RDB A;  3P38 A;  2GEL A;  1W97 L;  3B6O A;  3KLG A;  1TVR A;  2G8U A;  3K58 A;  4HCB A;  2O8E A;  2KFZ A;  4JN4 A;  1S3X A;  3ZSW A;  5BRH A;  4FXD A;  3OVN A;  5F0X A;  4FJK A;  3VOV A;  3HM9 A;  1CXQ A;  1XWL A;  3PVL A;  5ELZ A;  4YHH K;  1QQM A;  1HNW K;  2EWS A;  3TWH A;  1NJW A;  5BRD A;  3KD5 E;  4IZ9 A;  4LF9 K;  3AVA A;  3KLI A;  1K8K A;  3QML A;  1NWK A;  1JCF A;  4C8O A;  3AVI A;  1W9H A;  4BRO A;  4FJX A;  4O0J A;  2UXB K;  3MWP A;  3O9T A;  4BG8 A;  4BRP A;  3MK6 A;  1NK7 A;  3TTC A;  4CHY A;  4RW6 A;  3EN9 A;  2D4W A;  3KWI A;  1ST7 A;  1TL1 A;  3TTF A;  4AHV A;  1LAV A;  3ULE A;  3RWU A;  1EO1 A;  1X3M A;  2NRW A;  5TKY A;  3P39 A;  3QDK A;  2YV0 X;  2ZQB A;  2UXD K;  4BG9 A;  1CZB A;  1NMN A;  3NVK A;  3AY9 A;  4FJ8 A;  3NH2 A;  3RRG A;  5J2P A;  1NGF A;  1RBU A;  1T03 A;  4Z4E A;  5J2N A;  2HBK A;  2WH5 A;  1J6Z A;  1GGO A;  3L4Q A;  4FZX C;  1BI4 B;  5AQV A;  4B1X B;  3SMP A;  3ID6 A;  2I1K A;  1QHT A;  3SPY A;  3DOL A;  1C0F A;  1C1B A;  3R3L A;  1IV0 A;  2IIR A;  4FVM A;  2HW3 A;  1VQ7 N;  5AQN A;  1OH8 A;  5HRP A;  3OA9 A;  3OBY A;  3VET A;  4E89 A;  4BC3 A;  4IJN A;  1RCH A;  1UAX A;  3VEV A;  1LW2 A;  1DIK A;  4OJR A;  5T7B A;  4K8X A;  3LAL A;  3Q7B A;  4BDY A;  5AQS A;  5AQP A;  1S1T A;  4JD2 B;  4Y0W A;  2X78 A;  3ZSV A;  5FPM A;  3PUF A;  5M1Q A;  3ZDT A;  1D5A A;  5KQD A;  3G10 A;  4PL8 A;  2OPP A;  3ZX0 A;  5AQQ A;  3PY8 A;  4WF9 L;  4DF4 A;  4BE1 A;  3VQD A;  4MLH A;  1K9M O;  4JK8 A;  1L3U A;  1WLJ A;  4GW6 A;  4CK2 A;  4YY3 K;  3KLF A;  4Z4H A;  3TU5 A;  3LDO A;  5HRS A;  2CQU A;  4JS5 A;  4KHU A;  1KAX A;  4F3T A;  4ZRJ A;  2O8C A;  4BQL A;  3TSP A;  4OKE A;  4M42 A;  3K5N A;  1BU6 O;  1VRU A;  1NK4 A;  2W6L A;  2QKB A;  3F9K A;  3H3O B;  4KKO A;  2FBX A;  1KVB A;  2Q0R A;  4M45 A;  1ZBF A;  1NK0 A;  4KHS A;  2Z1I A;  1KAY A;  1NG9 A;  3CCQ N;  3PZD A;  4JKD A;  4RW7 A;  4HTL A;  4WCE L;  4JNE A;  4OKK A;  2CGL A;  2XY6 A;  1X3N A;  3NHG A;  3SZ2 A;  5LJV A;  2X74 A;  1QQO A;  3UB5 A;  3CQX A;  2O8D B;  2IC3 A;  5KRS A;  2HNY A;  4CJW A;  1E4F T;  1JL2 A;  2FSJ A;  3V1Q A;  4O8U A;  3VF6 A;  1RDU A;  2YHA A;  4I9Q A;  2ZWH A;  3O5B A;  3OYF A;  3VQ8 A;  1M1K O;  2AP1 A;  1YIJ N;  3FP5 A;  4RW9 A;  3O3F A;  2E2P A;  4E0D A;  2CGJ A;  3BF3 A;  1VQ9 N;  3K5L A;  1J54 A;  4FSV A;  4PA1 A;  2HF3 A;  3UKR B;  3D2E A;  2ABD A;  5JS1 A;  2W6K A;  3HPG A;  4A2B A;  4DQ8 A;  3VQE A;  4PY5 A;  2ASM A;  4BVP A;  4CZF A;  5GAE P;  3V9S A;  1S6P A;  4RW8 A;  1W7A A;  5AQH A;  1FXX A;  3LWM A;  3LM2 A;  1YIT N;  1CXU A;  2QK9 A;  4DSK A;  2GWK A;  3FZK A;  3QB0 A;  1RT7 A;  1WOQ A;  3O4N A;  1LWE A;  3VTH A;  4AM6 A;  4CZG A;  4DG1 A;  4EZ6 A;  2PYJ A;  4K25 A;  4ZRK A;  3K5O A;  2IAJ A;  4FWM A;  3VEW A;  1WBB A;  1EP4 A;  2ZM6 K;  4AHU A;  3VQ4 A;  4DV1 K;  1DTQ A;  3CXC M;  4GY2 B;  5AZJ A;  3FE1 A;  2B5J A;  2H3G X;  2D0A A;  1MWM A;  3ATV A;  3IG1 A;  3W3D A;  3O1W A;  1OH7 A;  2NRZ A;  2A3Z A;  2Y1J A;  3NCI A;  2BAN A;  3CER A;  3AO2 A;  1IKY A;  3FFK B;  1S5J A;  4B9T A;  3PX4 A;  4GV3 A;  3AA2 A;  5DM7 L;  2QWR A;  1KFS A;  2HMI A;  5K14 A;  