3ENBA

Crystal structure of prp8 core domain iv
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
219
Chain Sequence
LFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pre-mRNA-processing-splicing factor 8
publication title Structural elucidation of a PRP8 core domain from the heart of the spliceosome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 62
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.40 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3enbA02
3.30.420.230 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3enbA01
4JKAA 3E9LA 3E66A 4ILJA 4JKEA 3ENBA 4JKDA 4JKFA 4ILHA 3E9PA 4ILGB 3E9OA 4JK9A 4JKCA 3SBGA 4JK7A 4JKHA 3SBTA 4JKBA 4JK8A 4JKGB 4JKGA
chains in the Genus database with same CATH superfamily
1JJ2M 4FJJA 3GBTA 3LDQA 4CEEA 3O4NA 3NBPA 3OYLA 3S3MA 3OYIA 2UU9K 4RW7A 1NGBA 3KWIA 3LM9A 3C6UA 3ISNC 4RW6A 4JKDA 2P9IA 4H5TA 4IDHA 3HM8A 3U6FA 4Q5VA 4YFUA 3TSPA 3HT3A 1TKDA 4NXNK 3LANA 4W5RA 1XUPO 4DQPA 2FSKA 3SBTA 1XQSC 5F1XA 5AQIA 2X78A 4WCEL 4YL8A 3O1WA 5HLFA 1UAXA 1Y64A 3FP5A 3QINA 3FZMA 3M8QA 5E26A 5GIPA 4F4KA 1YITN 3MX5A 3I0SA 3RVCA 3J7ZO 1YVUA 3MAQA 3L3UA 4B9NA 1Y97A 5I42A 3P83D 1KD1O 1M1KO 4BC5A 1CZBA 3FZFA 5C10A 1NJZA 1RTIA 4EP5A 2DPNA 3QMLA 1R59O 1NK8A 3H1QA 3F5TA 3CFOA 3J81O 2ZQBA 4WQ4C 1TUUA 4RW8A 4BRNA 5FLXO 2O8BA 4FWQA 3PIPL 3O08A 1EP4A 1CZAN 3AY9A 3NF6A 3LP2A 5EY4A 3ZSZA 3L8BA 1XMQK 4HCCA 1LW2A 1T44A 4FO0A 2UXCK 3EN9A 4CESA 5CY4A 4CVNE 4DV0K 1HUXA 4B3TK 1NU0A 1S1UA 2QWPA 5AZJB 4H0OA 3VA3A 4AHCA 5EU7A 2R82A 3H1VX 2O8EB 3SUOA 3ZETA 3MN6A 4DFPA 1P8ZA 5HBMA 4DWIA 2HHSA 3RMBA 3RTVA 3CJ9A 4JI3K 3CJ7A 2Q3SA 3I8BA 4YOYA 3HXMA 2ASMA 3SNNA 1NK9A 1E3MA 3C94A 3ZYYX 4F9OA 2KW4A 5BPMA 4FLUA 4FVMA 5J2PA 4OVLA 4BRKA 1NJXA 4DB3A 4KV8A 4Z4EA 1BWFO 1HJOA 2RN2A 3QBWA 3VQ4A 5GIOA 3VQAA 3FGUA 4H0VB 4IWVA 4OLBA 2NRRA 3TTFA 4DTRA 2WC9A 1RNHA 1VBHA 3VETA 4DHYA 3QNNA 3BF1A 3VQ6A 1RBRA 1WNSA 3MN7A 2G8WA 3VQPA 1U45A 4CFDA 1P90A 1LOTB 1RTJA 4GKJK 1XHXA 1WSGA 2FC0A 1QQNA 3BEXA 4HUGA 4CJFA 4CGFA 4C8MA 2J4RA 1R0AA 4W5NA 1SV5A 2JWLA 4LSLA 1HRHA 1QQCA 4CERA 2FSJA 1FW6A 3VQQA 3C0BA 1TYQA 1WSIA 4CF8A 3O3FA 3C6TA 3NF9A 3AAPA 2NUBA 4MO4A 3OYCA 3PX0A 1KXPA 3SQ1A 2PY5A 4E1MA 4DSIA 2EHGA 2UYTA 4ZTJA 1YHQN 4DSFA 4EKUA 3M8PA 3CCVN 3KWGA 1VQKN 5AQOA 5M1KA 2DIKA 1N33K 2KHOA 2GV9A 4DMNA 5AJ3K 3J7YP 1VQ4N 4AILC 3RMDA 1J54A 1ZBSA 2P9NB 4KHNA 4GNIA 2HHTA 2DFFA 1XMOK 5BN8A 5BR9A 2P9UB 1VBGA 1NMNA 1YJ9N 4CF9A 4KH6A 3VTIA 3NVKA 3IUCA 2J0MA 3V9UA 3DXKA 1RT3A 1S6PA 4DF4A 3MMVA 5JVHL 2QWMA 4ZHRA 3WQUA 1TKXA 1YJWN 3CCJN 5J2NA 1O13A 1WSJA 4GV9A 4CD3A 1HB8A 4FJ8A 4LSNA 3L4QA 5C24A 1TAUA 3IG1A 5FDLA 1FKPA 5JS1A 3ULEB 1KC8O 1VQ6N 4OGCA 1NJIO 3AVHA 2OYQA 4JKBA 2IAJA 4IJAA 4RCHA 2ZJQL 4JHDB 4EHTA 3CJAA 1GLJO 1T7PA 4KHWA 1HPZA 4KHYA 3FLCO 2VQEK 5HROA 3U7DA 1NOYA 4CJPA 1XHZA 2E88A 3R6MA 4EP4A 1YVNA 3A5LC 4CIEA 3AVCA 3VQCA 1YF5L 2ZE2A 1VSEA 3OS0A 1NBWA 3CCQN 2ZWHA 3A2FA 4DSKA 1DLOA 3V81A 4E1NA 4CF2A 1GC6A 1ISNA 5AQGA 2VG5A 4YORA 4H5VA 4JKGB 4KH5A 4O0IA 3JAMO 4JS4A 3O9QA 4B9MA 1U04A 4BRCA 3P4IA 3V1QA 2BH1A 3T1AA 5BN9A 1ZBFA 2WFBA 2Q1NA 1SQKA 4E7KA 1RBVA 2A1SA 1NGEA 1EO1A 4DF8A 2E4LA 1QZ6A 3Q7CA 3LAMA 1E4GT 3VTHA 3QEVA 2CGKA 1NGAA 4LFAK 1VQPN 5KGXA 1O1WA 3EE9A 2GWJA 1K8KA 3O4WA 4CJWA 2CGLA 3I55N 1BU6O 1TK0A 1WBBA 1EETA 2HHXA 1LW0A 2O8CB 3I0RA 2YHYA 1BOTO 2YI1A 5AQYA 3CCMN 1NGFA 1NGJA 1L3SA 1NG9A 2P9KB 1G15A 4H5NA 1ZBLA 3A0IX 3CIPA 2FBTA 1QSSA 3HVTA 3JS6A 5JMVA 1K9MO 4KB0A 2Z1HA 1S1WA 4B9LA 5AQJA 2HHWA 2H3GX 2I1KA 3KHYA 3E9LA 4FLZA 4C1NK 4NO7A 1HYVA 3KLIA 1SL1A 3D2EA 3QEXA 1I39A 3SK3A 2QWNA 4JV5K 2X6SA 1VHXA 3T3FA 4CJQA 1RT4A 4KI6A 1HBKA 1NJWA 3H3OB 1DIKA 4OPJA 3CHWA 4LF4K 4M3UA 1J9AA 4F2SA 1FK9A 3HSTB 2ZD1A 4FWNA 4CHOA 3TPQA 5LL6Z 3OJSA 1JL1A 1S3XA 4GW6A 2D11A 4DV6K 3S3NA 3QDKA 4BWJA 1HYZA 5FPNA 2P5OA 5CZ1A 2HHVA 4FLYA 4X64K 2GX9A 3VEZA 2E20A 3F9KA 4K43A 4R79A 4NY0A 1SKSA 4CZJA 1NVLA 3HPHA 4IDKA 2QM1A 4DTJA 3VQ5A 5M1QA 4AQYK 3PSIA 4FJ9A 3TAQA 4W5QA 1BDGA 1NLVA 1MU2A 4IFVA 1Q9YA 1VRTA 2YNIA 3LP3A 1RTDA 4JAXA 4B1VA 1IBLK 4IJNA 4I6MB 3HO1A 1TKTA 4LF9K 1S1TA 4WYBA 4AF1A 5GAEP 1E4FT 1W97L 3MWPA 5DMRA 3VEWA 3RRGA 4BRQA 1QQOA 3ZSYA 5AFUA 5C2FA 4CJLA 1QQMA 3CCLN 2P9LA 1VQON 5HRSA 5KTQA 3CJBA 3AVLA 1Z6RA 2NRZA 3I33A 4PKHA 4C8OA 2FBXA 1L5UA 2HBLA 5J1EA 2I7NA 2VG7A 4ZTFA 2IVPA 3NFAA 1VAZA 4HWIA 3ZX2A 4H0XB 3SYZA 4E7IA 1QHTA 3HRGA 3THXA 3E9OA 1S22A 1YTAA 4O0JA 3GG4A 5F0XA 1IH7A 1U48A 3V6DA 1K8AO 1WOQA 2O8FB 4CW7B 4MLHA 3SJHA 4BG8A 2ASPA 4JN4A 1NGHA 5AQRA 3IDHA 4IEEA 2EMTA 4DU3A 3V4IA 3SPZA 3MXMA 5FPEA 1QS4A 1N34K 2A3ZA 5GAHP 3BZKA 2HHHK 5M1PA 4B1XB 3OYEA 2YX6A 3NCIA 3EYZA 3QLHA 3CG7A 3L6QA 3IS9A 3OW2M 3EKSA 5FROA 4YOTA 4JK7A 4F2RA 1NGIA 4JHDA 4JI7K 4GVMA 2HE7A 4Y0WA 2IIRA 1ITGA 4H8KA 5KPRA 4R5PA 5CYQA 4JKAA 4MLEA 4CEQA 1UA1A 4H5RA 3RSEB 4AM6A 3VEOA 1QZ5A 1KAXA 3VEVA 4IG0A 1H4RA 3G6EN 3ENBA 4PL8A 2E2QA 3RR7A 3G4SN 3QEIA 4DLEA 4C1NI 4F7GA 3PLAA 4PUOA 4CF0A 3ZCMA 3K5OA 4BREA 3ZT0A 4CHPA 3AARA 1RTHA 3LP1A 3CC4N 4H0PA 2UXDK 4FWKA 4DXAB 3E66A 3L4IA 4UQGA 4FJ7A 1QHAA 1VSMA 5J2MA 3ZEUA 3AA5X 1G99A 3CPWM 3MN9A 4X66K 3QFPA 2FBVA 4ILHA 1C1AA 2XY5A 4M7YA 1RDDA 1TVRA 2E6MA 4JI8K 4HDQA 3ZT1A 1S1VA 1J53A 4DCHA 3AAQA 4FK2A 4BR7A 3LWMA 3DAWA 3W0LA 2NRWA 3M5RA 4O44A 3J7AP 3MCPA 2F4VK 2FSNA 3BDPA 2HBMA 3H6EA 3MEDA 4IEIA 5FPDA 4AHTA 4LF5K 2P9KA 4ICLA 1UOCA 2A6AA 4B9VA 5BRFA 2D0CA 4KI4A 4DR1K 5SZTA 3TI0A 4M45A 2GUPA 2YV0X 4HTLA 1J5EK 1U2VB 2QWQA 1IO2A 4FJMA 2AJQA 4CIGA 1X9SA 4FZYA 3HOTA 3VQBA 1T03A 4J2EA 2HOEA 2YCHA 3V9SA 1VSIA 1EKEA 4XH5A 4KHQA 5KRTA 4OPAA 2KTQA 5SWMA 1MWMA 4K8XA 3HPGA 3SLCA 4FWOA 4YDUC 4CJEA 2RF2A 3ZT3A 1VQ9N 4EHUA 3F2KA 2DY4A 3CQXA 3ZLJA 4E1JA 3A5NC 1LCUA 1DTQA 4FWRA 4WFNL 5T7BA 1X9WA 3MEGA 4I9LA 3HZ6A 4CJUA 3M8SA 3PSFA 1BI4B 4FW2A 1IG9A 4JK9A 2Q97A 3OA9A 3MXJA 3AVMA 3DI6A 4H4OA 4XH1A 4F8RA 1S6QA 2DFHA 3PV8A 2WTUA 4QS8A 1TGOA 4FL9A 2KFNA 5C0YA 4B3SK 2WBNA 4B3OA 4LD0A 5BREA 4H4MA 3KK7A 5AQTA 1MDUB 5JLHA 3KIOA 3T19A 4JRQA 3QEPA 3B8AX 2AEHA 3A5MC 1KC7A 2I7PA 4YNQA 4IZ9A 1A5VA 3SAFA 4DV4K 2D0PA 4CJ4A 2HW3A 3UKRB 1UA0A 1C0MA 4CZHA 4CHYA 3SZ2A 4DSLA 4DTXA 3QBXA 2KKZA 2ASOA 4JKEA 3CJ1A 4V19S 4XH4A 4KBOA 2ETJA 2IDOA 3ZSVA 3KK1A 4CF1A 2V52B 2Q0RA 1WSFA 1I3AA 1RILA 3WA0A 4CI6A 2Q2RA 2XRIA 4ELUA 1TKZA 2YVCA 2RPIA 3E01A 1SUQA 1C0TA 4JLHA 5IWAK 4PHTX 4DFJA 4HHTA 4CHNA 4DS4A 3PVLA 4B1ZA 4E19A 5FRNA 1N32K 4Y1DA 4Z4HA 3KK3A 5KGWA 1CLQA 4WQ4A 2F9TA 4GVEA 1TL1A 4DTPA 3FLVA 3T69A 1EQYA 4JYAK 5C15A 1GOCA 5HOOA 3L2UA 3BF3A 2WUSA 3RSEA 1W9HA 3PX4A 4CE9A 4QCLA 1KVCA 3JXUA 3CC7N 4DG1A 3O3HA 1EWQA 4IOXA 1RBTA 3O4QA 2Q36A 1FKOA 1Q9XA 2GELA 2V51B 4O55A 1XC3A 3OTOK 4DSEA 1VSLA 4PWDA 4WF9L 1YJNN 3BY5A 3M3ZA 2ZJPL 3TSQA 4BWMA 3ZSRA 3X23A 3VQ8A 1ATSA 3EL2A 1F21A 3AVKA 2P9SB 5AZIB 2E6LA 1NKBA 4FM0A 1Q86O 