3ENKA

1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
340
structure length
340
Chain Sequence
MSTKGTILVTGGAGYIGSHTAVELLAHGYDVVIADNLVNSKREAIARIEKITGKTPAFHETDVSDERALARIFDAHPITAAIHFAALKAVGESVAKPIEYYRNNLDSLLSLLRVMRERAVKRIVFSSSATVYGVPERSPIDETFPLSATNPYGQTKLMAEQILRDVEAADPSWRVATLRYFNPVGAHESGLIGEDPAGIPNNLMPYVAQVAVGKLEKLRVFGSDYPTPDGTGVRDYIHVVDLARGHIAALDALERRDASLTVNLGTGRGYSVLEVVRAFEKASGRAVPYELVARRPGDVAECYANPAAAAETIGWKAERDLERMCADHWRWQENNPRGFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.9A crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei 1710b
molecule tags Isomerase
molecule keywords UDP-glucose 4-epimerase
total genus 125
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3enkA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3enkA02
2ZB8A 1Q7GA 1AXEA 3D5TA 1UZMA 3HN7A 3UW3A 1DXYA 4QFDA 3MJSA 5JYDA 3JYLA 5JAIA 1U3TA 3K96A 3P5SA 3UICA 5IJZA 3OF2A 2FRDA 1ID1A 1UR5A 4RZIA 1H5QA 2VZ0A 1GCUA 4FFNA 4LCEA 4CR6A 1PJLA 2DTXA 3MOIA 5HRUA 4FC7A 1W73A 1XCBA 1NM5A 1Y5RA 3Q9UA 3N74A 4U0KA 2PKQO 4EEZA 2I3GA 1C1XA 4XQGA 4ALJA 5HS4A 1QLJA 2GN4A 2I66A 2X0NA 1PJTA 3DZGA 4MVJE 4CLEA 4M1QA 5I8WA 1LSSA 4J4BA 4BNXA 5KOIA 1KVTA 4QUKA 2HK8A 4J7CA 2GUGA 1JKFA 3SJ7A 3MWDB 4BUCA 3GGGA 5U9CA 4XWYA 4ITUA 5I8ZA 1XDWA 4R16A 3ZCXA 4H3VA 1UUFA 4UUOA 1LXCA 3BTSA 3DOOA 3VH4A 3EW7A 4QO7A 3KEQA 3JYNA 5JXWA 2CY0A 4GX0A 4YAGA 4OSPA 1D8AA 1YOVA 1O94A 5BSEA 4IQ8A 3PHJA 3SLGA 2VHYA 4E30A 4R51A 3PDUA 1VE9A 1PZFA 3K8ZA 4UAGA 1I10A 4O6VA 5L51A 1TEHA 3AY3A 4BNGA 4GLOA 5AXBA 5DOVA 2NVUB 4IDEA 4QSMA 5G0WA 1QV6A 4LSMA 3STHA 4TMFA 5KKCA 3DAFA 3NRCA 4KQXA 5G2OA 2WD7B 2EXXA 4R3NA 5FF9A 3VZRA 5L9AA 2JHFA 3C85A 4YRAA 2VRBA 3JYOA 4GWGA 4BIIA 3GZNB 5C7LO 3A4VA 4B7UA 3BTVA 4RGBA 5KJEA 4BNNA 1ZJZA 4OOFA 1UDAA 2Y1OA 3WTBA 1SMKA 4L9RA 4PG7A 5JS6A 3GEMA 1WVGA 4F6CA 4UVIA 3OMLA 4IQGA 9LDBA 1RM3A 1DJQA 2NACA 3ZNPA 1X14A 3DBLB 2DT5A 2D0IA 2G5CA 3GDGA 2VUUA 1KC1A 2BHLA 1PQUA 3KM0A 3BTOA 1T26A 4CMGA 4DBZA 4PZDA 1SB9A 3I83A 2CF6A 2EWMA 4I08A 2BI7A 2Q1SA 4M8SA 1HSOA 4BO1A 3S8MA 4AJKA 4XZ3A 4NK4A 3K9QO 1F8GA 4OXYA 4Y6SA 3FBTA 2DBVO 1O8CA 4OL9A 4UUPA 4IJKA 4MO2A 4QXMA 2Q46A 3BMNB 4F46A 2PD4A 3ANMA 5DULA 4U0JA 4W4TA 1M67A 2BFPA 2ZQZA 4BB6A 4BMSA 3ZWCA 1MV8A 1A5ZA 2Z5LA 4BKRA 1H6CA 1LSJA 2WDZA 1OC2A 3GLQA 4HY3A 4JBGA 3KB6A 1SC6A 2OO5A 4I9HA 4XR4A 4YACA 1UP4A 3BYZA 4ALKA 1I32A 2XXBA 1KY5A 5JPIA 2NADA 3KUXA 1R6DA 3H2ZA 1ENYA 4MIOA 3E82A 1YKFA 1DPGA 1HDXA 2YFHA 4DREA 3I9LA 3RAJA 1NYTA 1LNQA 1HEUA 4AJ1A 1B0AA 2OL4A 3EYWA 5EINA 2PA3A 1QYVA 3JQBA 4KDEA 4TZKA 3RSHA 4TKMA 5J23A 4YYZA 5EL0A 3ADPA 4LVCA 1Y5MA 1BG6A 1KVUA 3AI2A 2VYND 1DO8A 3QWAA 3VPHA 2R6JA 1U4SA 1NPYA 3B6ZA 1GYRA 1EUCA 1HF3A 3G0OA 3QVSA 3RUFA 1SNYA 1PZHA 4J90A 4Q3AA 2FZEA 5KJCA 1XYGA 3L9XA 1M75A 5DT9A 1UZLA 4B4OA 5EJ2A 1HYEA 1NBOA 4LW8A 3OECA 3GNTA 3BA1A 3UUWA 1X0XA 3QVTA 5DCUA 3TN7A 4W7HA 4GQAA 4EITA 1ADCA 3DONA 2FWMX 1HYGA 2YV1A 3DBVO 1XLTA 3F1KA 2I5PO 5T8KC 3LLVA 1NNUA 1HYHA 3ANNA 3F4LA 1R16A 5FI5A 3CSDA 5EMHA 2OORA 4J1NA 1V6AA 3WOHA 3K6JA 3FR7A 2PZJA 4KUHA 1BHSA 3WGHA 4BGUA 2E37A 1DJNA 1Z7BA 5KVQA 2VT2A 1A27A 3RC1A 3ASUA 1YQXA 4N5LA 4NIMA 2W90A 4KMSA 1ZK0A 2A35A 4RVSA 1X7HA 4IJUA 2EGHA 1MG5A 5BQFA 1U2GA 1ZBQA 2PH3A 3V2UA 1ONOA 4IIVA 2YDYA 4CMEA 2Q1UA 4YPOA 2X0IA 3JQ7A 4PZEA 1LLUA 3GOHA 4XEHA 3PYLA 4E5YA 4A7PA 2X9VA 4C4OA 4CMEC 1XGKA 3GVHA 3NTRA 1QRRA 3OQ6A 1ZSYA 5F1PA 1JU9A 2VWPA 1CETA 1PX0A 2VWQA 4NBRA 3H5RA 1DBVO 1T2AA 1DC5A 2X5KO 1VC2A 3FD8A 4K26A 4NK5A 3MJ4A 4TZTA 4BO3A 6LDHA 1XR3A 4BMNA 2DBZA 1QORA 1MXFA 5JMPA 2GPTA 3HADA 4FOSA 4YT2A 1ZSNA 3WNQA 1Y6JA 3BMQB 5JNLA 3PPIA 3BMCB 3RD5A 3FBGA 2D5CA 3RASA 5FEUA 2DPHA 3DL2A 5TIIA 4HUJA 1Y8RA 4WEOA 3PGJA 3RBXA 4HBGA 3WYCA 4YJDA 3WGZA 1YL5A 1B2LA 2GRAA 1DRUA 2FOIA 3SBOA 2RHCA 2ZYAA 3O4RA 1ZFNA 4D42A 1K6JA 4OKIA 1PWZA 1ZEJA 3I9KA 5JDCA 4CV1A 3GPIA 4KOAA 4I1IA 1HDGO 2IZ1A 1N92A 4CLRA 4WLEA 1GEGA 1AGNA 4XJTA 1SEVA 2B4QA 2Q2WA 2Y1EA 2CVZA 5DF1A 1U2DA 2NTNA 3DBHB 4GSLA 3RFVA 3TZHA 1XU9A 1DIAA 4CM1A 3GVXA 2YDXA 4FSHA 1G1AA 4IMRA 4XGIA 2GZ3A 4U5QA 2E49A 3WG9A 1IB6A 4XA8A 5ADHA 1PJBA 1U7HA 3HHPA 3ICCA 4GSKA 2VTDA 4CM7A 5IZCA 3UOGA 1O6ZA 1BTOA 3RKUA 2DFVA 2VNAA 2YY7A 3EMKA 3PHLA 5L7YA 5B1YA 4DLLA 5B4UA 3ENKA 3C1TA 1PWXA 2O48X 4EUEA 3H2SA 2AW5A 1NFFA 4JLWA 4K1LA 3ZWNA 4RF5A 4ZN6A 4PLZA 1BDMA 4I5DA 1IHYA 1O0SA 3M1LA 2JFHA 2VTEA 3PFFA 2H5LA 1I5RA 5IF3A 4BNIA 3GT0A 3WTCA 3L6EA 4S3MA 1KEVA 3OA2A 5AXAA 1LDYA 2YQ5A 3L4BC 3E18A 4IINA 3CKYA 2NM0A 3OP4A 2O3QA 4IDCA 1N8KA 1VRWA 3IS3A 3U4IA 4EJ0A 3KV3O 1Y7TA 1ISMA 1WPQA 3L4BA 3DMYA 2O7SA 4X54A 5JY1A 2H6EA 1JA9A 2Y67A 4FW8A 1T2DA 4IGEA 2UUOA 4U7WA 2FPPA 1PL7A 3AY7A 2OP0A 2QW8A 1EDZA 3NDIA 1B3BA 1F17A 4RVHA 4QO8A 1NAHA 4R3WA 4TRNA 1HXHA 2DTEA 3U5TA 1C0KA 2F00A 2VYNA 1WXDA 3JQFA 3WSWA 1E7MA 1U1IA 3PHIA 5JY6A 5G0VA 3RUIA 4BKUA 3TSCA 2BLLA 2YYYA 3ANLA 4GWKA 5GMOA 1UH5A 1ONNA 2PNFA 3EK2A 4FN4A 2VT3A 2WMDA 3A28A 4A03A 2D3TA 1O5IA 3KSDO 2Y05A 2IE0A 3EZLA 5LDGA 1PJSA 1MC4A 4MVJG 2V65A 2B4RO 2FN7A 2VWHA 4AJNA 4CQLA 2PD6A 2NV6A 4GVXA 4S1VA 4CJXA 1ONPA 1ISFA 3X2EA 2VZ8A 4I5GA 4JK3A 