3M5R A;  4QCL A;  5BN8 A;  4M3X A;  4FPA A;  1UOC A;  4BRH A;  4NYF A;  4OPA A;  3THW B;  3MCP A;  3G4S N;  1RFQ A;  3DI6 A;  2QM1 A;  4CZL A;  4IG0 A;  1C1A A;  1RNH A;  4FLY A;  4YOU A;  2DPN A;  3KKR A;  1TV6 A;  3HI0 A;  3IUC A;  4HUF A;  1IH7 A;  2P9N A;  3I56 N;  3M8R A;  3HYF A;  3LDL A;  2WTU A;  1TK0 A;  4HCC A;  3DJC A;  2EMT A;  1IO2 A;  1HJO A;  2IDO A;  1J9A A;  1JLF A;  2OPS A;  3L4I A;  4HUE A;  1SQK A;  3NMU A;  1JXB A;  5GAH P;  3F73 A;  5E26 A;  2A1R A;  3BZC A;  2P9U B;  4FWP A;  3AVK A;  3KZB A;  4KB1 A;  3SQ0 A;  3THX B;  1VQO N;  3D2F B;  4NLB A;  4A5A A;  5D3G A;  4I6M A;  4DKW A;  4JRP A;  4HTU A;  4JK9 A;  5ADX H;  1TAQ A;  5BPL A;  1QQC A;  3QFU A;  4BRM A;  5E41 A;  1U04 A;  4JI1 K;  2KHO A;  5HOO A;  1NK9 A;  1NLV A;  2QA4 N;  4CEO A;  1T6D A;  4LF6 K;  1VSK A;  1YF5 L;  1WSE A;  4B9L A;  1RDA A;  3KWG A;  3AGR A;  3JS6 A;  4Z94 A;  4ICL A;  4XH4 A;  4B1U B;  4CD1 A;  3PSF A;  4CJR A;  2IVO A;  4ELU A;  3U6F A;  1WBD A;  4F9O A;  3DXK A;  1HNV A;  3K2P A;  2XHB A;  4DSL A;  3VMF B;  4KV8 A;  3VGM A;  4WE1 A;  1IBM K;  5FPN A;  2OZM A;  3EY1 A;  4E7L A;  1NJY A;  4CBX A;  1JJ2 M;  2F96 A;  2GUP A;  3HPO A;  4PKH A;  2R82 A;  3QER A;  2VGN A;  2Q3S A;  3C0B A;  3VF2 A;  4DF8 A;  4LH5 A;  5GAD P;  2OPQ A;  2IS3 A;  2OA8 A;  4CGG A;  1SKR A;  5J2M A;  2V51 B;  1RGI A;  5AR0 A;  3WNH A;  1W2B M;  4FZZ A;  2FBV A;  3VEO A;  3CFR A;  1TYQ B;  2HHQ A;  1NGI A;  1NJZ A;  4M63 C;  2J0J A;  1BCO A;  4CGJ A;  3CC7 N;  3L2V A;  2HND A;  3CYM A;  4QAG A;  1ZBI A;  1CLQ A;  3O4Q A;  3VA0 A;  4DSI A;  3LZJ A;  3LAM A;  4K42 A;  2D0P A;  1I39 A;  1ACA A;  3LM9 A;  1U4B A;  3A8Y A;  2P51 A;  4YOW A;  3W0L A;  5FLX O;  2KTQ A;  1U45 A;  1NKC A;  2KZM A;  3HSC A;  3OJS A;  1WSJ A;  4I9L A;  4HDO A;  1BA0 A;  2G8W A;  2RQ1 A;  2P1J A;  3LDQ A;  1D9F A;  2B6A A;  4CYE A;  3FFI A;  4CZJ A;  4FLX A;  4CW7 B;  5FDL A;  1D8Y A;  4IG3 A;  2FXU A;  4H4M A;  3SAH A;  4CHO A;  2F8T A;  4B9V A;  4DFJ A;  5I42 A;  1VSL A;  3AA3 A;  5EXW A;  3SMS A;  3BP8 A;  1ASW A;  5AQF A;  3AA5 X;  4G9Z A;  3VQP A;  3O80 A;  4CEE A;  1BOT O;  4W5R A;  4DR2 K;  4GKJ K;  4GMJ B;  3TTD A;  4JYA K;  4ZHR A;  1U48 A;  1Q18 A;  2FJ9 A;  5SWM A;  4JHD B;  1BHL A;  3WQT A;  3RMA A;  4KHN A;  3LL3 A;  4DR5 K;  3KLH A;  5AFU A;  1SS6 A;  4J2A A;  4BQZ A;  3DLG A;  5LMU K;  1Q8I A;  4NCB A;  3DLL L;  1JLG A;  3B8A X;  2CGK A;  4CZH A;  4ID5 A;  3LZI A;  2A40 A;  3U9D A;  4U7B A;  2E1Z A;  3DXM B;  3BDP A;  1ATS A;  3CJA A;  5BPN A;  5GIN A;  4B1Y B;  3M8P A;  2VG5 A;  2QEX N;  5C12 A;  3CJC A;  5BRF A;  1Y97 A;  1BGX T;  3QET A;  4KBO A;  3OYB A;  1NKB A;  1MWK A;  4K0K K;  4C1N K;  2O8F B;  4BR9 A;  1REV A;  3SI6 A;  5TKW A;  3FZH A;  3QES A;  3T1H K;  2RPI A;  1I94 K;  3PLA A;  2JWL A;  3OYM A;  1KCF A;  1QSL A;  1Q81 O;  5LMN K;  3A5N C;  3LP0 A;  3ID8 A;  3ZLJ A;  2HST A;  4MDB A;  1KC8 O;  3ASM A;  1S1X A;  4KH5 A;  3VEN A;  2D11 A;  4CJP A;  4H5T A;  5J1E A;  2QKK A;  1TUU A;  1TUY A;  2NNW A;  5JMV A;  1VSJ A;  4DV5 K;  4DUY K;  1NTI A;  4B3O A;  1ZBL A;  1Q9Y A;  2YJF A;  1HYS A;  4FOE