2ZJRL 4I2QA 4DR5K 3DXMA 2GBZA 3N4QA 3D0PA 2QKKA 4DQSA 2UXBK 4IO9L 1N5YA 2B4JA 3L0QA 2VGMA 1T6DA 5IT9O 4DTUA 3KLHA 3K5LA 2P1JA 3PO5A 2HF3A 3LDLA 2E2NA 3FZHA 1Z25A 2A5XA 3R9PA 3FFIA 3LPTA 4CBWA 3DLBA 4N41A 2ZF5O 3EPYA 3J80O 4KKOA 2NRTA 3C6AA 1DEJA 3OYHA 2D5RA 1U6ZA 4K25A 3HBTA 4BRMA 3MX2A 4NCAA 2YNHA 4DV5K 1DKGD 4OLAA 4B1UB 3B6PA 2VWJA 4YOUA 2HF4A 2O4GA 4HCBA 3ALYA 3CJCA 1GLEG 2XHBA 1LAWA 2YNFA 4CEZA 3MWTA 5ADXA 5JLFA 4DTSA 1RBUA 2Z1IA 4BRFA 3W3DA 2I5JA 5AR0A 3WXIA 2BDPA 1ATRA 3AVIA 3N4PA 2W6LA 2VYPA 5LMNK 3EEQA 2DFEA 1HKGA 2Z1JA 4JI0K 3LALA 5AQFA 2VGNA 4W5OA 4BVPA 3L2VA 4J2BA 2LSNA 4WQ5C 1LWEA 1T3VA 3UKUA 4EZ6A 4B8CA 1C6VA 3MN5A 1YIJN 2KFZA 4O8KA 1SKRA 3LDPA 4NLBA 4KHSA 5KPZA 4IOAL 2HHUA 3CFPA 1XNRK 2QA4N 3QO9A 4A2AA 1ATNA 5M1NA 4PKGA 1YAGA 4BDPA 4IO8A 3JYTA 4YOXA 3VGLA 4ID1A 3K59A 4PY5A 2F8SA 1ACAA 3A8YA 4A2BA 4B9SA 3RMAA 3PUFA 3CCEN 4AH9A 2ZM6K 4AHSA 1BL3A 3WT0A 1SGHA 4BRAA 3ID8A 4ILGB 3V9XA 2AL6A 4KH4A 5EVZA 4CK1A 4DS5A 3THYB 1YTUA 4KHPK 1BQMA 4A5BA 1N6QA 3IKMA 5KI6A 3EZWA 5C25A 2OPQA 3HPOA 2QWLA 3IVFA 2OTLN 1IBKK 4CIFA 2G8VA 1VSJA 4OKJA 2Q31A 4Z4CA 4HUEA 4B9QA 3AA2A 5GAGP 1KQSM 4JI1K 2NLXA 3O9UA 1U47A 2QK9A 1WAFA 5DK5A 3DLGA 3K5NA 3OHRA 3HP6A 1YT3A 1HNZK 2G8FA 5AZJA 3TSUA 4NXMK 3OYJA 4JS5A 1HYSA 2O8EA 3THWB 1VQ8N 1XC9A 3IFRA 1Q81O 3DOKA 3U8ZA 3H46O 2I1JA 4FXDA 4OKEA 1GOAA 3P39A 1J19A 4IBNA 5D3GA 3DRSA 3R1XA 4PKIA 3VA0A 3SBGA 2ZGZA 4Z4GA 1HQUA 3VQ9A 2OANA 2HNDA 4FK0A 3R8EA 3U9DA 1WN7A 4FJHA 3EO3A 4DLGA 2A1RA 4DKWA 1HB6A 1YUWA 3WUHA 3F9MA 1CZ9A 1HMVA 1RFQA 4RW9A 4AHVA 3KD5E 1WLJA 3QNOA 3RR8A 4FLXA 2Y1IA 2FLOA 3HI0A 5LJWA 2P5GA 3AVJA 4FVUA 1NNEA 3KJVA 1CXUA 3OJUA 1L3TA 4H0TB 1Y19B 1GLCG 2P9PB 2A42A 5KQDA 2WONA 4X65K 4DR3K 3MEEA 3NH1A 4L8RB 3VOVA 4DSJA 3OYKA 5C2DA 3OYFA 1GC7A 1RT5A 3HSCA 4XIUA 3WNGA 4CFCA 4PA1A 3TAEA 4G1QA 4P7IA 3M6GA 4IG3A 4FPBA 3HP9A 4BRIA 1MIZB 3VQ7A 2UUBK 3KLEA 2P9NA 3ENOA 3ZT2A 5MLCQ 2HMPA 3WXMB 2G8IA 2P9UA 2R7YA 1XNQK 3AO5A 2G8UA 3LAKA 3GE1A 3OYBA 1MA9B 3QICA 4JNEA 5CE3A 1TK5A 4FPAA 5EX5A 2V7ZA 4IOCL 2W40A 2PAVA 5ELZA 1VRUA 4LF6K 4FJGA 4DFMA 1FJGK 2D0AA 2RQ1A 2X74A 1NK0A 1HNWK 2QWRA 4ELTA 4FK4A 3C95A 2JWKA 4WE1A 4BRGA 4CJTA 3CQYA 3ULEA 4BGBA 2FDQA 5HRRA 1ZXOA 3T7ZA 1QSYA 3AA4A 5AQUA 5AQQA 2HMIA 1YXQA 1VK0A 4A62A 3NH0A 1WB9A 2O8BB 4CZLA 5EXWA 1S5JA 4CGGA 3UE5A 3LL3A 1HPMA 3G25A 4ID5A 4DTNA 3AVAA 4JI5K 1JCGA 2JGUA 3M1FA 5LY3A 1LAVA 1HR0K 1KVAA 1ST7A 1KAZA 1CXQA 1Z05A 4M3RA 4GXBA 1VQMN 4KB1A 4OPHA 1SZ2A 1OVQA 2JLEA 1KAYA 4WFAL 3G71N 2NZTA 3SQ2A 1ZC6A 2YHXA 1V4TA 1ZYQA 3D2FB 4I7FA 4EIAA 3ZSOA 2ATQA 3VGMA 4F3OA 1RCHA 1S9GA 3KKSA 4OJRA 4JKGA 1LWFA 3QERA 2CH6A 5GINA 4PQUA 3ATVA 3LPUA 1WSEA 3NDKA 4M41A 5I9EB 1U4BA 4PL7A 3TAFA 3FZLA 5E84A 1OH6A 4YY3K 4RW4A 1OH7A 3MCAB 3MDQA 2KLAA 2XY6A 1J6ZA 4DV1K 1GLDG 2E5LK 3P1GA 4LF8K 3WNHA 1S1XA 2QKBA 4LF7K 1X3NA 3BP8A 4DV2K 1JL2A 4GV6A 5HRNA 4E7HA 1BCMA 4CEAA 3CQ8A 3OYMA 4NCGA 1NK6A 1Q82O 1B9FA 3DJCA 1KRPA 3EZ5A 1RT2A 1L3UA 2HNYA 3CPEA 5FPMA 4FWMA 4QS7A 2O8CA 3KLFA 3AVGA 3VQEA 1HNIA 3ZX3A 3F73A 1D5AA 2E2PA 4CBXA 2HSTA 3DLEA 1T05A 2OTJN 3EY1A 4B9UA 1SS6A 4FLVA 1IG8A 4B1WB 3THWA 2VWKA 3OS2A 4LFCK 3O80A 4O5FA 4RG8A 3P31A 1IBMK 1B9DA 3VERA 2EWSA 3QIJA 1ZBUA 2OCEA 4M63C 3ASMA 1RDWX 4BC2A 2KZZA 3KD1E 1TYQB 4QOZB 1NMDA 4LH4A 2XY8A 5AFUH 2E2OA 4XEIA 2YJFA 1BA1A 4BRLA 1QSLA 3ZSQA 4CGHA 4CGIA 2O8DB 2IOCA 5CZ2A 4KREA 3AU5A 4KRFA 4CJSA 2D10A 4A61A 4DR2K 4CK3A 3OBYA 3L2WA 1BGXT 4M3WA 1C0GA 3DXKB 4BR9A 4EZ9A 1E5WA 1H1VA 4DU4A 4DQRA 3PO4A 4AHRA 5GADP 4GV3A 2LBBA 1WUAA 2FBYA 3K57A 3QETA 4BE1A 5AQMA 3CFRA 3PIOL 1WBDA 3D7EO 1SL2A 4GKKK 5LJVA 2QXFA 1RBSA 1RT7A 2UUAK 3HK2A 4I6MA 3ENHA 1Q7YO 3NAEA 1GLAG 2COPA 3ID6A 4LY7A 3V9ZA 3V1RA 4BVOA 4JK8A 1NOZA 4BRHA 4E89A 2PZSA 1JXEA 2Z1GA 4BG9A 1D9DA 5TKWA 3HJFA 2D2QA 3GDQA 1RDUA 3SI6A 1NWKA 3BUZB 3FZKA 1XI1A 2X6NA 3O6WA 3CYMA 4MDBA 5JVGL 1HX1A 1IV0A 2ZGYA 2J0KA 1BA0A 3EKUA 2YNGA 2O8FA 1RT1A 4CJ3A 1W2BM 1OH5A 5AQLA 5TKYA 2YKMA 4A57A 3WEEB 2YHAA 2IVNA 3ZSWA 3S9HA 4JI6K 1S9EA 3HVRA 4OGEA 3K58A 4AHUA 4LH5A 4MFBA 2X0SA 3TR8A 4AM7A 1WSHA 2OZMA 3FR0A 2V7YA 2VCPA 2GWKA 3SUPA 1J5OA 2GUIA 3DM2A 3R3LA 1K8KB 2YKNA 2W41A 2YHBA 3CI5A 1RDBA 1NK4A 4FZXC 4FJLA 4FZZA 2NRHA 1TV6A 1FXXA 3PZDA 1UWBA 4Z4FA 2XY7A 3FE1A 3VMFB 1OH8A 2QWOA 3E1YA 2G8HA 4BGAA 1JLGA 4BRPA 4E7JA 1OKJA 5AQHA 2PFUA 4M3YA 3D2FA 5JVLA 1DTTA 3DRPA 3V9WA 2KQ2A 2BANA 4HTUA 2ZPYA 2VQFK 4DFKA 3VENA 1ASUA 1HNVA 4DR6K 3LP0A 1HLUA 3THVA 4KAZA 4K41A 3S41A 2GTDA 2NRVA 2D0BA 2OPSA 3AVFA 3WQTA 2F7TA 4N76A 1EF1A 4DUYK 1HNXK 2EX3A 4UY8O 3D2EB 2IS3A 1VSDA 2CGJA 1KBLA 4JEPA 3PX6A 3E9PA 3RMCA 3ZSXA 1EX4A 4KFBA 3O9TA 5HP1A 3S3OA 4CGJA 2D1KA 2D4WA 1DGKN 4G9ZA 1QVFM 1QE1A 4K42A 1RGIA 3T1YK 3OBWA 4FWLA 3K5MA 4MQ3A 3TWHA 4NB4A 2QW9A 4M3XA 4OKKA 4DTOA 3CMEN 4CCHA 4OO1J 2PYLA 2F9WA 1SL0A 1BO5O 2Q0UA 1MK9B 4BR4A 1HJRA 4FOIA 1V4SA 1D8YA 3NHGA 4K0KK 3H3NO 1D4XA 1BIZA 4DQIA 3QIOA 2VG6A 3L3VA 1U2VA 1VQNN 3U8XA 3LZJA 3G10A 4Z94A 3G9WA 3K2PA 4I9QA 3B6OA 4M3ZA 3DYAA 1NGCA 2UUCK 4F3TA 2WH5A 4CZIA 4NCBA 4BDZA 4N56A 2BTFA 5FRMA 4GMJB 2ABDA 1NI2A 3DRRA 3ATUA 1BHLA 1KLNA 3AGKA 3I56N 1QVGM 5KRSA 4WFBL 1KFSA 2P9LB 4CFBA 4CZMA 1JXBA 4CJ5A 3O8MA 1X9MA 3CXCM 2O8DA 2B5JA 5BRDA 1ASVA 5AQKA 1Q18A 3AU4A 4NYNA 4ELVA 4JI2K 2E1ZA 1BCOA 2J0JA 2RHKA 4BR2A 5KPTA 3QB0A 4L3QA 3U3GA 5J2QA 4FOEA 4HUFA 1BI4A 3THXB 1ESVA 1A5XA 4B8AB 3P5JA 3VQDA 4FM2A 5C12A 1NK5A 4Z4IA 1GLFO 2F96A 3K9JA 4B08A 3VEXA 5AQSA 3CETA 4CZEA 4YHHK 3CC2N 3O9RA 3VPZA 3M8RA 1VQ5N 3SMPA 4FLTA 1ILYA 3A5OC 4MDAA 4DQ8A 5I3UA 1GGOA 3QIPA 4RTFD 4YOWA 4X62K 3VEYA 1VQLN 4N47A 3NGYA 3GOIA 3O3GA 2A41A 1IKWA 4KHUA 1ZBIA 3NMUA 1IKYA 3CMAN 1TL3A 1IKVA 2PBDA 1HKCA 4DQQA 3AVNA 5AQZA 3WXLA 1A5WA 1JLBA 4WQ5A 1SAZA 5DM7L 2FF3B 4CJVA 3UKRA 1N8RO 2HVHA 1W7AA 1C0UA 3U9ZA 2HBJA 5BRHA 4B9TA 2IVOA 3ULDA 4E0DA 4J2DA 3U3YA 1NKEA 3VF4A 3CM6A 4FM1A 3DLHA 2RE2A 3T1HK 4C23A 1HQEA 3CERA 3LDSA 1GOBA 3LDNA 1MK7B 5B8HA 1DT9A 4FWSA 5JS2A 1X1PA 2EMSA 1JLEA 1LWCA 3WEEA 2D0OA 1JCFA 5BR8K 3CCUN 1U49A 3NGIA 4BQZA 3ZEUB 1Z26A 1KLMA 2BE2A 3AO4A 3DWLA 3TANA 4FYDA 4JD2B 3K9KA 4RWTA 4KPYA 3H45C 3C7NB 3HTVA 3KZBA 4EFHA 3IAYA 3VF6A 3SV4A 1B92A 1ASWA 4B3MK 4KTQA 2PYJA 2KZMA 4W5TA 4DV3K 4FJIA 2XO7A 1MIXA 3OVNA 2HB5A 3L2RA 2O4IA 4C8LA 4CK2A 2OA8A 3DLKA 4DR7K 1XWLA 1VSKA 1JKHA 3SMSA 5CHIA 3SV3A 2P51A 1T8EA 3NE6A 2HRJA 5AQNA 4H0YB 4CBUA 5CYMA 4ISFA 2YHWA 3SAHA 2HHQA 4CHQA 3AO2A 1JDEA 4B1YB 4IFEA 2P9SA 4BRDA 5AZIA 5BPLA 2A40A 4OPKA 4E3SA 3TAGA 3KVGA 2GEMA 3HL8A 2B6AA 3HOSA 5ADXH 2YJEA 3IRXA 3EE8A 2QEXN 3P38A 1TUYA 2BUPA 1NM1A 1OVYA 1I94K 4CEBA 1T6CA 4B3RK 3ZT4A 4ISEA 3OYGA 3K0SA 1K6YA 1C0FA 1C1CA 4BY9C 4FJKA 1JLCA 1BQNA 5AQXA 3O1BA 2G8KA 1VQ7N 3LWLA 3D45A 1KFDA 4JI4K 4JKCA 3LDOA 1C1BA 5AQWA 3SQ4A 4HVJA 1BIUA 3OY9A 4H03B 4DR4K 2W42A 4C8NA 4KTWA 1EXQA 4BDYA 1LV5A 