2PH5A 3O38A 4RPJA 5TC4A 1E3SA 1FJHA 3MWEB 4MKRA 1HE5A 2Y1GA 3HDJA 4E3ZA 1PZEA 2NSDA 3KZVA 2YHIB 3LC2O 1N9GB 1GYPA 1SAYA 2HRBA 4CMAA 4B7XA 2IYOA 4J16A 3M1AA 4B79A 3RUAA 3ZH2A 3Q0EA 4AJIA 1L7EA 2V6FA 1IUKA 4BVAA 4DQVA 2PZKA 4L4SA 3TOXA 2ZTVA 2D4AA 3HJAA 3PQEA 4PZCA 4Q3CA 4KWIA 2RH4A 3VZSA 1QSGA 4CUKA 1LDMA 4Y98A 2HMWA 2VWGA 3VC7A 1N2SA 2DUWA 4MVJF 1N1GA 2X6TA 2H9IA 2RH8A 1B16A 3IOYA 4IDDA 4FPXA 5JAMA 5TX7A 3DEYX 6ADHA 3DZHA 3AM3A 1PU2A 1PEDA 5T57A 3ZHYA 3RVDA 1ULSA 4I5EA 4D3SA 5F1OA 1B26A 1N7GA 3F9IA 1GADO 1YVEI 1FDUA 5A9SB 1HRDA 2V6MA 4NZ9A 4P22A 1H0KA 4BQPA 3KEOA 5ITWA 4GI2A 3WIEA 5HTOA 3H8VA 4AJLA 4E0BA 3F5QA 1ZSVA 4MVJD 1CIVA 3RROA 5DDIP 4Q9NA 4PLGA 5L95A 3WB9A 4DWVA 1YDEA 1UJMA 5JAQA 4CR8A 4I9UA 4ZRMA 5A9SA 3AOGA 4MP8A 3P2OA 1V9LA 3TDKA 4RJTA 1RYEA 1DSSG 2BELA 1VM6A 2FR0A 1IPFA 1R0LA 4NNJA 3E5RA 3W4KA 1RM0A 1GAEO 5IXSA 1Q1NA 3ENNA 1TI7A 3QHAA 4ZA2A 1K6IA 3U9LA 5G0TA 3PIDA 2QZ9A 4PCVA 3ZU2A 5TS3A 3OJ0A 1J4AA 1P44A 4UVGA 2WYUA 4AJHA 1E1LA 1GUZA 1MC5A 2W8ZA 4BKPA 1KOLA 5CEJA 4BNTA 3ORFA 4CLDA 3CE6A 4CR7A 4R4JA 3KYCA 3HDHA 4ID9A 2B5WA 3KLPX 3E9NA 3OJOA 1H2BA 4JNKA 4R01A 2NVWA 2GNAA 2RAFA 5G4KA 5BNIA 1MA0A 1DIGA 2B36A 1EFLA 1H9AA 2SCUA 3QIVA 3WJAA 4CMJA 2ZCVA 1TB4A 5C5IA 4RF2A 3RC2A 1UXJA 1WZIA 3EAGA 1QYXA 3GZNA 1YB1A 2UAGA 4ZQHA 4KUGA 3KYCB 2Q2QA 1NP3A 2HRZA 4DBVO 4Y6PA 4NJOA 1F06A 1AHHA 5TF4A 3I5MA 3OJLA 4IZIA 3DXFA 3ROPA 1ZZEA 4RLHA 4XRGA 1MFPA 4PG6A 2DPGA 3ETEA 4FCCA 1VL8A 3PHGA 2ZTUA 4MKZA 1YBVA 1UXGA 1V8BA 2CUKA 1DRWA 1TXGA 4B3JA 4E2ZA 4GLLA 2Y66A 3KHUA 1M76A 4RPGA 5TT0A 3VKUA 4D44A 4D46A 4Y6RA 3RU7A 3WWZA 4J7UA 1DAOA 2HCTA 3ZN2A 4ND2A 2Q4EA 3B20A 5JMWA 1P1HA 3UCFA 1RM4A 1LA2A 4U8GA 5I7EA 1UXHA 3COSA 3L6OO 4YCAA 3RKRA 1MX3A 5H81A 3VTZA 2WEKA 1RWBA 4J49A 3OIFA 3INGA 3V1TC 2PY6A 5ES3A 2DUUA 2VRCD 4E2XA 1DRVA 4BO4A 4PLCA 3W1VA 5DNAA 3ZV6A 3R3JA 1MP0A 3DWFA 4RLSA 3VDQA 3LQFA 1MXHA 1I2BA 2GYYA 3F5SA 1C0LA 2WTBA 2H1SA 5A5EA 1H6DA 8LDHA 2CZCA 1B7GO 3RU9A 2AA3A 3HWRA 2I99A 3QQPA 1NQTA 4A2CA 1K89A 1BW9A 2OGUA 5HS6A 5KJFA 4Z3KA 1N9GA 4ZRNA 2IZ0A 1PJ3A 1X7GA 4PLVA 1LDBA 1U3UA 3CH6A 5A9RA 5TSDA 3DZJA 3QP9A 5JBIA 3AW9A 3JD1A 4MVJI 1EK5A 1U9JA 1R4MB 1S6YA 1B15A 3NYWA 4PG8A 1NHGA 1HZZA 1CYDA 3IQDB 3WNVA 3K5PA 3IIEA 3R0IA 1PGJA 2JKVA 3TZ6A 4CMIB 1H2HA 1Y8QA 2W2LA 1E1MA 2OFPA 3IUSA 1ZEMA 4FBGA 5JC8A 3OM9A 3WQRA 1ADGA 3I23A 2PD3A 4O1MA 3NAQA 1PS9A 1E6UA 3ITKA 4R5HA 1R4MA 5FWNA 2DAPA 4DLBA 3I3OA 2VOEA 5JCJA 1TT5B 4YR9A 3U4HA 4DUPA 1V0JA 4J1SA 4J9VA 4B8WA 1NQ5A 1EUDA 3OSUA 2AEJA 4G81A 1KEUA 3DZBA 1YO6A 3JQ8A 4PRKA 1GEEA 1O89A 4UEOA 4ALMA 4E5MA 3MOGA 1ZK3A 4XDZA 4URFA 3FPCA 2GN6A 4WASA 1N5DA 3JQ6A 5DN9A 1ZXLA 1GV0A 4IIUA 1LJ8A 2C29D 2EJWA 1IULA 4XCVA 3AK4A 4BQRA 3NDRA 5KKAA 1LLCA 4IQ0A 3JSAA 4QT0A 1GPDG 4BNLA 4KQWA 3SXPA 1YB4A 4XX0A 3BMCA 4LGVA 5A5FA 4CQLB 1Q0LA 2TMDA 1HTBA 1B8VA 3FPLA 4BS9A 1T1SA 4BOYA 3I9JA 1U3WA 5HWSA 3KLMX 3W8EA 4RV9A 2HO5A 2QRKA 3GK3A 4FJ1A 1O95A 4IS2A 2J5RA 1E3LA 4W82A 4XYEA 5L53A 4NU6A 1L7DA 2ZATA 1DC3A 2V7PA 2C5EA 4OAQA 4WUVA 1KVQA 3L9WA 3TNLA 2Y1DA 3GUYA 4RVFA 1D3AA 4UVEA 4YDRA 1NFQA 5AXDA 5T5QA 1IE3A 3UFXA 1PJ4A 1ZVMA 4LRSB 3GRKA 4IJWA 3HSKA 1VJ1A 3F1LA 4N5NA 3IDSA 2F1KA 1DLIA 4R5MA 4ZQFA 1NQOA 3WX0A 4CLOA 2DKNA 4LSWA 1K5HA 1WWKA 1ISHA 2LDXA 2UDPA 2IODA 3FWNA 4OXNA 3QLJA 2AEFA 5GZ3A 2X9GA 2B0JA 1SOWA 1XEAA 4W9NC 3RUEA 5BR7A 1KS9A 1MUUA 4G65A 2X5OA 3C3XA 4WK6A 1ZCJA 3AUAA 3OJFA 5TJ9A 2DLDA 4IXTA 1HDYA 3DBHA 4IZHA 2Z1NA 3VVBA 4XYBA 4ZICA 3K30A 5ILGA 1DHRA 1NTOA 3F4BA 1I30A 3IMFA 3INRA 5HA5A 1GQQA 4MVJA 5KCZA 1ZMOA 1DEHA 1ML3A 1NVGA 4OKNA 4YA6A 4B4UA 2QYTA 2WD7A 3GG2A 4B3HA 3TWOA 1HZJA 1LC3A 2PFGA 1E5LA 1Y1PA 4O59O 3GHYA 4FC6A 1I36A 2E82A 3KSUA 3WGQA 2GCGA 3PYMA 1EBUA 2CD9A 2O3TA 1EE9A 4JJGA 4F45A 2XOXA 4MJLA 3AUSA 3O8QA 4YRDA 3PP8A 5U1PA 4BGIA 3WICA 5BSHA 3JYPA 3L6DA 1DIBA 4J4TA 4QEDA 5I9MA 4FR5A 2EJVA 2JAHA 1TLTA 2EP5A 5T64A 1JN0A 2NNLD 1M66A 4AJ2A 4U6SA 2PZMA 4R68A 1OAAA 4E31A 4EYEA 4FGSA 4DXHA 1BVRA 2FSSA 2B83A 2O2SA 4CM9D 4NJMA 1PR3A 4J0EA 1VJ0A 3GZ4A 4NDNE 4NBUA 4UVHA 1GR0A 4YT4A 1LQTA 1LU9A 3V1UA 1PS8A 1IOLA 2OZPA 3E1KA 3GNSA 5DBIA 2NQ8A 4HXYA 5B37A 1HETA 3WFIA 2O3UA 3FNGA 3TL2A 1VSVA 4NH4A 2P9GA 3AOEA 2J8ZA 5C7OO 1R0SA 3H3FA 3R1IA 3SEFA 2QRLA 4BO7A 4RVGA 1X1TA 2VZ9A 1B8UA 4NBTA 2ZYDA 5JDCC 4TRRA 4IM7A 3PWKA 3NEPX 2JJYA 1ZXBA 1LDEA 1ZW1A 3QVOA 2R00C 2C2XA 3GN2A 4NJMB 4B4VA 1KYQA 3WDSA 4CLOB 1ZK1A 3N7UA 3QVXA 1MGOA 1VL6A 2O4CA 1YWGO 2FR1A 3D64A 3JQDA 3NTOA 3FNEA 1MB4A 1V3TA 4YJGA 1Z73A 5TNXA 1QLHA 3WIDA 2B37A 4BO5A 3H9GA 2OXIA 1YB5A 2AMFA 1EK6A 3G3EA 3DOJA 3W6ZA 1WDKA 2DFDA 1F12A 3DHYA 2PWZA 1E7WA 2HAEA 4CUJA 4PLHA 4DVJA 3WXBA 3EVNA 4DRYA 2HJSA 1Y8RB 3Q3CA 4EW6A 1T25A 2DBQA 3ONFA 2CVOA 3JQAA 4D79A 2HMSA 3PRJA 1LDNA 4WPGA 4PVCA 1Z75A 1JDJA 2AXQA 1FMCA 2JD0A 3JQEA 3ROMA 4W9NA 4IS3A 3RUCA 4ZU3A 5JO9A 2HJRA 1EZ4A 3TRIA 3LZ6A 3U3XA 2C7VA 1D7OA 1PR9A 3C24A 2X1HA 3GVCA 2ZCUA 2Q4BA 2WWRA 2BFOA 2HKIA 3PK0A 3PJDA 5L40A 3L0DA 1HDZA 2EKLA 1DIRA 3EDMA 1A71A 4NR0A 2NLOA 3DZKA 4JXKA 1YJ8A 4DIBA 1XSEA 4CM4A 1LLDA 3ZNNA 3U09A 1BRMA 1ADBA 1FDVA 1CQJA 4AG3A 