A;  5IJM A;  1TKX A;  3AA4 A;  3BEX A;  4CBW A;  1NU0 A;  2VG7 A;  3ZCM A;  4M3U A;  4ILJ A;  4Z4F A;  4KTQ A;  3S3N A;  3CC2 N;  5J2Q A;  5FRM A;  4CJE A;  1J5O A;  3OYI A;  1X9M A;  3D6R A;  3L2R A;  1OH5 A;  5LL6 Z;  4BDP A;  5AZI A;  4M3T A;  1IG8 A;  3IMX A;  2FDQ A;  1XC9 A;  1HUX A;  1HQU A;  4WYB A;  3MDQ A;  3ZEU B;  4B9M A;  3E9O A;  2P9K A;  3AVJ A;  3ULD A;  2PFU A;  3LP3 A;  4B9S A;  2BE2 A;  2DFH A;  4WQ5 C;  3G9W A;  4GXB A;  1KSP A;  1LOT B;  1UWB A;  2RN2 A;  3VN5 A;  2KW4 A;  2F9T A;  2P9P B;  4DSF A;  2FLO A;  4CF9 A;  3KK1 A;  4JI8 K;  2I1J A;  4FOI A;  1M90 O;  4BY9 C;  4FJH A;  3CM5 A;  3R1X A;  2A6A A;  4C1N I;  1XMQ K;  3DLK A;  4AM7 A;  4BRI A;  3H1V X;  3QEV A;  4H5R A;  3V9W A;  3QFP A;  2GWJ A;  1GLB G;  4B1Z A;  1KLM A;  4DFK A;  4PKI A;  1RBT A;  4DTU A;  4LF8 K;  1MK9 B;  2WON A;  2Z1G A;  3S41 A;  4KRF A;  4CED A;  2E2O A;  4W5Q A;  2QWM A;  3WXI A;  4R5P A;  3CCV N;  1Q82 O;  4OPK A;  1IBK K;  2YHY A;  3KK3 A;  3HJF A;  4O0I A;  3L0Q A;  3EE9 A;  5H1S Q;  3ZT0 A;  4BR0 A;  3QEI A;  1ATN A;  4CZI A;  2P5G A;  4PWD A;  1O1W A;  1S9E A;  3C7N A;  3MX2 A;  1OKJ A;  2VWK A;  2D0B A;  4LD0 A;  4IDH A;  4C23 A;  1T3V A;  4JI5 K;  4R79 A;  4DTO A;  5HLF A;  3O9R A;  3RR8 A;  1KBL A;  1U47 A;  2HBL A;  3R6M A;  3ZX2 A;  4BDZ A;  2KQ2 A;  3OTO K;  1T44 A;  1RT6 A;  4BRN A;  3J7Y P;  3NBP A;  1YAG A;  3SQ1 A;  3A5M C;  2ZJP L;  2PAV A;  4M41 A;  3TAE A;  1VQ5 N;  2QW9 A;  1GLE G;  4JI0 K;  5BPM A;  4DB3 A;  3RRH A;  1VSD A;  4LF4 K;  3ZSX A;  4BWM A;  3MEC A;  2O8B A;  4DV7 K;  5EOY A;  3SUQ A;  4EHU A;  1IKV A;  5DMR A;  4DTN A;  1GOA A;  2YKN A;  2QWO A;  4DTM A;  4CHQ A;  4BWJ A;  4IFV A;  3VTI A;  4QS8 A;  3UKU B;  2D0C A;  1K8A O;  1S9G A;  2E20 A;  2IOC A;  1LCU A;  1YJ9 N;  3MED A;  3AVM A;  4OKJ A;  3KD1 E;  3H45 C;  3T1A A;  1Z05 A;  4ZTF A;  4CZK A;  4YL8 A;  1V4T A;  1G99 A;  3CFO A;  4CF2 A;  3O9S A;  1Q7Y O;  1QZ5 A;  3WXM B;  3G25 A;  1A5V A;  1NGD A;  3FLV A;  4FJ5 A;  2D0O A;  1J19 A;  3N4P A;  4FZY A;  1GLD G;  1T05 A;  2P9I B;  2X0S A;  2E8A A;  5GIO A;  4BRK A;  3ATU A;  2ASO A;  2ZGZ A;  1HX1 A;  2OTL N;  5M1O A;  1HRH A;  1X9W A;  4JKG B;  1HKB A;  3SBT A;  4E7K A;  1NGJ A;  2J0M A;  3E9P A;  3E66 A;  5KPT A;  4KAZ A;  4GVM A;  3HT3 A;  1RTJ A;  2UUB K;  4Z4I A;  3HVR A;  1RBR A;  1BCM A;  4X64 K;  1LWF A;  3SBG A;  1KC7 A;  4CHZ A;  4ISE A;  4FJM A;  3L3U A;  5A2Q O;  4XIU A;  3RR7 A;  4FJJ A;  2GTD A;  3GL1 A;  4CJ7 A;  3FZF A;  3CG7 A;  1XUP O;  3QBX A;  1U6Z A;  1YVN A;  3OJU A;  1YUW A;  5AQU A;  4IO8 A;  3M6G A;  2ZJR L;  4CI6 A;  4C8M A;  4BR4 A;  2KKZ A;  3ZT2 A;  1JLB A;  1ZBU A;  2EHG A;  3SCX A;  4YFU A;  1ISN A;  3O4W A;  4I6M B;  1KD1 O;  4CGI A;  4FJ7 A;  3NDK A;  4N41 A;  3N4Q A;  2NRV A;  3V1R A;  3S9H A;  2QXF A;  2YCH A;  3V4I A;  4CHP A;  3K9K A;  2I5J A;  1RT2 A;  5CE3 A;  1Q86 O;  4K41 A;  4CJL A;  4X66 K;  1X9S A;  5DK5 A;  4MFB A;  2GEM A;  4BR5 A;  3MN5 A;  1X1P A;  3QNN A;  3NF9 A;  1U2V A;  2FSN A;  1SAZ A;  3CCU N;  3A5L C;  5FPE A;  3JXU A;  1NGE A;  3CQ8 A;  4DHY A;  1ATR A;  3FGU A;  2XY7 A;  