4FJNA 1X9JA 1GLLO 3DOLA 1TAQA 3VESA 4FJ5A 2QTDA 1JLFA 4FWPA 4A5AA 5CR4A 3LM2A 4ZRIA 3KKRA 4BQLA 3KTQA 2OPRA 3SAGA 2P9IB 2CB8A 4CFAA 3TABA 5KQ8A 4BROA 3L2QA 2HNZA 4BC3A 1RT6A 1BUPA 3GL1A 4ZRKA 3BZCA 4JRPA 4DU1A 3AGRA 3DLLL 2W6KA 3IMXA 4J2AA 1KSPA 4I2PA 3TTDA 4LFBK 3SQ0A 2HVIA 4O8UA 4C8KA 4J8FA 1RDCA 3TU5A 3CM5A 4JKFA 4CHZA 4N5SA 4BE2A 1KCFA 5A2QO 1NJYA 4CZFA 3NVMA 4IKFA 3PY8A 1GLBG 4CEFA 4A59A 2DTUA 3AO3A 4CEDA 3OYAA 1KTQA 2VWBA 3HM9A 2F8TA 4IFYA 4FCYA 3SCXA 1JCEA 5JICA 5BPNA 3ZX0A 4NYFA 3U4LA 3NH2A 3NGZA 3LZIA 3BINA 2NRXA 4CGDA 2AA4A 4Y1CA 5EOYA 2AP1A 4NLCA 3O5BA 3OYDA 1RDAA 4GY2B 4FW1A 3CF5L 2NNWA 2OZSA 4E7LA 2IGIA 4U7BA 1L3VA 4BC4A 3ZETB 4ISGA 1YI2N 3SPYA 5H1SQ 4BE0A 3I8DA 4Z0UA 1JLAA 5F2RA 3MXIA 3J8AA 1K73O 3VGKA 4DUZK 4O4GA 5IJMA 4K8ZA 4EAHD 4M3TA 3AV9A 3JSMA 1M90O 3THYA 4M42A 5AQVA 1NGGA 4FLWA 3TAPA 1D9FA 4DV7K 2FXUA 3SUQA 1ZBHA 3AVBA 3MECA 4CD1A 4BACA 4CZKA 4CEOA 1QTMA 3WXKA 2QXLA 3ITHA 3RWUA 4CZGA 4HDOA 1X3MA 3RRHA 4ILJA 1W0HA 3D6RA 3CCSN 2ITGA 1IKXA 3QFUA 4QAGA 4O5BA 3H08A 3VN5A 3C65A 2ITMA 2Y1JA 1NKCA 1VSFA 4KO0A 3VF2A 3SUNA 4CJ7A 4KTZA 1HKBA 3CD6N 3AO1A 4LC9B 5M1OA 1Q8IA 4JD2A 3DXMB 3CCRN 4CJRA 4CJKA 1BISA 4DTMA 1MWKA 2E1YA 3AA3A 3QEWA 3C7NA 4MO5A 3BGRA 3UB5A 4QS9A 2WOMA 3Q7BA 4M7XA 4CYEA 4TSXA 4TKNA 1NK7A 3TARA 3FFKB 4FSVA 1VSHA 4YOVA 3MK6A 4OX9K 3ZDTA 1KVBA 3KK2A 3HYFA 2OPPA 5E41A 3QESA 3TAMA 1JLQA 1NGDA 1S72N 3O9SA 4Q0BA 2E8AA 3WNFA 3OYNA 3KLGA 2CQUA 1NTIA 1BG3A 5C42A 3DLRA 1EWRA 1IJJA 3SJJA 2IC3A 5AQPA 5LMUK 4ZRJA 5DM6L 1TK8A 3TTCA 2HBKA 4U67L 3UIQA 3OS1A 2CH5A 4YDUA 4BR5A 2P9PA 1GG3A 3C6HA 4H5WA 4IXCA 2RKIA 3V1OA 5K14A 1REVA 2QI2A 3G0ZA 3NF8A 5HRPA 1WAJA 3DMJA 4BR0A 5M1FA 3WXJA 5HL7L 1N36K 1SKWA 2FF6A 2FJ9A 4JKHA 2BGGA 4CECA 3UKUB 4FJXA 3NF7A 3WNEA
chains in the Genus database with same CATH topology
1JJ2M 1VQ8N 3GBTA 3LDQA 5KPRA 3H3NO 1D4XA 3IFRA 1Q81O 4JKAA 4MLEA 1U2VA 4H5RA 1VQNN 3U8ZA 3RSEB 3H46O 1NGBA 3U8XA 4AM6A 3VEOA 1QZ5A 4Z94A 3G9WA 1KAXA 3KWIA 2I1JA 3VEVA 3LM9A 1NGCA 3G6EN 1H4RA 3ENBA 3P39A 1J19A 4JKDA 2P9IA 4H5TA 2WH5A 4IDHA 3HM8A 4CZIA 2BTFA 2E2QA 3R1XA 4PL8A 3TSPA 4PKIA 3G4SN 2ABDA 1NI2A 3SBGA 4C1NI 1XUPO 3ATUA 4F7GA 2ZGZA 2FSKA 3AGKA 3SBTA 1XQSC 3I56N 5F1XA 5AQIA 3PLAA 4WCEL 4YL8A 1QVGM 4WFBL 3O1WA 2P9LB 2OANA 4CZMA 3O8MA 3R8EA 1Y64A 3FP5A 4BREA 3AARA 3FZMA 3U9DA 5BRDA 3CXCM 5E26A 3EO3A 5GIPA 4H0PA 3CC4N 1YITN 3MX5A 5AQKA 1Q18A 3RVCA 3AU4A 4DKWA 1HB6A 1YUWA 4DXAB 3E66A 2E1ZA 3L4IA 4FWKA 3J7ZO 1QHAA 3WUHA 2J0JA 2RHKA 3F9MA 1RFQA 3ZEUA 4BR2A 5KPTA 1G99A 3CPWM 3MN9A 3QB0A 4L3QA 3QFPA 1KD1O 4FOEA 1M1KO 4ILHA 4BC5A 1ESVA 3FZFA 5C10A 4M7YA 5C12A 4HDQA 2DPNA 2FLOA 3HI0A 3QMLA 5LJWA 1GLFO 1R59O 4DCHA 3AAQA 3H1QA 3F5TA 3K9JA 3VEXA 4FVUA 5AQSA 4WQ4C 1TUUA 3CETA 4BR7A 4CZEA 4BRNA 3CC2N 4H0TB 3O9RA 1Y19B 3DAWA 4FWQA 1GLCG 2NRWA 3M5RA 3O08A 2P9PB 3VPZA 1CZAN 3W0LA 3PIPL 1VQ5N 3SMPA 1ILYA 3A5OC 3AY9A 5EY4A 3MCPA 4MDAA 1T44A 2A42A 4DQ8A 5KQDA 2FSNA 4FO0A 2HBMA 1GGOA 4RTFD 4YOWA 3H6EA 3VEYA 4IEIA 1VQLN 3EN9A 5FPDA 3GOIA 2A41A 2P9KA 3NMUA 1HUXA 3VOVA 3CMAN 2A6AA 2PBDA 5C2DA 1HKCA 2QWPA 5AZJB 1GC7A 5BRFA 4H0OA 5AQZA 3WXLA 3HSCA 4WQ5A 2R82A 1SAZA 3H1VX 5DM7L 3ZETA 2FF3B 4P7IA 2GUPA 3M6GA 1P8ZA 3MN6A 4FPBA 4HTLA 3UKRA 4BRIA 1N8RO 1U2VB 2QWQA 2HBJA 3U9ZA 5BRHA 1MIZB 2IVOA 3CJ9A 3HOTA 2P9NA 3ENOA 3CJ7A 3I8BA 5MLCQ 2HMPA 4YOYA 2ASMA 3WXMB 3ZYYX 3VF4A 2P9UA 4F9OA 2HOEA 2YCHA 2RE2A 5BPMA 4C23A 4XH5A 3CERA 3GE1A 4OPAA 3LDNA 4BRKA 1MK7B 1MA9B 3QICA 4JNEA 5B8HA 5CE3A 1DT9A 4FWSA 1MWMA 4FPAA 4DB3A 5EX5A 2V7ZA 3SLCA 2EMSA 4FWOA 4YDUC 1BWFO 4IOCL 1HJOA 2PAVA 2W40A 3QBWA 3F2KA 5ELZA 3WEEA 2D0OA 4EHUA 1JCFA 5GIOA 3FGUA 3CQXA 4H0VB 3CCUN 4E1JA 3A5NC 4IWVA 2NRRA 1LCUA 3TTFA 4FWRA 2WC9A 4WFNL 2RQ1A 4BQZA 2QWRA 3ZEUB 1VBHA 3HZ6A 3VETA 4DHYA 3BF1A 2JWKA 4BRGA 3CQYA 3MN7A 3DWLA 4JK9A 3ULEA 2Q97A 1P90A 3OA9A 1LOTB 2FDQA 4BGBA 1ZXOA 3T7ZA 4XH1A 4JD2B 5AQUA 5AQQA 3K9KA 4QS8A 1QQNA 4RWTA 1YXQA 3BEXA 3H45C 4A62A 3C7NB 3HTVA 4CZLA 1VQ9N 3KZBA 5EXWA 3UE5A 2J4RA 4FL9A 3LL3A 5C0YA 2WBNA 4EFHA 3VF6A 1HPMA 2JWLA 3G25A 5BREA 2FSJA 1JCGA 3M1FA 5LY3A 3KK7A 5AQTA 1MDUB 3C0BA 5JLHA 1ST7A 1KAZA 1TYQA 1Z05A 1VQMN 4GXBA 4OPHA 1SZ2A 3B8AX 2AEHA 1MIXA 1KC7A 1KAYA 2I7PA 3A5MC 3AAPA 2NZTA 4WFAL 1ZC6A 3G71N 2YHXA 1V4TA 4IZ9A 1KXPA 4MO4A 3D2FB 4EIAA 3VGMA 3SAFA 2UYTA 2D0PA 4JKGA 3SMSA 1YHQN 2CH6A 4EKUA 3UKRB 5CHIA 3KWGA 5GINA 3ATVA 2HRJA 5AQOA 5AQNA 5M1KA 2DIKA 4H0YB 4CBUA 1VQKN 4CZHA 2KHOA 4ISFA 2YHWA 3SAHA 1VQ4N 5I9EB 1ZBSA 2P9NB 1JDEA 4GNIA 4B1YB 3QBXA 4PL7A 4IFEA 2P9SA 2KKZA 2ASOA 4JKEA 3CJ1A 5BN8A 2P9UB 1VBGA 3FZLA 5E84A 4BRDA 5BR9A 1YJ9N 5AZIA 4XH4A 5BPLA 4KBOA 2A40A 3MCAB 4KH6A 3MDQA 3VTIA 3NVKA 3IUCA 2J0MA 2KLAA 3DXKA 3KVGA 1J6ZA 3MMVA 2GEMA 1GLDG 2Q0RA 2V52B 5JVHL 2QWMA 3HOSA 3WQUA 3WA0A 4CI6A 1YJWN 5ADXH 2Q2RA 2YJEA 3CCJN 1X3NA 3EE8A 3BP8A 2QEXN 1O13A 2YVCA 4GV6A 3P38A 1TUYA 2BUPA 4GV9A 1NM1A 1OVYA 4CD3A 1HB8A 1T6CA 1Q82O 4PHTX 3DJCA 4ISEA 3L4QA 1C0FA 4BY9C 3CPEA 5FPMA 4FWMA 4QS7A 5AQXA 3O1BA 3PVLA 1VQ7N 3ZX3A 3ULEB 4JKCA 3LDOA 2E2PA 5AQWA 4CBXA 2HSTA 1KC8O 1VQ6N 1NJIO 2OTJN 4B1ZA 4H03B 4JKBA 1SS6A 4IJAA 4RCHA 1IG8A 4B1WB 2ZJQL 4WQ4A 2F9TA 4JHDB 4GVEA 3FLVA 3CJAA 1GLJO 3T69A 1EQYA 4EHTA 5C15A 5HOOA 1X9JA 1GLLO 3O80A 4O5FA 3FLCO 3P31A 2QTDA 3VESA 4FWPA 3BF3A 3VERA 4A5AA 3U7DA 2WUSA 5CR4A 3RSEA 2EWSA 3QIJA 3LM2A 4BC2A 4M63C 4ZRIA 1RDWX 2E88A 3R6MA 3JXUA 1YVNA 4BQLA 3CC7N 3A5LC 4IOXA 1TYQB 3SAGA 2P9IB 2CB8A 1YF5L 2Q36A 5KQ8A 4BROA 1NBWA 2GELA 2V51B 3CCQN 2ZWHA 1XC3A 4BC3A 1NMDA 1BUPA 3GL1A 4ZRKA 5AFUH 1GC6A 2E2OA 4WF9L 1ISNA 1YJNN 5AQGA 4XEIA 3AGRA 4YORA 3M3ZA 2YJFA 1BA1A 4JKGB 4H5VA 4KH5A 4BRLA 3DLLL 2ZJPL 3TSQA 3O9QA 3IMXA 4BRCA 3AU5A 3X23A 3TTDA 3P4IA 1ATSA 3EL2A 2BH1A 2D10A 4O8UA 4J8FA 2P9SB 5BN9A 4A61A 3TU5A 2WFBA 2Q1NA 1SQKA 4JKFA 5AZIB 1NGEA 1EO1A 3OBYA 1C0GA 3DXKB 1QZ6A 3Q7CA 3NVMA 4BR9A 1E4GT 3VTHA 1E5WA 4CZFA 2ZJRL 1GLBG 1H1VA 4A59A 2CGKA 1NGAA 3DXMA 1VQPN 3N4QA 3EE9A 2GWJA 5GADP 1K8KA 3O4WA 2VWBA 2LBBA 1WUAA 4GV3A 2CGLA 4IO9L 3I55N 1JCEA 3L0QA 1BU6O 5AQMA 2VGMA 3PIOL 3D7EO 5JICA 1T6DA 5BPNA 3ZX0A 5LJVA 3U4LA 3BINA 2NRXA 2YHYA 1BOTO 2AA4A 2HF3A 5EOYA 2YI1A 3LDLA 2E2NA 2AP1A 1NGFA 1NGJA 3FZHA 5AQYA 3CCMN 4NLCA 4I6MA 3O5BA 3ENHA 1Q7YO 2P9KB 2A5XA 3R9PA 4GY2B 4H5NA 3A0IX 3CIPA 1GLAG 4CBWA 2COPA 2NNWA 3ID6A 3JS6A 3CF5L 5JMVA 1K9MO 2ZF5O 3EPYA 4BVOA 4JK8A 5AQJA 2NRTA 3C6AA 1DEJA 4U7BA 1U6ZA 4BC4A 3ZETB 4BRHA 4ISGA 1YI2N 4K25A 2H3GX 2I1KA 3KHYA 5H1SQ 3HBTA 4BRMA 3E9LA 3MX2A 4BG9A 4C1NK 5TKWA 4NO7A 2D2QA 5F2RA 3GDQA 1DKGD 3J8AA 1K73O 1RDUA 4B1UB 1NWKA 3BUZB 3FZKA 3VGKA 3D2EA 5IJMA 2HF4A 4YOUA 4MDBA 3O6WA 2QWNA 3SK3A 5JVGL 4EAHD 1M90O 1HX1A 3CJCA 1GLEG 2ZGYA 1HBKA 2J0KA 5AQVA 1BA0A 1NGGA 3EKUA 3MWTA 3H3OB 1DIKA 3CHWA 1W2BM 5AQLA 5TKYA 5ADXA 2FXUA 5JLFA 4CD1A 4FWNA 4CZKA 