3ENKA

1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
340
structure length
340
Chain Sequence
MSTKGTILVTGGAGYIGSHTAVELLAHGYDVVIADNLVNSKREAIARIEKITGKTPAFHETDVSDERALARIFDAHPITAAIHFAALKAVGESVAKPIEYYRNNLDSLLSLLRVMRERAVKRIVFSSSATVYGVPERSPIDETFPLSATNPYGQTKLMAEQILRDVEAADPSWRVATLRYFNPVGAHESGLIGEDPAGIPNNLMPYVAQVAVGKLEKLRVFGSDYPTPDGTGVRDYIHVVDLARGHIAALDALERRDASLTVNLGTGRGYSVLEVVRAFEKASGRAVPYELVARRPGDVAECYANPAAAAETIGWKAERDLERMCADHWRWQENNPRGFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.9A crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei 1710b
molecule tags Isomerase
molecule keywords UDP-glucose 4-epimerase
total genus 125
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3enkA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3enkA02
3AK4A 1ISJA 3KOUA 3KYDA 4LSWA 3KVOA 4R1TA 5IZCA 4KMSA 1KS9A 2O3JA 3MCVA 5CDSA 1B8UA 1XYGA 4MJLA 4ZQGA 3GRPA 1DDOA 3C7CB 1BVRA 5F5LA 3C24A 1N92A 1U3WA 4BNWA 3CZRA 1DLJA 3FHLA 3QY9A 4FGWA 3DFUA 4A26A 4IJKA 2C0CA 1WNTA 3IIEA 4RJTA 3DMTC 2Y1DA 4H7PA 2C7VA 2OGUA 4NQZA 5HRUA 3RROA 4HKTA 2EKLA 4Q3EA 4B4UA 4E5NA 1MB4A 1R4MA 2WE8A 3PK0A 4A7PA 2FR1A 3L6OO 4OXYA 4EJ0A 1BXGA 2Y1OA 4YAGA 1UJMA 3DAFA 1AUPA 4YQYA 3HHPA 3LC7O 1H9AA 3OHSX 1GTMA 9LDTA 2BELA 4GX2A 4ZU3A 2AG8A 2FOIA 5L51A 2W2LA 3NTRA 4FB5A 4Y67A 4E31A 2I66A 3ANLA 3DBLB 4NH4A 3DZKA 4ZVVA 4A10A 5DCWA 3WBFA 3ON5A 3D3EA 4HADA 2EP7A 2WD7A 1FDWA 2AA3A 3I9OA 2W98A 4EZBA 2GLXA 1ZFNA 3WGIA 3SBOA 5A02A 3AI1A 3NTOA 3EY4A 4Q9NA 4TVBA 4CL3A 2P2SA 2NLOA 3NUGA 3WSWA 4PLWA 1P44A 2V6BA 3VPSA 1RM4A 3TQHA 4B4WA 2BRUA 3ZDFA 4PLCA 1NXQA 3DZBA 5T67A 3EYWA 3WGHA 4TKLA 3BTOA 3JQBA 2C5EA 5JYDA 1FDVA 3RAJA 1QRRA 4NDNE 