4JV5 K;  1NM1 A;  4LF7 K;  3WEE A;  2HE7 A;  2HMP A;  3V9X A;  4DLG A;  4I7F A;  1VQL N;  4FK4 A;  4CF8 A;  4DS4 A;  5HP1 A;  1SL2 A;  4Z0U A;  3VER A;  1WAJ A;  3PSI A;  3CME N;  4CD3 A;  3F2K A;  3C65 A;  1Z25 A;  5KGX A;  1CZA N;  4W5N A;  3V6D A;  4KPY A;  3LP1 A;  3TSU A;  2I7P A;  1N5Y A;  4M7Y A;  1NK5 A;  3DLE A;  1TL3 A;  4AHT A;  4B3T K;  4DTX A;  4NXN K;  3G71 N;  1N8R O;  1JXE A;  2F7T A;  3DRP A;  4NCA A;  5KPZ A;  4FWL A;  4M7X A;  1YXQ A;  4DMN A;  2GBZ A;  2G8K A;  3HP9 A;  4OLA A;  1MU2 A;  3O9Q A;  2HHT A;  3QIC A;  3M8S A;  3LPT A;  2YHW A;  1NKE A;  3G0Z A;  1XNR K;  2WUS A;  3ZET B;  3PO5 A;  4N47 A;  4H0T B;  3LAK A;  1QTM A;  4BRG A;  4YOR A;  1KXP A;  1QE1 A;  4NO7 A;  3WNG A;  3TAP A;  1QVF M;  4F4K A;  1N6Q A;  4B08 A;  2YKM A;  3SUP A;  3MXJ A;  4JI2 K;  1HB6 A;  1WUA A;  4FK2 A;  2OZS A;  4E3S A;  3RTV A;  3AVC A;  1K6Y A;  5C15 A;  3H3N O;  3CMA N;  2NRR A;  2J0K A;  3TSQ A;  1WB9 A;  4LFC K;  2QI2 A;  3DRS A;  3E1Y A;  4L3Q A;  3J80 O;  4B3R K;  1EXQ A;  4M3R A;  3SUN A;  1Q9X A;  1C6V A;  1BI4 A;  4OGC A;  1GLL O;  3J7Z O;  4CJQ A;  2YNI A;  3SPZ A;  4H0V B;  2E6M A;  3E9L A;  3AU4 A;  4KHY A;  3LWL A;  4F2R A;  3U3Y A;  3TAN A;  3NH0 A;  4AIL C;  3DAW A;  3O08 A;  4B3S K;  1XC3 A;  4CZE A;  1VHX A;  3IAY A;  3NAE A;  3BUZ B;  1NBW A;  4NYN A;  1NMD A;  1ZC6 A;  4JD2 A;  3NFA A;  3CJB A;  2A41 A;  4AH9 A;  3NGI A;  1D4X A;  2F9W A;  3I55 N;  2WOM A;  3CJ7 A;  4IKF A;  2VG6 A;  4HDQ A;  4JI7 K;  1KTQ A;  1BA1 A;  1RT5 A;  1JKH A;  1TKZ A;  4BRL A;  3OYN A;  4YDU A;  3CCR N;  5KQ8 A;  1TKT A;  5AJ3 K;  3T7Z A;  4DQR A;  3MX5 A;  5M1K A;  4MO4 A;  3CPW M;  1LWC A;  3SK3 A;  3VQB A;  3U4L A;  2AL6 A;  4KH4 A;  2RF2 A;  1RBS A;  3I8D A;  2EMS A;  3QIP A;  3SQ2 A;  4CBU A;  3OYL A;  4FWQ A;  5E84 A;  4BC5 A;  4IFY A;  1HYZ A;  5AQZ A;  2FBT A;  2PY5 A;  4N76 A;  4O55 A;  3KVG A;  4IEI A;  2Q1N A;  3MN9 A;  2P9S B;  1MA9 B;  2HHW A;  5CZ1 A;  3L2U A;  4DUZ K;  1DKG D;  2XY5 A;  3A0I X;  1XQS C;  1DLO A;  3VA3 A;  4AHS A;  4ZTJ A;  4BGA A;  4P7I A;  2HF4 A;  1F21 A;  1HR0 K;  5C24 A;  4QS7 A;  3CCS N;  4IXC A;  2LSN A;  3QNO A;  1TAU A;  4ISG A;  2O8D A;  2W40 A;  3HTV A;  4B3M K;  4H0X B;  4F2S A;  5M1P A;  1XNQ K;  2A42 A;  3E01 A;  2AJQ A;  4BRF A;  1NGA A;  4DR6 K;  4OLB A;  5AZI B;  3KKS A;  3CIP A;  3HBT A;  3A5O C;  4LSL A;  4FWN A;  1YHQ N;  5BN9 A;  3AVB A;  3UKR A;  4A61 A;  1NJI O;  4CJS A;  5JVG L;  4CGD A;  5AQR A;  2HRJ A;  4DR7 K;  3KHY A;  4CVN E;  1XHX A;  4KRE A;  3DMJ A;  3HL8 A;  2R7Y A;  2E5L K;  1L3T A;  4KTW A;  3MN6 A;  4FVU A;  3THY B;  1SKS A;  4HWI A;  1OH6 A;  4RG8 A;  3SQ4 A;  2W42 A;  4KI6 A;  4GNI A;  5M1F A;  3CD6 N;  4KB0 A;  1JLQ A;  2D1K A;  1RBV A;  2ASP A;  2XY8 A;  3ENH A;  1HPZ A;  2ZJQ L;  3QEW A;  4JEP A;  4IDK A;  4DSJ A;  1NGH A;  1RDD A;  2O8E B;  2UUA K;  4JKF A;  4EKU A;  3JSM A;  2RKI A;  1D9D A;  1YJN N;  1T7P A;  4F7G A;  1N32 K;  4DTS A;  3OYA A;  4YDU C;  5CYQ A;  3TAF A;  5JIC A;  1BQM A;  4DTR A;  2E2Q A;  3BZK A;  1K8K B;  3C6A A;  4AF1 A;  3DYA A;  4AHR A;  3QIO A;  4FLT A;  2HHH K;  3DM2 A;  