1FXSA 1KERA 3PZRA 3DAPA 4J3FA 3DZIA 4XB2A 4UEKA 4CMIA 1UDCA 3K2EA 4PGFA 2HU2A 2I76A 2JFGA 4PG5A 3QWIA 4WKGA 1HE3A 3F3SA 1X7DA 3AFMA 1PIWA 3PVZA 3QWBA 1GU7A 4R54A 3M2PA 5JE8A 5KVVA 4XKJA 5EERA 1WNTA 3NDJA 4IDBA 4EUFA 3UH1A 4TKLA 4UEJA 5G0UA 2VHVA 3JQBC 3VVCA 2GLXA 2X58A 2B69A 3EUWA 3PWZA 5JW6A 2WSBA 3QRWA 1E77A 4IY1A 4KTVE 4RQUA 2J3JA 4JP2A 1QR6A 4HADA 4TWRA 1FF9A 2Q99A 3OEYA 1OZAA 3TQHA 4J91A 3WQSB 1Y81A 1A9ZA 3E5MA 1LSOA 3K31A 3H9JA 4Z0PA 1ZUD1 3D5QA 2QX7A 3OIDA 3PZBA 1DOHA 3K73O 5CHEA 1XU7A 1CJCA 4A10A 3P7MA 5H82A 1HSZA 3L77A 1F14A 4OJNA 4NFSA 1EMDA 2H63A 4PLFA 1J5PA 2IYPA 4PLPA 4BNUA 3JQCA 1ZKMA 3RIHA 5F3RA 3LU1A 1E3EA 3LSYA 5JYEA 2Q1TA 4GH5A 2I65A 2R00A 1UP7A 1CDOA 1G0NA 3ZNQA 4XGNA 1TT7A 1SOVA 1PTJA 3VOSA 2GERA 3KSZO 4GX1A 3WLEA 3KBOA 3GGPA 1KEWA 1B3RA 3CUKA 4LVUA 4WNIA 4ESOA 1DIHA 1Q2XA 4XQCA 3WBBA 1PGNA 4CM6A 4GMGA 1UP6A 2LDBA 3OH8A 1T2EA 4YAJA 4UREA 4YEDA 4ONEA 4CM9A 3GR6A 2Y0EA 2GR9A 3FN4A 1UXIA 5A3JA 4II3A 3JQAB 1GZ4A 1KVRA 5L7WA 4RCVA 1EVIA 4A5OA 4Z3DA 2G1UA 1ZIDA 1H9BA 2B5VA 3BAZA 3INTA 4XQ9A 1QP8A 3A06A 1V35A 4AFNA 2P9CA 3CIFA 4N18A 2VCYA 1X13A 3ICPA 4BO0A 3M6IA 4HP8A 2POQX 4CV3A 3HNPA 2Q1WA 1XKQA 3D3WB 3GN1A 2X0RA 2J5QA 3K92A 3RC9A 4ND3A 4XYMA 2PZLA 1HT0A 5I7VA 4L4RA 1ISGA 4GX5A 1BXGB 2YFQA 5COQA 3EHEA 3OBBA 4IBOA 3S2GA 3AI1A 1T2CA 5CDUA 1Z74A 5AOVA 1T2FA 4DA9A 3G1UA 3GAFA 3WBFA 4ALNA 3V2HA 5T67A 3F47A 3D4NA 5IDWA 2BGMA 2FPGA 4Y9DA 4I5FA 4BNKA 2PV7A 2C82A 3BMOA 4PRLA 5B12A 2Y1FA 1DDOA 1A72A 1ZK4A 1WLYA 3WGOA 3Q2KA 4BNWA 2E4AA 4N5MA 3T7CA 3LLSA 3CXRA 2J5KA 4RQTA 5JFOA 3WJ7A 4K6CA 3D4PA 4HFNA 1U3VA 2QG4A 4Q3BA 2GF2A 4ZGWA 2RBEA 1HWYA 4CMHA 5L4SA 3I6IA 5LDHA 4PIVA 3PFWO 4E32A 2PKRA 3PWSA 5I9LA 4Q3NA 1NR7A 1OMOA 4FJ0A 2YHUA 3PEFA 3VHRA 5ILOA 3EVTA 2J6IA 4LMRA 2VHWA 4NQZA 4A0SA 4D3FA 5IG2A 2DBRA 2GD1O 4WECA 1NWHA 1JW9B 3BIOA 2WYVA 1UAGA 2BGLA 2P91A 5AVOA 3KYDB 3RUHA 4B7CA 4IGFA 4E13A 4XRRA 7MDHA 2PGJA 4WNCA 5A06A 1PQPA 2X22A 1PGQA 4MVJH 4D45A 2GASA 3JQFC 3SC6A 2BMAA 1TA4A 2BH9A 5CDGA 4EUHA 3PJFA 3Q6IA 5FFFA 2X0JA 4JBHA 3HG7A 1BVUA 2P4QA 1U5AA 1LRLA 1JWAB 1I2ZA 3ADOA 1ULUA 1E0DA 2RCYA 4Q39A 4I8XA 3S2IA 3T4EA 2C5AA 2CDBA 3JTMA 4W7IA 3S1LA 5CFZA 3OIGA 2JCVA 2CSUA 2B35A 3QWHA 4J9UE 1KC3A 4BNMA 3S55A 3EGOA 2ZB3A 5BT9A 3ABIA 3ON5A 3QW2A 3CPSA 3NUGA 4IPTA 3JD4A 4YT5A 2UV8A 1Y8QB 2FSVA 5ICSA 2DTDA 5CEEA 3DAGA 3ZHZA 2PLAA 3DFZA 3HN2A 3PQFA 1SZJG 3JQGA 4CMKA 1EQUA 3C8MA 4U6QA 4W6ZA 3TOZA 1CERA 5CEFA 4O0LA 4L4XA 4BNJA 1E3JA 3PLNA 4CM5A 4GGPA 3H3JA 4XYLA 1N7HA 1NX6A 2O7QA 3FTNA 4CLRB 2AQ8A 4CUZA 3ZZNA 4EDFA 4W99A 5CG1A 5F1KA 3CTMA 3ZV5A 1FDTA 4FFPA 5GY7A 1DLJA 3VPGA 3C7DB 2OMEA 1YL6A 5TT1A 4IJVA 4JJFA 1C0IA 2O3RA 5ICMA 4LMPA 1QYCA 3IJPA 3WR5A 1X15A 4DIOA 4OGWA 4P4NA 3LF2A 1YQGA 3AOEC 1VI2A 2ET6A 4MDHA 1GTMA 4DTIA 1K0UA 2DC1A 1M6WA 3OETA 3FTPA 4TVBA 4XIYA 4ZQGA 3RWBA 1YRLA 8ADHA 3NJ4A 1BDBA 3HUDA 3PYXA 4KDFA 4DMMA 3CEAA 2YJZA 5GZ6A 4YT8A 3D3EA 5I9NA 1VKOA 1X0VA 3WFJA 4M54A 4DQXA 5U4QA 3IC5A 4MIYA 1EVZA 4L8VA 2X4GA 2C59A 3WWYA 1DFGA 3MJEA 3EC7A 7ADHA 2Y93A 5A3VA 1PSDA 5K6AC 3U62A 4AL4A 4NG5A 4CODB 1H93A 1PGPA 2ZK7A 3C7CB 1M6HA 4CM8A 1B8PA 4OQZA 2FP4A 2XXJA 3PLRA 1P1RA 2BKAA 3RBVA 2WE7A 3PXXA 5JCJD 1LX6A 2ZKLA 5DZSA 4E2WA 5MDHA 3I6QA 1GQYA 1HE4A 1YXMA 4ZJUA 4RO0A 2JHGA 4MINA 5A04A 3A9WA 2OBYA 1TT5A 3RCBA 2HK7A 3F46A 4QX6A 1E1KA 1JLLA 3IJRA 4J2HA 4OMUA 4CM8B 4Z9XA 4ZQEA 1OBFO 5JAZA 4E6PA 4YJHA 2EHDA 1GD1O 4DYDA 3V1YA 3HDYA 1CWUA 1QYDA 4YWJA 1YJQA 4BGEA 2WJPA 2DQ4A 3GY0A 5C3MA 3GFGA 2HDHA 4HFMA 3RJ9A 4AICA 2C07A 4R9RA 1FK8A 3ETGA 1H6BA 4CQMB 3ULKA 5MGBA 3D7LA 4YAKA 2GZ2A 2WD8A 3PDJA 4NU5A 3NJ8A 3I1JA 4PLYA 5HBRA 3HFGA 2NUAA 4FIZA 3PHHA 3VPFA 4GMFA 1SEPA 1ZJYA 5JDIC 1AXGA 2GZ1A 3IKVA 5TQVA 4J6FA 3O8QB 4WLNA 1KEPA 4AJEA 3U4DA 3P2YA 3DBRA 3ITDA 2EIHA 2HSDA 4L0QA 4OIMA 5I7FA 1NXQA 4E21A 4E5PA 2EP7A 4DYVA 2HK9A 1OFGA 5CDYA 1OC4A 3HB5X 4L75A 4H7PA 5A02A 1GCOA 2NU9A 3WGGA 1E3WB 3RC7A 3JQ8B 4D0RA 3DFUA 1E5QA 4WLOA 2X9NA 4CMCA 5KVSA 3ZWOA 3G49A 3GDFA 3SJUA 2P68A 4OHUA 4QECA 3BZUA 3AJRA 3T4XA 4UUMA 4A73A 2PGLA 1P31A 4OOEA 2EV9A 1JVBA 2CMDA 4B8ZA 3KVOA 3ZU5A 3BHIA 2AG5A 4RDHA 2X5JO 5ENVA 5TJHA 4XB1A 5KIAA 2Q45A 5CG2A 2GGSA 2PK3A 4E5KA 4XYGA 4YVFA 3NT4A 1XHLA 3PIIA 1E6WA 4XR9A 3SC4A 1LBEA 2D1YA 3SLKA 3TZQA 2IDZA 4GX2A 1P0FA 4TRJA 1A7AA 1YBAA 3MTGA 4DIFA 5ER9A 1WP4A 4A26A 4J43A 1OI7A 1P77A 3CMMA 2XF8A 1CRWG 3GMDA 1I3NA 5DCYA 2UYYA 4XIJA 4O5OA 1E6EA 3E48A 2W2KA 1JWBB 1FDWA 3NKLA 5CP8A 3RUDA 4H15A 3DQPA 4F3YA 2BRUA 4YRBA 3DMTA 3GAZA 1GUYA 1LDGA 2NQTA 3C7AA 3H9EO 4GPD1 3FNFA 3TL3A 4YAIA 3PGXA 1ZH8A 1EFKA 3HFSA 3NGLA 3MCVA 3W4IA 1VKNA 3E9QA 4IUYA 4Z9YA 3H65A 2BI8A 4EJ6A 2IEBA 4INAA 3AU8A 1VSUA 2ZJ0A 1HKUA 3E9MA 4KZPA 3GA0A 4GGOA 2XAAA 4M87A 1U7TA 3ZU3A 1A7KA 3MJVA 3CZMA 2OP1A 3BHJA 1KVSA 1YL7A 2NTJA 3K2BA 1GL3A 1Q0HA 3IP1A 5B4VA 5IDXA 2NTVA 2EKQA 3LYLA 3IAHA 1T24A 1H6AA 2HMTA 3DC2A 3GVIA 4HWKA 4RPKA 5EESA 2OBNA 4PG4A 4BV9A 5LC1A 3FSRA 4PN3A 2TMGA 1E3WA 5JCXA 2RHRA 5C37A 3G1TA 3I4CA 2XPCA 3U4CA 5TLSA 2G76A 2IXBA 4DC0A 4KWHA 1PL8A 1T4DA 1WAMA 1LEHA 4KP7A 3SVTA 4C7JA 2YV2A 1R15A 