3ENKA

1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
340
structure length
340
Chain Sequence
MSTKGTILVTGGAGYIGSHTAVELLAHGYDVVIADNLVNSKREAIARIEKITGKTPAFHETDVSDERALARIFDAHPITAAIHFAALKAVGESVAKPIEYYRNNLDSLLSLLRVMRERAVKRIVFSSSATVYGVPERSPIDETFPLSATNPYGQTKLMAEQILRDVEAADPSWRVATLRYFNPVGAHESGLIGEDPAGIPNNLMPYVAQVAVGKLEKLRVFGSDYPTPDGTGVRDYIHVVDLARGHIAALDALERRDASLTVNLGTGRGYSVLEVVRAFEKASGRAVPYELVARRPGDVAECYANPAAAAETIGWKAERDLERMCADHWRWQENNPRGFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.9A crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
rcsb
molecule keywords UDP-glucose 4-epimerase
molecule tags Isomerase
source organism Burkholderia pseudomallei 1710b
total genus 125
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3enkA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3enkA02
1GQQA 1Y7TA 3KZVA 4HFRA 1J49A 2NWQA 4GVLA 1NR1A 3HWRA 4OO3A 2G17A 3C7AA 2RIRA 5A3JA 1UZLA 4Z3KA 4KUHA 4DPLA 1I8TA 1AXGA 2WJPA 2J3KA 4D41A 2QZ9A 1XU7A 1LA2A 1YJ8A 5IN4A 1XR3A 5COAA 4IZIA 3VC7A 2CY0A 3K9QO 1U2DA 4LRTB 3B6ZA 4DQXA 4DC1A 4S1VA 5JLAA 3D4NA 4GH5A 2ZIZA 3L9XA 4RV9A 4OXKA 1BDBA 3IP3A 3I9JA 2YV1A 1NQTA 2J3IA 1HKUA 1EBUA 2YFQA 5A9RA 2BGMA 1AE1A 4FOSA 1V3VA 2V6FA 2DKNA 3C7CB 1WZEA 1Q7CA 2NQ8A 4NBTA 1ENPA 2IXBA 2HUNA 3DQPA 2AA3A 3VPXA 4XYMA 1GYQA 4OL9A 5DCYA 1E3IA 1X15A 3EDMA 4A2CA 2Y05A 2EW2A 2B36A 4CM6A 3V2UA 2D59A 2VHZA 2DFVA 2NU6A 3PFWO 4P4GA 4RDHA 4XEHA 3AI3A 5JDCC 1ZEJA 5JCXA 5G0VA 3W6ZA 3GC6A 4AG3A 5KCZA 3TZQA 3PP8A 4QFDA 2Q50A 3NDJA 3OP4A 1D3AA 5JW6A 3A9WA 3UH1A 5MGBA 2WYWA 1JWAB 3GPDG 1Z73A 3GH3A 2AE2A 4I8XA 2OL4A 5L4LA 4FGSA 3UCEA 3Q11A 3WICA 4CR7A 2GN6A 3NTRA 2GCGA 3QRWA 5ER9A 2Q3EA 2D5AA 1P1RA 1BVRA 3EW7A 2O7QA 3ZH2A 1U7TA 1A72A 3PQEA 2AQHA 3Q9NA 4JGBA 4Y6SA 4BO1A 4AJOA 5I7EA 4TRJA 3I83A 1OMOA 5TNXA 5L7WA 1E1LA 2EERA 2IYPA 3E9NA 5EL0A 1YDWA 5FWNA 1MB4A 3JD3A 3WBFA 2DBZA 4NQZA 2BHLA 4AICA 1TT5A 3LF2A 1ORRA 3GVPA 4F6LA 2YQ5A 1O9BA 1KVQA 2BMAA 1GTMA 2EIHA 2EHDA 2FSVA 2Y1FA 3WLEA 4XYGA 1YRLA 3LZ6A 4IIVA 1I24A 2VT3A 3GZNA 5GZ3A 5KJ1A 4FS3A 3PGJA 2Q49A 2FHSA 2O4CA 4KUGA 4R1NA 1N9GB 2VHYA 4BV9A 1HSOA 1E1NA 2J8ZA 2X1HA 1NHWA 3PZRA 1ENOA 1M66A 4RVHA 3CMCO 2GDZA 1YDEA 4Q3NA 4WNIA 1LXCA 1N7GA 3AWDA 4LCEA 2BGKA 3WXBA 2HRZA 2NM0A 1EVYA 4KOAA 1I3NA 1NFQA 1LX6A 3WFIA 3O9ZA 3TZCA 4OH1A 1VJ1A 1GQYA 2C20A 1C0KA 5AYVA 4PLHA 4YBZA 1B0AA 2I3GA 4LMPA 4RVSA 3P19A 1PJBA 3VDRA 4R3WA 1BRMA 1KY5A 3LT4A 4A10A 3JQBC 4E0BA 3HFSA 2DC1A 3QP9A 4PG4A 1PJ3A 1XQ1A 5CDUA 3ICCA 1T24A 4YJGA 1L7EA 1U4OA 3LQFA 3AOGA 4C7JA 4ZRMA 4U8GA 1MX3A 3E1KA 4P38A 4RQTA 1JN0A 3HE3A 1I10A 1PL7A 5U4QA 4IMRA 4BNZA 2AEJA 1NPYA 3ETDA 2WYUA 3GMDA 3E8XA 4M8SA 1PWZA 1UZNA 1I32A 1YQDA 3FHLA 4BB6A 3W6UA 3PHHA 3EK2A 2HMWA 4DLLA 3KYDA 5G2OA 1HLDA 4CMBA 1GR0A 3PI7A 4JBIA 5CHEA 5CDSA 5G0SA 4E6PA 5THQA 4K28A 3CMMA 4Q3BA 1LLQA 4INAA 4B7UA 4MINA 2JAHA 2JHFA 3RSHA 1JDJA 3EC7A 1DLIA 1LDMA 3O38A 5A9SA 5CDYA 1PEDA 3E9QA 1JQBA 3JQAB 1K2WA 3GVCA 1ZKMA 1E3WA 3ZDFA 3ZWVA 3MJTA 1ZK3A 4OIMA 4PVDA 2JAPA 5TX7A 3RKRA 3RUEA 1ZMOA 2YY7A 1M75A 1KIFA 3HDHA 3QWIA 4CQMB 1QYVA 3BA1A 1Z74A 2B4RO 4AJ4A 1W0CA 3TOXA 4KMSA 5B1YA 2BELA 1WDMA 1SB9A 1I33A 3FCOA 3OFSA 5JNLA 1X7GA 4NIMA 4IQ0A 3WX0A 4K6CA 4F45A 1HZZA 2PD6A 2ZB8A 1GZ6A 1FJHA 1UAYA 1EE2A 4Z9YA 2WD7B 3PDUA 1LRJA 4IQ8A 3V1UA 3VOSA 1I0ZA 1SEVA 3DZHA 4HP8A 2FPIA 1R6DA 4BO9A 3B20A 4DVJA 1LSJA 4CQLB 3FWNA 1GCOA 1DIHA 3NDRA 4P4NA 1YH3A 2WWRA 1Y8RB 3WGIA 1ZSVA 3M1AA 1M6WA 4DUPA 4ALJA 4BMSA 3EGOA 4H7PA 4YJHB 3NDIA 5I7FA 4Y9DA 5I9LA 3OIDA 2YHIA 4R5HA 1VJ0A 2C2YA 3S2EA 4U0JA 2HMUA 5JY1A 5I8ZA 1GZ4A 3T4XA 1ML3A 1CF2O 1T2EA 1Z82A 3LT0A 1U3VA 3WMWA 3WNQA 1T1SA 2VNAA 4WE3A 4EJ6A 1VKNA 5JFOA 4JXKA 1LJ8A 2TMDA 3GHYA 3E82A 2WD8A 3U49A 4TRMA 4YXFA 2X7HA 2B35A 1MP0A 1VC2A 4P22A 2DFDA 2NUAA 1DJNA 3RI3A 4GX5A 4UVGA 4LN1A 3WGGA 3EVNA 1PJTA 4CR6A 3NJ4A 3W8DA 1I5RA 2HK8A 4YPOA 5A5FA 2E6UX 4IJKA 2OHXA 4O63O 1SCUA 4CM5A 2DUUA 1IOLA 3TJRA 1BDMA 1DC4A 1QG6A 1KYQA 4XD2A 4CR8A 5EINA 2B0JA 1K5HA 1XG5A 4Z9XA 4GSKA 3FI9A 2IDZA 2Q46A 3ANLA 1O6ZA 1BXGA 3BHJA 3SVTA 2QQ5A 1YL5A 3KVOA 3VH1A 1CYDA 4NBRA 1CIVA 4QSMA 4HWKA 3VH3A 4NBUA 2P5YA 1YWGO 3E18A 3PK0A 4D3DA 5DCWA 2IEBA 1T4DA 3TQHA 5I7VA 1I3KA 5H81A 3O8QA 4A0SA 1DEHA 1C14A 1CQIA 3P2OA 2XF8A 4NFSA 1TA4A 4K26A 4J43A 3KHUA 2A9FA 3TFQA 1RM5A 3D3EA 4I1IA 4R9SA 1ISFA 1VPDA 2R00A 2G5CA 4MP8A 1H2HA 2DBRA 3DFZA 5EIOA 4AJLA 1X13A 5L9AA 3OQ1A 4PFJA 1H93A 4WLFA 1HEUA 1FXSA 1QYCA 1R4MB 1XGKA 1HSZA 5BNTA 1C1DA 3RBXA 3I4FA 1UP6A 3EUWA 3WGZA 3VDQA 2B5WA 3KSZO 4JX8A 3W4JA 3V8BA 5JO9A 4G65A 4I5GA 2NV6A 3WNVA 4QX6A 4MVJI 2NU8A 4A27A 4YAKA 4QFCA 5KJCA 1DLJA 4WLEA 1GAEO 2FSSA 1GQ2A 2B69A 2NADA 1ZXLA 3BAZA 3I6IA 3A28A 3JQ7A 3S8MA 1AHIA 3OJLA 3ROPA 2YW9A 4KQXA 3MJCA 2JD2A 4UAGA 2HK9A 4FOOA 4C7KA 3GDGA 3QVOA 3LSYA 4PLTA 4B8WA 2JD1A 1X1TA 3CZRA 3GEGA 1D7OA 3K96A 1A7AA 4I5EA 5JYDA 1U1IA 1YOVA 4NH4A 2B37A 2RH8A 2X9NA 5T5QA 1PR3A 5G0WA 4CUZA 2UV8A 3RVDA 1ONPA 1XWFA 3QLJA 5KOIA 2B5VA 4CQMD 1VM6A 1NR7A 1WZIA 3HB5X 1CWUA 2CDCA 4CV2A 1BVUA 3FBTA 2W4QA 4FN4A 4BVAA 3KTDA 1MXHA 3KO8A 4QECA 5IFLA 4ALNA 