3OYJ A;  1RTD A;  3C94 A;  2VWJ A;  1BG3 A;  1VQ4 N;  2HVI A;  4EFH A;  4LF5 K;  3THW A;  5I9E B;  3DLB A;  4E1J A;  1IJJ A;  4DCH A;  5JVL A;  3DLR A;  3O3G A;  3CJ1 A;  1HNX K;  3ULE B;  3ENO A;  4CJU A;  3AGK A;  3WQU A;  1LW0 A;  3HST B;  2O8B B;  3I0S A;  2VQF K;  2F8S A;  4LFB K;  4DTJ A;  3IFR A;  4BVO A;  4DLE A;  2DFF A;  4JKE A;  3MAQ A;  3ZX3 A;  1VQK N;  2FF3 B;  3VQQ A;  4PL7 A;  1P8Z A;  2NRT A;  3K5M A;  3QEP A;  4UY8 O;  4E19 A;  4DU4 A;  2FC0 A;  3PIP L;  4ILG B;  1QS4 A;  1QHA A;  1JLE A;  1RT1 A;  5LY3 A;  4KI4 A;  4WFA L;  3L3V A;  1KRP A;  2P9U A;  4IJA A;  2HHV A;  4JKA A;  3GDQ A;  1TK5 A;  4JKH A;  5KRT A;  3THX A;  4CGH A;  2ITG A;  1OVY A;  2FSK A;  4CJ5 A;  3A2F A;  1EF1 A;  1KAZ A;  5CZ2 A;  4FM2 A;  4ID1 A;  4XH5 A;  3SUO A;  3TPQ A;  5C10 A;  2V52 B;  3WA0 A;  3TAR A;  3SJH A;  4BRC A;  4DFM A;  1VQM N;  5GAG P;  4F3O A;  3GE1 A;  4Y1D A;  3SYZ A;  4RCH A;  4W5O A;  1EQY A;  1GOC A;  4Y1C A;  3IKM A;  2QWQ A;  4EAH D;  3ENB A;  2ZGY A;  3AV9 A;  4CJK A;  2P9L A;  1DTT A;  2E6L A;  4FLZ A;  1HKG A;  1BWF O;  1L5U A;  1C0U A;  4IOX A;  5AQT A;  3HP6 A;  4KHW A;  2VYP A;  2PBD A;  3VPZ A;  4KFB A;  1RIL A;  3H6E A;  3TAM A;  1NGG A;  1GC6 A;  4CEB A;  1SGH A;  1HKC A;  4TSX A;  5LJW A;  1GLJ O;  1WSG A;  3OYH A;  2JGU A;  3AVL A;  1IBL K;  1HYV A;  3MN7 A;  3TAB A;  5AQI A;  3ZSZ A;  4K43 A;  2YI1 A;  3VEZ A;  3PX0 A;  3P31 A;  3B6P A;  4FWR A;  1FKO A;  1SL1 A;  1TYQ A;  1Z6R A;  2VWB A;  4FJ9 A;  5BRE A;  4RWT A;  3IDH A;  3RSE A;  1NOY A;  2O8C B;  3J7A P;  3F5T A;  3OY9 A;  4CIG A;  5IT9 O;  1C0M A;  4X62 K;  3H08 A;  4B9Q A;  3KTQ A;  1YTU A;  2O4G A;  3CPE A;  4FM1 A;  3AAR A;  3V9Z A;  4BRQ A;  5F1X A;  2UU9 K;  3BY5 A;  3L2W A;  4DV0 K;  1NK6 A;  3VGK A;  3RMB A;  3K59 A;  5HRO A;  1XI1 A;  4I2P A;  2FF6 A;  1HB8 A;  3V81 A;  1C0G A;  1V4S A;  2PYL A;  4ELT A;  3WEE B;  4CEF A;  4FJN A;  3CHW A;  4RTF D;  3LDS A;  4GKK K;  4B8C A;  2HVH A;  5B8H A;  4CJ3 A;  4H5N A;  4OVL A;  4B9U A;  2CB8 A;  3I33 A;  4A5B A;  3HM8 A;  4DV4 K;  4FJG A;  2ZPY A;  4FCY A;  1Y19 B;  1DT9 A;  2BUP A;  3PV8 A;  1JDE A;  4UQG A;  1QQN A;  2OYQ A;  4GV6 A;  3EEQ A;  3D2E B;  5CHI A;  2QXL A;  3NF7 A;  1IKX A;  3CCJ N;  1J5E K;  5AFU H;  1LV5 A;  3T3F A;  3AO1 A;  4JHD A;  2FBY A;  2HHU A;  5KGW A;  4JKC A;  2DY4 A;  1JL1 A;  4TKN A;  4JRQ A;  3C6T A;  3QIN A;  1NI2 A;  2O4I A;  3L2Q A;  4CE9 A;  3O1B A;  2YNG A;  4E7I A;  3OYC A;  4JAX A;  2GUI A;  1VQ6 N;  2GV9 A;  4DQS A;  4BAC A;  4YOT A;  3DXM A;  3QIJ A;  3EKU A; 
#chains in the Genus database with same CATH homology
 3G71 N;  3Q7C A;  4PKH A;  1JCG A;  5JVH L;  2F7T A;  2R82 A;  4IFE A;  1N8R O;  5CR4 A;  2VGN A;  3C0B A;  3VF2 A;  2E1Y A;  2Q36 A;  3K9J A;  5KPZ A;  3SAG A;  3OW2 M;  1QVG M;  4BRD A;  1YJW N;  5AQO A;  5AZJ B;  4FL9 A;  4FWL A;  4M7X A;  1YXQ A;  3QBW A;  2KLA A;  5GAD P;  5AQY A;  4MLE A;  3O9U A;  2V51 B;  3O9Q A;  1RGI A;  5AR0 A;  1HPM A;  4H03 B;  3QIC A;  4JKB A;  3WXK A;  1VQP N;  1W2B M;  3VEO A;  1X9J A;  2YHW A;  4H0P A;  4IOC L;  1TYQ B;  4JK7 A;  1JCE A;  2WUS A;  5C0Y