1ENYA 5KTKA 1U5CA 2H1SA 3MWEB 2H5LA 1BXKA 1MUUA 1YBAA 1PIWA 3U4IA 5IF3A 4OSPA 1KVSA 5BNIA 4YJHA 4DWVA 4OMUA 2X0IA 3RC7A 2YFQA 4IMRA 3VZQA 1ZH8A 4LGVA 5JO9A 1EQ2A 1H93A 2YV1A 4FC6A 1R15A 1PZFA 2CVOA 4W7HA 2BF7A 1T2EA 3D4NA 3KV3O 4FFMA 4JX8A 4YT2A 5JW6A 2C20A 3TSCA 1TI7A 3JQAA 4Q3NA 1F8FA 2YV3A 4RVHA 4CV2A 1M76A 3WQRA 2JFGA 4IS2A 1E7SA 5KKCA 2ZJ1A 3KSZO 4BO8A 4BB6A 2E37A 1NHWA 3OETA 1PQPA 5LDHA 1ULUA 3HB5X 3C7AA 4A03A 4UEJA 3WWYA 3GGOA 3PEFA 4ZQFA 3GC6A 3GDOA 1PTJA 3PQDA 4GWKA 3WJAA 1NVMB 2AQKA 2E49A 2FZEA 4XYEA 5GMOA 4AJ2A 3K92A 5JCJD 2DFVA 3CINA 1IE3A 2I6TA 4P8RA 2WYVA 1JU9A 4YDRA 4INAA 3GGPA 2A92A 3RUEA 3S2FA 3ZZNA 3FPCA 3O4RA 3TL2A 3MZ0A 3VPGA 5A05A 4OH1A 3ZV3A 4DVJA 4M1QA 1PL7A 4J91A 3RUIA 5K6AA 4WLVA 1K3TA 3PFWO 1GEGA 3PFFA 3RBVA 3S1LA 3LT0A 4KDEA 1QKIA 3CIFA 3I6IA 3GRKA 4E5MA 2OFPA 1R4NA 2PGDA 1DHRA 2CF5A 5IN5A 1XEAA 5K0ZA 1M2WA 2FR0A 5JMWA 3ZHXA 5THQA 1JKJA 4PZCA 5FFFA 2AE2A 4AJKA 5A3JA 1EVZA 2CDBA 1F14A 4EJMA 3C8MA 1Z74A 1I10A 3I9LA 3GDGA 1HDOA 1P1JA 4CLOB 1P33A 3O8QB 2DQ4A 2Q2QA 2BKAA 3RJ5A 1VL6A 2YZ7A 4XR9A 2AEMA 2ZB4A 4A0SA 1AXGA 2B4TO 2QRJA 4QO8A 1U1IA 4WOJA 2GZ3A 1ZW1A 2G0TA 3UXYA 3KTDA 5C37A 4OJNA 4YBZA 1ENPA 1ARZA 4IJVA 4B4OA 1I33A 2NV6A 2C5AA 2O3SA 4DMMA 3FTPA 3JYNA 3AOEA 4GSKA 5TRTA 3AUUA 1B15A 3CE6A 1I2ZA 3EHEA 1QMGA 4OOFA 4BKUA 3GNQA 3SLKA 5JY6A 3LYLA 4PLHA 4YJFB 4LCEA 2AHRA 5JO0A 1V35A 4NR0A 5BR7A 3VC7A 2AQHA 1HDCA 3RUAA 1GR0A 1ZCJA 4NJMA 4U5QA 5F1OA 1WDMA 1XLTA 1EUCA 5B4VA 4RQUA 3LT2A 3EDMA 1R6DA 5FWNA 3M1AA 4Z3DA 1EK5A 3FNEA 1T26A 5ER6A 3PWKA 3GDFA 2HLPA 3ORFA 1PX0A 4NJOA 2Q4EA 4ZQHA 5EIOA 4EI2A 5C5IA 5ICMA 1O95A 3DB2A 4LRTB 4WOKA 1JTVA 3ZW8A 3GMSA 4JLWA 3TDKA 4PLFA 3PYMA 