4A57A 3TPQA 3WEEB 4BRFA 3WXKA 2IVNA 1S3XA 2QXLA 3W3DA 5AR0A 3WXIA 2D11A 1ATRA 4Y0WA 4CZGA 3CCVN 4HDOA 1X3MA 4ILJA 3D6RA 3QDKA 3CCSN 3N4PA 3QFUA 5FPNA 2X0SA 3C65A 2ITMA 3VF2A 4AM7A 2VYPA 4CJ7A 2GX9A 3VEZA 2E20A 1HKBA 3CD6N 4LC9B 4K43A 4R79A 1HKGA 3FR0A 4NY0A 5M1OA 2V7YA 4CZJA 1NVLA 2VCPA 4JD2A 3DXMB 2VGNA 5AQFA 3CCRN 2GWKA 4BVPA 4WQ5C 1MWKA 2QM1A 2E1YA 1T3VA 3C7NA 3R3LA 4MO5A 1K8KB 5M1QA 3UB5A 3UKUA 2W41A 4QS9A 3Q7BA 4M7XA 3CI5A 3MN5A 1YIJN 2NRHA 4O8KA 4CYEA 3LDPA 1BDGA 3PZDA 1NLVA 4NLBA 4TKNA 3FE1A 3VMFB 2QWOA 3E1YA 4JAXA 4BGAA 5KPZA 4B1VA 4IOAL 4BRPA 4IJNA 4I6MB 3FFKB 1OKJA 4FSVA 5AQHA 4YOVA 2QA4N 3MK6A 4WYBA 4AF1A 5GAEP 3ZDTA 2PFUA 1E4FT 1W97L 3MWPA 3VEWA 4A2AA 1ATNA 5M1NA 3D2FA 4BRQA 4PKGA 1QQOA 5JVLA 1YAGA 5AFUA 4IO8A 5C2FA 4YOXA 1QQMA 3CCLN 2P9LA 2ZPYA 1VQON 3VGLA 1NGDA 1S72N 3VENA 3O9SA 3CJBA 2E8AA 1Z6RA 2NRZA 1HLUA 3I33A 4PKHA 1ACAA 3A8YA 4K41A 3S41A 4A2BA 2GTDA 2NRVA 2HBLA 3WQTA 2F7TA 2I7NA 3CCEN 2IVPA 2CQUA 1NTIA 1VAZA 1EF1A 1BG3A 4HWIA 3WT0A 1SGHA 4H0XB 3ZX2A 3D2EB 4UY8O 1IJJA 2CGJA 1KBLA 4JEPA 3HRGA 3E9PA 4ILGB 3E9OA 1S22A 3ID8A 4BRAA 5AQPA 3O9TA 3GG4A 2AL6A 4ZRJA 4KH4A 5EVZA 5F0XA 5DM6L 4A5BA 1K8AO 2D1KA 3TTCA 1WOQA 2D4WA 2HBKA 1DGKN 4U67L 3IKMA 4MLHA 3EZWA 3SJHA 4G9ZA 4BG8A 2ASPA 4JN4A 1NGHA 5AQRA 1QVFM 3IDHA 4IEEA 2QWLA 2EMTA 2CH5A 3IVFA 4YDUA 4K42A 4BR5A 2OTLN 1RGIA 2P9PA 1GG3A 3C6HA 1Q86O 4H5WA 5FPEA 2A3ZA 2Q31A 4IXCA 3OBWA 5GAHP 5M1PA 4FWLA 4B9QA 4B1XB 5GAGP 2QI2A 1KQSM 2YX6A 2NLXA 4BR0A 3O9UA 5M1FA 4NB4A 3L6QA 3WXJA 2QW9A 3OHRA 5HL7L 3CMEN 4OO1J 3OW2M 3EKSA 4YOTA 2FF6A 2FJ9A 2F9WA 4JK7A 1BO5O 4JKHA 2Q0UA 3TSUA 5AZJA 1MK9B 4BR4A 1NGIA 4FOIA 4JHDA 1V4SA 3UKUB 2HE7A 2IIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKA A;  3E9L A;  3E66 A;  4ILJ A;  4JKE A;  3ENB A;  4JKD A;  4JKF A;  4ILH A;  3E9P A;  4ILG B;  3E9O A;  4JK9 A;  4JKC A;  3SBG A;  4JK7 A;  4JKH A;  3SBT A;  4JKB A;  4JK8 A;  4JKG B;  4JKG A; 
#chains in the Genus database with same CATH topology
 1JJ2 M;  4FJJ A;  3GBT A;  3LDQ A;  4CEE A;  3O4N A;  3NBP A;  3OYL A;  3S3M A;  3OYI A;  2UU9 K;  4RW7 A;  1NGB A;  3KWI A;  3LM9 A;  3C6U A;  3ISN C;  4RW6 A;  4JKD A;  2P9I A;  4H5T A;  4IDH A;  3HM8 A;  3U6F A;  4Q5V A;  4YFU A;  3TSP A;  3HT3 A;  1TKD A;  4NXN K;  3LAN A;  4W5R A;  1XUP O;  4DQP A;  2FSK A;  3SBT A;  1XQS C;  5F1X A;  5AQI A;  2X78 A;  4WCE L;  4YL8 A;  3O1W A;  5HLF A;  1UAX A;  1Y64 A;  3FP5 A;  3QIN A;  3FZM A;  3M8Q A;  5E26 A;  5GIP A;  4F4K A;  1YIT N;  3MX5 A;  3I0S A;  3RVC A;  3J7Z O;  1YVU A;  3MAQ A;  3L3U A;  4B9N A;  1Y97 A;  5I42 A;  3P83 D;  1KD1 O;  1M1K O;  4BC5 A;  1CZB A;  3FZF A;  5C10 A;  1NJZ A;  1RTI A;  4EP5 A;  2DPN A;  3QML A;  1R59 O;  1NK8 A;  3H1Q A;  3F5T A;  3CFO A;  3J81 O;  2ZQB A;  4WQ4 C;  1TUU A;  4RW8 A;  4BRN A;  5FLX O;  2O8B A;  4FWQ A;  3PIP L;  3O08 A;  1EP4 A;  1CZA N;  3AY9 A;  3NF6 A;  3LP2 A;  5EY4 A;  3ZSZ A;  3L8B A;  1XMQ K;  4HCC A;  1LW2 A;  1T44 A;  4FO0 A;  2UXC K;  3EN9 A;  4CES A;  5CY4 A;  4CVN E;  4DV0 K;  1HUX A;  4B3T K;  1NU0 A;  1S1U A;  2QWP A;  5AZJ B;  4H0O A;  3VA3 A;  4AHC A;  5EU7 A;  2R82 A;  3H1V X;  2O8E B;  3SUO A;  3ZET A;  3MN6 A;  4DFP A;  1P8Z A;  5HBM A;  4DWI A;  2HHS A;  3RMB A;  3RTV A;  3CJ9 A;  4JI3 K;  3CJ7 A;  2Q3S A;  3I8B A;  4YOY A;  3HXM A;  2ASM A;  3SNN A;  1NK9 A;  1E3M A;  3C94 A;  3ZYY X;  4F9O A;  2KW4 A;  5BPM A;  4FLU A;  4FVM A;  5J2P A;  4OVL A;  4BRK A;  1NJX A;  4DB3 A;  4KV8 A;  4Z4E A;  1BWF O;  1HJO A;  2RN2 A;  3QBW A;  3VQ4 A;  5GIO A;  3VQA A;  3FGU A;  4H0V B;  4IWV A;  4OLB A;  2NRR A;  3TTF A;  4DTR A;  2WC9 A;  1RNH A;  1VBH A;  3VET A;  4DHY A;  3QNN A;  3BF1 A;  3VQ6 A;  1RBR A;  1WNS A;  3MN7 A;  2G8W A;  3VQP A;  1U45 A;  4CFD A;  1P90 A;  1LOT B;  1RTJ A;  4GKJ K;  1XHX A;  1WSG A;  2FC0 A;  1QQN A;  3BEX A;  4HUG A;  4CJF A;  4CGF A;  4C8M A;  2J4R A;  1R0A A;  4W5N A;  1SV5 A;  2JWL A;  4LSL A;  1HRH A;  1QQC A;  4CER A;  2FSJ A;  1FW6 A;  3VQQ A;  3C0B A;  1TYQ A;  1WSI A;  4CF8 A;  3O3F A;  3C6T A;  3NF9 A;  3AAP A;  2NUB A;  4MO4 A;  3OYC A;  3PX0 A;  1KXP A;  3SQ1 A;  2PY5 A;  4E1M A;  4DSI A;  2EHG A;  2UYT A;  4ZTJ A;  1YHQ N;  4DSF A;  4EKU A;  3M8P A;  3CCV N;  3KWG A;  1VQK N;  5AQO A;  5M1K A;  2DIK A;  1N33 K;  2KHO A;  2GV9 A;  4DMN A;  5AJ3 K;  3J7Y P;  1VQ4 N;  4AIL C;  3RMD A;  1J54 A;  1ZBS A;  2P9N B;  4KHN A;  4GNI A;  2HHT A;  2DFF A;  1XMO K;  5BN8 A;  5BR9 A;  2P9U B;  1VBG A;  1NMN A;  1YJ9 N;  4CF9 A;  4KH6 A;  3VTI A;  3NVK A;  3IUC A;  2J0M A;  3V9U A;  3DXK A;  1RT3 A;  1S6P A;  4DF4 A;  3MMV A;  5JVH L;  2QWM A;  4ZHR A;  3WQU A;  1TKX A;  1YJW N;  3CCJ N;  5J2N A;  1O13 A;  1WSJ A;  4GV9 A;  4CD3 A;  1HB8 A;  4FJ8 A;  4LSN A;  3L4Q A;  5C24 A;  1TAU A;  3IG1 A;  5FDL A;  1FKP A;  5JS1 A;  3ULE B;  1KC8 O;  1VQ6 N;  4OGC A;  1NJI O;  3AVH A;  2OYQ A;  4JKB A;  2IAJ A;  4IJA A;  4RCH A;  2ZJQ L;  4JHD B;  4EHT A;  3CJA A;  1GLJ O;  1T7P A;  4KHW A;  1HPZ A;  4KHY A;  3FLC O;  2VQE K;  5HRO A;  3U7D A;  1NOY A;  4CJP A;  1XHZ A;  2E88 A;  3R6M A;  4EP4 A;  1YVN A;  3A5L C;  4CIE A;  3AVC A;  3VQC A;  1YF5 L;  2ZE2 A;  1VSE A;  3OS0 A;  1NBW A;  3CCQ N;  2ZWH A;  3A2F A;  4DSK A;  1DLO A;  3V81 A;  4E1N A;  4CF2 A;  1GC6 A;  1ISN A;  5AQG A;  2VG5 A;  4YOR A;  4H5V A;  4JKG B;  4KH5 A;  4O0I A;  3JAM O;  4JS4 A;  3O9Q A;  4B9M A;  1U04 A;  4BRC A;  3P4I A;  3V1Q A;  2BH1 A;  3T1A A;  5BN9 A;  1ZBF A;  2WFB A;  2Q1N A;  1SQK A;  4E7K A;  1RBV A;  2A1S A;  1NGE A;  1EO1 A;  4DF8 A;  2E4L A;  1QZ6 A;  3Q7C A;  3LAM A;  1E4G T;  3VTH A;  3QEV A;  2CGK A;  1NGA A;  4LFA K;  1VQP N;  5KGX A;  1O1W A;  3EE9 A;  2GWJ A;  1K8K A;  3O4W A;  4CJW A;  2CGL A;  3I55 N;  1BU6 O;  1TK0 A;  1WBB A;  1EET A;  2HHX A;  1LW0 A;  2O8C B;  3I0R A;  2YHY A;  1BOT O;  2YI1 A;  5AQY A;  3CCM N;  1NGF A;  1NGJ A;  1L3S A;  1NG9 A;  2P9K B;  1G15 A;  4H5N A;  1ZBL A;  3A0I X;  3CIP A;  2FBT A;  1QSS A;  3HVT A;  3JS6 A;  5JMV A;  1K9M O;  4KB0 A;  2Z1H A;  1S1W A;  4B9L A;  5AQJ A;  2HHW A;  2H3G X;  2I1K A;  3KHY A;  3E9L A;  4FLZ A;  4C1N K;  4NO7 A;  1HYV A;  3KLI A;  1SL1 A;  3D2E A;  3QEX A;  1I39 A;  3SK3 A;  2QWN A;  4JV5 K;  2X6S A;  1VHX A;  3T3F A;  4CJQ A;  1RT4 A;  4KI6 A;  1HBK A;  1NJW A;  3H3O B;  1DIK A;  4OPJ A;  3CHW A;  4LF4 K;  4M3U A;  1J9A A;  4F2S A;  1FK9 A;  3HST B;  2ZD1 A;  4FWN A;  4CHO A;  3TPQ A;  5LL6 Z;  3OJS A;  1JL1 A;  1S3X A;  4GW6 A;  2D11 A;  4DV6 K;  3S3N A;  3QDK A;  4BWJ A;  1HYZ A;  5FPN A;  2P5O A;  5CZ1 A;  2HHV A;  4FLY A;  4X64 K;  2GX9 A;  3VEZ A;  2E20 A;  3F9K A;  4K43 A;  4R79 A;  4NY0 A;  1SKS A;  4CZJ A;  1NVL A;  3HPH A;  4IDK A;  2QM1 A;  4DTJ A;  3VQ5 A;  5M1Q A;  4AQY K;  3PSI A;  