1CEQA 2OHXA 1ISJA 1XA0A 4WCFA 4WOKA 3I9OA 4R1NA 3WLFA 2PKQP 2AQKA 5A4DA 3WS7A 3B1JA 2Y0DA 4DMLA 4RF4A 3H4VA 1XIVA 3W8FA 2D5AA 1IPEA 4D7AA 5L3ZA 4ZHSA 3DR3A 2AG8A 1EVYA 4FFMA 3ASVA 3AU9A 2QHXA 4GKBA 3OJEA 4L76A 4MP6A 4MOWA 1HDCA 1RPNA 2G0TA 1U8FO 1AE1A 4R1UA 3CINA 3H5AA 1TVEA 2IRWA 3WGYA 1NVTA 3GF4A 4D3DA 4P4LA 4JIGA 1GZ6A 1I3MA 3W8DA 3ZWYA 4HX5A 4KUEA 4AJPA 4BNYA 2NU6A 2FZWA 3WYBA 4CM4B 4Q3DA 5ENDA 1D4FA 4FJ2A 1U5CA 4RPLA 4WE3A 5T8KA 3V5NA 5K0ZA 1X1EA 3X2FA 1YH3A 4DQUA 4JBIA 3AUUA 4WCDA 1GYQA 1EUZA 3WQQA 3EY4A 4JX8A 5G0SA 4HFRA 5IZCC 2X23A 1A4UA 4C7KA 2Y68A 3UVEA 2Q3EA 4Y8VA 4DLAA 2P5YA 1PGOA 2DVMA 3OQ1A 2VUTA 4MKXA 1GUFA 1Z7EA 2CVQA 1C1DA 1NR1A 1PJQA 5BSGA 2W2KB 3FRJA 1JKIA 2O23A 3H5NA 1Z82A 2NVUA 4FD3A 1J0XO 4GKVA 4M89A 3B70A 3ROQA 3QWFA 3AM4A 3Q11A 2O4UX 4BGVA 2Y99A 3JD0A 2GDZA 1YGYA 4JN6B 1JVSA 4TQGA 4YJGB 3ZWMA 5TRTA 3ZWBA 3KRTA 3NT5A 5EIOA 4XQEA 2ZB4A 3D3WA 1JQBA 2ZIZA 1JAYA 2GSDA 2YV3A 5K6AA 1PJ2A 4YJFB 1YDWA 3ZW8A 4CLHA 4P8RA 3WMWA 2EG9A 1KY4A 4NFYA 5L45A 5KNLA 4XDYA 2HMUA 1NPTO 1D1SA 4NBVA 3O03A 4XJSA 9LDTA 5GZ1A 4EJMA 3IUPA 2QYSA 3PI7A 4PVDA 5DP2A 1NPDA 5F21A 1I24A 4R41A 3D0OA 1IY8A 1LSUA 1WMAA 1YS4A 1ZK2A 1D1TA 2C0CA 2PGDA 1B14A 3DB2A 4B3IA 2Z95A 4CPDA 1YE3A 3FCOA 5IZ4A 3VAZA 3ROKA 3GEDA 4JQCA 1W8DA 4WLUA 5AYVA 3I9NA 1P1KA 2Q49A 2AE1A 4AJ4A 2EW8A 1R37A 4AVYA 5G4KB 2G82A 3HB4X 3UXYA 1BXKA 2A4KA 3AWDA 3LT4A 5COBA 1ISIA 3R6DA 5IAAA 4RVUA 3QY9A 1VL0A 3ST7A 4NFHA 3FR8A 3LC1O 3VKVA 2GO1A 3DTYA 1I2CA 1VLLA 1GDHA 4BNVA 3ZV4A 5K9ZA 4ND4A 3DHEA 1T4BA 2IEDA 3SX2A 3V8BA 3O26A 1IZ0A 2CDAA 4OQYA 5CPBA 1S7CA 2X7HA 3OHSX 4FDAA 3KETA 4WCFC 5FYDA 1J6UA 1EBFA 2ZTMA 1HDOA 4P4GA 1F0YA 2J3KA 3LT0A 3OEWA 4CL3A 2R2GA 4RL6A 2IZZA 3UF0A 2G17A 3E6AA 3WYEA 1LRJA 3GFBA 4JROA 1ZNQO 1IZ9A 4RVDA 2FPIA 2I6TA 4AJOA 2YZ7A 2C54A 5I7SA 3HZZA 2EF1A 3G17A 4WLVA 1W4ZA 5AXCA 1PS0A 2W2LD 1DFHA 1XWFA 4CQMD 4LCJA 1E92A 2PR2A 3P19A 1IL0A 1P45A 5THKA 5CAEA 4BKQA 4BNFA 4J1QA 3FI9A 4ILKA 1ZMTA 1C0PA 3LF1A 1ADFA 3GC6A 1DC6A 1IYZA 4R1SA 4RF3A 1PJCA 4Z6KA 5A05A 5BSFA 3TZKA 4QQRA 5A03A 1C1XB 3UN1A 1WZEA 1I0ZA 2I9PA 4GVLA 4R9SA 4BV8A 4IMPA 3FHLA 4NHEA 3D1LA 1NHWA 3ZV3A 2Z1MA 1G6KA 3E03A 4BO8A 4M49A 3E8XA 3GMSA 2Q2VA 3GG9A 2ILTA 2JCYA 4LISA 4WOJA 4D41A 3M2TA 4UULA 1J49A 1I01A 2CF5A 2IXAA 3BMNA 3JV7A 3IKTA 4CV2A 3H9UA 4G2NA 4RORA 4P38A 3MJCA 4BKOA 1K3TA 4F6LA 1XG5A 3GEGA 3H6KA 4FOOA 4YTEA 3LDHA 1XELA 3IP3A 5ITVA 4UVDA 3DO5A 2EKPA 4BO2A 1GFSA 2C7GA 4MVJP 4BHTA 3JQAD 3AM5A 3BHMA 4YB8A 2BF7A 5JDIA 3TF5A 4J4HA 4JCOA 3O9ZA 3ZHBA 2O3JA 5THQA 2CFCA 4CV0A 4BMVA 1Z6ZA 1UAYA 3PQDA 5L7TA 3I9MA 4WGGA 2W98A 3DHNA 1DB3A 4EI2A 4I9NA 1Y9AA 2VUSA 3LC7O 4GBJA 4MVJM 1ZO8A 1P33A 4RZHA 3KYDA 3OA0A 1BXGA 1UZNA 3KO8A 4FFRA 3RBZA 4Z0TA 1DFIA 1KBZA 4L73A 2ZTLA 2AE2A 3PJEA 2ZYGA 4HFJA 3A14A 2DU8A 4J0FA 3VZQA 1E7RA 2FR8A 1RJWA 2OOSA 1QKIA 3U49A 4FQ8A 1SO8A 4RPHA 3JCZA 1QG6A 2JAPA 5F5NA 4XGKA 4OSOA 1O9BA 2J3IA 1BSVA 3GGOA 4BB5A 1SBYA 1P1FA 5DP1A 1AUPA 3GH3A 4Z0HO 3JQ9C 1SPXA 3F6YA 3WGTA 5L4NA 3ZWWA 2EERA 2V6GA 5HM8A 4LK3A 3ONDA 3JQGB 3N58A 4D43A 2D2IA 4TRMA 1Q0QA 2FMUA 1NASA 4R1TA 3U0BA 1I33A 5DBFA 4HNGA 1RM5A 1A9YA 1K6XA 1T1RA 1U4OA 3JQ9A 3VZPA 5EN4A 4BNHA 1Q7CA 1P74A 1V3UA 1ENOA 3FF4A 4DPLA 2QQ5A 2VOJA 2QIOA 2HLPA 1GPJA 4J2OA 5ER6A 5IFLA 2B4TO 3AFNA 4YJHB 1QYWA 3DZFA 3TFOA 3LK7A 4IDAA 3GDOA 3QVWA 1U28A 1R4NB 1R66A 4PFJA 4OXKA 2YQ4A 2AQHA 2FY8A 2GN9A 2W4QA 2NWQA 4E5NA 4DC1A 4IXWA 4OH1A 1VPDA 3OQBA 1BW9B 2FHSA 4A27A 3DMTC 1LI4A 3FWZA 3TFQA 3UGKA 3ETDA 2BFAA 4B4WA 3PTZA 2QZZA 1MG0A 3VPSA 4EBFA 2ZQYA 2BFMA 4G5HA 3NT2A 4WJZA 4MPDA 3W4JA 1MFZA 1LUAA 1HL3A 2EW2A 3RJ5A 1RKXA 1EVJA 4JJIA 4K28A 3T7EA 1E7YA 2E48A 5TGDA 4EGFA 5EQDA 3TJRA 3VPXA 4D0SA 3JD3A 4N7RA 1E3IA 4Q3EA 2JFFA 4YQZA 3PJGA 5CDSA 1HDRA 2GN8A 2JD2A 3R3SA 2JD1A 2VYVA 2ZB7A 3VTFA 3WSVA 3C1OA 2AQIA 3BMQA 1LRKA 1KIFA 3S2EA 3S2FA 3RFTA 3ZW9A 3GPDG 3RI3A 4EEXA 1I3LA 4UUNA 4R69A 2O50A 1R0KA 3L4SO 4LN1A 4MIEA 4ALLA 3L07A 1I8TA 1GY8A 3ZWAA 3DTTA 3FNHA 5KVCA 2X8LA 3ZWPA 4CM3A 2AEMA 1H94A 4HKTA 4YQYA 5C7IO 1NAIA 3D4OA 4O63O 5T6BA 2HUNA 1PZGA 5DBGA 3AI3A 4NPCA 2I3AA 4OO3A 1LQUA 3WGIA 5EPOA 3QV1A 5FI3A 5KJ6A 3QJ5A 2VRCA 1LC0A 2EEZA 3VH2A 4TROA 1CQIA 1SB8A 3OFSA 4KTTE 1WMBA 3JQ7B 3KOUA 2BGKA 2NU7A 1Q7BA 4GL4A 1DHTA 1QXSA 4M86A 5H83A 2DM6A 4DL9A 2ZJ1A 2JCXA 4WLFA 4ZD6A 4H16A 3QA9A 3AUTA 1HLDA 5IDQA 1Y9EA 4FB5A 5JO0A 1KETA 2WE8A 2UVDA 4ZQBA 2JL1A 4YAEA 4YXFA 1PQWA 3CMCO 4XD2A 5KTKA 1P1IA 3B1KA 4DPKA 1NQAO 1W0CA 4ROSA 4OYRA 2O3SA 1W6UA 2RIRA 3KTDA 5COAA 3TZCA 4WEQA 1VJTA 3CZRA 3JD2A 1G0OA 4RDIA 4DPMA 5G4LA 1JAXA 4BO6A 1E7QA 1NFRA 2YHIA 5DOZA 4E33A 3RFXA 1DC4A 4E2YA 3V2GA 4QFCA 1GV1A 3VH3A 3UCXA 2VNSA 1U8XX 2P5UA 2Y0CA 3ONEA 4LRTB 2VYVD 1YQDA 3KYBA 3VH1A 2P2SA 3NTQA 1I3KA 4JP3A 4EZBA 3ZU4A 3B1FA 4PLTA 4IDFA 5LCXA 3UCEA 3ZGYA 4Z9FA 1UXKA 1P1JA 1AN9A 1LLQA 2VN8A 3MZ0A 5L4LA 3I4FA 1EQ2A 2HQ1A 3GUCA 4CLXA 2VQ3A 1F8FA 5JSFA 2CDCA 1E1NA 1YOVB 5BNFA 4TVOA 1P0CA 2VHXA 1ARZA 5EQFA 5JC1A 5B4TA 1HLPA 3IL2A 1UDBA 2PTGA 1YBMA 2NU8A 1SCUA 2YW9A 4MP3A 4PLWA 4HNHA 3I52A 4AJJA 1C14A 2D8AA 3GRPA 1L1FA 