1PGPA 3NJ8A 4RGBA 2BFPA 1NFQA 2X5OA 4CLEA 3ZWBA 3KEOA 3JQ7A 1JA9A 4N54A 1HWYA 4RVGA 3BMCA 1QLJA 2DAPA 2W4QA 1HKUA 3PQFA 4FJ0A 5CHEA 3LK7A 4IDAA 4I5GA 1QR6A 4FS3A 1HRDA 3L9XA 1PZHA 1PQWA 3G17A 3O9ZA 1XQ1A 3VTZA 2Y68A 4GL4A 3GEGA 5DT9A 1PR3A 2RBEA 2YUTA 8ADHA 3IQDB 4WLUA 5ENDA 4F6CA 2CF6A 1FK8A 2GERA 2O3RA 2PH5A 3WGGA 2VUSA 1DC4A 1YONA 2VHXA 3K6JA 4GKBA 4FC7A 2VT3A 3G3EA 2Y1CA 1ZEMA 3S55A 1XELA 1S7CA 1P45A 4JXKA 2GN9A 1HYEA 3P2OA 1LDMA 4LVCA 3BMNA 3HDYA 4A73A 3I52A 4DGSA 3OF2A 4CM4B 4FJ2A 3B70A 1HDXA 4IINA 1MXHA 1Y8QB 1EUDA 5DBGA 1X7HA 1F8GA 3JSAA 4RVDA 1MFZA 5IDQA 4ROSA 4TMFA 5FEUA 2D2IA 4ZGWA 1P1RA 3CKYA 4IDGA 3RU9A 5IZ4A 2NU8A 1AHIA 1JDJA 3W6UA 1LLQA 3RKUA 4R9SA 1H94A 5L95A 3TOZA 2H9IA 4GQAA 4BNNA 1LJ8A 3OIDA 1RJWA 1XWFA 1H9BA 3ITDA 1LU9A 3I23A 4D43A 1DBVO 2O4CA 2DLDA 3BMQB 3H9JA 1KEPA 2Q99A 1NR7A 1T2DA 2PZJA 1C0KA 4II3A 2DUWA 4NPCA 5AXCA 5KJEA 4C7JA 1DIGA 1CF2O 1YO6A 1QV6A 4PZDA 3HE3A 4BUCA 1SZJG 3HSKA 3QA9A 4R5HA 5JDIA 4JJIA 1D1TA 4Y9DA 5I9LA 3DBLA 4FQ8A 2C82A 1LDYA 5GZ6A 1YOVA 3ADOA 4IY1A 3S2IA 3EVTA 5CDUA 3GMDA 5T5QA 4IUYA 5COQA 5IJZA 4I5FA 5TJ9A 1R0KA 2NACA 3OEWA 1FDUA 2O3QA 1NYTA 2V65A 1I3NA 4ALNA 1E5LA 2GZ2A 1B2LA 3GVCA 3FWNA 4WPGA 3PXXA 4ALJA 1O8CA 3FNHA 4JNKA 4X54A 5DN9A 2AE1A 2CY0A 4XGNA 3U0BA 2HQ1A 1DEHA 1HTBA 4IQGA 4L75A 3RD5A 3AOGA 3R1IA 1ZVMA 3DTYA 4GMFA 3E82A 4M49A 2EGGA 1YQDA 2EKQA 3NTQA 2ZQZA 4J1QA 3SJ7A 2QX7A 2VRCA 4BL5A 4RPHA 4BV8A 4D0RA 4O6VA 2Y0EA 4S1VA 1UDBA 3L4SO 2NM0A 3AY6A 1A27A 2H63A 4YJHB 5A9RA 3GY0A 3RBZA 4DIFA 1E5QA 2O7SA 1NQTA 4E5KA 3K30A 1XIVA 4XCVA 3NEPX 8LDHA 2R00C 5IDYA 4BKOA 4E33A 4Q39A 2NU6A 5DF1A 4L9RA 1LLUA 1UAYA 4JP3A 1ISMA 3VZRA 3K5PA 3AI2A 2A35A 3RIHA 