A;  3ZET B;  4H0T B;  1NGI A;  3MWT A;  5M1N A;  2P9S A;  4BRA A;  4M63 C;  2J0J A;  4BRG A;  4YOR A;  3CCL N;  1KXP A;  3CC7 N;  4NO7 A;  1QVF M;  4XEI A;  5C2D A;  3L6Q A;  1HB6 A;  2CH5 A;  3LDN A;  3U9Z A;  1WUA A;  4K42 A;  1NGB A;  2D0P A;  2HBJ A;  2WBN A;  3MMV A;  1ACA A;  3LM9 A;  5C15 A;  3H3N O;  3A8Y A;  3CMA N;  2NRR A;  2P9N B;  2J0K A;  4YOW A;  3W0L A;  3TSQ A;  3BIN A;  2VGM A;  4H0Y B;  3X23 A;  3HSC A;  1ILY A;  2OAN A;  2QI2 A;  3E1Y A;  4HDO A;  4L3Q A;  1BA0 A;  1QZ6 A;  2RQ1 A;  3LDQ A;  2NLX A;  1VQ8 N;  4CYE A;  4OPH A;  4CZJ A;  4NY0 A;  4BRE A;  3MCA B;  4NB4 A;  2COP A;  1GLL O;  4FWK A;  3J7Z O;  2NRH A;  3HOT A;  2FXU A;  3SAH A;  1E5W A;  4O5F A;  4H0V B;  4GVE A;  2V7Z A;  4FPB A;  5AQX A;  5AQG A;  3E9L A;  5EXW A;  3SMS A;  4CZM A;  4WFN L;  3AU4 A;  1U2V B;  3BP8 A;  3GOI A;  5AQF A;  4G9Z A;  3O80 A;  4H0O A;  1VBH A;  4KH6 A;  1BOT O;  1VAZ A;  3TTD A;  4BC4 A;  3CJ9 A;  5AQK A;  3GBT A;  3U8X A;  2IVP A;  2Q2R A;  2D10 A;  3DAW A;  3O08 A;  4YOX A;  1XC3 A;  1Q18 A;  4CZE A;  1KQS M;  1BUP A;  2FJ9 A;  5JLF A;  1DGK N;  4JHD B;  5ADX A;  1VQN N;  5AQJ A;  2DIK A;  3BUZ B;  3WQT A;  1NBW A;  3LL3 A;  1NMD A;  1ZC6 A;  4JD2 A;  3ZEU A;  5AFU A;  2D2Q A;  1SS6 A;  3CJB A;  4BQZ A;  2A41 A;  5HL7 L;  4GV9 A;  4IO9 L;  1MDU B;  2J4R A;  3P38 A;  1D4X A;  2GEL A;  2F9W A;  4BGB A;  3I55 N;  1W97 L;  3DLL L;  3B8A X;  3CJ7 A;  2CGK A;  4CZH A;  3DXK B;  4JN4 A;  1S3X A;  5BRH A;  4HDQ A;  5AQM A;  4DXA B;  5F0X A;  2P9P A;  1BA1 A;  2A40 A;  3VOV A;  4BRL A;  4YDU A;  3U9D A;  5KQ8 A;  4U7B A;  3CCR N;  3PVL A;  5ELZ A;  3T7Z A;  2E1Z A;  3DXM B;  3MX5 A;  1QQM A;  4MO4 A;  5M1K A;  2WFB A;  2EWS A;  1ATS A;  3CJA A;  3CPW M;  2WC9 A;  3SK3 A;  5BPN A;  4B1Y B;  5GIN A;  3U4L A;  5BRD A;  2AL6 A;  4KH4 A;  3CCE N;  4IZ9 A;  2QEX N;  2ITM A;  2BTF A;  1K8K A;  3QML A;  1NWK A;  2YVC A;  3BF1 A;  2LBB A;  1JCF A;  4FWS A;  2EMS A;  3R8E A;  1ZXO A;  4B1V A;  5C12 A;  4BRO A;  4CBU A;  3CJC A;  5BRF A;  4FWQ A;  3MWP A;  3O9T A;  5E84 A;  4BG8 A;  3MK6 A;  4BC5 A;  4BRP A;  5AQZ A;  4KBO A;  3TTC A;  1MWK A;  4C1N K;  4IEE A;  3KVG A;  4IEI A;  3WXL A;  3EN9 A;  4BR9 A;  2D4W A;  3KWI A;  2Q1N A;  1ST7 A;  2P9S B;  3MN9 A;  1MA9 B;  3TTF A;  5TKW A;  3FZH A;  3ULE A;  1S72 N;  1HBK A;  1X3M A;  4BR2 A;  1EO1 A;  1DKG D;  4B1W B;  3A0I X;  2NRW A;  2JWL A;  1XQS C;  3PLA A;  5TKY A;  3P39 A;  4LC9 B;  1Q81 O;  4BGA A;  3QDK A;  4P7I A;  2HF4 A;  3A5N C;  5F2R A;  4QS7 A;  3CCS N;  3ID8 A;  4BG9 A;  4H5V A;  4IXC A;  2HST A;  4OO1 J;  3O6W A;  3P4I A;  4MDB A;  3U8Z A;  2CH6 A;  4ISG A;  2E2N A;  1KC8 O;  1YI2 N;  3NVK A;  3AY9 A;  2W40 A;  3HTV A;  4MO5 A;  1NVL A;  1GLF O;  4H0X B;  4KH5 A;  3UE5 A;  1NGF A;  3VEX A;  3VEN A;  1P90 A;  2D11 A;  5M1P A;  2A42 A;  2HBK A;  4H5T A;  3OBW A;  4BRF A;  1TUU A;  3EKS A;  1TUY A;  2NNW A;  3ZYY X;  5JMV A;  2WH5 A;  1NGA A;  1J6Z A;  2QWP A;  5AZI B;  1NTI A;  1GGO A;  3CIP A;  3L4Q A;  3HBT A;  4B1X B;  5AQV A;  1H4R A;  2RE2 A;  3SMP A;  3ID6 A;  2I1K A;  2YJF A;  4FOE A;  3A5O C;  1YHQ N;  