4FJ9 A;  3TAQ A;  4W5Q A;  1BDG A;  1NLV A;  1MU2 A;  4IFV A;  1Q9Y A;  1VRT A;  2YNI A;  3LP3 A;  1RTD A;  4JAX A;  4B1V A;  1IBL K;  4IJN A;  4I6M B;  3HO1 A;  1TKT A;  4LF9 K;  1S1T A;  4WYB A;  4AF1 A;  5GAE P;  1E4F T;  1W97 L;  3MWP A;  5DMR A;  3VEW A;  3RRG A;  4BRQ A;  1QQO A;  3ZSY A;  5AFU A;  5C2F A;  4CJL A;  1QQM A;  3CCL N;  2P9L A;  1VQO N;  5HRS A;  5KTQ A;  3CJB A;  3AVL A;  1Z6R A;  2NRZ A;  3I33 A;  4PKH A;  4C8O A;  2FBX A;  1L5U A;  2HBL A;  5J1E A;  2I7N A;  2VG7 A;  4ZTF A;  2IVP A;  3NFA A;  1VAZ A;  4HWI A;  3ZX2 A;  4H0X B;  3SYZ A;  4E7I A;  1QHT A;  3HRG A;  3THX A;  3E9O A;  1S22 A;  1YTA A;  4O0J A;  3GG4 A;  5F0X A;  1IH7 A;  1U48 A;  3V6D A;  1K8A O;  1WOQ A;  2O8F B;  4CW7 B;  4MLH A;  3SJH A;  4BG8 A;  2ASP A;  4JN4 A;  1NGH A;  5AQR A;  3IDH A;  4IEE A;  2EMT A;  4DU3 A;  3V4I A;  3SPZ A;  3MXM A;  5FPE A;  1QS4 A;  1N34 K;  2A3Z A;  5GAH P;  3BZK A;  2HHH K;  5M1P A;  4B1X B;  3OYE A;  2YX6 A;  3NCI A;  3EYZ A;  3QLH A;  3CG7 A;  3L6Q A;  3IS9 A;  3OW2 M;  3EKS A;  5FRO A;  4YOT A;  4JK7 A;  4F2R A;  1NGI A;  4JHD A;  4JI7 K;  4GVM A;  2HE7 A;  4Y0W A;  2IIR A;  1ITG A;  4H8K A;  5KPR A;  4R5P A;  5CYQ A;  4JKA A;  4MLE A;  4CEQ A;  1UA1 A;  4H5R A;  3RSE B;  4AM6 A;  3VEO A;  1QZ5 A;  1KAX A;  3VEV A;  4IG0 A;  1H4R A;  3G6E N;  3ENB A;  4PL8 A;  2E2Q A;  3RR7 A;  3G4S N;  3QEI A;  4DLE A;  4C1N I;  4F7G A;  3PLA A;  4PUO A;  4CF0 A;  3ZCM A;  3K5O A;  4BRE A;  3ZT0 A;  4CHP A;  3AAR A;  1RTH A;  3LP1 A;  3CC4 N;  4H0P A;  2UXD K;  4FWK A;  4DXA B;  3E66 A;  3L4I A;  4UQG A;  4FJ7 A;  1QHA A;  1VSM A;  5J2M A;  3ZEU A;  3AA5 X;  1G99 A;  3CPW M;  3MN9 A;  4X66 K;  3QFP A;  2FBV A;  4ILH A;  1C1A A;  2XY5 A;  4M7Y A;  1RDD A;  1TVR A;  2E6M A;  4JI8 K;  4HDQ A;  3ZT1 A;  1S1V A;  1J53 A;  4DCH A;  3AAQ A;  4FK2 A;  4BR7 A;  3LWM A;  3DAW A;  3W0L A;  2NRW A;  3M5R A;  4O44 A;  3J7A P;  3MCP A;  2F4V K;  2FSN A;  3BDP A;  2HBM A;  3H6E A;  3MED A;  4IEI A;  5FPD A;  4AHT A;  4LF5 K;  2P9K A;  4ICL A;  1UOC A;  2A6A A;  4B9V A;  5BRF A;  2D0C A;  4KI4 A;  4DR1 K;  5SZT A;  3TI0 A;  4M45 A;  2GUP A;  2YV0 X;  4HTL A;  1J5E K;  1U2V B;  2QWQ A;  1IO2 A;  4FJM A;  2AJQ A;  4CIG A;  1X9S A;  4FZY A;  3HOT A;  3VQB A;  1T03 A;  4J2E A;  2HOE A;  2YCH A;  3V9S A;  1VSI A;  1EKE A;  4XH5 A;  4KHQ A;  5KRT A;  4OPA A;  2KTQ A;  5SWM A;  1MWM A;  4K8X A;  3HPG A;  3SLC A;  4FWO A;  4YDU C;  4CJE A;  2RF2 A;  3ZT3 A;  1VQ9 N;  4EHU A;  3F2K A;  2DY4 A;  3CQX A;  3ZLJ A;  4E1J A;  3A5N C;  1LCU A;  1DTQ A;  4FWR A;  4WFN L;  5T7B A;  1X9W A;  3MEG A;  4I9L A;  3HZ6 A;  4CJU A;  3M8S A;  3PSF A;  1BI4 B;  4FW2 A;  1IG9 A;  4JK9 A;  2Q97 A;  3OA9 A;  3MXJ A;  3AVM A;  3DI6 A;  4H4O A;  4XH1 A;  4F8R A;  1S6Q A;  2DFH A;  3PV8 A;  2WTU A;  4QS8 A;  1TGO A;  4FL9 A;  2KFN A;  5C0Y A;  4B3S K;  2WBN A;  4B3O A;  4LD0 A;  5BRE A;  4H4M A;  3KK7 A;  5AQT A;  1MDU B;  5JLH A;  3KIO A;  3T19 A;  4JRQ A;  3QEP A;  3B8A X;  2AEH A;  3A5M C;  1KC7 A;  2I7P A;  4YNQ A;  4IZ9 A;  1A5V A;  3SAF A;  4DV4 K;  2D0P A;  4CJ4 A;  2HW3 A;  3UKR B;  1UA0 A;  1C0M A;  4CZH A;  4CHY A;  3SZ2 A;  4DSL A;  4DTX A;  3QBX A;  2KKZ A;  2ASO A;  4JKE A;  3CJ1 A;  4V19 S;  4XH4 A;  4KBO A;  2ETJ A;  2IDO A;  3ZSV A;  3KK1 A;  4CF1 A;  2V52 B;  2Q0R A;  1WSF A;  1I3A A;  1RIL A;  3WA0 A;  4CI6 A;  2Q2R A;  2XRI A;  4ELU A;  1TKZ A;  2YVC A;  2RPI A;  3E01 A;  1SUQ A;  1C0T A;  4JLH A;  5IWA K;  4PHT X;  4DFJ A;  4HHT A;  4CHN A;  4DS4 A;  3PVL A;  4B1Z A;  4E19 A;  5FRN A;  1N32 K;  4Y1D A;  4Z4H A;  3KK3 A;  5KGW A;  1CLQ A;  4WQ4 A;  2F9T A;  4GVE A;  1TL1 A;  4DTP A;  3FLV A;  3T69 A;  1EQY A;  4JYA K;  5C15 A;  1GOC A;  5HOO A;  3L2U A;  3BF3 A;  2WUS A;  3RSE A;  1W9H A;  3PX4 A;  4CE9 A;  4QCL A;  1KVC A;  3JXU A;  3CC7 N;  4DG1 A;  3O3H A;  1EWQ A;  4IOX A;  1RBT A;  3O4Q A;  2Q36 A;  1FKO A;  1Q9X A;  2GEL A;  2V51 B;  4O55 A;  1XC3 A;  3OTO K;  4DSE A;  1VSL A;  4PWD A;  4WF9 L;  1YJN N;  3BY5 A;  3M3Z A;  2ZJP L;  3TSQ A;  4BWM A;  3ZSR A;  3X23 A;  3VQ8 A;  1ATS A;  3EL2 A;  1F21 A;  3AVK A;  2P9S B;  5AZI B;  2E6L A;  1NKB A;  4FM0 A;  1Q86 O;  2ZJR L;  4I2Q A;  4DR5 K;  3DXM A;  2GBZ A;  3N4Q A;  3D0P A;  2QKK A;  4DQS A;  2UXB K;  4IO9 L;  1N5Y A;  2B4J A;  3L0Q A;  2VGM A;  1T6D A;  5IT9 O;  4DTU A;  3KLH A;  3K5L A;  2P1J A;  3PO5 A;  2HF3 A;  3LDL A;  2E2N A;  3FZH A;  1Z25 A;  2A5X A;  3R9P A;  3FFI A;  3LPT A;  4CBW A;  3DLB A;  4N41 A;  2ZF5 O;  3EPY A;  3J80 O;  4KKO A;  2NRT A;  3C6A A;  1DEJ A;  3OYH A;  2D5R A;  1U6Z A;  4K25 A;  3HBT A;  4BRM A;  3MX2 A;  4NCA A;  2YNH A;  4DV5 K;  1DKG D;  4OLA A;  4B1U B;  3B6P A;  2VWJ A;  4YOU A;  2HF4 A;  2O4G A;  4HCB A;  3ALY A;  3CJC A;  1GLE G;  2XHB A;  1LAW A;  2YNF A;  4CEZ A;  3MWT A;  5ADX A;  5JLF A;  4DTS A;  1RBU A;  2Z1I A;  4BRF A;  3W3D A;  2I5J A;  5AR0 A;  3WXI A;  2BDP A;  1ATR A;  3AVI A;  3N4P A;  2W6L A;  2VYP A;  5LMN K;  3EEQ A;  2DFE A;  1HKG A;  2Z1J A;  4JI0 K;  3LAL A;  5AQF A;  2VGN A;  4W5O A;  4BVP A;  3L2V A;  4J2B A;  2LSN A;  4WQ5 C;  1LWE A;  1T3V A;  3UKU A;  4EZ6 A;  4B8C A;  1C6V A;  3MN5 A;  1YIJ N;  2KFZ A;  4O8K A;  1SKR A;  3LDP A;  4NLB A;  4KHS A;  5KPZ A;  4IOA L;  2HHU A;  3CFP A;  1XNR K;  2QA4 N;  3QO9 A;  4A2A A;  1ATN A;  5M1N A;  4PKG A;  1YAG A;  4BDP A;  4IO8 A;  3JYT A;  4YOX A;  3VGL A;  4ID1 A;  3K59 A;  4PY5 A;  2F8S A;  1ACA A;  3A8Y A;  4A2B A;  4B9S A;  3RMA A;  3PUF A;  3CCE N;  4AH9 A;  2ZM6 K;  4AHS A;  1BL3 A;  3WT0 A;  1SGH A;  4BRA A;  3ID8 A;  4ILG B;  3V9X A;  2AL6 A;  4KH4 A;  5EVZ A;  4CK1 A;  4DS5 A;  3THY B;  1YTU A;  4KHP K;  1BQM A;  4A5B A;  1N6Q A;  3IKM A;  5KI6 A;  3EZW A;  5C25 A;  2OPQ A;  3HPO A;  2QWL A;  3IVF A;  2OTL N;  1IBK K;  4CIF A;  2G8V A;  1VSJ A;  4OKJ A;  2Q31 A;  4Z4C A;  4HUE A;  4B9Q A;  3AA2 A;  5GAG P;  1KQS M;  4JI1 K;  2NLX A;  3O9U A;  1U47 A;  2QK9 A;  1WAF A;  5DK5 A;  3DLG A;  3K5N A;  3OHR A;  3HP6 A;  1YT3 A;  1HNZ K;  2G8F A;  5AZJ A;  3TSU A;  4NXM K;  3OYJ A;  4JS5 A;  1HYS A;  2O8E A;  3THW B;  1VQ8 N;  1XC9 A;  3IFR A;  1Q81 O;  3DOK A;  3U8Z A;  3H46 O;  2I1J A;  4FXD A;  4OKE A;  1GOA A;  3P39 A;  1J19 A;  4IBN A;  5D3G A;  3DRS A;  3R1X A;  4PKI A;  3VA0 A;  3SBG A;  2ZGZ A;  4Z4G A;  1HQU A;  3VQ9 A;  2OAN A;  2HND A;  4FK0 A;  3R8E A;  3U9D A;  1WN7 A;  4FJH A;  3EO3 A;  4DLG A;  2A1R A;  4DKW A;  1HB6 A;  1YUW A;  3WUH A;  3F9M A;  1CZ9 A;  1HMV A;  1RFQ A;  4RW9 A;  4AHV A;  3KD5 E;  1WLJ A;  3QNO A;  3RR8 A;  4FLX A;  2Y1I A;  2FLO A;  3HI0 A;  5LJW A;  2P5G A;  3AVJ A;  4FVU A;  1NNE A;  3KJV A;  1CXU A;  3OJU A;  1L3T A;  4H0T B;  1Y19 B;  1GLC G;  2P9P B;  2A42 A;  5KQD A;  