3BMQA 4YT5A 3LC7O 3B1JA 1HYHA 2AG8A 4FFMA 4OOFA 1U7HA 4CV0A 4IXWA 1NM5A 4JP2A 3ZU4A 1HDRA 3BMCA 1UP4A 4GMFA 4RF4A 3VPHA 3UCXA 2PR2A 4PZDA 3T7CA 5CDTA 2PZKA 2NNLD 4B4OA 1NTOA 4E32A 2NU7A 1RWBA 3Q3CA 4A03A 1NWHA 4JJGA 2FOIA 1LSUA 2Q2WA 2UYYA 3G3EA 3IL2A 5IXSA 4MKRA 3PIIA 3JQFA 3DWFA 2Y0DA 2H5LA 3WOHA 1E7MA 1U5CA 3CUKA 5KIAA 1YBAA 2FR1A 3JQFC 1RJWA 3GA0A 4NHEA 3CTMA 5KVQA 1ULUA 2BH9A 1YVEI 2VRBA 4LISA 3H3JA 2Y1EA 2GR9A 4XQEA 2HRBA 3ZWCA 3KLPX 4E33A 1EBFA 4J4TA 2O7SA 3H8VA 1M76A 3WSVA 2HMTA 1X1EA 3PQFA 3HDJA 2UUPA 3DBLB 4GX0A 4PG5A 3RCBA 1T2FA 3F5QA 3OIFA 3PHJA 4CL8A 1ISMA 1PZGA 1ULSA 5DBIA 4EBFA 4IUYA 1L7DA 3AU9A 4OMUA 1A27A 2C29D 1MFZA 3L6DA 4ZQFA 2ZTUA 4II3A 1RM3A 4LSWA 5DP1A 1HYEA 1Y8QA 1LDGA 3KYCB 1EK6A 1D4FA 4RF2A 4YRBA 3OJ0A 3ZNPA 1KERA 2WDZA 2GO1A 1GFSA 2FRDA 3PJDA 4DLBA 3EHEA 3OQ6A 3WGOA 2EW8A 1FDVA 2NSDA 3IKVA 1V3UA 3ABIA 3C3XA 4CMHA 4E31A 1NNUA 1UXJA 3ETGA 3LVFO 4IDGA 4PLZA 1DFGA 1OZAA 3HZZA 4AFNA 3F4BA 4NR0A 4YQZA 2CDAA 1E7RA 5LDGA 4MIYA 2PKQP 3G1UA 9LDTA 5CG2A 2Q2VA 4NJOA 2EV9A 3GNSA 2IYOA 1PL6A 3FNGA 3BMNB 3DTYA 2C5EA 3E6AA 5F1KA 1P0CA 3RWBA 1GYRA 1W8DA 5HRUA 3HHPA 1PJQA 1VJTA 3ZNOA 1E1MA 1PGOA 1R0SA 1UXKA 2QRLA 3K5PA 5KVCA 3DAPA 4FC6A 1X0VA 5AOVA 4AJEA 1NXQA 1ZK4A 2FMUA 1O95A 1KVRA 1KEWA 4G2NA 4J0FA 2CF5A 4U0KA 3E03A 4EJMA 4FC7A 1YO6A 2BFAA 3ROMA 5DZSA 1F8GA 3ZWBA 3MJSA 4PZCA 5C7IO 5L95A 4W9NA 1NFFA 4ZD6A 2C7GA 1JKJA 3DOOA 4LCJA 3V2GA 5IXYA 3CH6A 3B1FA 5IZCA 4DRYA 2VYNA 4D3FA 4EEXA 3VPFA 4CV1A 3I9OA 4CLEA 4BKQA 1W6UA 3UN1A 1WWKA 4RZHA 1ADBA 1DIGA 4I5DA 2PTGA 6LDHA 1P74A 4TVBA 1R4NA 2E82A 5TF4A 1B8UA 1VL6A 1T26A 1F17A 5G4KB 3BIOA 1TVEA 5EESA 3MWDB 3K73O 1RM0A 4N5NA 2X22A 4HADA 4RPKA 5A06A 1J6UA 1C0PA 1LEHA 1LLDA 3ANMA 3QW2A 3BTUA 3ON5A 3ITKA 1LRKA 4IDDA 2CUKA 1DAOA 1LI4A 1UXGA 3C85A 4L0QA 4Y6PA 1XSEA 4IINA 3A14A 4AL4A 4WEOA 2ZCUA 3HSKA 4XWYA 3D5TA 1JW9B 1MA0A 3PLRA 4J0EA 2FWMX 3WQRA 4Z0TA 5ER6A 4QT0A 1TXGA 3FTNA 2OGUA 3GFBA 4YVFA 3ZV3A 3BTVA 3AUSA 2F1KA 3DBHB 1QR6A 4FFPA 1BSVA 2VN8A 3WWZA 1E77A 4IDCA 3WBBA 3K92A 4CM8B 4ZA2A 1KC1A 1PQPA 3S2GA 5K6AC 3NTQA 1A7KA 4FJ2A 1DBVO 4JNKA 4ONEA 4HXYA 2AMFA 5C5IA 5CEFA 4R69A 1N2SA 3GT0A 3TNLA 4LRSB 1PR9A 5A02A 2VWQA 2Q4BA 4OQZA 2BFPA 4CMCA 2Y0CA 1P31A 4ZGWA 1V8BA 5ILOA 2GZ1A 2EKQA 4PRKA 2HLPA 3D4OA 4RF3A 4WLOA 4KTTE 3FN4A 3WGTA 2OOSA 5C37A 3PPIA 3F1KA 2WTBA 5COBA 3KUXA 1B16A 4J7CA 1PJ2A 4PG7A 4N7RA 4J9UE 1P1FA 1PS8A 2O3RA 4F46A 1LC0A 1CDOA 3WGYA 2SCUA 2VHXA 3GY0A 3RAJA 3UXYA 3UAGA 2NACA 2C82A 3DZGA 3R6DA 5BT9A 4DMMA 1H6BA 3ZHZA 3ENKA 4EW6A 5JAMA 4BGVA 3JQ9A 1R12A 2VWPA 5COQA 4MVJD 4JIGA 3ZCXA 1GPDG 3AI1A 5AXCA 1IHXA 4Q3AA 3PIDA 3OHSX 2J6IA 4WEQA 2X5KO 3BMOB 2VRCD 7MDHA 5L4NA 2JCYA 2ZJ1A 3Q6IA 4E12A 2JFFA 1A5ZA 3TN7A 5TT0A 4DQUA 6ADHA 2X9VA 3ST7A 3VH2A 4Q3CA 1V9LA 2BLLA 2Q1TA 4LGVA 2VOJA 1QLHA 4YRDA 4DA9A 4WCFB 5GMOA 3GN2A 3ICPA 4I9UA 3ZV6A 3IUPA 1XCBA 4CM7A 4CPDA 2A35A 3KRTA 3KEQA 3AM5A 2GYYA 5BNFA 3OECA 4CMIB 1LSOA 2GLXA 2QX7A 4RVFA 3D3WB 3NX4A 4OKNA 3V1YA 5I8WA 1EQ2A 2D4AA 2WD7A 4NJMB 1T4BA 4NZ9A 3WYBA 3AFMA 2HKIA 5DCUA 1HDXA 1ISJA 1GDHA 1X0XA 1ZO8A 2V6GA 3AU8A 4OAQA 3ZW9A 5T57A 5BSHA 2NVBA 4XCVA 1SPXA 3L07A 4PRLA 1CJCA 3DXFA 3RU7A 4BOYA 4FGWA 1GEEA 5L53A 4W4TA 4XB1A 3QE3A 3TZ6A 3OJEA 2P68A 1QV7A 5DULA 3H7AA 4I08A 4PLYA 1D8AA 4XQGA 4UULA 2AXQA 5KJFA 3EMKA 2Z95A 4OKIA 4Q3EA 3SX2A 3ZHYA 1FF9A 1YQXA 4KP7A 4OJNA 5A9TA 1JAYA 1ZIDA 2Z1MA 4M55A 2GN4A 2Q4EA 3ETEA 4R41A 1FDUA 1ZJZA 3WLFA 3SLKA 4JLWA 2IODA 2JFGA 5A3VA 4NBVA 4A73A 1DIBA 2D1YA 2XXBA 3HN2A 3HNPA 1LC3A 3TSCA 3JQGA 1DRVA 2X0IA 3WIDA 4XGNA 3ZN2A 3CE6A 4TSKA 3ZHBA 1KOLA 2DU8A 1VL8A 1MG0A 4JP3A 1YB4A 3WYEA 1M2WA 2D0IA 2J5QA 5IDYA 4E5KA 4YQYA 1MLDA 1G0NA 4MVJM 4O6VA 1DIRA 1P9LA 2X0RA 2A4KA 1B3RA 1DXYA 4ALKA 4BGIA 5TS3A 3JYLA 4FSHA 2YV3A 4NBWA 2PA3A 3ROKA 4PLWA 1HDCA 1ZXBA 3WTBA 2WSBA 1Y5RA 7ADHA 2X58A 1MUUA 4FCCA 4BL5A 1ISGA 4DIFA 3H6KA 1VE9A 1E7YA 2NVWA 3VTFA 1NAHA 4FB5A 3MOGA 3ONFA 4J2HA 4CLHA 4DIOA 4H3VA 3SXPA 4GWGA 4E2WA 2LDXA 3WWYA 1QXSA 2YUTA 5JCJA 3PYXA 2C2XA 2GD1O 2Q45A 1S7CA 1IPFA 4WOJA 3PZBA 2UVDA 2O3TA 2ZATA 4GQAA 2FPGA 4YACA 1PJCA 2O2SA 5KNLA 2Q1WA 3PVZA 3DO5A 1H5QA 5JXWA 4RJTA 5JAZA 3GAZA 2QYTA 4XB2A 4BO7A 5BSFA 1LSSA 4CLRB 3DONA 3PTZA 3AY6A 4NPCA 5HS6A 4AJKA 1C1XB 1LNQA 1YJQA 1GZ3A 3G1TA 4BNUA 4ROSA 4E2YA 3ASVA 2AHRA 4J7UA 5JC1A 1P77A 1Z7EA 3SEFA 2VTDA 1WVGA 4PCVA 3RIHA 2I3AA 4MIEA 1UXHA 2I5PO 4FQ8A 4J3FA 1PZEA 5CEJA 4EI2A 2VUSA 1Q0LA 3OM9A 3TL3A 1BG6A 4ND4A 1JKFA 4BNXA 3GVXA 4BHTA 2QZZA 3O03A 1BXZA 4FR5A 1PU2A 3FR7A 2DBQA 3D7LA 3LT2A 1F12A 2G82A 1E3SA 2RHRA 1N7HA 2RH4A 4ND1A 3UW3A 3DBRB 1NVTA 2HCTA 2PLAA 3F9IA 1A9YA 4DIBA 4OYRA 3WQSB 1JWBB 4FJ1A 2HU2A 1GUZA 1LDNA 3AY3A 4KWIA 4YWJA 3QQPA 3JD0A 3V5NA 1H2BA 3TRIA 3BTOA 1NVMB 3H5RA 4CM4B 2ZB7A 1PJSA 4WLNA 3GGPA 1JVBA 1YL7A 1ZW1A 3DAFA 5FF9A 1ZNQO 5EPOA 2P4QA 2PWZA 5DF1A 3ZI0A 4E5MA 3U5TA 4J7XA 1V35A 1ID1A 3CIFA 3LYLA 4ALMA 4XRGA 4J9VA 1NWCA 3ANNA 2UUOA 1BW9A 1WNTA 2CVOA 3K31A 3ZWYA 3JV7A 3DHNA 5KJ6A 2QRKA 4AJHA 4DWVA 2TMGA 3UFXA 5JC8A 2QHXA 3E48A 4O1MA 1B14A 1E6EA 1GADO 4BMNA 4D46A 2X5OA 5LDHA 2UDPA 