4FWN A;  1MK7 B;  5IJM A;  5BN9 A;  3G6E N;  1C0F A;  4EHT A;  3BEX A;  4CBW A;  3R3L A;  4IWV A;  3UKR A;  1O13 A;  3CI5 A;  4A61 A;  2IIR A;  4FO0 A;  1NJI O;  3H46 O;  5JVG L;  5AQR A;  2HRJ A;  1VQ7 N;  2QWL A;  3KHY A;  5AQN A;  2V7Y A;  4ILJ A;  3OA9 A;  3UKU A;  3WUH A;  2YJE A;  3OBY A;  3CC2 N;  1S22 A;  3VET A;  4BC3 A;  4IJN A;  3PIO L;  4A59 A;  3VEV A;  3D6R A;  3MN6 A;  4FVU A;  1DIK A;  3EO3 A;  4HWI A;  3D7E O;  5AQL A;  5AZI A;  1GLA G;  3R9P A;  1IG8 A;  3EE8 A;  3IMX A;  3C6H A;  3Q7B A;  2FDQ A;  4PKG A;  4IOA L;  4GNI A;  5AQS A;  2ZF5 O;  5AQP A;  5M1F A;  4U67 L;  1HUX A;  4WYB A;  3CD6 N;  3MDQ A;  4JD2 B;  3ZEU B;  2D1K A;  3HOS A;  2RHK A;  2ASP A;  4Y0W A;  3ENH A;  2ZJQ L;  5FPM A;  4JEP A;  3E9O A;  2P9K A;  5M1Q A;  3ZDT A;  2PFU A;  2Q31 A;  5EX5 A;  5KQD A;  3F9M A;  3G9W A;  1GC7 A;  4GXB A;  1NGH A;  1LOT B;  4PL8 A;  4WQ5 C;  4BR7 A;  3ZX0 A;  4JKF A;  4EKU A;  2P9I A;  5AQQ A;  2E88 A;  3OHR A;  4WF9 L;  1SZ2 A;  5C2F A;  2F9T A;  4MLH A;  2P9P B;  1YJN N;  2FLO A;  1K9M O;  4JK8 A;  2AA4 A;  2I1J A;  4FOI A;  1M90 O;  4BY9 C;  4F7G A;  3R1X A;  2A6A A;  4C1N I;  4JKG A;  4AM7 A;  3TU5 A;  4BRI A;  3H1V X;  4PHT X;  3LDO A;  4H5R A;  2CQU A;  4YDU C;  3VEY A;  3EPY A;  3QFP A;  2GWJ A;  1GLB G;  4B1Z A;  5JIC A;  3EL2 A;  2E2Q A;  4PKI A;  1KAX A;  1K8K B;  3C6A A;  4AF1 A;  2QWN A;  1MK9 B;  2Q0U A;  5FPD A;  3S41 A;  2E2O A;  4ZRJ A;  1BG3 A;  4WQ4 A;  4BQL A;  1VQ4 N;  2QWM A;  3HRG A;  3TSP A;  3CET A;  3WXI A;  4EFH A;  3CCV N;  1Q82 O;  3U7D A;  2YHY A;  5I9E B;  1BU6 O;  4E1J A;  3L0Q A;  1IJJ A;  3EE9 A;  5JVL A;  3H3O B;  4DCH A;  4BR0 A;  5H1S Q;  1ATN A;  4CZI A;  4ISF A;  3C7N A;  3CQY A;  3CJ1 A;  2Q0R A;  1OKJ A;  3MX2 A;  3ULE B;  2JWK A;  3ENO A;  4EIA A;  3AGK A;  3M3Z A;  4IDH A;  3NVM A;  1T3V A;  3WQU A;  4C23 A;  2NRX A;  4R79 A;  1KAY A;  3CCQ N;  3PZD A;  4JKD A;  3O9R A;  3IFR A;  4HTL A;  4WCE L;  4BVO A;  4JNE A;  2CGL A;  4JKE A;  1X3N A;  1KBL A;  2HBL A;  3R6M A;  3ZX2 A;  2VCP A;  5LJV A;  1QQO A;  3UB5 A;  1T44 A;  3ZX3 A;  3O8M A;  2FF3 B;  4PL7 A;  3CQX A;  1P8Z A;  2NRT A;  4BRN A;  1VQK N;  4UY8 O;  1YAG A;  3A5M C;  2ZJP L;  2PAV A;  2W41 A;  3PIP L;  4ILG B;  1QHA A;  1VQ5 N;  1E4F T;  2QW9 A;  2FSJ A;  1GLE G;  4O8U A;  3VGL A;  5BPM A;  3VF6 A;  4DB3 A;  1RDU A;  5LY3 A;  2GX9 A;  4WFA L;  5MLC Q;  2HOE A;  3IVF A;  2ZWH A;  3O5B A;  1M1K O;  2AP1 A;  1YIJ N;  3FP5 A;  1BDG A;  2P9U A;  4IJA A;  2E2P A;  4JKA A;  2CGJ A;  3BF3 A;  3GDQ A;  4JKH A;  5EOY A;  1VQ9 N;  4FSV A;  4EHU A;  1OVY A;  2FSK A;  2P9L B;  2HF3 A;  5DM6 L;  2Q97 A;  3UKR B;  1EF1 A;  1KAZ A;  3D2E A;  2ABD A;  4A2B A;  1R59 O;  2QWO A;  1K73 O;  4DQ8 A;  4XH5 A;  3VTI A;  3TPQ A;  5C10 A;  2V52 B;  3WA0 A;  4QS8 A;  3UKU B;  3SJH A;  2ASM A;  3VES A;  4BVP A;  1K8A O;  3AAP A;  4H5W A;  4BRC A;  2E20 A;  3KK7 A;  1LCU A;  4CZF A;  5GAE P;  1YJ9 N;  1VQM N;  5GAG P;  4YOY A;  3J8A A;  3GE1 A;  5AQH A;  4XH1 A;  4RCH A;  1EQY A;  3H1Q A;  2HBM A;  1YIT N;  3H45 C;  3LM2 A;  1Z05 A;  3FR0 A;  3IKM A;  4CZK A;  4YL8 A;  1NGC A;  