2WON A;  4X65 K;  4DR3 K;  3MEE A;  3NH1 A;  4L8R B;  3VOV A;  4DSJ A;  3OYK A;  5C2D A;  3OYF A;  1GC7 A;  1RT5 A;  3HSC A;  4XIU A;  3WNG A;  4CFC A;  4PA1 A;  3TAE A;  4G1Q A;  4P7I A;  3M6G A;  4IG3 A;  4FPB A;  3HP9 A;  4BRI A;  1MIZ B;  3VQ7 A;  2UUB K;  3KLE A;  2P9N A;  3ENO A;  3ZT2 A;  5MLC Q;  2HMP A;  3WXM B;  2G8I A;  2P9U A;  2R7Y A;  1XNQ K;  3AO5 A;  2G8U A;  3LAK A;  3GE1 A;  3OYB A;  1MA9 B;  3QIC A;  4JNE A;  5CE3 A;  1TK5 A;  4FPA A;  5EX5 A;  2V7Z A;  4IOC L;  2W40 A;  2PAV A;  5ELZ A;  1VRU A;  4LF6 K;  4FJG A;  4DFM A;  1FJG K;  2D0A A;  2RQ1 A;  2X74 A;  1NK0 A;  1HNW K;  2QWR A;  4ELT A;  4FK4 A;  3C95 A;  2JWK A;  4WE1 A;  4BRG A;  4CJT A;  3CQY A;  3ULE A;  4BGB A;  2FDQ A;  5HRR A;  1ZXO A;  3T7Z A;  1QSY A;  3AA4 A;  5AQU A;  5AQQ A;  2HMI A;  1YXQ A;  1VK0 A;  4A62 A;  3NH0 A;  1WB9 A;  2O8B B;  4CZL A;  5EXW A;  1S5J A;  4CGG A;  3UE5 A;  3LL3 A;  1HPM A;  3G25 A;  4ID5 A;  4DTN A;  3AVA A;  4JI5 K;  1JCG A;  2JGU A;  3M1F A;  5LY3 A;  1LAV A;  1HR0 K;  1KVA A;  1ST7 A;  1KAZ A;  1CXQ A;  1Z05 A;  4M3R A;  4GXB A;  1VQM N;  4KB1 A;  4OPH A;  1SZ2 A;  1OVQ A;  2JLE A;  1KAY A;  4WFA L;  3G71 N;  2NZT A;  3SQ2 A;  1ZC6 A;  2YHX A;  1V4T A;  1ZYQ A;  3D2F B;  4I7F A;  4EIA A;  3ZSO A;  2ATQ A;  3VGM A;  4F3O A;  1RCH A;  1S9G A;  3KKS A;  4OJR A;  4JKG A;  1LWF A;  3QER A;  2CH6 A;  5GIN A;  4PQU A;  3ATV A;  3LPU A;  1WSE A;  3NDK A;  4M41 A;  5I9E B;  1U4B A;  4PL7 A;  3TAF A;  3FZL A;  5E84 A;  1OH6 A;  4YY3 K;  4RW4 A;  1OH7 A;  3MCA B;  3MDQ A;  2KLA A;  2XY6 A;  1J6Z A;  4DV1 K;  1GLD G;  2E5L K;  3P1G A;  4LF8 K;  3WNH A;  1S1X A;  2QKB A;  4LF7 K;  1X3N A;  3BP8 A;  4DV2 K;  1JL2 A;  4GV6 A;  5HRN A;  4E7H A;  1BCM A;  4CEA A;  3CQ8 A;  3OYM A;  4NCG A;  1NK6 A;  1Q82 O;  1B9F A;  3DJC A;  1KRP A;  3EZ5 A;  1RT2 A;  1L3U A;  2HNY A;  3CPE A;  5FPM A;  4FWM A;  4QS7 A;  2O8C A;  3KLF A;  3AVG A;  3VQE A;  1HNI A;  3ZX3 A;  3F73 A;  1D5A A;  2E2P A;  4CBX A;  2HST A;  3DLE A;  1T05 A;  2OTJ N;  3EY1 A;  4B9U A;  1SS6 A;  4FLV A;  1IG8 A;  4B1W B;  3THW A;  2VWK A;  3OS2 A;  4LFC K;  3O80 A;  4O5F A;  4RG8 A;  3P31 A;  1IBM K;  1B9D A;  3VER A;  2EWS A;  3QIJ A;  1ZBU A;  2OCE A;  4M63 C;  3ASM A;  1RDW X;  4BC2 A;  2KZZ A;  3KD1 E;  1TYQ B;  4QOZ B;  1NMD A;  4LH4 A;  2XY8 A;  5AFU H;  2E2O A;  4XEI A;  2YJF A;  1BA1 A;  4BRL A;  1QSL A;  3ZSQ A;  4CGH A;  4CGI A;  2O8D B;  2IOC A;  5CZ2 A;  4KRE A;  3AU5 A;  4KRF A;  4CJS A;  2D10 A;  4A61 A;  4DR2 K;  4CK3 A;  3OBY A;  3L2W A;  1BGX T;  4M3W A;  1C0G A;  3DXK B;  4BR9 A;  4EZ9 A;  1E5W A;  1H1V A;  4DU4 A;  4DQR A;  3PO4 A;  4AHR A;  5GAD P;  4GV3 A;  2LBB A;  1WUA A;  2FBY A;  3K57 A;  3QET A;  4BE1 A;  5AQM A;  3CFR A;  3PIO L;  1WBD A;  3D7E O;  1SL2 A;  4GKK K;  5LJV A;  2QXF A;  1RBS A;  1RT7 A;  2UUA K;  3HK2 A;  4I6M A;  3ENH A;  1Q7Y O;  3NAE A;  1GLA G;  2COP A;  3ID6 A;  4LY7 A;  3V9Z A;  3V1R A;  4BVO A;  4JK8 A;  1NOZ A;  4BRH A;  4E89 A;  2PZS A;  1JXE A;  2Z1G A;  4BG9 A;  1D9D A;  5TKW A;  3HJF A;  2D2Q A;  3GDQ A;  1RDU A;  3SI6 A;  1NWK A;  3BUZ B;  3FZK A;  1XI1 A;  2X6N A;  3O6W A;  3CYM A;  4MDB A;  5JVG L;  1HX1 A;  1IV0 A;  2ZGY A;  2J0K A;  1BA0 A;  3EKU A;  2YNG A;  2O8F A;  1RT1 A;  4CJ3 A;  1W2B M;  1OH5 A;  5AQL A;  5TKY A;  2YKM A;  4A57 A;  3WEE B;  2YHA A;  2IVN A;  3ZSW A;  3S9H A;  4JI6 K;  1S9E A;  3HVR A;  4OGE A;  3K58 A;  4AHU A;  4LH5 A;  4MFB A;  2X0S A;  3TR8 A;  4AM7 A;  1WSH A;  2OZM A;  3FR0 A;  2V7Y A;  2VCP A;  2GWK A;  3SUP A;  1J5O A;  2GUI A;  3DM2 A;  3R3L A;  1K8K B;  2YKN A;  2W41 A;  2YHB A;  3CI5 A;  1RDB A;  1NK4 A;  4FZX C;  4FJL A;  4FZZ A;  2NRH A;  1TV6 A;  1FXX A;  3PZD A;  1UWB A;  4Z4F A;  2XY7 A;  3FE1 A;  3VMF B;  1OH8 A;  2QWO A;  3E1Y A;  2G8H A;  4BGA A;  1JLG A;  4BRP A;  4E7J A;  1OKJ A;  5AQH A;  2PFU A;  4M3Y A;  3D2F A;  5JVL A;  1DTT A;  3DRP A;  3V9W A;  2KQ2 A;  2BAN A;  4HTU A;  2ZPY A;  2VQF K;  4DFK A;  3VEN A;  1ASU A;  1HNV A;  4DR6 K;  3LP0 A;  1HLU A;  3THV A;  4KAZ A;  4K41 A;  3S41 A;  2GTD A;  2NRV A;  2D0B A;  2OPS A;  3AVF A;  3WQT A;  2F7T A;  4N76 A;  1EF1 A;  4DUY K;  1HNX K;  2EX3 A;  4UY8 O;  3D2E B;  2IS3 A;  1VSD A;  2CGJ A;  1KBL A;  4JEP A;  3PX6 A;  3E9P A;  3RMC A;  3ZSX A;  1EX4 A;  4KFB A;  3O9T A;  5HP1 A;  3S3O A;  4CGJ A;  2D1K A;  2D4W A;  1DGK N;  4G9Z A;  1QVF M;  1QE1 A;  4K42 A;  1RGI A;  3T1Y K;  3OBW A;  4FWL A;  3K5M A;  4MQ3 A;  3TWH A;  4NB4 A;  2QW9 A;  4M3X A;  4OKK A;  4DTO A;  3CME N;  4CCH A;  4OO1 J;  2PYL A;  2F9W A;  1SL0 A;  1BO5 O;  2Q0U A;  1MK9 B;  4BR4 A;  1HJR A;  4FOI A;  1V4S A;  1D8Y A;  3NHG A;  4K0K K;  3H3N O;  1D4X A;  1BIZ A;  4DQI A;  3QIO A;  2VG6 A;  3L3V A;  1U2V A;  1VQN N;  3U8X A;  3LZJ A;  3G10 A;  4Z94 A;  3G9W A;  3K2P A;  4I9Q A;  3B6O A;  4M3Z A;  3DYA A;  1NGC A;  2UUC K;  4F3T A;  2WH5 A;  4CZI A;  4NCB A;  4BDZ A;  4N56 A;  2BTF A;  5FRM A;  4GMJ B;  2ABD A;  1NI2 A;  3DRR A;  3ATU A;  1BHL A;  1KLN A;  3AGK A;  3I56 N;  1QVG M;  5KRS A;  4WFB L;  1KFS A;  2P9L B;  4CFB A;  4CZM A;  1JXB A;  4CJ5 A;  3O8M A;  1X9M A;  3CXC M;  2O8D A;  2B5J A;  5BRD A;  1ASV A;  5AQK A;  1Q18 A;  3AU4 A;  4NYN A;  4ELV A;  4JI2 K;  2E1Z A;  1BCO A;  2J0J A;  2RHK A;  4BR2 A;  5KPT A;  3QB0 A;  4L3Q A;  3U3G A;  5J2Q A;  4FOE A;  4HUF A;  1BI4 A;  3THX B;  1ESV A;  1A5X A;  4B8A B;  3P5J A;  3VQD A;  4FM2 A;  5C12 A;  1NK5 A;  4Z4I A;  1GLF O;  2F96 A;  3K9J A;  4B08 A;  3VEX A;  5AQS A;  3CET A;  4CZE A;  4YHH K;  3CC2 N;  3O9R A;  3VPZ A;  3M8R A;  1VQ5 N;  3SMP A;  4FLT A;  1ILY A;  3A5O C;  4MDA A;  4DQ8 A;  5I3U A;  1GGO A;  3QIP A;  4RTF D;  4YOW A;  4X62 K;  3VEY A;  1VQL N;  4N47 A;  3NGY A;  3GOI A;  3O3G A;  2A41 A;  1IKW A;  4KHU A;  1ZBI A;  3NMU A;  1IKY A;  3CMA N;  1TL3 A;  1IKV A;  2PBD A;  1HKC A;  4DQQ A;  3AVN A;  5AQZ A;  3WXL A;  1A5W A;  1JLB A;  4WQ5 A;  1SAZ A;  5DM7 L;  2FF3 B;  4CJV A;  3UKR A;  1N8R O;  2HVH A;  1W7A A;  1C0U A;  3U9Z A;  2HBJ A;  5BRH A;  4B9T A;  2IVO A;  3ULD A;  4E0D A;  4J2D A;  3U3Y A;  1NKE A;  3VF4 A;  3CM6 A;  4FM1 A;  3DLH A;  2RE2 A;  3T1H K;  4C23 A;  1HQE A;  3CER A;  3LDS A;  1GOB A;  3LDN A;  1MK7 B;  5B8H A;  1DT9 A;  4FWS A;  5JS2 A;  1X1P A;  2EMS A;  1JLE A;  1LWC A;  3WEE A;  2D0O A;  1JCF A;  5BR8 K;  3CCU N;  1U49 A;  3NGI A;  4BQZ A;  3ZEU B;  1Z26 A;  1KLM A;  2BE2 A;  3AO4 A;  3DWL A;  3TAN A;  4FYD A;  4JD2 B;  3K9K A;  4RWT A;  4KPY A;  3H45 C;  3C7N B;  3HTV A;  3KZB A;  4EFH A;  3IAY A;  3VF6 A;  3SV4 A;  1B92 A;  1ASW A;  4B3M K;  4KTQ A;  2PYJ A;  2KZM A;  4W5T A;  4DV3 K;  4FJI A;  2XO7 A;  1MIX A;  3OVN A;  2HB5 A;  3L2R A;  2O4I A;  4C8L A;  4CK2 A;  2OA8 