4CMEA 3LU1A 4UVHA 2W2LD 3CXRA 1AUPA 3NEPX 4GX1A 4JN6B 1Y1PA 5T64A 3IS3A 3JQDA 3BXXA 4Z6KA 3RBZA 1MFPA 4DQVA 5CPFA 3F1LA 3PGXA 3GG9A 3JQ8B 2OUIA 4E5NA 4FBGA 4G81A 4BO3A 2O4UX 2NTNA 5JS6A 1UAGA 4EGFA 5JSFA 1DPGA 1ZK1A 4IDEA 2PH3A 2GN9A 1YBMA 4ITUA 3FRJA 3I3OA 4BKRA 3BHIA 3FNEA 4HFNA 3HADA 2W2KA 3DBLA 3R1IA 1IPEA 1EUZA 1RKXA 3FSRA 3Q1LA 5I9MA 1W73A 1HT0A 2Y1OA 3V1TC 4WLUA 1H0KA 2E37A 1LLCA 3CEAA 3JYQA 4NG5A 4UEJA 4BNIA 3RUCA 1ONNA 1H9BA 4ESOA 4BNNA 3HQ4O 3PYLA 4E4YA 3ZU2A 1E3EA 2W8ZA 3PEFA 1OI7A 4GAEA 1PS0A 3UVEA 1O5IA 1W4ZA 5HM8A 2NU9A 1I3MA 2O3JA 2JD0A 3WIEA 2CF6A 1N1EA 1VL0A 4KTVE 5TJ9A 1BGVA 1RYEA 5DOZA 1EQUA 2X86A 1ZBQA 2CMDA 4M1QA 4GLOA 5I7SA 4XGIA 3P5SA 2ZK7A 1U3TA 4IDAA 4R4JA 1L1FA 1QYDA 1E0DA 1O94A 4PGFA 2ZTLA 3JQCA 4E21A 4YAJA 4PZEA 1NAIA 3OA2A 1ARZA 3KV3O 1ZJYA 4PLVA 4DREA 2GUGA 3QIVA 1MV8A 1ZUD1 2VQ3A 2F00A 1TT5B 3FNHA 3FR8A 4B8ZA 2P9EA 4YT4A 5LC1A 4F6CA 2ZTMA 3GRKA 3RJ5A 2D5CA 3HB4X 3PJEA 1QP8A 3PXXA 3GZNB 4L8VA 3T7EA 4RGBA 4LMRA 4DLAA 2PZMA 1U2GA 4L75A 1DIAA 3ZNNA 5CFZA 2DPHA 3GLQA 4B3IA 1ENZA 2R00C 3G79A 3OJOA 5ITVA 2J5RA 4FFRA 3ROQA 3DHYA 2HSDA 3QV1A 4HNHA 1PQUA 4UUMA 2GN8A 1P0FA 2XOXA 2VZ9A 4ALIA 3VKVA 3O4RA 2A92A 2Q2QA 3L4BA 5JPIA 4D7AA 2VWHA 2GZ2A 3BHMA 4BIIA 5FFFA 1H9AA 2ZYGA 4CLOA 3DEYX 3GEDA 1TEHA 1BWSA 2HJRA 1LLUA 3L4BC 3GGGA 4ND2A 1RM4A 2HQ1A 5EQFA 4XIJA 2I99A 4TWRA 3WS7A 3ZNQA 5DBGA 1YBVA 3DB2A 2WM3A 5JY6A 5TT1A 1HE4A 4DL9A 4YJGB 1H6DA 4L73A 5U9CA 4WJZA 3ZW8A 2I9PA 1DB3A 4MP3A 1B3BA 1IL0A 1KVSA 3JQAD 2D8AA 4YEDA 3ULKA 3VAZA 1BMDA 1J5PA 4E2ZA 1Y9AA 4NMHA 3EYWA 3U4IA 5THKA 1ZK2A 1H6CA 1C3VA 1TT7A 1UH5A 3RD5A 1I2BA 2P4HX 1I36A 5H83A 2GERA 4JBHA 1HRDA 4TZKA 3KYDB 4AJ2A 1BHSA 2Y1GA 1AHHA 4GVXA 4ND5A 2DQ4A 3RC9A 3GRPA 3IOYA 2DVMA 1DAPA 1K3TA 2NVUB 2B83A 3VZSA 3JYOA 3U4CA 1HXHA 2FP4A 3OICA 1K6IA 3H5NA 1WMAA 3PHIA 4BNFA 4RPHA 2H1SA 5A9SB 3AUAA 3KXDA 1P45A 3D5QA 2FZWA 5TGDA 2HAEA 3DZIA 4W7HA 3N7UA 1KVTA 3F5SA 1C0LA 1IB6A 4R51A 1KEUA 4IJUA 2V65A 3EAGA 5IZ4A 1GV1A 3SLGA 1UP7A 4B79A 4FIZA 1X14A 1NBOA 4Z0PA 3RFVA 4E3ZA 2CVQA 2VTEA 4AJNA 2AE1A 3MJEA 5T8KA 1DDOA 1Y6JA 2YDXA 3RU9A 4CM1A 4RVUA 1EUCA 2P9CA 3F46A 5ADHA 1S6YA 4MKXA 4N18A 1KS9A 4U5QA 1TI7A 1GCUA 2JCXA 3U4DA 1GPJA 4FDAA 3WFJA 3OMLA 4LVUA 3UGKA 3L77A 3PWKA 4JJIA 1U3WA 3PFFA 2AG5A 5B12A 1R37A 3PJFA 5F5NA 3OH8A 1XKQA 3ZGYA 1AN9A 4NDNE 3MJ4A 2V6MA 4HFMA 2PK3A 3IDSA 4GKVA 5C7OO 4BNMA 4B7CA 5GZ6A 3JD1A 4E5YA 3QVXA 2BFMA 3KEOA 1KY4A 4YAGA 3I9LA 3UF0A 3TZKA 2I66A 1A4IA 3KSDO 4KZPA 2FR8A 3QWBA 1QV6A 1GL3A 4P8RA 3VZRA 4BGEA 4EUHA 2VWGA 3BZUA 5AXBA 2X8LA 3SJUA 1G0OA 2YHIB 1JU9A 5EERA 4YDRA 4CMAA 2IZ0A 4NFHA 4WCFA 2WYVA 2J3HA 1IY8A 2Y1CA 3JD2A 3VPSA 1CETA 1VKOA 2Y67A 1E7WA 2CZCA 2HDHA 2HMVA 3R0IA 4MOWA 4JJFA 2PNFA 4EJ0A 4YYZA 1Y9EA 3QVTA 3D1LA 3EZLA 1ENYA 4BO8A 1WDKA 4RLHA 4ZQHA 2J5KA 4KWHA 2FN7A 3ENNA 5G0TA 4M54A 2OZPA 1SB8A 3GVHA 1GUFA 1T2DA 3TL2A 3TWOA 1DO8A 3OIGA 4MJLA 1U5AA 1P1IA 4ILKA 1SZJG 1HTBA 4R1TA 3WR5A 4B4WA 4D0SA 4IDBA 1E7SA 4BGUA 3U9LA 3QWFA 5K0ZA 2EGGA 4K9DA 4WPGA 1BXGB 4YB8A 4CM9D 1DRWA 1PTJA 2BFOA 1XDWA 5JAQA 4BQPA 4FW8A 3QWAA 1PQWA 4Z3DA 2OORA 4OGWA 1VLLA 1O89A 4BB5A 1E7QA 4HY3A 2H9IA 3HDYA 5IJZA 4FFOA 4I9HA 5ENDA 3H2ZA 1HYGA 3ZWAA 5JAIA 5J23A 4NK4A 4B3JA 2G0TA 1NHGA 1QYXA 2W98A 4W9NC 1QKIA 5AXDA 1ZH8A 4E5PA 1U3UA 4QO8A 3QWHA 4DPKA 3F4LA 5IZCC 2Z1NA 3RQSA 2AW5A 4GBJA 2NTVA 1R15A 4MP6A 1B8VA 4II2A 4I9NA 4WLVA 3K2BA 1WLYA 4EUEA 3E5RA 3QY9A 5L40A 4AJIA 3E9MA 2GZ3A 3V2HA 1C1DB 1ONOA 5TIIA 1J0XO 3IKTA 4U6QA 2Q1UA 3ZWPA 1N9GA 1U8FO 4BS9A 5TRTA 2JKVA 1HWYA 2JL1A 4DXHA 1PX0A 1AXEA 4PG6A 2C07A 2BF7A 4D3SA 1I2ZA 1UJMA 4ID9A 1F14A 3GUCA 4BO4A 3JTMA 4BNWA 4EITA 1OC4A 4IS2A 3U09A 2POQX 1E5LA 1FDWA 3GR6A 3KSUA 1B7GO 1JLLA 4GGOA 1VRWA 4RL6A 2CFCA 3JQ7B 2VYVD 2PV7A 3PLNA 4NI5A 4QXMA 5IF3A 4Q3DA 4S3MA 1DRUA 2BI7A 1IZ0A 2XXJA 3NV9A 4IY1A 3NRCA 4R1UA 5CP8A 3U3XA 3GNQA 3ZWXA 3NT5A 4L74A 2GNAA 3H5AA 4LVCA 1DFIA 1B2LA 1P33A 3RC2A 5JBIA 1DHTA 1QSGA 1YOVB 4L4RA 4J16A 3ONEA 4M89A 4MVJP 4AJ1A 3K2EA 2EJWA 1XHLA 4TZTA 3K6JA 3NKLA 4ZICA 3CPSA 3S2FA 4D45A 4XYBA 3OEWA 4CLRA 5A03A 3H9UA 4YRAA 1QMGA 4K6FA 2EG9A 3PRJA 1NASA 3Q0EA 4W99A 1KVUA 3I5MA 4UUPA 3BMQB 4BO0A 4GX2A 2C54A 2C7VA 4MVJH 4O0LA 1A9ZA 3FF4A 2JCVA 3HUDA 3NT4A 2C0CA 3VVCA 3W8FA 4UREA 3QVSA 2DTEA 4TRRA 5KVVA 4AJPA 1H6AA 2EEZA 3VH4A 3BMCB 2O23A 5T6BA 1ZSNA 3ZWOA 3MJVA 1E3LA 3RROA 4IMPA 5L45A 2Y0EA 1R66A 1XELA 3G0OA 4XZ3A 1H94A 2CNBA 3DMTA 1RYDA 2FR0A 4IS3A 1EZ4A 5F1PA 4D43A 2OBYA 3I1JA 1YB5A 3GDOA 1LRLA 3NT2A 3JQ9C 4FFNA 4WNCA 5FI3A 4BNVA 3JQAA 3DMTC 1LUAA 2RHCA 4PLFA 3ADPA 1TLTA 3RFXA 1VSVA 3VHRA 1EE9A 1FDTA 1PJ4A 2EJVA 4CM4A 1MC5A 3RJ9A 3QSGA 4W7IA 1K6JA 2I67A 4NFYA 2DT5A 4OSOA 4CQMA 4ZN6A 3MTGA 3H4VA 1M67A 2QRJA 1EVIA 3M2PA 1EEHA 4QEDA 4BKUA 4MPDA 1U8XX 2VOEA 3COSA 4CMJA 4PIVA 2Q99A 4WECA 4BNLA 4GPD1 4TMFA 1FDSA 3RUDA 4NK5A 4X54A 4MO2A 1YQGA 4E30A 4XA8A 1V3TA 3X2FA 2Y66A 3GF4A 1F0YA 5CDGA 1Y8QB 4RPGA 1P3DA 4ZQEA 4CQLA 1KC3A 4FD3A 4G5HA 3I6QA 4GWKA 4MVJE 5EJ2A 1N5DA 4LW8A 5BQFA 1Y8RA 3JQ8A 3W8EA 2E4AA 2RCYA 3ONDA 4R68A 4BNYA 3Q2KA 3VZPA 4IJWA 3ASUA 4RPLA 