3A28A 3E9MA 3GGGA 1UZMA 3WR5A 4E4YA 3F4LA 4BNYA 4M89A 3ETEA 4G5HA 1DO8A 3P2YA 1PWXA 2ET6A 3VDRA 3ZWYA 3LT1A 3DHNA 4CQLB 2XAAA 4CMCA 5KVSA 2X9VA 4QSMA 1QYCA 2HO5A 3KLPX 1ZJZA 1I01A 1GV1A 4R9RA 1ONNA 1NQAO 3NT4A 3CZMA 5CG2A 3TZQA 1W73A 2QIOA 1IYZA 5F3RA 2EF1A 4DTIA 4WE3A 3CH6A 3ANMA 1F06A 1N9GB 3IKVA 3NAQA 4WNIA 2IEBA 1GY8A 5I7SA 1I32A 4W9NA 2B5WA 4E32A 1ZXBA 1LQUA 4BNKA 2DTXA 4OOEA 1Q0QA 5JAQA 4YJGA 2IYOA 3QLJA 3SXPA 4DPMA 3DFZA 4DUPA 2GN8A 4BO5A 3GPIA 4PG5A 3RI3A 3OJOA 5BSEA 1PJ2A 4MP3A 5F21A 3N58A 4U0KA 3IMFA 3F1LA 1MA0A 3QVOA 3F5QA 2IEDA 1JAYA 1E1KA 2C54A 2DM6A 4MIYA 2GNAA 1VC2A 4MVJI 3ZV6A 4DLBA 4UVIA 4EYEA 4PLVA 1E7WA 2UDPA 1MG5A 4D3FA 3EGOA 3I3OA 2Q1WA 1IL0A 2Q3EA 3WNQA 2IE0A 4J2HA 5KJ1A 1Y5MA 4TKMA 6ADHA 3ONDA 4EUFA 3GG2A 4RV9A 3JQ8B 4OO3A 4FN4A 4IZIA 2PK3A 3V5NA 4BNLA 2JFHA 4D46A 5HTOA 4DC0A 4NI5A 4ID9A 3ZWCA 2VHYA 4CQMD 2JHFA 1ADGA 1KVRA 3KM0A 1JQBA 1UAGA 1E92A 3LSYA 3TL3A 3CXRA 4LSMA 1WXDA 1E77A 1EK6A 5L4NA 2GO1A 3ZCXA 4O1MA 4IS3A 1YJQA 5AQ1A 5EJ2A 1H6CA 2WYUA 3QWIA 1MC5A 2WEKA 4OKNA 2WTBA 3FR7A 4QTZA 2HCTA 3F4BA 1DIBA 3KXDA 3NJ4A 2CNBA 3W8DA 1E1MA 1NHGA 1R12A 4WUVA 5H82A 1HZZA 4YJFA 3W4JA 3OECA 1NQ5A 1P0FA 1JWBB 1OAAA 3M2TA 4Q3DA 3Q11A 4DRYA 1U5AA 2B4RO 4XRGA 5H81A 4CLDA 1TXGA 1KEVA 3KB6A 3LVFO 4IQ0A 4G65A 1NX6A 2CUKA 3PYLA 4TRNA 3C1TA 3WYEA 1IY8A 3DHYA 5IG2A 2OORA 4R54A 3ST7A 5IDWA 4Z0TA 3ZWVA 3D3WB 1X1EA 3WYBA 5EPOA 1ID1A 1IHXA 4FGSA 2JCVA 4UVEA 3NKLA 4DXHA 3ENKA 2EW2A 2I9PA 3LF2A 4NU6A 1XQ6A 1JAXA 2FSVA 3NYWA 1U3VA 3BMCB 1DRVA 4F6LA 2RH8A 5DP2A 1JLLA 2DBRA 4CM6A 3INRA 5ITWA 5CEEA 4FFLA 1GUFA 3DXFA 1H6DA 4K9DA 4PG7A 2D0IA 2O23A 3OH8A 2D8AA 5THKA 4D7AA 2GPTA 4WCFA 4ND1A 1CJCA 