A;  3DLK A;  4DR7 K;  1XWL A;  1VSK A;  1JKH A;  3SMS A;  5CHI A;  3SV3 A;  2P51 A;  1T8E A;  3NE6 A;  2HRJ A;  5AQN A;  4H0Y B;  4CBU A;  5CYM A;  4ISF A;  2YHW A;  3SAH A;  2HHQ A;  4CHQ A;  3AO2 A;  1JDE A;  4B1Y B;  4IFE A;  2P9S A;  4BRD A;  5AZI A;  5BPL A;  2A40 A;  4OPK A;  4E3S A;  3TAG A;  3KVG A;  2GEM A;  3HL8 A;  2B6A A;  3HOS A;  5ADX H;  2YJE A;  3IRX A;  3EE8 A;  2QEX N;  3P38 A;  1TUY A;  2BUP A;  1NM1 A;  1OVY A;  1I94 K;  4CEB A;  1T6C A;  4B3R K;  3ZT4 A;  4ISE A;  3OYG A;  3K0S A;  1K6Y A;  1C0F A;  1C1C A;  4BY9 C;  4FJK A;  1JLC A;  1BQN A;  5AQX A;  3O1B A;  2G8K A;  1VQ7 N;  3LWL A;  3D45 A;  1KFD A;  4JI4 K;  4JKC A;  3LDO A;  1C1B A;  5AQW A;  3SQ4 A;  4HVJ A;  1BIU A;  3OY9 A;  4H03 B;  4DR4 K;  2W42 A;  4C8N A;  4KTW A;  1EXQ A;  4BDY A;  1LV5 A;  4FJN A;  1X9J A;  1GLL O;  3DOL A;  1TAQ A;  3VES A;  4FJ5 A;  2QTD A;  1JLF A;  4FWP A;  4A5A A;  5CR4 A;  3LM2 A;  4ZRI A;  3KKR A;  4BQL A;  3KTQ A;  2OPR A;  3SAG A;  2P9I B;  2CB8 A;  4CFA A;  3TAB A;  5KQ8 A;  4BRO A;  3L2Q A;  2HNZ A;  4BC3 A;  1RT6 A;  1BUP A;  3GL1 A;  4ZRK A;  3BZC A;  4JRP A;  4DU1 A;  3AGR A;  3DLL L;  2W6K A;  3IMX A;  4J2A A;  1KSP A;  4I2P A;  3TTD A;  4LFB K;  3SQ0 A;  2HVI A;  4O8U A;  4C8K A;  4J8F A;  1RDC A;  3TU5 A;  3CM5 A;  4JKF A;  4CHZ A;  4N5S A;  4BE2 A;  1KCF A;  5A2Q O;  1NJY A;  4CZF A;  3NVM A;  4IKF A;  3PY8 A;  1GLB G;  4CEF A;  4A59 A;  2DTU A;  3AO3 A;  4CED A;  3OYA A;  1KTQ A;  2VWB A;  3HM9 A;  2F8T A;  4IFY A;  4FCY A;  3SCX A;  1JCE A;  5JIC A;  5BPN A;  3ZX0 A;  4NYF A;  3U4L A;  3NH2 A;  3NGZ A;  3LZI A;  3BIN A;  2NRX A;  4CGD A;  2AA4 A;  4Y1C A;  5EOY A;  2AP1 A;  4NLC A;  3O5B A;  3OYD A;  1RDA A;  4GY2 B;  4FW1 A;  3CF5 L;  2NNW A;  2OZS A;  4E7L A;  2IGI A;  4U7B A;  1L3V A;  4BC4 A;  3ZET B;  4ISG A;  1YI2 N;  3SPY A;  5H1S Q;  4BE0 A;  3I8D A;  4Z0U A;  1JLA A;  5F2R A;  3MXI A;  3J8A A;  1K73 O;  3VGK A;  4DUZ K;  4O4G A;  5IJM A;  4K8Z A;  4EAH D;  4M3T A;  3AV9 A;  3JSM A;  1M90 O;  3THY A;  4M42 A;  5AQV A;  1NGG A;  4FLW A;  3TAP A;  1D9F A;  4DV7 K;  2FXU A;  3SUQ A;  1ZBH A;  3AVB A;  3MEC A;  4CD1 A;  4BAC A;  4CZK A;  4CEO A;  1QTM A;  3WXK A;  2QXL A;  3ITH A;  3RWU A;  4CZG A;  4HDO A;  1X3M A;  3RRH A;  4ILJ A;  1W0H A;  3D6R A;  3CCS N;  2ITG A;  1IKX A;  3QFU A;  4QAG A;  4O5B A;  3H08 A;  3VN5 A;  3C65 A;  2ITM A;  2Y1J A;  1NKC A;  1VSF A;  4KO0 A;  3VF2 A;  3SUN A;  4CJ7 A;  4KTZ A;  1HKB A;  3CD6 N;  3AO1 A;  4LC9 B;  5M1O A;  1Q8I A;  4JD2 A;  3DXM B;  3CCR N;  4CJR A;  4CJK A;  1BIS A;  4DTM A;  1MWK A;  2E1Y A;  3AA3 A;  3QEW A;  3C7N A;  4MO5 A;  3BGR A;  3UB5 A;  4QS9 A;  2WOM A;  3Q7B A;  4M7X A;  4CYE A;  4TSX A;  4TKN A;  1NK7 A;  3TAR A;  3FFK B;  4FSV A;  1VSH A;  4YOV A;  3MK6 A;  4OX9 K;  3ZDT A;  1KVB A;  3KK2 A;  3HYF A;  2OPP A;  5E41 A;  3QES A;  3TAM A;  1JLQ A;  1NGD A;  1S72 N;  3O9S A;  4Q0B A;  2E8A A;  3WNF A;  3OYN A;  3KLG A;  2CQU A;  1NTI A;  1BG3 A;  5C42 A;  3DLR A;  1EWR A;  1IJJ A;  3SJJ A;  2IC3 A;  5AQP A;  5LMU K;  4ZRJ A;  5DM6 L;  1TK8 A;  3TTC A;  2HBK A;  4U67 L;  3UIQ A;  3OS1 A;  2CH5 A;  4YDU A;  4BR5 A;  2P9P A;  1GG3 A;  3C6H A;  4H5W A;  4IXC A;  2RKI A;  3V1O A;  5K14 A;  1REV A;  2QI2 A;  3G0Z A;  3NF8 A;  5HRP A;  1WAJ A;  3DMJ A;  4BR0 A;  5M1F A;  3WXJ A;  5HL7 L;  1N36 K;  1SKW A;  2FF6 A;  2FJ9 A;  4JKH A;  2BGG A;  4CEC A;  3UKU B;  4FJX A;  3NF7 A;  3WNE A; 
#chains in the Genus database with same CATH homology
 1JJ2 M;  1VQ8 N;  3GBT A;  3LDQ A;  5KPR A;  3H3N O;  1D4X A;  3IFR A;  1Q81 O;  4JKA A;  4MLE A;  1U2V A;  4H5R A;  1VQN N;  3U8Z A;  3RSE B;  3H46 O;  1NGB A;  3U8X A;  4AM6 A;  3VEO A;  1QZ5 A;  4Z94 A;  3G9W A;  1KAX A;  3KWI A;  2I1J A;  3VEV A;  3LM9 A;  1NGC A;  3G6E N;  1H4R A;  3ENB A;  3P39 A;  1J19 A;  4JKD A;  2P9I A;  4H5T A;  2WH5 A;  4IDH A;  3HM8 A;  4CZI A;  2BTF A;  2E2Q A;  3R1X A;  4PL8 A;  3TSP A;  4PKI A;  3G4S N;  2ABD A;  1NI2 A;  3SBG A;  4C1N I;  1XUP O;  3ATU A;  4F7G A;  2ZGZ A;  2FSK A;  3AGK A;  3SBT A;  1XQS C;  3I56 N;  5F1X A;  5AQI A;  3PLA A;  4WCE L;  4YL8 A;  1QVG M;  4WFB L;  3O1W A;  2P9L B;  2OAN A;  4CZM A;  3O8M A;  3R8E A;  1Y64 A;  3FP5 A;  4BRE A;  3AAR A;  3FZM A;  3U9D A;  5BRD A;  3CXC M;  5E26 A;  3EO3 A;  5GIP A;  4H0P A;  3CC4 N;  1YIT N;  3MX5 A;  5AQK A;  1Q18 A;  3RVC A;  3AU4 A;  4DKW A;  1HB6 A;  1YUW A;  4DXA B;  3E66 A;  2E1Z A;  3L4I A;  4FWK A;  3J7Z O;  1QHA A;  3WUH A;  2J0J A;  2RHK A;  3F9M A;  1RFQ A;  3ZEU A;  4BR2 A;  5KPT A;  1G99 A;  3CPW M;  3MN9 A;  3QB0 A;  4L3Q A;  3QFP A;  1KD1 O;  4FOE A;  1M1K O;  4ILH A;  4BC5 A;  1ESV A;  3FZF A;  5C10 A;  4M7Y A;  5C12 A;  4HDQ A;  2DPN A;  2FLO A;  3HI0 A;  3QML A;  5LJW A;  1GLF O;  1R59 O;  4DCH A;  3AAQ A;  3H1Q A;  3F5T A;  3K9J A;  3VEX A;  4FVU A;  5AQS A;  4WQ4 C;  1TUU A;  3CET A;  4BR7 A;  4CZE A;  4BRN A;  3CC2 N;  4H0T B;  3O9R A;  1Y19 B;  3DAW A;  4FWQ A;  1GLC G;  2NRW A;  3M5R A;  3O08 A;  2P9P B;  3VPZ A;  1CZA N;  3W0L A;  3PIP L;  1VQ5 N;  3SMP A;  1ILY A;  3A5O C;  3AY9 A;  5EY4 A;  3MCP A;  4MDA A;  1T44 A;  2A42 A;  4DQ8 A;  5KQD A;  2FSN A;  4FO0 A;  2HBM A;  1GGO A;  4RTF D;  4YOW A;  3H6E A;  3VEY A;  4IEI A;  1VQL N;  3EN9 A;  5FPD A;  3GOI A;  2A41 A;  2P9K A;  3NMU A;  1HUX A;  3VOV A;  3CMA N;  2A6A A;  2PBD A;  5C2D A;  1HKC A;  2QWP A;  5AZJ B;  1GC7 A;  5BRF A;  4H0O A;  5AQZ A;  3WXL A;  3HSC A;  4WQ5 A;  2R82 A;  1SAZ A;  3H1V X;  5DM7 L;  3ZET A;  2FF3 B;  4P7I A;  2GUP A;  3M6G A;  1P8Z A;  3MN6 A;  4FPB A;  4HTL A;  3UKR A;  4BRI A;  1N8R O;  1U2V B;  2QWQ A;  2HBJ A;  3U9Z A;  5BRH A;  1MIZ B;  2IVO A;  3CJ9 A;  3HOT A;  2P9N A;  3ENO A;  3CJ7 A;  3I8B A;  5MLC Q;  2HMP A;  4YOY A;  2ASM A;  3WXM B;  3ZYY X;  3VF4 A;  2P9U A;  4F9O A;  2HOE A;  2YCH A;  2RE2 A;  5BPM A;  4C23 A;  4XH5 A;  3CER A;  3GE1 A;  4OPA A;  3LDN A;  4BRK A;  1MK7 B;  1MA9 B;  3QIC A;  4JNE A;  5B8H A;  5CE3 A;  1DT9 A;  4FWS A;  1MWM A;  4FPA A;  4DB3 A;  5EX5 A;  2V7Z A;  3SLC A;  2EMS A;  4FWO A;  4YDU C;  1BWF O;  4IOC L;  1HJO A;  2PAV A;  2W40 A;  3QBW A;  3F2K A;  5ELZ A;  3WEE A;  2D0O A;  4EHU A;  1JCF A;  5GIO A;  3FGU A;  3CQX A;  4H0V B;  3CCU N;  4E1J A;  3A5N C;  4IWV A;  2NRR A;  1LCU A;  3TTF A;  4FWR A;  2WC9 A;  4WFN L;  2RQ1 A;  4BQZ A;  2QWR A;  3ZEU B;  1VBH A;  3HZ6 A;  3VET A;  4DHY A;  3BF1 A;  2JWK A;  4BRG A;  3CQY A;  3MN7 A;  3DWL A;  4JK9 A;  3ULE A;  2Q97 A;  1P90 A;  3OA9 A;  1LOT B;  2FDQ A;  4BGB A;  1ZXO A;  3T7Z A;  4XH1 A;  4JD2 B;  5AQU A;  5AQQ A;  3K9K A;  4QS8 A;  1QQN A;  4RWT A;  1YXQ A;  3BEX A;  3H45 C;  4A62 A;  3C7N B;  3HTV A;  4CZL A;  1VQ9 N;  3KZB A;  5EXW A;  