2BD0A 3WJAA 4YJHA 4KUEA 2QW8A 3OBBA 2PGLA 3FNFA 5DNAA 5JDCA 5K9ZA 4MIOA 3RC1A 1U4SA 1GV0A 2DUWA 1KEVA 4CUKA 3R3SA 2HJSA 2ZQYA 4OHUA 3RBVA 5FEUA 3L4SO 3L9WA 3AI2A 4ZVVA 2BGLA 1ZCJA 3ZU3A 3VKUA 3N74A 2E48A 1IHYA 1NPDA 5A5EA 2FPPA 2DBVO 1V0JA 2OP0A 4IGEA 5BR7A 5AXAA 3HFGA 3ITDA 4Z0HO 3DMYA 2G76A 2DTDA 4GL4A 3RUHA 3W1VA 2FY8A 3G17A 3INGA 5L3ZA 2GGSA 4U6SA 4UUOA 3TF5A 4M49A 3ZV4A 3OETA 1DOHA 4CMGA 4TRNA 1Q7BA 5HS4A 2R2GA 3RASA 3IJRA 3ZV5A 1QLJA 4RO0A 4J90A 3GMSA 2R6JA 1QYWA 2IRWA 3KYBA 4PN3A 4RCVA 1ZSYA 2D2IA 3AK4A 5A05A 1XU9A 3F47A 3W4KA 1BTOA 1YGYA 4ALLA 3DR3A 1RPNA 4JCOA 3I4CA 4J91A 2OFPA 3TFOA 1ZVMA 3W4IA 2GF2A 1HF3A 5JYEA 3D0OA 1R4NB 4YJFB 4BV8A 5U1PA 3PQDA 1XEAA 3IC5A 2YZ7A 3AOEA 4PG8A 3RKUA 2O48X 4GSLA 1NYTA 4HX5A 1KETA 3LLVA 1X7DA 3TPCA 2PKRA 5EQDA 5CG1A 3QA9A 2EKLA 5ENVA 4PLPA 4NNJA 3GN1A 3AOEC 3RUIA 1YB1A 3I23A 1UUFA 3H65A 1IULA 3D4PA 4CM9A 1R4MA 5B4TA 3GUYA 3NJ8A 1EFLA 3LK7A 4DBVO 3ZWNA 4Z9FA 4XR9A 1GU7A 3VZQA 1O8CA 5G4LA 2DPGA 2Y68A 3WJ7A 4D79A 4ZHSA 1XLTA 5BSEA 5ITWA 4YCAA 1GEGA 1Z7BA 2HO5A 3ADOA 3LF1A 1VI2A 4ND3A 1UR5A 4WK6A 1Y81A 1HL3A 3CSDA 3PDJA 4W6ZA 2X23A 1U28A 1O0SA 5DOVA 2NQTA 3H2SA 3JQBA 1NFRA 2DAPA 2OMEA 5L4SA 5ICSA 3JSAA 1DHRA 3F3SA 2OP1A 5LCXA 2OBNA 3INTA 4DGSA 4OM8A 1HZJA 5B4UA 4H15A 4GKBA 3AY7A 4CLXA 2EXXA 2IZZA 3H9QA 3PWZA 5L7TA 2AEMA 1XA0A 3EY4A 4RQUA 1NP3A 4JQCA 3AM3A 4XJSA 2Q1SA 4LK3A 1DJQA 1YXMA 3GGOA 1XYGA 3B1KA 4QQRA 2WE8A 2VHVA 1EDOA 4EDFA 1ZEMA 3VPGA 4XKJA 4L4SA 2JHGA 3HJAA 1V6AA 1U9JA 4H16A 4MVJF 4BUCA 4UVIA 5A4DA 2H6EA 2X4GA 8LDHA 4CJXA 3GNTA 2ZCVA 3C1TA 3CKYA 1A4UA 2VNSA 1JTVA 3PJGA 3H3FA 1SOVA 4HBGA 5JMPA 2RBEA 5BNIA 3GFGA 4ZJUA 5DP2A 3G49A 1DC6A 3KOUA 3S55A 3EVTA 2VYVA 4IGFA 2AQKA 2ZYDA 3S1LA 4BO2A 2NVUA 4DC0A 4B3HA 5KKAA 3DTTA 4M87A 4EYEA 5HWSA 1E1KA 1C0IA 4OXNA 1JVSA 3ZZNA 4L9RA 2FZEA 3N58A 3LDHA 1EFKA 1LBEA 4TVOA 4KDEA 5F5LA 3NYWA 4K1LA 4AJJA 4IZHA 3NUGA 3CZMA 4J4BA 4UVDA 1B8PA 3GZ4A 2EGHA 4BKPA 1Q1NA 1SC6A 1YS4A 3JD4A 3FTPA 8ADHA 3IQDB 2VZ8A 3M6IA 2CDBA 4CMEC 1B15A 4IPTA 2E49A 1WDLA 2ZKLA 4Y98A 1NQOA 2X0JA 2P2SA 2YQ4A 3CINA 1WW8A 1CEQA 1JKIA 2B4TO 1WP4A 3I9KA 1PL8A 2G1UA 3GPIA 4J1SA 2I76A 2YJZA 3GAFA 3PHLA 4CV3A 5AQ1A 3C1AA 2ZJ0A 3LLSA 4JBGA 1ZK0A 1A71A 3PWSA 3OSUA 1F06A 1WPQA 5L51A 3H9JA 4E13A 5TJHA 1B26A 1SEPA 5TQVA 1XIVA 3IUSA 4WUVA 3JYPA 2C5AA 1T1RA 4OXYA 5IDQA 1EMDA 4MVJA 5C7LO 4WKGA 1OAAA 3X2EA 4ZRNA 3DZBA 3UHAA 4CLDA 1WMBA 2VRCA 3KYCA 3I9MA 2PZLA 3DOCA 4YT8A 3M2TA 4JROA 5JMWA 2C59A 4QUKA 1ISHA 2EKPA 2IZ1A 3B70A 3GQVA 3IP1A 4YTEA 3INRA 3HDQA 4IDFA 1ZFNA 4R16A 1WXDA 2JJYA 3FPLA 4GLLA 3DZJA 1SBYA 2VYND 3JQEA 1BXKA 4URFA 2D3TA 3HN7A 3GDFA 2PGDA 3WGHA 2ZB4A 3OEYA 3RUFA 3AM4A 2P91A 3JQGB 3L6EA 1GD1O 1F8FA 4BNKA 4OOEA 4J49A 4P4LA 3HG7A 3SBOA 3NTOA 4TKLA 1X7HA 4YA6A 4UEKA 1P44A 1QORA 4BQRA 2YV2A 1PSDA 3BMNA 1E6WA 4ZQBA 4BMVA 5ES3A 1K89A 4NU6A 3PHGA 5CAEA 1ZMTA 4CODB 5FYDA 3S2IA 3DBVO 4XJTA 4EEZA 3TZHA 2IXAA 1OC2A 3BYZA 2IE0A 1FK8A 2NLOA 2VCYA 3IIEA 4O59O 1LDBA 2EP7A 2ZB3A 1T2AA 3GVIA 4M86A 4YJDA 2GRAA 1D1SA 3AJRA 4DYDA 3DC2A 2YFHA 2ET6A 1UDCA 2B4QA 3IJPA 4GGPA 4IBOA 4XYLA 4EZBA 2X5JO 4UVEA 4WCDA 1VSUA 1PZHA 1UZMA 4B4VA 4BO6A 5IAAA 5CEEA 3AFNA 4CM3A 1EDZA 4RZIA 5CPBA 4BNHA 4RF5A 2YYYA 3MCVA 1I30A 4RORA 1I01A 4BNGA 4J4HA 4FJ0A 3WSWA 2GPTA 1IE3A 3UUWA 1NQAO 1HE2A 3IMFA 3MZ0A 3ZHXA 4XIYA 3EZYA 4D0RA 5G4KA 1IYZA 1NVGA 1SOWA 5KVSA 4N5MA 5GY7A 4D44A 5TLSA 2Y1DA 3Q2IA 5HA5A 4Y67A 2PKQO 2PH5A 5JO0A 1HDGO 3KB6A 1R0LA 2VUUA 1YE3A 1LDEA 4OSPA 4Y6RA 5EN4A 4MDHA 1PGJA 1HDYA 4R9RA 4QTZA 2AQ8A 3ZWMA 3DZFA 3OQBA 5I9NA 2O50A 3P7MA 3TOZA 3E5MA 4IXTA 3SC4A 3O26A 3DHEA 4RVGA 4RPJA 2GASA 2CSUA 1J4AA 1E3JA 3OJFA 2XAAA 1TB4A 3DBHA 3A4VA 4MVJG 1E92A 1OOEA 5DDIP 1K0UA 4XX0A 5KJEA 4CM8A 1PGQA 5HBRA 1K6XA 4IQGA 3AUTA 1EVZA 1HE3A 4GI2A 2Y93A 3ZU5A 3MOIA 1ADGA 3QHAA 1YKFA 3LC2O 3RUAA 4A7PA 4J1TA 1E3WB 1HDZA 1PS9A 2O3QA 5BSGA 1XQ6A 3WMXA 2EF1A 3C24A 2QG4A 5IDXA 3H9GA 5A04A 3WYCA 5HTOA 4CL3A 3SC6A 4ZQGA 4GMGA 1N92A 5B37A 1Z45A 1EVJA 2AEFA 2O3UA 5F3RA 1KEPA 3I9NA 3C8MA 2V7PA 5MDHA 3DDNA 1N8KA 3QJ5A 2HMSA 4HUJA 3MEQA 1HETA 4O5OA 2A94A 1G6KA 2IEDA 1BW9B 2X0NA 4A5OA 4DPMA 5ICMA 5T8KC 2BKAA 2ZTVA 2P5UA 2X6TA 1DC5A 2PD4A 4FFLA 1R16A 1JA9A 1E5QA 2DM6A 3MWEB 4WASA 4BKOA 1SO8A 1JAXA 3AW9A 4MKZA 4ZU3A 5IDWA 2PY6A 2H63A 4R5MA 1PWXA 3DZKA 2W90A 2J3JA 4IM7A 1AGNA 3BMOA 1CERA 3UKOA 4A26A 3BTSA 3A06A 2DTXA 5H82A 5F1OA 3C1OA 1DFHA 4J1NA 1ADFA 2Y99A 3ORFA 4XYEA 4BNJA 3DL2A 2EWMA 4YAEA 1MG5A 4KDFA 3OA0A 3DAGA 4PVCA 1I3LA 1EK5A 5DT9A 4B4UA 1E6UA 1LQUA 2W2KB 2EP5A 5AVOA 2VT2A 3C7DB 5FI5A 4WCFC 1ZZEA 1P1KA 2BI8A 4E2XA 4CMIA 2O3SA 4RLSA 3MTJA 2PGJA 3D3WA 4DBZA 1Z75A 2LDBA 2XPCA 3QVWA 3FBGA 4NJMA 1FMCA 1UDAA 3FWZA 3I52A 3OF2A 2NTJA 1Q7GA 2GSDA 4N5LA 3AUUA 1DC3A 1NPTO 1QRRA 3DOJA 4BO5A 1EUDA 3Q9UA 4J6FA 3U0BA 2OO5A 4HNGA 4RDIA 4YR9A 4HKTA 2BRUA 2VHWA 3H9EO 3L0DA 2W2LA 5L7YA 1PGNA 2YHUA 3UCFA 2RAFA 3PYMA 5G0UA 1IZ9A 1PGPA 3LT1A 4I5FA 1Y5MA 4DYVA 3D64A 4J1QA 2PFGA 1HE5A 3U62A 3GG2A 4XDYA 4W82A 4J2OA 2CVZA 1ISIA 5KKCA 2I6TA 4RVDA 3L6OO 4TROA 3WGQA 1SAYA 4CUJA 3LC1O 1I2CA 3JCZA 