1MLDA 3GNQA 5KJ1A 3MEQA 1AHIA 4YBZA 3GVPA 2E6UX 3NGXA 3Q1LA 1ENZA 1C3VA 1XQ6A 2WYWA 2A94A 3ZWVA 4FFLA 2D59A 3ZI0A 4ND5A 4FGWA 1HE2A 4M55A 4BO9A 1P9LA 3ZHXA 2VHZA 5JLAA 3BXXA 4Y67A 5BNTA 3EZYA 3ZWXA 2YUTA 4N54A 5DCWA 4NMHA 2WM3A 1QMGA 1R4NA 1Z45A 2UUPA 3HE3A 4K6FA 2C20A 3TPCA 4FS3A 2HMVA 3W6UA 2I67A 3UAGA 4OM8A 1DAPA 3DBLA 5IXYA 1XQ1A 3RQSA 2A9FA 1WDLA 3VDRA 3BTUA 4L74A 2P9EA 4IDGA 1GQ2A 3MTJA 1GZ3A 3OICA 4ZVVA 4CMBA 5A1TA 4K9DA 3C1AA 1RYDA 3ZDFA 5IN4A 1ENPA 2A92A 3BMOB 4NI5A 3KXDA 4BNZA 4TSKA 2C2YA 1NWCA 3UHAA 1PL6A 3MJTA 2Y1CA 2NVBA 1BXZA 3LVFO 4QTZA 4HV4A 4YJFA 3LT1A 4J1TA 1E7SA 1EDOA 3NV9A 4E4YA 4II2A 3H9QA 2Q50A 1WW8A 1BWSA 1QV7A 1FDSA 2OUIA 2X86A 1R12A 4JGBA 4BL5A 4FFOA 4GAEA 3H7AA 5F5LA 3ZNOA 5KWEA 2AHRA 1LTHR 2CNBA 1A4IA 3A1NA 4J7XA 1K2WA 3DOCA 2O2YA 3GHHA 1C1DB 1IHXA 1V3VA 1OOEA 3LT2A 4DGSA 3QE3A 1YONA 1WDMA 3HQ4O 1NVMB 1P3DA 3GQVA 3WMXA 1M2WA 2J3HA 2QRJA 3AY6A 4CL8A 3QSGA 3UKOA 1BGVA 2EGGA 5A9TA 4CQMA 3DBRB 1JKJA 1ORRA 2V6BA 1CF2O 3Q2IA 4ALIA 5CPFA 3Q9NA 3JYQA 3DDNA 5CDTA 1BMDA 1N1EA 4NBWA 4ND1A 2BD0A 4E12A 3NX4A 1EEHA 5AQ1A 3G79A 3HDQA 1EE2A 1JTVA 4WCFB 5IDYA 2P4HX 5IN5A
chains in the Genus database with same CATH superfamily
2ZB8A 1NMXA 3IBSA 3LBFA 5F35A 1Q7GA 1AXEA 3D5TA 2QE6A 3GRVA 4D96A 3MVEA 3P9ZA 4QFDA 2A57A 2XY4A 4P3KA 1QK5A 2WINI 2ZLBA 3QPWA 1GCGA 5E7JA 2CVFA 4QXOA 1W4BA 4XE5A 5IJZA 1O6CA 1E66A 2HT1A 1GVHA 2WJYA 3O1JC 1H2XA 3BQNB 1ID1A 3OF2A 2NO4A 4REQA 3RODA 3VO2A 4AWBA 4EFLA 4IV0A 1H5QA 2A1TR 4FFNA 2AI1A 4LCEA 1PJLA 2DTXA 1PI3A 2LRHA 3T7KA 3VYRB 5F9HA 3EUAA 3HYRA 1UOOA 2J08A 3KSRA 4L5BA 1XCBA 5JV5A 2R5NA 4C3OB 4JR1A 5BSRA 3ZE2B 2FZ4A 2FN4A 2FGJA 2VQ6A 4MTLA 3FYUB 1RLJA 1I4DD 2RGGA 4U0KA 3TAHA 2I3GA 3KQMA 5HS4A 3DZGA 3K9GA 2NGRA 1TYAE 4RHEA 1Z0UA 1RI2A 1RC1A 4J4BA 3CONA 1KVTA 3MHPA 4QUKA 4J7CA 3ZHSA 1MBZA 1JKFA 3SJ7A 2P62A 3MWDB 4BBJA 4DG9A 3NG1A 2EWWA 1ZRNA 1DT5A 2ZYVX 1T3ZA 1XDWA 4GM1A 4R16A 4UMDA 4H3VA 5KTRA 2YIMA 1LXCA 2Z98A 1EH5A 2LCFA 4XEUA 3VH4A 4IKEA 4TYNA 1NNSA 2HJHA 2WF8A 3EGIA 4ARVA 5AK0A 5JXWA 2C2MA 5K0SA 3TTWA 4GX0A 4OB7A 3NTXA 4G37A 3GCZA 3AEKA 1UQTA 1YOVA 4OSPA 3V9AA 1UM8A 4DEYA 3N9IA 1SG6A 4EI8A 4QQNA 5BSEA 3S6JA 3PHJA 1J2UA 2VHYA 4R51A 3T1QA 2VSNA 1EDEA 3BWDD 2YIDA 4A2PA 1KP3A 3KTAA 4L9SA 4UAGA 4BQIA 1SQ5A 2GJAA 2MWMA 1JLSA 3AFIA 3MB8A 1GXSB 1NKSA 1NXSA 1ZG3A 2FOLA 2I2DA 4GLOA 4BNGA 4D0GA 5HQ3B 3THWB 3KVVA 1SK8A 4UXHA 3UT5A 3RSFA 1PG0A 1QV6A 5EJ5A 2EOAA 2LPMA 4TMFA 2GAFA 4UBMA 5ALLA 1MB2A 2L69A 6Q21A 4IDHA 3HC7A 2F1HA 3DAFA 5G2OA 4KQXA 5TVGA 4AIIA 5L9AA 3V42A 3L05A 3FCUB 4FBLA 2Q0SA 3C85A 2RHJA 4YRAA 2VRBA 3MCUA 3JYOA 1NUQA 4GWGA 4YMVA 3D4BA 1P4SA 3H8SA 3A4VA 3IEPA 2I6UA 4RGBA 3EEBA 4BNNA 3QVKA 4QDZA 1ZJZA 2IHTA 3S2SA 1NW5A 1K7SN 2ZBQA 3C6KA 2XXAB 2MSNA 1SCJA 1JT2A 1XZIA 4PG7A 3RIMA 7GPBA 3GEMA 3GFVA 4F6CA 2YMPA 5KYXA 4UVIA 5B53A 1IXZA 1TKCA 3SR3A 1G8KA 1COWA 3IAUA 3QXCA 4TYWA 3KTOA 2NACA 3MQFA 7ABPA 3P0HA 3VRHA 4JJ4A 1S8NA 3WYAA 4JBYA 4UUAA 4HWGA 4NXNB 1F8UA 4CMGA 4DBZA 1H1LB 2X3FA 1EESA 2CF6A 4I08A 2WB2A 2BI7A 5C1IA 4EY7A 3W5VA 3FFBA 4AJKA 2R60A 4HPXB 4LJSA 3K9QO 3QKRB 4OXYA 4XFDA 5GONA 5B1SA 4FHEA 4NZOA 5HKOA 4NP6A 1AGYA 1O8CA 2DBVO 2YWDA 3BJMA 3FKJA 4LA4A 4LYAA 4QDUA 3V4OA 2AXPA 2Q46A 3BMNB 2OCKA 2XW6A 1P9NA 3U4GA 1UBOS 2IUYA 3O31A 3G2NA 5DULA 1DBQA 3LT5A 4DCMA 1A4XA 2VJLA 5ADUS 5GIOE 1GAQA 1EFRA 1MV8A 1QH1B 2VBGA 1JXQA 3PHBE 2IU6A 4XVCA 3CVVA 3THXA 4GYKA 3RVJA 4XW2A 5IC6A 1OC2A 1WABA 3D1VA 1F1BA 4MCIA 4DLYA 2OO5A 4GMHA 4XR4A 4H17A 3SHFA 1M2FA 1C9EA 1W36B 1KY5A 4YR7A 3ICWA 4X3OA 4HD8A 1W4CA 5JPIA 1L5NA 3M3DA 4KXUA 4ND6A 1ZR2A 1QE3A 2VJDA 2YQZA 3MXOA 1OX6A 2YWFA 2A9RA 3E82A 1DPGA 5BSMA 3T7IA 3AIIA 4AX4A 2KS6A 2H1LA 3FPHA 1E6MA 1RKVA 2IITA 3RU2A 2COEA 1HEUA 5EINA 1YJ5A 3C3DA 2PA3A 4KFUA 4OHMA 3LPMA 4ZO6A 3VYUB 1JHXA 1WSWA 3N8HA 4KDEA 1V7ZA 3R4CA 4HS4A 4O4HB 3TGWA 4NMLA 4EFMA 2W6ZA 4YYZA 5FYQA 5KTOA 4UBJA 1RDFA 1BG6A 1N0HA 2YRWA 3ONNA 3UWDA 4EZEA 1GUDA 5BUQA 4MDYA 1H2ZA 1P7ZA 2G8LA 2R6JA 4PQYA 1TJNA 2ZT6A 3G0OA 3QVSA 2OLJA 3WK6A 4TTQA 1ZCAA 2XYRA 5THXA 3F49S 2FZEA 2JLUA 5KJCA 1XYGA 2DFNA 3BC1A 1UZLA 1XYVA 3KQSA 5AVKA 1HYEA 1NBOA 1YZNA 3QQ5A 2DWOA 3NNSA 3UUWA 4H7EA 2V6IA 1VSTA 4HSGA 2WMYA 3KBBA 3OZDA 5CFLA 1DKOA 2HSZA 4IDUB 1M73E 4H3KB 5DCUA 4MW4A 2J41A 2WAYA 4LRYA 3O8OA 4W7HA 4GQAA 3PDIA 1ADCA 3S2YA 3WL4A 2M32A 1WB4A 4GYJA 2PMDA 2OHOA 2OFXA 3F1KA 1NRIA 3K2IA 2I5PO 3LUCA 4HQFA 5AVZA 5KVAA 1M2KA 3D8HA 1XMOB 1AU9A 1HYHA 1BO6A 2AX4A 2HJWA 2QTVB 4I4TF 2DLCX 2AR9A 1R16A 1PVDA 1SUEA 5FI5A 1ND5A 3A32A 1OWNA 3CSDA 3B9RA 1O95C 4O1HA 1ZGZA 4DEXA 2OORA 3BDIA 4EMTA 2XB4A 3DVAB 1V6AA 2X13A 3M5CA 3WOHA 1M7HA 3EXEB 3RJZA 1PL0A 3TRFA 3ZIAA 2BEUB 1GL6A 2WWXA 3GJ8A 1A9TA 4LHSA 2PZAA 1A27A 3OQJA 3M1YA 3DV2A 4DRXB 2HM7A 5JSYA 1IBLB 1Q15A 3CXUA 4IVRA 4N5LA 5K3BA 2C9MA 3LGXA 3SHQA 4DA4A 1QGUA 3FOAA 2YJ5A 4UEQA 2EGHA 4UBKA 2Z58A 3A9CA 2GEKA 2KLBA 4KBYA 2HMAA 2PH3A 4DJ5X 2H1HA 4XPIA 4C87A 421PA 1K97A 2OMKA 5HJEA 4QGBA 4C4OA 2X9VA 1K7YA 3BN3A 1GPUA 3NTRA 3HO6A 1QRRA 1ZSYA 3ND8A 3P9KA 1OXXK 1PX0A 4NBRA 1U0EA 4K26A 3E58A 5JS2A 4TZTA 3G8DA 2FWRA 