2QWQ A;  4EAH D;  3ENB A;  1V4T A;  1G99 A;  2YX6 A;  2ZGY A;  2GWK A;  3O9S A;  1Q7Y O;  1QZ5 A;  3WXM B;  2P9L A;  3FZK A;  3G25 A;  1NGD A;  3QB0 A;  1WOQ A;  3FLV A;  4J8F A;  3VTH A;  4AM6 A;  4CZG A;  2P9K B;  1HKG A;  1BWF O;  2D0O A;  5EVZ A;  1J19 A;  3N4P A;  4IOX A;  5AQT A;  1GG3 A;  2VYP A;  4ZRK A;  2PBD A;  4FWO A;  4K25 A;  1GLD G;  4FWM A;  3H6E A;  3VPZ A;  3VEW A;  2P9I B;  2X0S A;  3RSE B;  1NGG A;  2E8A A;  5GIO A;  1GC6 A;  1SGH A;  4BRK A;  1HKC A;  1GLC G;  1Y64 A;  3ATU A;  5LJW A;  1GLJ O;  2ASO A;  1HX1 A;  2ZGZ A;  4O8K A;  3CXC M;  2OTL N;  5M1O A;  4ILH A;  4GY2 B;  5AZJ A;  3FE1 A;  2H3G X;  3MN7 A;  1MWM A;  3FLC O;  3ATV A;  5AQI A;  4JKG B;  1HKB A;  3SBT A;  1NGJ A;  4K43 A;  2IVN A;  1MIZ B;  2J0M A;  3E9P A;  2YI1 A;  3O1W A;  3E66 A;  1RDW X;  3W3D A;  5KPT A;  3VF4 A;  3VEZ A;  2NRZ A;  2A3Z A;  3P31 A;  3EZW A;  4FWR A;  3CER A;  3SBG A;  1KC7 A;  3FFK B;  1TYQ A;  4GV3 A;  4ISE A;  5DM7 L;  2QWR A;  1H1V A;  1Z6R A;  2BH1 A;  2VWB A;  5BRE A;  3ZET A;  3M5R A;  3M1F A;  4RWT A;  3IDH A;  3RSE A;  5BN8 A;  3F5T A;  4FPA A;  2GTD A;  4BRH A;  3GL1 A;  4OPA A;  2YHX A;  3MCP A;  4CJ7 A;  3FZF A;  4QS9 A;  3G4S N;  1RFQ A;  1XUP O;  3QBX A;  1U6Z A;  1YVN A;  4B9Q A;  2QM1 A;  3GG4 A;  4CZL A;  1YUW A;  3AAQ A;  4WQ4 C;  5AQU A;  4IO8 A;  3M6G A;  2ZJR L;  4CI6 A;  3C7N B;  4BR4 A;  3AU5 A;  4YOU A;  3CPE A;  2DPN A;  2KKZ A;  3FZM A;  3AAR A;  4BRQ A;  3HI0 A;  3IUC A;  5F1X A;  2OTJ N;  5BR9 A;  2P9N A;  4ZRI A;  3I56 N;  3CC4 N;  2UYT A;  1ISN A;  3VGK A;  3O4W A;  3LDL A;  5JLH A;  1HLU A;  4I6M B;  3SAF A;  2FF6 A;  1KD1 O;  1HB8 A;  1C0G A;  3DJC A;  2EMT A;  1HJO A;  1V4S A;  3N4Q A;  4NLC A;  4A57 A;  2NRV A;  3WEE B;  2YCH A;  3K9K A;  1E4G T;  3DWL A;  3L4I A;  5CE3 A;  2NZT A;  1DEJ A;  3CHW A;  4RTF D;  1SQK A;  3WT0 A;  4K41 A;  1Q86 O;  5B8H A;  3NMU A;  4H5N A;  5GAH P;  5GIP A;  2CB8 A;  2GEM A;  4WQ5 A;  5E26 A;  4BR5 A;  3MN5 A;  2A5X A;  3I33 A;  4A5B A;  2I7N A;  3HM8 A;  4MDA A;  1U2V A;  2FSN A;  2P9U B;  3WXJ A;  2ZPY A;  4FWP A;  3CF5 L;  1SAZ A;  3I8B A;  3KZB A;  3CCU N;  1Y19 B;  3A5L C;  4A62 A;  5FPE A;  1VQO N;  1DT9 A;  3D2F B;  5KPR A;  4NLB A;  2BUP A;  4A5A A;  1JDE A;  4I6M A;  1QQN A;  4DKW A;  3JXU A;  4GV6 A;  1NGE A;  4JK9 A;  3D2E B;  5CHI A;  4DHY A;  1ATR A;  1BO5 O;  3FGU A;  1VBG A;  2QXL A;  5ADX H;  1NM1 A;  5BPL A;  3CCJ N;  3WEE A;  2HE7 A;  3QFU A;  3T69 A;  4BRM A;  2HMP A;  2KHO A;  2AEH A;  5AFU H;  5HOO A;  4YOV A;  1ZBS A;  1NLV A;  1T6C A;  4JHD A;  3SLC A;  3FZL A;  2QA4 N;  1VQL N;  1T6D A;  1MIX A;  1YF5 L;  3LDP A;  3KWG A;  4JKC A;  3VER A;  3CME N;  4CD3 A;  4TKN A;  3AGR A;  3F2K A;  3JS6 A;  3C65 A;  5EY4 A;  4Z94 A;  1CZA N;  2QTD A;  4XH4 A;  4B1U B;  1NI2 A;  4CD1 A;  3TSU A;  2IVO A;  3D2F A;  2I7P A;  4F9O A;  3DXK A;  3O1B A;  1ESV A;  3HZ6 A;  5AQW A;  4JAX A;  4WFB L;  4M7Y A;  3VMF B;  1VQ6 N;  3VGM A;  3RVC A;  4A2A A;  5FPN A;  3CCM N;  4CBX A;  4YOT A;  1JJ2 M;  3DXM A;  3QIJ A;  4BC2 A;  2GUP A;  3EKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...