3NAQA 5DN9A 2JFHA 1Z6ZA 3NGXA 4WOKA 3JYNA 4F3YA 3VTZA 4FPXA 4PLCA 3O8QB 4CMKA 4N54A 3ZWWA 5JCJD 4TKMA 4HV4A 4AVYA 5IN5A 5EMHA 1GYPA 3UOGA 2PZJA 3U4HA 1Q0QA 1HLPA 3JQ6A 3R3JA 3WG9A 2AQIA 1Q0HA 5JE8A 2P9GA 4R3NA 2O2YA 1PZFA 4UEOA 3IAHA 1OBFO 1DSSG 4B7XA 1CQJA 1MC4A 1GUYA 1GY8A 3RFTA 5F21A 4TQGA 2YDYA 4BNTA 4CLOB 4IIUA 5JDIA 1LQTA 3SJ7A 5A1TA 2WE7A 5C3MA 1HDOA 4YJFA 5ILGA 1Q2XA 3KETA 1YL6A 3KLMX 4QO7A 4R01A 4R54A 5JDIC 4XDZA 3UICA 3TDKA 2VUTA 3WDSA 4D42A 2I65A 2QYSA 3GEMA 3P2YA 5TC4A 1R0KA 3VVBA 4C4OA 9LDBA 1CRWG 2WEKA 3DFUA 1P1JA 4JK3A 4WGGA 4DTIA 1OFGA 3GK3A 4YAIA 4LSMA 1G1AA 5KTKA 4Y8VA 1N1GA 1YONA 5T67A 1MGOA 2ZQZA 4HFJA 5TSDA 1UDBA 4XQ9A 3RC7A 5K6AA 2VZ0A 2WMDA 4U7WA 2V6BA 2X9GA 3A1NA 3GHHA 3NGLA 1C1XA 2CD9A 3FPCA 4L4XA 1SNYA 1KBZA 4Q9NA 2ZYAA 4DMLA 1M6HA 3GOHA 2HK7A 5IG2A 4KQWA 1NX6A 1SMKA 4UUNA 1T25A 5DBFA 1NQ5A 1T2CA 3K8ZA 4YT2A 4R1SA 1UXIA 2OXIA 2DLDA 1PJLA 1LTHR 1ADCA 3K30A 3STHA 3WQQA 5GZ1A 1D1TA 5B4VA 4IJVA 5KWEA 1LU9A 1WAMA 4Q39A 3KBOA 4NU5A 4XRRA 3WB9A 1P1HA 2PD3A 4L76A 2ILTA 2UAGA 4PLGA 2Z5LA 3KM0A 3DBRA 3WTCA 3M1LA 4EUFA 1IUKA 1LDYA 3FD8A 4OQYA 2QIOA 3T4EA 3F6YA 1PIWA 4XQCA 1MXFA 4XGKA 4XR4A
chains in the Genus database with same CATH superfamily
5A5DA 1L5ZA 2HXGA 1KQ3A 3PQ3A 1W52X 2WYIA 3DT8A 4QELA 4UDOA 5ECWA 1LW7A 4PYOA 2C61A 3KWFA 4EO7A 3T5DA 1XLWA 4IX9A 4D5GA 2XB4A 1I8TA 2GILA 1J9EA 1C7JA 4D41A 2QZSA 9MHTA 4QLBA 4LWZA 1QBGA 2Q4OA 3M5PA 1LA2A 2ISCA 4F2DA 3BWDD 4QUEA 3A6LA 1YKSA 1YFKA 3B1WA 3P45A 1J06A 5COAA 4N8SA 1L1QA 4LTDA 4YV2A 4QWMA 4KXQA 3B3AA 1DX4A 1FQKA 1KJIA 1PSZA 3I53A 4O25A 4NBNA 4WFKA 4CKWB 3BDAA 1X1CA 1V7QA 3I8OA 4S1VA 2P9YA 4QJBA 5JRZA 1ISRA 1A96A 1VCOA 1ABBA 4XVRA 1ML4A 3VSAA 2GQ0A 3IP3A 5JU6A 1HKUA 1T2UA 2HJHA 2YFQA 3S4YA 3T54A 2BGMA 4I55F 1RWQA 1IUPA 3CLSD 2DKNA 3C7CB 4DJJA 1WZEA 5EVJA 4M0UA 1S8AA 2HUNA 3HNOA 4JVLA 1F5SA 2CDRA 2ONZA 4UU1A 3VPXA 4F3TA 2NYRA 4AX4A 2BV3A 4JLAA 2IITA 2B36A 1M0WA 2OO3A 3V2UA 1O0CA 2D59A 3QUCA 4KCGA 2PKEA 3PFWO 2WHXA 5BSUA 5AJVB 2NXCA 2YHBA 3Q8KA 1NJ5A 4YUYA 2WFAA 5G0VA 4DLKA 3OF5A 3DWGA 3SQDA 3UJHA 1T9GR 3F4KA 3QKRA 4UHHA 4Q5IA 2IV7A 3WLJA 4AG3A 2ZJZA 4XIIA 4KG7A 1WB5A 1CUXA 3PP8A 1EJ6A 1PW5A 1GPBA 1D3AA 4M1OA 3LPLA 3SKVA 2XYGA 1WQ1R 2QN6A 2WVHA 2WYWA 4WOCA 2PMEA 4EGJA 4F91B 4GICA 4OH7A 1Z73A 1O57A 2D2XA 4CCSA 3DV9A 1CHDA 2AE2A 2ZRFA 2XXAA 1EFRD 1P1BA 1U7UA 4FGSA 1WHSA 2FLWA 3Q11A 3UCEA 3NTRA 1FDIA 3IAXA 4HQOA 4KBYA 1I4TD 3I3SR 4FE4A 5DHPA 3C6YA 2D5AA 4X71A 3ED5A 5K2OA 5CDHA 1SHJA 1E89A 1FRNA 1KZ1A 4HQKA 4Y6SA 4EFKA 2IUSA 1M8GA 1DAFA 3T5GA 3ZEIA 2QTTA 2CHVA 4WKPA 5CVUA 5A2GA 1WMEA 3UWDA 4DEVA 3I83A 4OYHA 3V34A 2WU4A 2QE6A 2BM8A 5CJ2A 3W5UA 4ZVMA 2HTEA 5FWNA 2QTZA 4I3FA 3JD3A 2DBZA 1DKQA 1QK4A 2KPOA 4JQSA 3JASB 4NQZA 2FVXA 5FTJA 3WZ2A 3ZWDA 1U8AA 3EMVA 1PD1A 2NO5A 2A9KA 1E2IA 5HZGA 4CIVA 2O0KA 3R7WA 4NY1A 4G5QA 1YRWA 2ONYA 2X8JB 1K88A 3S68A 5E4YA 4C01A 5KJ1A 2ETXA 1L0BA 1ULBA 3PGJA 2FHSA 4R1NA 1OZHA 1ZI8A 3KOZA 2VHYA 3VISA 1HSOA 2R6ZA 2CDNA 1NIPA 3UTDA 3CMCO 4WNIA 1YDEA 4YK7A 5D5PA 4JI2B 1VG8A 3PA6A 1L4EA 1XE3A 5EZYB 1UFOA 2AZXA 2V9ZA 1CEXA 5FORA 1L8LA 4P0QB 3AWDA 3AEKB 4OP2A 2OECA 2IEYA 3WXBA 4MPRA 3TW4A 2HRZA 4EO4A 3STUA 2NM0A 1EVYA 4PY2A 1JLLB 5PNTA 1NFQA 3B9RA 3EG9B 1LX6A 3WFIA 5JAHA 1EHCA 1ZRHA 2VUHB 3HACA 3N86A 4E15A 5IUNC 3BFJA 5B3JA 1W36D 4ZDKA 1XDUA 4LJ7A 3WO0A 2H52A 5DSTA 4WH0A 5AYVA 4PLHA 1XLTC 2YIDA 1U6JA 2Q0XA 3FYDA 4FYKA 4RVSA 4HWTA 3EH1A 1D5WA 2GJ8A 3CLKA 4R3WA 2GMWA 1BRMA 1NA5A 2ZSAA 2VF2A 2ZJAA 2WP8J 2Y6UA 4FNOA 4QPNA 4NCIA 4RY9A 1SUDA 5HCIA 1BA2A 4K2HA 4I4TF 2Z2ZA 4M0LA 4DCCA 2IHTA 3T8YA 1AQUA 2GJ9A 3GEHA 1UBGA 3ICCA 3OHMA 1U4OA 3BPSA 3EVEA 3LQFA 4FNAA 4L8YA 3RGWS 2ZVJA 4ZRMA 3L5KA 2RD2A 1JGTA 3EVBA 5A7FA 1XRMA 4ESVA 4MHTA 2GETA 3V8QA 2B78A 2XMSA 3LGXA 4IRXA 5D3MA 1ODTC 2R44A 5U4QA 5JISA 5HGJA 2QMZA 5F52A 3RIMA 2EYUA 3GMDA 1OWMA 5J4YA 4GPZA 1T9ZA 3ZH9B 1BIFA 1I32A 2X9LA 4RNDB 1UK7A 4FEAA 4BB6A 2HD4A 3JZDA 4P2GA 4C88A 2XADA 3KYDA 4XCXA 1HLDA 2GCOB 5EWJA 1CJBA 3LRXA 1WB9A 3HWSA 2P9HA 3FAKA 2IPXA 1QGUB 3IPCA 3LVBA 4JBIA 4D5EA 2NYVA 1PFVA 1N5MA 2PMKA 1YC5A 5THQA 5A6SA 1KRXA 1QYIA 3U6KA 1L7RA 4INAA 1TJNA 2JHFA 3SQXA 5EUBA 2I7XA 3EC7A 1F3OA 3NDPA 4KO8A 4N7JA 4W5HA 1LDMA 1T4GA 2DFPA 2VJPA 5EP4A 3WB2A 4CN9A 5CDYA 3E9QA 3WIUA 3CJQA 1JQBA 4ZVSA 2C88A 3DQQA 4BMYA 1HK7A 1Z0IA 2QVXX 2WU8A 3JR7A 3MJTA 4BX3A 2JRLA 2WVAA 5DW0A 5EZQA 5CA0A 4DM4A 2FCAA 2QTWB 2X14A 4NYIR 5SYNA 4AN4A 4BYMA 2A2ZA 3R0ZA 5JPCA 4JR1A 5K3EA 5KYNA 2YY7A 4IV8A 4DG9A 3VNRA 2WAXA 2WG0A 1Z74A 2OQ2A 1U11A 4DXDA 2PAFA 2HJGA 4IIEA 4PM4A 4BLTA 2OA0A 4YNBA 2QLNA 3EIFA 4ZO8A 4EF4A 5B1YA 3IX7A 2A7QA 1WPXA 1SBNE 2ES4A 5BSMA 4FYMA 2IXEA 1KDRA 1WDMA 2FUEA 2H85A 1SB9A 1UBKS 1IIBA 4HEQA 3MYRA 5EIHA 4ZVUA 2CNOA 2J32A 4PN7A 3V3TA 3VC3A 2FN8A 3BB1A 2FG5A 2R2AA 4UMEA 3B82A 2ZB8A 1C3OA 5C80A 1UAYA 2FK7A 3LY9A 1II9A 1RWPA 2MINA 4PGMA 3D8TA 5BUZA 1N36B 3DE1X 3I0MA 1OREA 3ND9A 1SEVA 4EUKA 5JHHB 4UMVA 2FPIA 1GCIA 4D26A 3VOBA 5C8VA 4QFMA 4B3BA 1Z7GA 1QC5A 1Z15A 1GCOA 2R1VA 2ID4A 2DUMA 2J0UA 1L7PA 3NDRA 2VT6A 2AIRA 3LAWA 5HTKA 2WWRA 1Y8RB 3IEUA 4OQLA 