5BV8A 4RXTA 5CAEB 4N48A 1JS1X 1GL7A 1E20A 3KVYA 3HADA 4DLKA 1ZSNA 5EEHA 1Y6JA 2O0KA 3BMQB 3I64A 4HAOA 3PPIA 4JYCA 5CB4A 5LOVA 4DUYB 1UDWA 3TTXA 4F0JA 1CDDA 2XA1A 2DPHA 3DL2A 3I3SR 3LCJA 1X1SA 3C14C 4TKVA 5JNTA 3OESA 2OAP1 5FUMA 1SBTA 5KYYA 3GPBA 4TVSA 2DMRA 1YL5A 2K7ZA 3FPFA 3KLNA 2J0VA 3RSOA 3ZDZB 2FOIA 5DM2A 3VR0A 4TMVA 4G1MB 1UPXA 3S99A 5K8CA 2YS6A 3AF2A 2YVAA 2B94A 1E1RA 4II7A 1TA9A 4OKIA 1MGPA 3I9KA 1B4DA 3KJHA 1ABEA 1FMFA 4C7OB 1UCFA 5WRFA 3M9WA 1NN5A 1N92A 3V8MA 4U8HA 1BA3A 4FUQA 4MYDA 4WLEA 2BGNA 4JNGA 1U9IC 3QBJA 5CLHA 1SEVA 5MFPA 1CEXA 4GEGA 2ZJ8A 3G0HA 1RHRA 3OLQA 1R8SA 2Y1EA 2CVZA 2IF2A 2HQBA 1J70A 4G85A 3G5TA 3RFVA 2H4XA 3TUZC 3BBLA 2OORC 3STUA 2WWHA 4QFBA 4Q03A 1FQWA 1KQGA 3GVXA 4IMRA 1NF2A 1G1AA 1M2HA 1ZINA 3NTVA 1W5SA 1MH1A 1XMQB 1VE6A 1YS1X 2E49A 2G7ZA 5F2KA 4ZVPA 2MU1A 1IB6A 5HCUA 1JDSA 4YREA 5B3JC 3M4JA 4JVMA 3ZG6A 1RRFA 3HR7A 4AZ0B 5JU6A 2WJAA 3ICCA 2CXQA 3LUGA 2QBYA 4E7OA 1NJ8A 1Q95A 3SHVA 4TTVA 5BN3A 2DFVA 2OBXA 4LS3A 1RJ9B 4NS4A 1Q16A 1KYWA 2P6OA 3EMKA 2YY7A 3TYXA 3W34A 3ZVMA 4E6EA 1IBMB 5B7PA 3AEQA 2O48X 1NE7A 2PMCA 1Q0SA 1NFFA 1UFQA 3DVAA 4K6MA 3ZWNA 5AM4A 3UTDA 4ZN6A 4PLZA 5ANRB 4P3XA 1EVKA 1O0SA 5GVRA 3UAOA 2P3LA 1KPHA 5C51B 1WR8A 1RCUA 1W5FA 2VTEA 1Q92A 2FQWA 4C22A 1RE1A 4X61A 3WFZA 3GT0A 3WTCA 1F20A 3N3AC 1NV8A 3MQ4A 4YRIA 4S3MA 5F2EA 1XNHA 2XITA 1E4YA 1KEVA 2VK8A 3FGPA 4K6HA 2KPOA 1J2RA 5J4VA 1KO4A 1W94A 4OBBA 3NKVA 3TOCA 2ZG6A 1BAPA 3N5CA 4WBNF 5HE9A 3C3EA 1DTEA 1Y7PA 2PYIA 2XLCA 3EZ6A 3KKNA 3L4BC 2Z30A 1U6JA 3CKYA 1AUVA 2NM0A 3HYSA 4GP7A 3K09C 4QUGA 4XWTA 1VRWA 1IMJA 2OR3A 2HL6A 1Y7TA 3DMYA 3NHLA 2RB5A 5K0FA 2IV7A 1J97A 3G8AA 3IXLA 4FW8A 1T2DA 1ZD5A 2WD9A 4AKGA 1EXMA 4GOND 3LH5A 4RTLA 4GZ3A 1DKLA 3U31A 1Z29A 3MTQA 5E1MA 5CGQB 3AY7A 4ZI2A 5EKSA 4MR9A 3FYCA 3CY6A 4PPYA 2GO7A 3LS2A 2W42A 2B7LA 4Q37A 3LWZA 4Y2YA 1XZFA 3NHMA 4CI9A 1YJAA 4RVHA 1ULZA 4TRNA 1YDGA 2QLMA 2DTEA 4GXTA 4HDQB 1Y5NA 3K6SB 1LPAB 1WXDA 1E7MA 4QYWA 5FBQB 3PHIA 4NH0A 4RK6A 3KOYA 4DNPA 2XDQA 1U2ZA 5IKOA 5KPDA 5DHSA 4H35A 4NMWA 4DG8A 2TS1A 2JGJA 3NNNA 2F3TA 3VV2A 2F8TA 1ESZA 4F1WA 1EM8A 3GA7A 3OFJA 1U02A 3U2QA 3S70A 5DTRA 2W48A 2WMNB 1ISPA 1R27A 5EC8A 1ONNA 4FN4A 2DCUA 2VT3A 1HI9A 5HF6A 2BFDB 2YUIA 3WGJA 3QF4A 5E0KB 2Y05A 3O4IA 4JX9A 2IE0A 3FOFC 4GIBA 1T0IA 4JEUA 3S7TA 4YJ3F 3PGVA 1AHNA 1IBSA 4AJNA 5TMBA 5FTMA 3CLUC 2QX9A 1QO7A 2LCIA 1PWHA 4M7WA 4S1VA 5A4AA 2NUBA 1ONPA 1RRPA 3X2EA 1CY0A 4I5GA 4BTLA 2B61A 3K0HA 3O38A 1VE5A 1ZU4A 3V7WA 2Y0BA 4IQ4A 2ZE8A 3MWEB 3UJDA 1HE5A 2C9YA 1LWNA 3H99A 2Y1GA 2GVDC 2PS0A 1ZXXA 3NANA 4JOSA 4MO9A 2W6OA 4N49A 3ZS9A 4E3ZA 2QP4A 5TQ0B 4Q9KA 2XUGA 1DELA 2G9RA 1CR6A 1KDTA 4MV9A 2JS7A 4KMOA 3NHRA 4R2XA 3H2BA 2ZFUA 3A1CA 3L0IB 3EWNA 4X97A 1L7EA 2V6FA 5EP2A 3DO8A 2LXNA 4Q6WA 3BE8A 8ATCA 2ZRFA 3D6JA 3D7RA 1GZVA 1BDJA 1NIJA 2XADA 2FLVA 2QAGC 1E2MA 1QF7A 3NVDA 1P2VA 3IT1A 1HTTA 2HMWA 2QTNA 3UT6A 3NI2A 1A5SB 4ZODA 4MVJF 2QNIA 3CX4A 3E0QA 3LCUA 2H9IA 2RH8A 1B16A 2QU7A 4FPXA 3EGCA 3K4QA 1VG8A 4JYAB 4M83A 4W1RA 2JLZA 3MBKA 1PEDA 4I5EA 5A1JA 5JTTA 3G8CA 4U7JA 1N7GA 3Q8WA 2HYDA 4CKWA 3NVMB 3HVHA 1FDUA 1X7XB 2AI3A 4NZ9A 2AVDA 4OU4A 5BQOA 1OXUA 3QLTA 5E6SA 1E2JA 1FNBA 2DR0A 1JDPA 1S4MA 4JJ7A 1W5EA 2FMFA 2PMBA 3ETCA 3H8VA 5FQNA 3F5QA 5C0OE 4O0MA 5HTOA 4NOKA 1OB2A 4MVJD 2FP3A 3LHSA 4R2WA 1GP2A 4K0RA 1SCBA 3PX3A 5CH5A 1BWQA 4COOA 6AT1A 3DEJA 1WE2A 4P5DA 1MJHA 5KYWB 1Q21A 3TDKA 4OPMA 1PF7E 1GAXA 2BELA 1M74A 3KQWA 3H1PA 1R0LA 3HA2A 3CR8A 3QVUA 3QOWA 1CY7A 4PFKA 1RM0A 3C74A 3P32A 4QPCA 3NC0C 3GI1A 3QHAA 1QHFA 2FKAA 4I2VA 1Y80A 4FCTA 2DJ5A 2ZBEA 3KKEA 3K1ZA 3M70A 4PCVA 2J09A 4OXQA 1G8YA 5LA6F 1JR3E 3JZIA 2BEJA 5C34B 4DADA 1P44A 621PA 4DOMA 4CIBA 2IKSA 2WYUA 3N2YA 4MQFB 1D2RA 1M1YB 4UVGA 3IEIA 2WHPA 3TI7A 4AJHA 2VH1A 3M9LA 4FEGA 4QVGA 2W8ZA 5I01A 1WUJS 1YR2A 4M53A 1JXMA 5K8VA 1XCJA 4P35A 1V8DA 3ORFA 5EZ5A 4GKJB 1RRMA 1CZLA 4CLDA 1A0OA 3F0TA 1CUIA 3HDHA 3EDYA 5JMOA 2XMQA 2ZBVA 4QUJA 2PKEA 4K87A 1H2BA 3KKQA 1TTHA 3WOVA 1M1YE 2VDLB 3B1VA 4ZV7A 2G3YA 1L5ZA 3EC2A 1MA0A 1DIGA 3WJAA 1EFLA 2ZU0C 4CMJA 1X1BA 4RUKA 2QRPA 1APBA 1TB4A 3UPDA 1GPNA 2VDWA 2G67A 3RC2A 2YWCA 3UMJA 3X1KA 3C16C 1TUBB 4TLDA 3SZ3A 1EWKA 1XZNA 5JROA 5HUQA 1CE8A 1U7ZA 1YB1A 2PQ0A 2IUEA 3KYCB 4MB2A 2Q2QA 3C3YA 4HB2A 4NJOA 1JLKA 1Q6ZA 1U98A 1RADA 2Z8YA 3I5MA 1WW3A 2X15A 2IZ7A 4CEJA 3ESDA 1STOA 1YMVA 3A4NA 3CKMA 4PW0A 3MF4A 4RH1A 1MFPA 1XQYA 2F3RA 1C3JA 2PRSA 4UDOA 4QAQA 5EOVA 4XRGA 3PTAA 3B2QA 4M0KA 3H83A 4R7GA 5DB4A 2WSLA 3ETEA 4DCGA 2R8PA 2QS9A 4W9RA 1TC1A 2ZTUA 1V8BA 2CUKA 4MUEA 1TXGA 5IVKA 1FJXA 4GLLA 2CJPA 4QOHA 5JZBA 3RYFA 1DNPA 5LIPA 1TPYA 4U63A 4D44A 1X74A 2C04A 4D8XA 1RLOA 2ODEA 4YPVA 1LI5A 1TO2E 1XZMA 2QORA 2D2VA 1DAOA 2HCTA 2ISCA 2DFLA 2P11A 4K03A 5TQ2A 1RAIA 1RM4A 4U8GA 4KKVA 3WNDA 1UXHA 4JMLA 2MSWA 3FCCA 5GVSA 5I7EA 3OZWA 4QXPA 1XFAA 1KP9A 5UKDA 1RWBA 4NCBA 3C4QA 1JNYA 3OIFA 2J9GA 3V1TC 5ES3A 2J45A 3N0TA 2OAQ1 5LLTA 5KSZA 4R2LA 4Q7LA 2UYCA 3TZEA 3DW1X 3ED5A 3T7AA 1J07A 4KGXA 2XUJA 1S2IA 4Q05A 4BBZA 2F3PA 4URXR 1MN6A 1RCTE 3UC9A 2KQUA 4B5LA 1TYBE 4KVZA 1N5OX 4D9NA 4QYSA 3HKEB 8MHTA 