3UE5 A;  2J4R A;  4FL9 A;  3LL3 A;  5C0Y A;  2WBN A;  4EFH A;  3VF6 A;  1HPM A;  2JWL A;  3G25 A;  5BRE A;  2FSJ A;  1JCG A;  3M1F A;  5LY3 A;  3KK7 A;  5AQT A;  1MDU B;  3C0B A;  5JLH A;  1ST7 A;  1KAZ A;  1TYQ A;  1Z05 A;  1VQM N;  4GXB A;  4OPH A;  1SZ2 A;  3B8A X;  2AEH A;  1MIX A;  1KC7 A;  1KAY A;  2I7P A;  3A5M C;  3AAP A;  2NZT A;  4WFA L;  1ZC6 A;  3G71 N;  2YHX A;  1V4T A;  4IZ9 A;  1KXP A;  4MO4 A;  3D2F B;  4EIA A;  3VGM A;  3SAF A;  2UYT A;  2D0P A;  4JKG A;  3SMS A;  1YHQ N;  2CH6 A;  4EKU A;  3UKR B;  5CHI A;  3KWG A;  5GIN A;  3ATV A;  2HRJ A;  5AQO A;  5AQN A;  5M1K A;  2DIK A;  4H0Y B;  4CBU A;  1VQK N;  4CZH A;  2KHO A;  4ISF A;  2YHW A;  3SAH A;  1VQ4 N;  5I9E B;  1ZBS A;  2P9N B;  1JDE A;  4GNI A;  4B1Y B;  3QBX A;  4PL7 A;  4IFE A;  2P9S A;  2KKZ A;  2ASO A;  4JKE A;  3CJ1 A;  5BN8 A;  2P9U B;  1VBG A;  3FZL A;  5E84 A;  4BRD A;  5BR9 A;  1YJ9 N;  5AZI A;  4XH4 A;  5BPL A;  4KBO A;  2A40 A;  3MCA B;  4KH6 A;  3MDQ A;  3VTI A;  3NVK A;  3IUC A;  2J0M A;  2KLA A;  3DXK A;  3KVG A;  1J6Z A;  3MMV A;  2GEM A;  1GLD G;  2Q0R A;  2V52 B;  5JVH L;  2QWM A;  3HOS A;  3WQU A;  3WA0 A;  4CI6 A;  1YJW N;  5ADX H;  2Q2R A;  2YJE A;  3CCJ N;  1X3N A;  3EE8 A;  3BP8 A;  2QEX N;  1O13 A;  2YVC A;  4GV6 A;  3P38 A;  1TUY A;  2BUP A;  4GV9 A;  1NM1 A;  1OVY A;  4CD3 A;  1HB8 A;  1T6C A;  1Q82 O;  4PHT X;  3DJC A;  4ISE A;  3L4Q A;  1C0F A;  4BY9 C;  3CPE A;  5FPM A;  4FWM A;  4QS7 A;  5AQX A;  3O1B A;  3PVL A;  1VQ7 N;  3ZX3 A;  3ULE B;  4JKC A;  3LDO A;  2E2P A;  5AQW A;  4CBX A;  2HST A;  1KC8 O;  1VQ6 N;  1NJI O;  2OTJ N;  4B1Z A;  4H03 B;  4JKB A;  1SS6 A;  4IJA A;  4RCH A;  1IG8 A;  4B1W B;  2ZJQ L;  4WQ4 A;  2F9T A;  4JHD B;  4GVE A;  3FLV A;  3CJA A;  1GLJ O;  3T69 A;  1EQY A;  4EHT A;  5C15 A;  5HOO A;  1X9J A;  1GLL O;  3O80 A;  4O5F A;  3FLC O;  3P31 A;  2QTD A;  3VES A;  4FWP A;  3BF3 A;  3VER A;  4A5A A;  3U7D A;  2WUS A;  5CR4 A;  3RSE A;  2EWS A;  3QIJ A;  3LM2 A;  4BC2 A;  4M63 C;  4ZRI A;  1RDW X;  2E88 A;  3R6M A;  3JXU A;  1YVN A;  4BQL A;  3CC7 N;  3A5L C;  4IOX A;  1TYQ B;  3SAG A;  2P9I B;  2CB8 A;  1YF5 L;  2Q36 A;  5KQ8 A;  4BRO A;  1NBW A;  2GEL A;  2V51 B;  3CCQ N;  2ZWH A;  1XC3 A;  4BC3 A;  1NMD A;  1BUP A;  3GL1 A;  4ZRK A;  5AFU H;  1GC6 A;  2E2O A;  4WF9 L;  1ISN A;  1YJN N;  5AQG A;  4XEI A;  3AGR A;  4YOR A;  3M3Z A;  2YJF A;  1BA1 A;  4JKG B;  4H5V A;  4KH5 A;  4BRL A;  3DLL L;  2ZJP L;  3TSQ A;  3O9Q A;  3IMX A;  4BRC A;  3AU5 A;  3X23 A;  3TTD A;  3P4I A;  1ATS A;  3EL2 A;  2BH1 A;  2D10 A;  4O8U A;  4J8F A;  2P9S B;  5BN9 A;  4A61 A;  3TU5 A;  2WFB A;  2Q1N A;  1SQK A;  4JKF A;  5AZI B;  1NGE A;  1EO1 A;  3OBY A;  1C0G A;  3DXK B;  1QZ6 A;  3Q7C A;  3NVM A;  4BR9 A;  1E4G T;  3VTH A;  1E5W A;  4CZF A;  2ZJR L;  1GLB G;  1H1V A;  4A59 A;  2CGK A;  1NGA A;  3DXM A;  1VQP N;  3N4Q A;  3EE9 A;  2GWJ A;  5GAD P;  1K8K A;  3O4W A;  2VWB A;  2LBB A;  1WUA A;  4GV3 A;  2CGL A;  4IO9 L;  3I55 N;  1JCE A;  3L0Q A;  1BU6 O;  5AQM A;  2VGM A;  3PIO L;  3D7E O;  5JIC A;  1T6D A;  5BPN A;  3ZX0 A;  5LJV A;  3U4L A;  3BIN A;  2NRX A;  2YHY A;  1BOT O;  2AA4 A;  2HF3 A;  5EOY A;  2YI1 A;  3LDL A;  2E2N A;  2AP1 A;  1NGF A;  1NGJ A;  3FZH A;  5AQY A;  3CCM N;  4NLC A;  4I6M A;  3O5B A;  3ENH A;  1Q7Y O;  2P9K B;  2A5X A;  3R9P A;  4GY2 B;  4H5N A;  3A0I X;  3CIP A;  1GLA G;  4CBW A;  2COP A;  2NNW A;  3ID6 A;  3JS6 A;  3CF5 L;  5JMV A;  1K9M O;  2ZF5 O;  3EPY A;  4BVO A;  4JK8 A;  5AQJ A;  2NRT A;  3C6A A;  1DEJ A;  4U7B A;  1U6Z A;  4BC4 A;  3ZET B;  4BRH A;  4ISG A;  1YI2 N;  4K25 A;  2H3G X;  2I1K A;  3KHY A;  5H1S Q;  3HBT A;  4BRM A;  3E9L A;  3MX2 A;  4BG9 A;  4C1N K;  5TKW A;  4NO7 A;  2D2Q A;  5F2R A;  3GDQ A;  1DKG D;  3J8A A;  1K73 O;  1RDU A;  4B1U B;  1NWK A;  3BUZ B;  3FZK A;  3VGK A;  3D2E A;  5IJM A;  2HF4 A;  4YOU A;  4MDB A;  3O6W A;  2QWN A;  3SK3 A;  5JVG L;  4EAH D;  1M90 O;  1HX1 A;  3CJC A;  1GLE G;  2ZGY A;  1HBK A;  2J0K A;  5AQV A;  1BA0 A;  1NGG A;  3EKU A;  3MWT A;  3H3O B;  1DIK A;  3CHW A;  1W2B M;  5AQL A;  5TKY A;  5ADX A;  2FXU A;  5JLF A;  4CD1 A;  4FWN A;  4CZK A;  4A57 A;  3TPQ A;  3WEE B;  4BRF A;  3WXK A;  2IVN A;  1S3X A;  2QXL A;  3W3D A;  5AR0 A;  3WXI A;  2D11 A;  1ATR A;  4Y0W A;  4CZG A;  3CCV N;  4HDO A;  1X3M A;  4ILJ A;  3D6R A;  3QDK A;  3CCS N;  3N4P A;  3QFU A;  5FPN A;  2X0S A;  3C65 A;  2ITM A;  3VF2 A;  4AM7 A;  2VYP A;  4CJ7 A;  2GX9 A;  3VEZ A;  2E20 A;  1HKB A;  3CD6 N;  4LC9 B;  4K43 A;  4R79 A;  1HKG A;  3FR0 A;  4NY0 A;  5M1O A;  2V7Y A;  4CZJ A;  1NVL A;  2VCP A;  4JD2 A;  3DXM B;  2VGN A;  5AQF A;  3CCR N;  2GWK A;  4BVP A;  4WQ5 C;  1MWK A;  2QM1 A;  2E1Y A;  1T3V A;  3C7N A;  3R3L A;  4MO5 A;  1K8K B;  5M1Q A;  3UB5 A;  3UKU A;  2W41 A;  4QS9 A;  3Q7B A;  4M7X A;  3CI5 A;  3MN5 A;  1YIJ N;  2NRH A;  4O8K A;  4CYE A;  3LDP A;  1BDG A;  3PZD A;  1NLV A;  4NLB A;  4TKN A;  3FE1 A;  3VMF B;  2QWO A;  3E1Y A;  4JAX A;  4BGA A;  5KPZ A;  4B1V A;  4IOA L;  4BRP A;  4IJN A;  4I6M B;  3FFK B;  1OKJ A;  4FSV A;  5AQH A;  4YOV A;  2QA4 N;  3MK6 A;  4WYB A;  4AF1 A;  5GAE P;  3ZDT A;  2PFU A;  1E4F T;  1W97 L;  3MWP A;  3VEW A;  4A2A A;  1ATN A;  5M1N A;  3D2F A;  4BRQ A;  4PKG A;  1QQO A;  5JVL A;  1YAG A;  5AFU A;  4IO8 A;  5C2F A;  4YOX A;  1QQM A;  3CCL N;  2P9L A;  2ZPY A;  1VQO N;  3VGL A;  1NGD A;  1S72 N;  3VEN A;  3O9S A;  3CJB A;  2E8A A;  1Z6R A;  2NRZ A;  1HLU A;  3I33 A;  4PKH A;  1ACA A;  3A8Y A;  4K41 A;  3S41 A;  4A2B A;  2GTD A;  2NRV A;  2HBL A;  3WQT A;  2F7T A;  2I7N A;  3CCE N;  2IVP A;  2CQU A;  1NTI A;  1VAZ A;  1EF1 A;  1BG3 A;  4HWI A;  3WT0 A;  1SGH A;  4H0X B;  3ZX2 A;  3D2E B;  4UY8 O;  1IJJ A;  2CGJ A;  1KBL A;  4JEP A;  3HRG A;  3E9P A;  4ILG B;  3E9O A;  1S22 A;  3ID8 A;  4BRA A;  5AQP A;  3O9T A;  3GG4 A;  2AL6 A;  4ZRJ A;  4KH4 A;  5EVZ A;  5F0X A;  5DM6 L;  4A5B A;  1K8A O;  2D1K A;  3TTC A;  1WOQ A;  2D4W A;  2HBK A;  1DGK N;  4U67 L;  3IKM A;  4MLH A;  3EZW A;  3SJH A;  4G9Z A;  4BG8 A;  2ASP A;  4JN4 A;  1NGH A;  5AQR A;  1QVF M;  3IDH A;  4IEE A;  2QWL A;  2EMT A;  2CH5 A;  3IVF A;  4YDU A;  4K42 A;  4BR5 A;  2OTL N;  1RGI A;  2P9P A;  1GG3 A;  3C6H A;  1Q86 O;  4H5W A;  5FPE A;  2A3Z A;  2Q31 A;  4IXC A;  3OBW A;  5GAH P;  5M1P A;  4FWL A;  4B9Q A;  4B1X B;  5GAG P;  2QI2 A;  1KQS M;  2YX6 A;  2NLX A;  4BR0 A;  3O9U A;  5M1F A;  4NB4 A;  3L6Q A;  3WXJ A;  2QW9 A;  3OHR A;  5HL7 L;  3CME N;  4OO1 J;  3OW2 M;  3EKS A;  4YOT A;  2FF6 A;  2FJ9 A;  2F9W A;  4JK7 A;  1BO5 O;  4JKH A;  2Q0U A;  3TSU A;  5AZJ A;  1MK9 B;  4BR4 A;  1NGI A;  4FOI A;  4JHD A;  1V4S A;  3UKU B;  2HE7 A;  2IIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...