1U2SA 4RS4A 3KJZA 4IXMA 1P1CA 1LPPA 4DUPA 4ALJA 1OFIA 4KQ2A 2C8VA 4YJHB 2GCEA 2VAWA 5FLEX 5I9LA 4Y9DA 2XQFA 2QK4A 4F2WA 1KI8A 4R5HA 2PIAA 1GJRA 1VJ0A 2AR9A 3DF9A 2WNSA 3PXAA 5A1JA 3T3NA 1QWSA 2XEDA 5JY1A 1E0JA 3QU2A 3CNQS 3WIVA 2HWWA 2JLSA 3VHLB 3ZVRA 1Z82A 1B00A 4IV0A 4JX9A 1QQBA 2Z2YA 4RKEA 1VKNA 4JXKA 1RVDA 1LJ8A 2AX3A 1XN4A 2C5HA 3AKDA 2H1IA 3LBHA 3PQ4A 4FMPA 3SEAA 4TRMA 3ZDEA 3U1VA 3WK5A 1G8GA 1GZDA 2B35A 2EBWA 2VDUE 2X7HA 3A2MA 2ODWA 3HGQA 3L7CA 4TMWA 5SY6A 2XJ9A 4QATA 1ONBA 2ZBVA 3O2NA 4YMSA 3M1YA 2ERYA 1AHPA 4UVGA 3WAGA 4TZ0A 2WSMA 4LN1A 4XSGA 2X0DA 1PJTA 4CR6A 2GUWA 1I5RA 1RIIA 2HK8A 2J5XA 2VSNA 5AJXA 3K9CA 2Y4NA 4NAVA 3WLSA 5T3YA 1WJGA 2ZYIA 2WTEA 4CM5A 1CZRA 2FQYA 1IOLA 1ECBA 3F71A 3PICA 2OK7A 3OTQA 3R6GA 4MTLA 3I6MA 4P58A 3TJRA 1QH8B 4XD2A 1TADA 2B0JA 3ABQB 1K5HA 3C15C 1DWOA 1LF0A 3OZFA 1XG5A 4Z9XA 2JAXA 5CXQA 2C4MA 4H1HA 5AKYA 1SVNA 2QRMA 3KPWA 1N2IA 4EAQA 1O6ZA 1NX9A 3VYUB 4C4TA 1UZAA 1CLUA 1OLXA 2J4FA 1JQAA 1YL5A 3P0IA 1CIVA 1EFUA 2PMBA 5KBYA 3QUTA 1QANA 2CV0A 3VGJA 2BMDA 4Z7QB 4NBUA 1DKNA 4ETMA 5BMVA 3E18A 2QRNA 1OJ7A 2QD4A 4AF6A 1M7BA 2I6SA 3AILA 4GR5A 3TQHA 1FMFA 3E9EA 3P94A 3GFPA 2YIMA 5E2IA 3RVQA 3MMNA 4F60A 5ITZB 2C3YA 3DVAA 4A0SA 2OD2A 5CT8A 3WLHA 5K05A 1BC5A 4E1BA 1CQIA 2PKXA 3SJBA 2B5OA 4I6JA 3EVAA 4FTWA 3TFQA 1E1RD 5CFPA 1PVVA 4NBLA 3D3EA 3I6YA 4M1YA 3SXUB 2YXLA 4KQFA 4QODA 1ISFA 3ACCA 4AU1A 2E9SA 5JSZB 1OZ0A 2IYVA 4W5RA 3THWA 1UMDA 2G5CA 3QGMA 2YOGA 5EIOA 2OBLA 3M6WA 3VU8A 1G4HA 4RHUA 3OQ1A 4WLFA 1H93A 1EFRA 1CFZA 2HA3A 3CX4A 4HDNB 5ALQA 1J8DA 2X2FA 3O1HB 5CTJA 3FMIA 2J1LA 4FGUA 4LE2A 3TTVA 1TTHA 5BNTA 1C1DA 1G2QA 1SD1A 3BXHA 3DOUA 4F1JA 3NETA 5AI5A 4B40A 1UP6A 4D8YA 3WGZA 2B5WA 2ZWMA 3TNDA 3V8BA 4Q19A 1N7IA 2VK1A 2P9TA 1F2UA 4J07A 4MVJI 3K09C 4Q4HA 4D80A 4JYAB 3F8SA 2BKEA 1YJCA 1ZMRA 1YFZA 4AG5A 1QHEA 5KJCA 1PR0A 2GFIA 4LMBA 2B69A 3TOVA 3CA8A 2HR1A 4BEVA 1T4CB 3COZA 3PD1A 4LOLA 3ZWQA 3JVDA 4NMMA 1UBSB 1N2EA 4HYYA 2R5NA 1L9KA 4QDZA 2J3DA 1Q83A 1QJ4A 1VHWA 4PAQA 4BMCA 3KKZA 3GUZA 5JI3E 3QVOA 4PLTA 1NONA 4I50F 3CZRA 4L07A 2LCQA 1GFIA 3B6JA 3MTDA 2ZIFA 2RGBA 1K27A 3C3MA 1U1IA 1RWVA 1S1CA 4CG0A 2B37A 5T5QA 1QVZA 1PR3A 4M0PA 3LBIA 1RR6A 1XPOA 2V4ZA 4PC6A 1CR6A 2L82A 1Q0ZA 2FX3A 2WIJA 1P4AA 4PZYA 2ZUFA 4AKIA 1WZIA 3HB5X 4M0EA 2WU0A 3PD0A 4YP5A 1KQGA 3OOWA 1ZAYA 4YMIA 3UNXA 4BGPA 4GGMX 3E9CA 1J22A 3B1JA 1QRAA 1RZ3A 2CBZA 5JARA 4L2IB 5FWDA 5DXJA 1EXWA 1X8XA 3IIIA 2WF8A 1OWPA 1QPZA 4HK4A 2OCGA 1ZESA 4RSRA 3IQIX 2ONKA 3QX7A 3T7AA 3GT7A 1POXA 1CY2A 1NM5C 2O0LA 3I2JA 4XLZA 5K0FA 1NXWA 1WKCA 5ERXA 3HVKA 4EF5A 2RJNA 3BD6A 4LPSA 3ZKWA 3KYIB 4O2BF 1O1YA 1VIYA 3T7CA 4RH0A 5BWNA 2PZKA 2NNLD 3CO0S 4UAUA 1UFQA 4KR9A 5IMBA 2IS4A 2PUFA 3P71T 1KI3A 1R0ZA 3KR0A 4N03A 1E5DA 2EL9A 2G72A 3A7EA 4JJGA 3ECSA 5BOVA 2QF7A 1DO0A 5IXSA 1BXRB 3AG6A 5TPZD 1UC8A 3IP8A 1U5CA 3R9IA 4L8FA 2CNNA 1CP2A 2I4NA 4E6EA 5BW5A 5ISMA 2QVZX 1T0PA 3CPJB 2FR1A 5NLLA 4NHEA 4YP9A 4M8LA 1GVNB 1SCNE 3E9DA 4F38A 2H65A 1BWQA 2G83A 4LISA 4O4IB 1KJWA 3ZWCA 2HCFA 3CX3A 4BJHB 1EBFA 1EXMA 4E33A 2O7SA 1NDHA 1JBEA 1WG8A 3AFHA 3ZQ4A 4A1FA 2XGSA 5KPJA 4TLCA 5LD2C 2WNIA 1GRCA 2UZIR 1R1DA 4UBKA 1E2HA 1K8YB 2G71A 3BWYA 3V80A 1WVIA 4ZT5A 3I2FA 4QOFA 1L7DA 5TB5A 4EJSB 3AU9A 5CB8A 3KTAB 4OMUA 5T41A 5D85A 5JOQA 2OCBA 3L1VA 4FCVA 5JECA 4X1OA 5JD5A 3UBTA 3OVMA 3UZUA 2FSIA 1RM3A 4JT8A 4II3A 4R2XA 4X91A 5DP1A 5IVDA 3UXMA 5CCXA 4QOIA 3QENA 1W4LA 1G7SA 1TO1E 5IBPA 4KBGA 2RAVA 4MRMA 2OCLA 4IOJA 1TZCA 2IHJA 3EZ2A 2H4JA 2POCA 5DI3B 3SIXA 1MR3F 1BKDR 2WYHA 5F12A 2F3PA 2PDAA 2XA9A 3VYWA 4PHFA 2XRMA 1FDVA 3WAJA 1VYHA 3ABIA 3IKVA 2DHEA 5IYZF 1FU7A 3KQSA 5EPUA 2QRUA 5I4IA 1B23P 3HZZA 1TAHA 3D0KA 1R8YA 4JDUA 4J2TA 4TSFA 2CDAA 3I72A 3L8DA 2H2FA 1VXOA 5IKXA 1WXFA 4LDQA 3HCCA 2AZTA 2X7JA 4HH4A 1FX0A 1A5TA 3ZTYA 5CG2A 9LDTA 1QZTA 1OYOA 2R1TA 1T8SA 4NJOA 4OJYA 4Z2YA 4LF8B 2OXRA 4PWZA 4TS4A 4KQGA 1TMOA 1B6SA 5F1KA 1NU6A 1GYRA 3NBQA 1JRLA 3HHPA 4BYGA 5HRUA 3E22B 3O2QB 3OUZA 2PKYX 2TMKA 4P7JA 1UFRA 3BVPA 2G9QA 2JJMA 5KVCA 1FPQA 1KJJA 2AYYA 2NXWA 4FC6A 2FKNA 3CLUC 4AJEA 1TUEA 3FCSB 4CG3A 1JLMA 2IT1A 3HKCA 1KEKA 4BDSA 1IFXA 2FMUA 4UD2A 1KVRA 4G2NA 1KMHB 1MDFA 5LMUB 4U0KA 4EPRA 2YNMD 2ZIGA 2V0NA 3BD8A 1VTKA 3VTAA 1F48A 3UAOA 4M0MA 1AK1A 1YO6A 1IY1A 3ROMA 1P0QA 1F8GA 1PK7A 1A9TA 3N05A 5C7IO 5L95A 1XRLA 1MIOA 2D1FA 3ET4A 3T94A 3D7NA 4K3VA 2H00A 2YZNA 2RHBA 4P93A 3CH6A 1GRNA 4GUDA 5IZCA 4DRYA 1VLJA 4R05A 3BT7A 4B87A 2OMKA 3VPFA 2FE1A 4CV1A 5KTSA 3ENQA 4RTOA 2C8JA 4BKQA 1L6IA 2WU3A 3UN1A 4NYJQ 4C0LA 2EJBA 2VBFA 3LW7A 5FFMA 3SC2A 3AL2A 4Y2SA 2KS6A 3TLMA 1S4MA 1R2QA 2ATCA 4R0VA 3AGQA 5F51A 4I5DA 2J45A 2XJ4A 2J9XB 1F6BA 1CUJA 4D6XA 2CFIA 5TF4A 4RZUA 4EHAA 5MGNA 1VL6A 3EF3A 1F17A 1NGSA 5KKNB 4CIYA 1TVEA 5EESA 3MWDB 3UMJA 3RTCA 3IERA 1UEJA 1LEHA 1AGPA 1Y9DA 1RQRA 5I47A 4ZAFA 1I2DA 1TC1A 2BMVA 1DAOA 2X2EA 1UXGA 1CDEA 4L0QA 2F8SA 1XSEA 3ZY6A 5EP1A 3A14A 3ROZA 4WEOA 4OQMA 5LYYA 4AZSA 5KVAA 4GZLA 3PLRA 2NUPB 4EUSA 2EX4A 1ZHHA 5EWLA 3WQRA 2PH1A 2B1JA 5CJJA 4Q4JB 1JMVA 2FW9A 3ONWA 4UDNA 4Y1RB 3RAPR 5B2ZA 4JOBA 4ERNA 1DRJA 1GCGA 1QR6A 2GPSA 2UUBB 