5EJ9A 1B7GO 2ATVA 2C5LA 1H0RA 3PFIA 3RU9A 4CW7A 2BCEA 3HWRA 3EXAA 5FAXA 3PF8A 4DEVA 3HNRA 1T8UA 3QQPA 1NQTA 1Q0UA 4DTCA 5K3DA 4FB4A 2OGUA 3EODA 3RTAA 1RAAA 1FRNA 3NDPA 1YE8A 4ZRNA 4D26A 1U3UA 2NPIA 3OTHA 3B3GA 3DZJA 3QP9A 4Z4EA 3AW9A 3ZHYA 1U9JA 3RIXA 1N4AA 4GL2A 2PT9A 3NYWA 2ACKA 2VP3A 4PG8A 4H08A 1LK7A 3H2JA 3PUKA 1NYLA 4LPKA 1EZ1A 1PGJA 5IAGA 3TZ6A 4G0NA 5LZ9A 3HI6A 4CMIB 2K6GA 2DUMA 2AOTA 2RHOA 2W2LA 4NYMR 4WXEA 3TIGA 2QY9A 3DMDA 2G08A 3WQRA 4YIHA 1KJNA 1ADGA 1KYZA 1TDJA 2EX0A 2JEOA 4AMUA 5KNBD 1UT8A 5JNVA 1UKBA 2WNHA 4QGFA 3OCZA 4JOCA 2CCGA 1R4MA 2FUG1 1NOIA 4YNBA 4U5XA 4BAZA 4DLBA 1DTWB 3I3OA 4N0QA 5IU6A 5JCJA 4C3VA 2VHJA 5LZ4A 3L0PA 3IDOA 2IYAA 2Z4RA 3EGWA 3AQ4A 1V0JA 4IV8A 2YINC 3BJIC 2VJPA 2FTKE 2ZBUA 1USVA 2X42A 2Y9PB 3GOQA 4B8WA 2RONA 1EUDA 3OSUA 4KB5A 5LM3A 1DV1A 4H4DA 3JQ8A 4LRXA 4J03A 1ULHA 4UEOA 5ERYA 2YJTD 4JJ6A 3SJZA 1JKMA 1KI8A 1GTG1 4LJ4A 3U48A 1AB5A 1ZK3A 4HDKA 3LQQA 1NTRA 5JECA 2OCIA 5MN4A 2AMYA 3RSGA 1QHGA 3FPCA 1GPBA 1ZIPA 4MYCA 1TCCA 2O0JA 1N5DA 4MR9B 2ZI9A 3CLVA 3HWWA 3LLUA 1EP1B 3GRCA 4QBHA 1GV0A 721PA 2VHUA 2E1RA 2BRUC 2C29D 2EJWA 4XCVA 4OK5A 3AK4A 1IQ0A 2XIJA 3GJ6A 1TU3A 1DWOA 2ZYWX 3JSAA 5KKAA 1YB6A 4D5GA 1GDTA 1U7DA 2BV3A 1ECCA 2COKA 4JKYA 3SXPA 3EH2A 3T9DA 4BIMA 1V71A 3BMCA 3REQB 3WMFA 4RVOA 2ORVA 3HFJA 3PE4A 4W63A 5A5FA 3EPJA 4CQLB 1Q0LA 1EIWA 1KH1A 2IS6A 3ACBA 3FPLA 4BS9A 2BY4A 3M6LA 4BOYA 3PVSA 1OSNA 1U3WA 2XMBA 3HU1A 1G16A 3EA5A 3ZLBA 1UFKA 3FAZA 4G67A 5HWSA 1ECJA 1SZCA 2DKOA 1IB0A 1XXHB 3MAAC 4RV9A 1O95A 2ONJA 1XTUA 4DGQA 4EA6A 3L4KA 5GJBA 1SHLA 1VZ3A 3BORA 1XZQA 1FBNA 2CLSA 2D1RA 4KYVA 3WNCA 4AZTA 2V7PA 3TLBA 2C5EA 3SS7X 5ELXA 4KE7A 5DYNA 2OQRA 2VAMA 3SC2A 1DL5A 1KVQA 1GNRA 2VQEB 2YMLA 3TNLA 2Y1DA 4RVFA 3WNZA 4UVEA 5AXDA 1VSBA 3FCEA 1PJ4A 2BM1A 2PYZA 1ZVMA 3AI7A 3H2KA 4IJWA 4LRSB 3GJTA 3KEGA 4F5EA 4A15A 4CFYA 1LI7A 2QGFA 1K3UB 2R7LA 2IA5A 4R1MA 4PQGA 1UJ6A 5IAJA 2LDXA 3RB8A 1DDGA 1AKNA 3CW9A 2JI9A 3FWNA 3UK7A 3WIOA 1J23A 1L4HA 5IBQA 1GRQA 3QLJA 2CBXA 4BQQA 5MHTA 3N2GB 3ZCTA 3M6WA 4IHJA 4HN4B 2BGRA 1XRPA 2BKVA 2RGEA 2W6MA 3GD5A 3GGDA 2AOUA 4O4IB 4EELA 2EC5A 2V58A 3RUEA 3WDMA 1KS9A 5BR7A 5C80A 1MUUA 3D6FA 5EKXA 4L2IA 5HW0A 4B3RB 3AUAA 5TJ9A 2DFTA 1SBNE 2P9QA 5E8RA 3PXEA 2XQVA 4XYBA 1QONA 2DSNA 3B2EA 4RKEA 3K30A 1HT2E 1R64A 5ILGA 1NTOA 4FWTA 4M1WA 4KNYA 4UNRA 3L8DA 4JLNA 3IMFA 5JPDA 2X3YA 3AKCA 1MO4A 1BGWA 1JHOA 2BR3A 1GFIA 2G06A 3O7WA 1FLDA 1RAEA 1ML3A 1SGWA 2QEQA 2VQDA 3N39C 4M1EA 3W8EA 1YQWA 4YA6A 4B4UA 5HKKA 3EEYA 3GG2A 4B3HA 1XX6A 1LC3A 5K0TA 1Y1PA 1PO7A 4FI3F 4NYJR 2GOYA 4Y18A 4FC6A 3W5IA 3QLVA 5EA2A 1I36A 2IXEA 3VNQA 4PC7A 2GCGA 2O2DA 4JJGA 1JLRA 3L0OA 1TU4A 3AUSA 3K5IA 5U1PA 4DHEA 3A6GA 2V7QA 1SCAA 1T6XA 3WICA 2HU7A 2GZMA 3FMPB 1DIBA 4J4TA 3OX3A 4QEDA 3JASB 1PBNA 3I8OA 3PRYA 4MJ3A 3LUKA 4MULA 1JN0A 3IP7A 3LBYA 3O84A 4WTOA 4JLVA 1GDDA 3II6X 4OAOA 5MN5A 1TKRA 5BW6B 1J33A 1N2GA 4R68A 1EA7A 1T0BA 1X2BA 1P7PA 1PKXA 2H1RA 2M2IA 1UBRS 3M82A 4E31A 4XOUA 1JE1A 2H48A 2AD1A 3IAM1 4M46A 2GXAA 2GCPA 1UBCA 2O8DB 4WT7A 1PR3A 4J0EA 2H52A 5GAJA 5IHXA 4NBUA 3A1SA 5L8VA 3ROTA 1Y34E 2B3TA 1LPBB 3ISVA 4UHFA 1T91A 3ZD8A 4C0XA 3EN0A 1LU9A 3V1UA 5KYGA 4I99A 1R9GA 3GNSA 4M37A 3KX2A 4HLDA 4J94A 5DBIA 2A4MA 2FK7A 4I1YA 4M0EA 5F7XA 3FTQA 1HETA 3MXTA 2Y4OA 4REOA 4BZWA 3R9IA 2ZUUA 2ZUVA 2AZDA 2QJOA 2D4HA 2ZT8A 4FMBB 1UC8A 2WKWA 1CEEA 3EXHC 3DVLA 2YWJA 2J8ZA 5CH8A 3ZR4B 5TV2A 3THXB 3R1IA 4OREX 3Q8KA 4A8TA 5B3KA 1ZAYA 3RGWS 4W8OA 1T15A 4CI0B 4MV0A 3MUNA 3SSMA 1ZJ4A 4V1CI 1U9ZA 5ALOA 4NBTA 3O2JA 1UIRA 2WW8A 5DW3A 4EATA 3V4SA 1KO5A 4ETIA 4UBIA 1Z33A 1S2MA 4WOBA 1ULTA 2FPOA 2GN0A 4Y1EA 4XEHA 1ZK1A 4DLSA 4B46A 2P9YA 1F2VA 4CYMA 4A8JC 2AOUB 2ZXEA 1ZGHA 2PUJA 1R0CA 4OHVA 4XB6B 1YWGO 4JLOA 3RRYA 2TRSB 3L0ZA 3NTOA 4JNCA 5EPUA 2WVGA 3F9RA 1QU3A 5DHTA 4D8YA 2B82A 3G8YA 4EY3A 3P4XA 2H4ZA 4LOIA 3TE6A 4IXNA 1TM5E 4MW0A 1GG8A 4O2AA 3EGEA 3ETNA 4LYHA 3ZJVA 4FK8A 1EK6A 5FPPA 1SVUA 1OUMA 1TVMA 1UMKA 2H59A 1QX3A 3BK1A 4ZOLB 2KBFA 3MYRA 4B35A 3EQ8A 4FIDA 2WHEA 4EP1A 4PEVA 2GYWA 1WHTA 2XECA 3DHYA 4XIGS 3IPYA 2HAEA 2QGNA 3DKPA 1G8PA 2VC2B 2XOKA 4FFVA 3U17A 1RP1A 2GEUA 3VO8A 1BJTA 3EVNA 3WXBA 4PN7A 3DLIA 1Y8RB 1GCIA 2PX3A 3N0RA 3VNRA 1QWOA 1KF0A 3QLUC 4NV1A 1SVKA 1Z0IA 3G7UA 3SDBA 2V4UA 1AUQA 4QUBA 2OQ2A 4UZEA 2WFLA 4J0JA 1LDNA 1YKGA 5E1OA 1AMNA 2AOXA 4CIVA 2JCBA 2AXQA 1N4DA 1OIWA 1RNLA 1XJ0A 2JD0A 3MUEA 1YRBA 3OKAA 1N2HA 3PQ7A 5J2TB 1KE1A 3MTDA 2BHSA 3HWX1 3A6FA 4W9NA 4HGOA 4Y9RA 2CFTA 1Z0ZA 2REQA 3OZ7A 1JBQA 1QMPA 5F9FA 2GM3A 3K0EA 3U3XA 4Q9LA 1NVVR 2JVJA 3GVCA 5GQSA 2VH2A 1NLFA 1GGKA 1UJ4A 4BLTA 1NMYA 3BB3A 3LM8A 4M1OA 1HDZA 4PPFA 2M6SA 1CZNA 2ZVDA 1UBHS 1H9CA 3DLAA 1X1AA 4MRNA 4QA9A 4WJKB 2UZ3A 3KU4A 3EZGA 2BGGA 2O7VA 3GLSA 1XI2A 4S1NA 3LRTA 1NUPA 2G83A 3UJ3X 2JJ8A 4CHGA 3FMVA 3OCXA 3WHIA 3IP9A 1EX6A 1ADBA 1MHTA 4KJZA 1FDVA 1G291 1HTWA 5SZHB 1I2MA 2XTAA 3H5WA 4IRXA 2SNIE 5DGIA 7AT1A 4E11A 3VGPA 4BYMA 4J3FA 2L42A 3CX6A 3DZIA 3IPLA 4UEKA 4PGFA 4XB2A 4CMIA 1KH3A 4DA0A 2HU2A 4F4FA 1TEZA 4PG5A 4YMWA 1HE3A 3ESZA 3PQ6A 4L51A 3AFMA 3C3WA 4OQMA 1MRSA 4PR0A 3PVZA 4I4CA 