1T2AA 2Q50A 4PN3A 1Q7BA 3GEMA 4NBUA 2NVUA 4QUKA 1KIFA 4PVCA 3GPDG 3JYQA 3PP8A 3TFOA 4MP6A 3RKRA 3X2EA 4R69A 2ZIZA 4IM7A 3BHMA 1PQUA 3JQ7B 2WD8A 1JVBA 2JCYA 3LZ6A 1J49A 3V1UA 2O7QA 2WWRA 3ZU5A 1EBUA 3OBBA 1KOLA 2OL4A 1VSUA 1PEDA 1EVYA 1CRWG 4HXYA 3LU1A 3DBHB 1HE5A 3ZHZA 4NBTA 3WQQA 3DBVO 1U2GA 3DZJA 2GDZA 3SVTA 3VTFA 4BS9A 4EUHA 5JS6A 1FJHA 4R1UA 5C7OO 5CFZA 1TA4A 4IDFA 2QQ5A 1PGNA 3AUSA 2IODA 2VWPA 1BTOA 1ZNQO 2OBNA 1PJBA 1V3VA 1VL0A 3CMMA 4O0LA 4KUHA 4DL9A 5KIAA 2Q2VA 5JY1A 1PL8A 3KO8A 2G17A 4HY3A 1L1FA 2HMUA 3WYCA 2OZPA 2VZ0A 5A9SA 1R16A 1LRJA 2I3AA 2ZYGA 3ZH2A 1P1HA 3GVIA 5GZ3A 2SCUA 4CMGA 4BNHA 3FNGA 5G2OA 3WTBA 3GH3A 4RZIA 4NMHA 1LEHA 4K6CA 3W1VA 1GL3A 5DOZA 5TC4A 3SX2A 1U3UA 1ENOA 4E21A 1L7DA 1DAOA 1ZKMA 3PJDA 2HAEA 1IPEA 1E1LA 1VLLA 4J43A 3GLQA 1T4BA 1GCOA 3DMYA 3P19A 1ORRA 2FMUA 4GVLA 1O5IA 2LDXA 2Y05A 1LX6A 4QXMA 4TSKA 4AJOA 4F3YA 2Y1FA 1B14A 3L6EA 1DIAA 1U2DA 2PLAA 2O4UX 3Q3CA 3EC7A 4MKZA 1JVSA 3PIDA 1C1XA 3D5QA 3R0IA 1TB4A 3KYCB 3UH1A 2OOSA 1CQIA 4L73A 4XEHA 1N1GA 2RH4A 3K96A 4LK3A 2IXAA 1WMAA 2B35A 2BHLA 1LDNA 4Y6RA 4R1SA 2FN7A 3GUCA 4Z3KA 1X0XA 2B0JA 2DFDA 3PJFA 4MDHA 4HV4A 5CDYA 1A5ZA 1X14A 3ICCA 1DB3A 2AXQA 2DBVO 3TNLA 5BNFA 2HJRA 3VOSA 3U3XA 5BT9A 4CPDA 4CUZA 1I24A 1XKQA 3ULKA 2JCXA 5JAZA 1IUKA 1Q0LA 2Q2WA 4YR9A 2VTDA 3WG9A 3ETGA 1CYDA 4GLLA 3B6ZA 1NPDA 1XG5A 4QQRA 5LDGA 4Y98A 4YVFA 1H5QA 1Y6JA 2B83A 3HZZA 2QZ9A 3AUAA 4R41A 1C1DB 1YRLA 5CEJA 4AICA 3GEDA 4QFCA 3FD8A 3NT5A 5BNTA 3K2BA 1SOWA 3V2UA 4XQCA 1ZMOA 3QSGA 1HYHA 3FN4A 3KYDB 1QV7A 5KCZA 3SC6A 4CUJA 3ASVA 4BO2A 1LLCA 3WWZA 3OQ6A 4AJPA 1VRWA 4PG6A 3I1JA 2B69A 4JP2A 3ETDA 4J6FA 1NAIA 4YJGB 1T1SA 4ZN6A 4H16A 4DPLA 2VOEA 1Y8RA 