4FHCA 4TLAA 4G09A 3WBBA 1VFPA 1ZJWA 1KC1A 1N2CB 1PQPA 3I2HA 3OPMA 4DZRA 4EOGA 3T5AA 1DJOA 2C5BA 3Q12A 2CLKB 4RMNA 3PRYA 3QKSB 1A7KA 4FJ2A 3I61A 1WETA 4MWDA 4ONEA 5KI6A 4JUBA 2PXCA 5C5IA 4J75A 2XZDA 4UC0A 4ZTUB 4P31A 4K9SA 3IEXA 3NUZA 4H1TA 3GT0A 3TNLA 2UXBB 2VF5X 4LRSB 5B2EA 1W4CA 3BOSA 5F98A 4ZI7A 1RRPA 4OQZA 1GPYA 4IUCS 4LV5B 5LR6A 1DMSA 3MUEA 1V8BA 3G13A 2XCIA 4W63A 1JR3D 3W3AD 3HJTA 4QARA 1OYWA 1UPFA 4F1KA 2CVHA 4WLOA 3JATB 5M7EA 4UM7A 4FMDF 1XP8A 3F1KA 3W5DA 1VMEA 3KUXA 3U6BA 4BMXA 1CNEA 1EUCB 3EOBI 3HBLA 3KS9A 2ZSKA 4F46A 2QVGA 5BYJA 1W88A 2GVNA 2PVPA 3GY0A 4MV7A 3SDBA 3UAGA 4PR3A 2NACA 4Q7EA 3R6DA 5J9FA 1JX6A 3LBNA 1BWPA 4ND6A 3UQZA 4EW6A 5JAMA 3K0AA 1YS7A 4C4XA 1XWWA 2IQ5A 3JQ9A 1J56A 3QOFA 1R12A 4N3NA 1WULS 4I19A 2NZWA 4NC9A 2VWPA 3ZCXA 1Q3TA 3MINB 5DLQC 1JQDA 3ETHA 5AXCA 1C9MA 2ADOA 1QG4A 4Q3AA 2QY6A 2L69A 3PIDA 1WCIB 3KKEA 1GITA 3OHSX 4UD6A 3VYTB 2UYOA 3C45A 4C05A 7MDHA 2JCYA 4ZREA 4DV4B 3IR7A 1B2RA 2DGDA 1J1IA 4DV1B 3EE6A 1O0BA 3O47A 3MAJA 5JIBA 1G291 2ZAYA 4MMXB 3IR5A 1YK0A 3GEBA 1A5ZA 3RJZA 1JTFA 3TN7A 4I1UA 4EVRA 1KYYA 6YASA 4IFIA 1V9LA 1U2DC 4LGVA 2VOJA 1G63A 1L8AA 3C6MA 4YRDA 5C3UA 2QYOA 1VYUA 1KAGA 3BXOA 3B3QA 3IUPA 3MG9A 3OZUA 4CM7A 4CPDA 3IEKA 3KRTA 3OM0A 2BY4A 3HZRA 4QGSA 4F8JA 1JIQA 4O3MA 2GRJA 4MRAA 4TTRA 1B0PA 2XMGA 1CG6A 1Z28A 2V5UA 1FUYB 1LSOA 2FPKA 4CMIB 2RHDA 2Z3VA 3AO0B 2CLOB 3TK1A 1EQ2A 4E46A 2W6JA 3AFMA 4Z8YA 1CZKA 1Y9JA 1HDXA 1H2AS 4FFSA 1ISJA 4W5JA 4HZIA 4BE4A 2ZM5A 3HO1A 2HY7A 4KJXA 5BSHA 3CQ9A 1UINA 2DQZA 4XCVA 3L07A 3PE6A 2Z1DA 6ABPA 3H7IA 4B3MB 4BOYA 3G7NA 2Q5LA 3EXEA 3UMVA 1H23A 5AQEA 4EJ2A 3FLAA 2ODBA 4I9GA 3ZHQA 3K6RA 3TLCA 4LC9A 5MF6A 3IBGA 5KJFA 3EMKA 4IQFA 3R8FA 2FMIA 4Q3EA 4EHNA 1YQXA 4MQUA 1JXMA 4OJNA 1PW7A 2XUOA 3C98A 1JAYA 1ZIDA 1SKQA 5ULLA 3EAFA 3WADA 3LIPA 4TT8A 5AKGA 1J09A 1ZH0A 4AS2A 1FNDA 1DDGA 2W58A 1DEOA 2HX1A 1ZJZA 2BGJA 2FWNA 2VZLA 3HCNA 3OHPA 3QFFA 5AM1A 5A3VA 2H4XA 4AK9A 4C04A 4A73A 1GG8A 2D2EA 3HN2A 3HNPA 4HUQB 2V3WA 1LC3A 1KI2A 2NSJA 4EWLA 1DRVA 2FETA 1Q1GA 1L7VC 3QU4A 3WIDA 4GI7A 3GDWA 3ZN2A 1XNHA 4OB7A 5A3SA 5JXGA 3OFVA 4BN5A 2BM0A 3LLCA 5FBKA 3ER8A 3QELB 4ZAGA 3D6TB 4HWPA 5IDYA 3K1AA 1MW9X 4WK4B 1GPWB 3U60B 5LOVA 2ZS7A 1CRQA 3M4NA 1G0NA 3D31A 3EXIA 1F38A 4IFEA 4RFLA 3URKA 4EGQA 4ZEMA 2PUCA 4ITVA 3H11A 4MUNA 2FQWA 1YZUA 3W6NA 3ZE9A 4CDRA 5INTA 1B1AA 5B6JA 4P35A 1B3RA 4ALKA 3GGCA 4KR7A 3R5HA 1WL8A 1BCRA 1T3ZA 1OXMA 3NWJA 4MCHA 4HX9A 4NBWA 3AFOA 3O4VA 2IYLD 1XI2A 1KE2A 4AB1A 3UFBA 1A8PA 4WNYA 4JC0A 3UGTA 3CBGA 4PNHA 2I7TA 2WSBA 3BQ9A 3G85A 3FTEA 7ADHA 1SQSA 2X58A 3O8DA 4FCCA 5LQSA 4Z4GA 4BL5A 5I9SA 4JFRA 5KYYB 4X7MA 4DIFA 5ALVA 3H6KA 1V25A 2OO7A 4FB5A 2NVWA 3DCJA 2JI6A 1JE0A 1U0BB 3D8RA 1KE1A 2JLUA 2OE2A 3UH0A 5IKEA 2XMRA 5LP6A 2OOKA 5JCJA 3TL6A 2C2XA 2V4UA 2VH2A 2NAFA 2NO1A 1S7CA 4UKDA 1V47A 4YCBA 1LI7A 2XQKA 2Q5HA 1KP2A 4R1MA 5DCLA 3N76A 1PFGA 2ZAIA 2VAPA 4G9GA 3DDHA 3GLHE 4GQAA 4LSGA 4YACA 1I4EB 2AL7A 5BW4A 2ECOA 2Q1WA 2UKDA 5EJ8A 1F7UA 5DYGA 3DGFC 4RJTA 4D56A 4B3CA 4XB2A 5F9MA 4BO7A 3CSUA 4J0JA 4L50A 3OC6A 3CFYA 4E88A 2RB5A 3BCUA 4JYPA 1G59A 3SZOA 4N7BA 3UT6A 1C1XB 2IH5A 5GPBA 1Y4SA 2DRIA 3OY7A 3P4XA 2HLNA 2FWBA 4ROSA 1O96A 4E7PA 1Z7EA 2WJGA 5DWVA 3SEFA 4DHWA 2Q6VA 2ZWPA 1JFLA 2ZJFA 2VTDA 3BXPA 3OLYA 4C0XA 1C7RA 2I3AA 2A5GA 2VDKB 2QG9A 3K1JA 1PZEA 1VIVA 2OYCA 4EI2A 2VUSA 3W9BA 3OM9A 3HY4A 1RS0A 1I2AA 8MHTA 3CUSA 1BG6A 3HU3A 5EHNA 2RE8A 3GVXA 3NHLA 5CR9A 4EKGA 4M2LA 1N0VC 3IBYA 3JZAA 2OVFA 3IVRA 3PL1A 3D7LA 4JI6B 2P3OA 5BY2A 3SSNA 1F12A 2G82A 2HUPA 1N7HA 1PT9A 1SJ9A 2RH4A 3I92A 4ND1A 2QUZA 3UW3A 3CNEA 1NVTA 3ZZ0A 2PT6A 5LQKA 3F9IA 1AQIA 1MORA 4OYRA 4G97A 4MS4B 3WQSB 2IYUA 4L3WA 3M83A 4Q3KA 2HU2A 1GUZA 1LDNA 3FGOA 3WP1B 5KX5F 2AMJA 1J2JA 1L5HA 3R4VA 1H2BA 2G7ZA 3IIMA 3BTOA 4OHFA 3V5NA 3H5RA 1OBHA 1NP7A 1PJSA 2IV3A 5GQSA 2W2OA 3H84A 3DAFA 5KMGA 3JWEA 3WIBA 1IVNA 2JZOA 1XCGB 1YA4A 1N6PA 4LC1A 3ZI0A 4E5MA 5LZ5A 1VMDA 3GJTA 3EWIA 4ZOCA 1QRTA 4HEJA 4XRGA 2VJQA 5FTNA 2AXPA 2WHEA 3EFBA 3IHTA 3ZWYA 4OFZA 3GXBA 3K31A 3SIPA 2CD7A 5F35A 3DHNA 3B6EA 1KO8A 4G36A 3UFXA 3K0BA 3U19A 3E48A 3OIVA 4O1MA 1GADO 2FDRA 1J2RA 4KL8S 3MWEA 4TL9A 4UVHA 3NEPX 2KX7A 4V1CA 2OV4A 1G5PA 5HF8A 1LH0A 4YRLA 2HHHB 4BV3A 1HE8B 3IS3A 4I8IA 4IJQA 3RBZA 1MFPA 3AIIA 3FA2A 5CPFA 3N5CA 3A6PC 4FHEA 2H2AA 4E5NA 2JAUA 2WICA 5IHPA 4FMBB 3OG9A 3ZVMA 3H83A 2CJXA 4BP1A 3ABRB 1TCCA 4QBFA 1X7ZA 3EZFA 2P2DA 4IH9A 1XA3A 2IPMA 4EGFA 4JI0B 4EGAA 3H9BA 1DPGA 1ZN9A 2HJ9A 1XNRB 4JYMA 3H1AA 3OCXA 1NLZA 1PT5A 4U2KA 3TB4A 3I3OA 2JI9A 3BHIA 3BA6A 3FNEA 3QVKA 4QLOA 2O8FB 2J85A 1OZGA 2VH1A 5AKHA 1Q0TA 3AETB 1FVFA 2UZ1A 4RL4A 1RKXA 3FSRA 3G2JA 1RHRA 1EZZA 4MCIA 2AOTB 1T1IA 5G40A 5B2FA 4QGBA 2HTFA 2E37A 4TT3D 2IHBA 3U40A 2Y0BA 3VV2A 1W2GA 1IBCA 1S9HA 2PWYA 3CEAA 3EUFA 3JYQA 3NH6A 4TLDA 4UEJA 1X87A 4G63A 4O4LF 5ARCA 1M2EA 3LECA 3RYHA 2PQ2A 5DNWA 1DQYA 1CP3A 1MB2A 3PEFA 3H05A 3O8RA 4GAEA 4NMXB 4G3XA 4LZAA 1D4ZA 2O3JA 2WLTA 2CF6A 4Y6LA 5HKOA 2YZKA 5TJ9A 3UV6A 3KQWA 5C4MA 1DAMA 4BIMA 1PHRA 4PR0A 5KAPA 2ZRPA 4XGIA 1G5RA 2PRYA 1LPOA 3L0IB 4KFSA 2DPYA 2K5UA 4R4JA 1BO6A 