1I3OA 1Z06A 3WK9A 2C92A 3M2PA 4G63A 3FYUA 1KJQA 1PNTA 3K1TA 4UMEA 2EWVA 4EUFA 4U2CA 4TKLA 5G0UA 3AFHA 1QRSA 5AHXA 1OYYA 3FWYA 1J1UA 3IAM6 1FPMA 4LDPA 3VVCA 1XZGA 1TFUA 2FSFA 2VR1A 2WWIA 3CUWA 3F7OA 4LQDA 4O4HF 3MW8A 4PE5B 1RIFA 2BM0A 2IH5A 4GDFA 4QVIA 2J6HA 2W2OA 3CUTA 2FLKA 2QVZX 2WJIA 3EOAI 3W7BA 1XJ5A 1Q20A 1DKQA 1ZD3A 3QITA 4Q7JB 1QR6A 3SQLA 4IDXA 5JRZA 2J3DA 2Q99A 3KIPA 1OZAA 2IIPA 1KRHA 3PXCX 4BAUA 4HXGA 2CYBA 2AS0A 1G4HA 1JDBC 3H9JA 5LBUA 1ZUD1 2QX7A 1WCIA 1I13A 3PZBA 5A5VA 3K73O 3HJFA 3R7DA 1UK9A 3KWMA 1FTSA 3ZHRA 2A5LA 3AHDA 1NNLA 2JFUA 3GDHA 1HSZA 1Z39A 3T5GA 1Z3CA 2OCGA 2C57A 2FWPA 5AK3A 4PLFA 5EGSA 3AZOA 4BNUA 5ADVA 4Q6BA 1YNSA 5JD3A 5F3RA 5HEKA 4RWEA 3ZYCA 4F4HA 1E99A 3LSYA 4UQPA 2PGOA 1POWA 5JYEA 2WMOB 2OK7A 2I65A 3L06A 4KQ2A 1BKYA 3K4HA 3QOFA 3OZGA 4A1FA 2JRLA 1N34B 1KQPA 2V59A 1CDOA 1G0NA 4XGNA 2BFFA 2CZGA 2B78A 3ZWDA 4ZVRA 5K8IA 4GX1A 3ZIUA 3K70B 2HRQA 2BFWA 3WLEA 3VSAA 2ONKA 4HPJB 3KBOA 1VB3A 1I9CA 1BH6A 4LVUA 4TLCA 4PBSA 1Q2XA 3WBBA 1Y82A 2ZSKA 3UO8B 1X8XA 1TOAA 3UJ8A 4BQSA 3PS9A 5EZSA 3FOBA 1T2EA 3REOA 3HCPA 2Y0EA 3FN4A 4ETWA 4LQ4A 2GNPA 1ZISA 3O90A 5ABPA 2YXDA 2V3WA 5JSQA 3JQAB 1GZ4A 3NBZC 5L7WA 2Q0XA 2GFHA 3L1HA 3E3LA 3NYIA 4A5OA 2VK2A 5CA1A 3F5DA 3HEMA 3ORSA 2G1UA 2BFCB 3MCTA 1JEEA 1UPUA 3WYGA 1G66A 3BAZA 2OGWA 3HI4A 3INTA 4XQ9A 2PZFA 1R9NA 2ID8A 4IOKA 2WFAA 5IJXA 4JI8B 1X13A 4V0SA 5J4HA 2QLBA 1JIVA 3ICPA 4W8HA 3W8RA 1L8LA 2POQX 1JHPA 4YP5A 3OT1B 2Q1WA 4IJ5A 1XKQA 3D3WB 2XH8A 4G1CA 1F2UA 1N0VC 3I0NA 4PM4A 4AD8A 2VYFA 3K92A 1AD2A 1OLXA 1HT0A 1T0PA 3TQIA 4L4RA 5I7VA 4DE5A 4LHWA 3ISJA 1O03A 1P7WA 2I54A 2XR1A 3OBBA 4LVNA 3ONVA 3H4MA 1IM5A 1JMKC 3SQOA 4LHVA 3PSAA 4WY5A 4TS3A 4F04A 1VXRA 1GTZA 1ZQ9A 5KQGA 3L49A 2IP1A 1Z74A 5K99A 3EXFA 3RS4A 1A50B 4J0DA 2OLEA 4DA9A 4EHBA 1WTAA 2DZDA 2Q8PA 3GAFA 1J9EA 3WBFA 5J59A 3GJRA 2HZ7A 3KHKA 2BZ1A 3I72A 1G8HA 2QTMA 4WA7A 4UDNA 1NG1A 1U4NA 4RMIA 2FPGA 3MN1A 1L4EA 1XZBA 3QMVA 3QXJA 2C82A 2QK4A 3WZLA 3KDAA 3PNLA 1J2TA 3IQHX 1DDOA 1AZLA 4H31A 2I7DA 4JLMA 5G1NA 4BNWA 2C4NA 2E4AA 2WWYA 2A9OA 5L6MB 5C18A 4B6GA 3CXRA 1V16A 3UXHA 3WWPA 1J0DA 1FNNA 4K6CA 3UB2A 2ZR7A 1Q83A 4D97A 2O7RA 1UMDA 4ZGWA 3TQCA 5EHZA 4B7AA 1AM4D 1G3IA 2ZUDA 4DY6A 1S01A 2D1SA 1GKYA 3G1WA 4OP1A 4BJ3A 4CMHA 3I6IA 1SKBA 1J2EA 3EPRA 4XWOA 4C4RA 5B64A 1WX1A 5LDHA 1A88A 3PFWO 2X0DA 4CTMA 3PL5A 3OZSA 1OMOA 2HBYA 1KFJB 1DO0A 1FPQA 1XHFA 4MCHA 3S81A 5KMGA 2WUVA 3T7TA 4HH0A 3MINB 3AO0B 3RHSA 1NC3A 1BH2A 4JQSA 4MWZA 2PUEA 3AM1A 1AV6A 4G1VA 2J6IA 1WCYA 2Q4DA 2F43A 2DYKA 2VP0A 4NQZA 4A0SA 2PWPA 1BZYA 3M6XA 4IF6A 2GD1O 2JH3A 4KL8S 4XCQA 4Y2GA 3N6XA 4WECA 2I78A 3Q5EA 4AG6A 1NWHA 1YA4A 4UFNA 3BIOA 1YU6A 3LHIA 3OAAD 4ZOBA 5EGNA 5B1EA 3RVOA 2PT5A 5LBIA 1WF6A 4B7CA 3DMRA 1PP4A 1A69A 4E13A 3ZY5A 7MDHA 2YCLA 5CNMA 4LOHA 4L5IA 2EYQA 3U3MA 2PLRA 4RD4A 1TA4A 5HJ2A 3PJFA 2C4WA 3HG7A 1A9XB 3NBYC 4ILEA 4KQIA 4P3NA 4KPYA 1Y7HA 1I2ZA 1JWAB 2O8CB 2ZT7A 2J4DA 5AOBA 1VI6A 4D80A 4WH0A 1XTQA 4B73A 3U56A 3ME5A 2MMCA 3AHHA 3QYFA 2X6QA 1LVGA 4W7IA 2PEZA 4TLBA 3S1LA 1QJ4A 1VHJA 3I5AA 3PEWA 3BWEA 4ENPA 4GKKB 4J9UE 1AQIA 1KC3A 1WO8A 4WKCA 1OQAA 2QG9A 3DTVB 5AK4A 2GD2A 4MUFA 3S55A 5ADWA 4I1VA 2ZJ2A 2XTNA 2JW5A 3P4YA 3BQMB 3FYSA 2VPYA 4YT5A 5EJGA 3VO1A 3RADC 5AKHA 1BVHA 1L5KA 5ICSA 4MUHA 3IPRA 2EKBA 2QZ4A 2RHLA 2BDTA 3JZDA 1RRVA 3SVZA 4L7QA 3ZHZA 3TSWA 2JEYA 3DDWA 3V8QA 1U9YA 4K6KA 3PQFA 4PFSA 1NBMA 1SZJG 1T5SA 3JQGA 4IAOA 4URYR 3C8MA 2BYTA 1Q44A 4U6QA 4W6ZA 5CLIA 1A9OA 3TR6A 5SZJA 1IATA 5CEFA 4O0LA 4L4XA 4XIFA 4DV3B 3JWJA 1CQZA 4TKVB 1D5WA 3U81A 4TM8A 3H3JA 4XYLA 1PT5A 1GRRA 1N7HA 2O7QA 3FTNA 4AUNA 4UUBA 4CLRB 3ZZNA 4BQNA 1USUA 1GGVA 3NIFB 3OKFA 4EDFA 2XUDA 1ZGGA 5BW8A 4C6SA 4KDCA 3ZV5A 3AVUA 5GY7A 2BZGA 3WHLA 5B57C 5JCPA 2C3MA 2OMEA 1G21B 3PUZA 3BH6A 4INZA 4JLPA 1PEKE 4RE5A 5GM1A 2FCRA 1C0IA 3E7DA 3HZHA 4JJFA 4MUIA 5IPFA 3K1YA 3EZ7A 1CVRA 2ANCA 3ZE8A 1UBKS 1QFZA 3JX9A 5DSZA 3RU3A 4DIOA 2OV2A 1JKJB 1QOPB 3KPVA 4UAUA 2QD4A 1JZSA 1RXIA 4MITA 4FKMA 2ET6A 3W5JA 4MDHA 1EZZA 2KLHA 2VCEA 5CD1A 1AGXA 3RWBA 1B0ZA 4ZQGA 3CVWA 3OCYA 221PA 3LY5A 3PYXA 1PYGA 3QXHA 2ZRKA 2Z5GA 3BCSA 2R25B 4YT8A 4KACA 3N2ZB 1P4JA 2O57A 3EC1A 5LWQA 1HK7A 5U4QA 1JHDA 4NYMQ 5LBTA 1W46A 1H2EA 4MWSA 4TTAA 2X4GA 5CXQA 5CFPA 2ZDGA 4R40A 2O2CA 3L4EA 3MJEA 4Y7DA 3UA3A 1DJMA 4L3OA 1Y9DA 3UFBA 5JOQA 2XF2A 5HBGA 3AUJB 2VHEA 1PSDA 2ZBFA 3MS7A 3O3CA 4B3SB 4E1AA 3DVQX 5IJAA 2ZK7A 3QMPA 4C06A 4V3BA 4BHHB 1VGRA 2XCLA 3C3JA 4DBLE 2AUMA 4YMTA 1QRDA 1IQUA 1TUGA 1P1RA 2BKAA 2GKOA 3PFCA 4Y2VA 4WDQA 1VYUA 2J3MA 2WE7A 3I8XA 3RS2A 2ZKLA 5DZSA 3U3ZA 4E2WA 4FE4A 1N6OA 2JGDB 1HG1A 4RA6B 3SPXA 3MGAA 4ABTA 4DCNA 5A04A 2Q0HA 3DJFA 1U0LA 2OBYA 1J0EA 2NXNA 3NXKA 1NLZA 4QX6A 4MR8B 1I6MA 5GJVC 3IJRA 4J2HA 4X1KB 5J2UB 4CM8B 1KRXA 4AIRA 3K0BA 3N6VA 4RNDB 3UYKA 3NXSA 1FCJA 2C2KA 5FUQA 1TZJA 2ZRCA 1OT3A 1V5EA 4HZUA 3AF4A 3T54A 4ZOEA 3HDYA 2C4TA 4EUSA 2DB3A 3K94A 2O1SA 3A37A 3X43A 1SUWA 1Z83A 2CLIB 1ZJ6A 2PFSA 4D4KA 1QP4A 5E4FA 3VR4A 3KYIB 3GFGA 4AICA 1PE0A 4NQRA 1TQHA 4JY7A 3UC5A 2ATEA 3HUEA 5D6OA 2XMSA 5AK5A 3ET5A 1ZLXA 3B12A 3WNBA 5AKKA 5EXTA