4Y6GB 3VSCA 1ODJA 1UF9A 1GXSB 2YWEA 4YAJA 5LKRA 3UA4A 3MCAA 2IH4A 1ARZA 3ZVLA 1ZJYA 5DGCA 1OGJA 3QIVA 4M60A 1BMTA 4MPJA 4TLMB 1ZUD1 2WJWA 4A0RA 4C7OB 4ZIRB 3QFTA 3WK9A 1H3EA 5C5DA 1VKJA 2DCMA 2ZUUA 4R40A 3EZXA 1RJDA 4B4DA 1FRVA 1KL7A 3GU3A 3V9AA 1IAVA 3E15A 3B3GA 3GGSA 4R2KA 3RJ5A 3TRKA 1AMNA 3HB4X 1NC3A 3PXXA 1G42A 3GZNB 5FOVA 1XLVA 3V7WA 3ACBA 2ZBUA 3PQ7A 2I29A 4GRDA 4C07A 4MLPA 1RQNA 1LBIA 1Y4UA 4U39A 2C4WA 4XXHA 3JARA 4L78A 4NYJR 4JKIA 1SKMA 2ZRIA 1JHDA 1U9YA 3L7JA 4KXLA 1UK9A 2MTBA 2WJZB 5C8YA 2C1ZA 1M1YB 1XEWY 1PNTA 3GLQA 2X6QA 4B3IA 2BFBA 2R00C 3OJOA 1IUNA 4LS3A 4QHYA 4FFRA 2OCDA 3ROQA 5K3OA 2GHRA 2MWMA 2CGEA 3MRSA 4AYXA 3QV1A 2YYSA 3VTKA 3DXXA 2CV1A 3T5BA 2IQIA 5KQSA 5CVTA 4N48A 5IJ9A 5AP9A 1ZCZA 3WHPA 5KREA 1LJUA 2CUTA 1ZH4A 2VZ9A 4GNKA 2R1ZA 3LX4A 4HAZA 3L4BA 2Q2QA 4DLTA 1UIRA 3F5MA 3QEKA 4ZWNA 3KKLA 3BHMA 5K3FA 5FFFA 5B7NA 2ODQA 4GRIA 3FDIA 3AEUB 3AVQA 4QGHA 3DEYX 4JQOA 4KO1S 4MUKA 3PDWA 2ZJ2A 1UOPA 3B12A 1E2PA 3QPBA 3WQHA 2QN7A 4KQ1A 4XIJA 5EQFA 1KZGB 1VG0B 4ZC1A 4NAUA 3IO3A 2QN1A 1H4QA 1OHHD 3DE5X 2NXNA 1YBVA 2VP2A 2WM3A 2INGX 3GLHA 4LY6A 4NULA 5JY6A 1FTWA 2R5FA 4DL9A 4YJGB 1H6DA 2C4KA 3OCVA 4TTVA 4KSCA 5FOSA 3B48A 1CEYA 1F2TB 1VPLA 3MWFA 2NXEA 2VCHA 4PC2A 6GPBA 3ULKA 5LUBA 3BE5A 4YEDA 3VAZA 3A1WA 4BLUA 1XPUA 3AIMA 4NMHA 2ID9A 3U4IA 3ELDA 1UH5A 4BCBA 2YV4A 4N5IX 1I2BA 3M89A 1B93A 2Z9BA 4OUKX 5C81A 1POWA 1I36A 3FVRA 3KQYA 5BSKA 1RJ9B 4JBHA 5CW2A 2FUCA 2RI1A 1SM4A 4GVXA 4QOGA 5E7MA 4ENVA 4WAUA 3REOA 3IOYA 3EN0A 3AFGA 2OR3A 1DAPA 1OYYA 3NV7A 4Y0NA 1K3TA 1XVLA 2ZOSA 3S70A 3ADCA 2O8BB 2B83A 2OB1A 2XLBA 3ESCA 3JYOA 1Z2OX 4KE8A 1HXHA 3PNBA 1L4HA 3PSHA 4R98A 1JHVA 1OLUB 5A9SB 3G2KA 4RSHA 4YMUA 3FMOB 4PAWA 5TGDA 4LHZA 1C4OA 1WVMA 3NHFA 2WTAA 3A36A 1AKEA 2B6NA 3DZIA 4HVTA 3N7UA 5IEJA 2Y27A 2IHYA 3NALA 2HXYA 2WUVA 3I73A 3NBFA 2H1CA 1RPTA 1KEUA 3EQ2A 2P75A 1GV1A 3DPSA 2OXTA 3SLGA 3TRJA 1B76A 2Q9AA 5IZ4A 5LUAA 3NWPA 5E2AA 4F12A 4PPNA 1P9OA 2CVQA 1JDNA 2JJ1D 3MJEA 2NV2B 5FBZA 5T8KA 2OSBA 1UQRA 1DDOA 2JIDA 4IVPA 3RU9A 2QRQA 4JBWA 2P9CA 2E4ZA 4JGGA 4PSDA 5ADHA 2TSYB 1FMTA 5KYWB 5JXJA 2UUCB 1O4VA 3D6JA 4N18A 1L8OA 4QRHA 1Q16A 1SCBA 3WFJA 3LE8A 5B58T 3ZI4A 4AKGA 3PWKA 3U4AA 1O54A 1U3WA 3G2HA 4EKEA 1KS2A 1T0BA 4I81A 1OX4B 3TPZA 5B12A 4EH1A 1D03A 4KAFA 4F3CA 3UHPA 3I0ZA 5F5NA 4ZK2A 1AN9A 4QWWA 3ZGZA 2V6MA 5GJCA 2PK3A 1UC5B 1NI4B 5GZ6A 3JVUA 3R3UA 3K0KA 3M33A 2BM1A 3WIOA 4F5YA 1RI5A 3KEOA 3S81A 1ZR4A 4U7DA 3FPSA 4WJLA 1E5XA 4YAGA 1Z8HA 1A04A 3UF0A 1MA3A 1ZLYA 1EK1A 2GBCA 2OQRA 3U26A 5C4IA 4CKWA 1CRLA 1E9CA 5D6OA 3OM1A 2BDEA 4BGEA 1NJSA 3IP9A 1KZHA 1MW8X 1R9GA 5DMHA 2BZSA 1VSTA 2QN8A 1C4KA 2J41A 2YHIB 4R1LA 3RNLA 3TGWA 5JJ5A 2WWYA 1GTSA 4YDRA 5FL7A 2ZXUA 2NZVG 1QIFA 3QPVA 4WCFA 2WYVA 2O2XA 4KN5A 2AVDA 2X0FA 5JZ9A 2CWWA 1P75A 5ECDA 3VPSA 2QNIA 3AF2A 3RRXA 5TEVA 3DFFA 1UBFA 4Q02A 1RPJA 2HDHA 2ZJ4A 3R0IA 2N42A 2CNWD 3MMZA 4H6PA 5AJHA 2PNFA 4EJ0A 2FRDC 2PTHA 5IKPA 4DR2B 3EPKA 1Z0DA 1FVXA 3HSYA 3OLWA 1YNOA 4OIFA 3ZTWA 3UK2A 2NUAB 1BJKA 2C2HA 4KXVA 4RLHA 1D2HA 1KYVA 2BEWB 3EZGA 3QYPA 3V3KA 3AL0C 4KWHA 2FN7A 1JPVA 4N65A 3PGVA 3FM9A 4P53A 5G0TA 3MTQA 4L7QA 1YK1A 1ACMA 3OOSA 4L85A 2ZSJA 3TWOA 2F55A 3OIGA 3HVJA 4JLOA 4KN9S 4US1R 4PPQA 1XMSA 3H42B 4UOQA 1U5AA 1NXOA 3N07A 2PYDA 3D4BA 3QXJA 2VTKA 3DR5A 4EG3A 4UXIA 2AMLA 1UBTS 2WDPA 3VSBA 3WR5A 2XD4A 1A9RA 2AYZA 2FN4A 4IDBA 2EAUA 3SZ3A 1YDGA 1CY7A 2ZIEA 5K8VA 1EIZA 4GS5A 1A97A 3G9QA 2CW5A 2ZZKA 2E7ZA 2P6NA 3JZMA 3QWFA 4YDSA 3GBSA 3FFXA 4COOA 1NVEA 1OXUA 1SZPA 4BRUA 5LIPA 1R64A 1ZN8A 4MKHA 3DT6A 5HJEA 1AG9A 1PTJA 3PT5A 4WCVA 1FS5A 1YRYE 3GPLA 4CEHB 1JZQA 2OQIA 1XDWA 3L4KA 4BQPA 1ZONA 4FW8A 1PQWA 4B6RA 4F4DA 3H1PA 3LRPA 4AZTA 1E7QA 4HY3A 3HDYA 5K8UA 1XPRA 2HIMA 3K2IA 3GFTA 3JY6A 4FFOA 4MGYR 1MT0A 1HYGA 4MR7B 5D01A 3SEQA 4NK4A 5JAIA 1BFUA 1N78A 4ZC8A 3ZS8A 1QYXA 2ZRBA 4W9NC 1QKIA 2HLDD 2WIKA 5FB3A 4CFZA 4DB2A 4OQEA 2YRFA 1XRSB 5AXDA 1NRWA 4QO8A 4DPKA 2H59A 3N1UA 4HS4A 3O7MA 2PKCA 3JASA 2CVFA 4OP1A 2AW5A 1NZDA 4Z8XA 3EIUA 3ZDAA 4II2A 4I9NA 1SR8A 4QVGA 4WLVA 3AUJB 2K7ZA 3JYHA 1XXLA 4EUEA 2IK8A 4R8MA 4LMAA 3E9MA 2BJVA 1QS0B 1KEZA 1UL1X 1XZJA 2X8JA 4V03A 5CLIA 1ONOA 1AVTA 2ZKIA 4FNMA 1JKXA 3IKTA 4U6QA 2HA7A 2A1TR 2W71A 5EUCA 1E61A 2NZYA 2QJTA 3PDIB 5TRTA 3RYFB 1V11B 2JL1A 1M2VB 1BS1A 2C2OA 2BH2A 1H66A 1PX0A 1V95A 4RD0A 5EZYA 3T3MB 4BC1A 3CM0A 5EJFA 4BO4A 3V8PA 3AEKA 2AXNA 3HU2A 4MVXA 3RHSA 4ZZ3A 1HQDA 3U09A 3BILA 3RU3A 3KSUA 4L3OA 1B7GO 1JLLA 1Z08A 1RQ2A 1ZIPA 4GGOA 1JLSA 1YZQA 4IWXA 4X00A 4ZARA 3SDZA 2DR2A 3MCUA 3G7UA 4QXMA 1AKWA 1AKTA 3OP1A 4LYFA 3UB4A 3ADDA 4OHBA 1DRUA 3IXQA 2BI7A 2XXJA 3GUVA 4JMPA 4MYUA 1T0IA 3NRCA 3W3AH 1Z34A 4DM3A 1MVNA 2PH7A 4U5XA 5AI0A 3B53X 4JS0A 3ORSA 4L74A 3DVLA 3IEVA 4LVCA 2QU7A 3H97A 1M6YA 1JFRA 2VQ6A 2IYFA 3L7MA 1XHEA 1QSGA 3OSZA 4NVRA 1Z2PX 3KWMA 4J16A 3ONEA 4H31A 4NOJA 3VR2A 1H2XA 1KO1A 3IMGA 4RY8A 3WBKA 4OI0A 1RKQA 4P33A 3OIYA 5A4KA 1P7VA 2V55B 2W6PA 2YWJA 3TM5A 4ZICA 4D45A 3BFKA 4DJDC 3A4IA 2XWPA 4LUCA 4B9EA 1YUMA 1JL3A 2IYYA 3EAQA 3OKPA 3Q0EA 4K6FA 5LDDC 1WY5A 3U56A 3HO6A 2QLLA 2FEMA 3MMSA 4GX2A 4BO0A