1RM3A 2XPCA 2ZQYA 3C7DB 4KTTE 2YY7A 4Y8VA 4BQPA 1N9GA 2Z1MA 1ZSNA 2FSSA 4IDDA 3Q9UA 3AY7A 3BXXA 4WJZA 1Y7TA 1R0SA 5AXBA 2RHRA 3QVTA 4E3ZA 1EMDA 3T7EA 1DFGA 1BSVA 2ZTVA 2VNAA 4TRRA 2F00A 4ALKA 1LBEA 3OEYA 4P22A 2BGLA 2C2YA 2UUOA 3PHLA 1ML3A 4XQGA 3WTCA 5A5EA 3E8XA 4OHUA 1ZZEA 3JTMA 3K9QO 3D0OA 4WLEA 3WGTA 1F0YA 4MIOA 5DZSA 9LDBA 3JD0A 1DOHA 1KBZA 3QE3A 4PLGA 3IUPA 1KC3A 4M54A 2W90A 4FPXA 1L7EA 3AW9A 4BV9A 4YWJA 1M6WA 3QJ5A 1DC3A 2V6GA 1N7HA 5J23A 4XQEA 2P9CA 1FF9A 3D7LA 3JQ9C 3ZWAA 3QVWA 4FOSA 2DPHA 3X2FA 3U4HA 2A4KA 1J0XO 4CUKA 5L9AA 1ADCA 4IDEA 1M6HA 1MFPA 1U9JA 2Q4BA 2GASA 3Q6IA 4CM8B 3FPLA 1FXSA 1O89A 4ZD6A 4TWRA 2ZKLA 4FR5A 2UYYA 5TS3A 3A4VA 1YDWA 3K31A 5DULA 5G0SA 4RVUA 2E6UX 1GYRA 3ZI0A 2JAPA 1GUZA 3AOEC 4R51A 1YB5A 4PLZA 4ESOA 2IXBA 3VDQA 5TGDA 1MGOA 3JV7A 1E3IA 1MLDA 3H3JA 3TZKA 4AJNA 4BNVA 4N5NA 3GR6A 1YGYA 5U4QA 1WDKA 3TF5A 1Y1PA 3L77A 1VM6A 3D3WA 3UGKA 4DIOA 1P3DA 3GVXA 2X23A 1KVQA 1QG6A 3VH2A 1ADBA 2I5PO 3UN1A 5IAAA 2NU7A 1EBFA 3UF0A 4II2A 4H3VA 2FZWA 5B4UA 1GAEO 5G0UA 3GOHA 4RZHA 4OQZA 1Y9AA 3IAHA 3ZW9A 3PDUA 3DR3A 3PTZA 5BSFA 1PS0A 1UP6A 1UXKA 5TSDA 2J5RA 2PD3A 3ZNOA 5JSFA 4FFNA 3VHRA 4YB8A 3AI3A 3HUDA 5IXSA 3CEAA 3OM9A 4MINA 4IIVA 4B79A 3C3XA 4GX1A 1H6AA 1JKFA 1PWZA 4JK3A 1P1IA 5CDTA 1BRMA 2GRAA 2YW9A 3OSUA 4R5MA 3VVCA 3MJEA 3RUFA 2C2XA 4JJGA 1LDBA 4XA8A 5DBFA 4B3HA 1B0AA 1PU2A 4J3FA 4NU5A 3IS3A 4AJJA 4MVJA 4BGIA 5DCUA 3QVSA 3E18A 1KY5A 4NK4A 1KVTA 2Y1GA 3O38A 3BA1A 1R4NB 2HK9A 2VYVA 2W2KA 5JFOA 4YAKA 3JYLA 1M67A 4B8ZA 2QHXA 1A9ZA 1ZK4A 2J5KA 2P68A 3CTMA 4CODB 4PZEA 2NWQA 1DJNA 1R37A 1MG0A 5C7IO 5JXWA 5ICSA 2VUTA 2CDCA 2IDZA 2X8LA 4UULA 2G76A 4XYGA 3UUWA 1A4IA 1NM5A 3V1TC 1GCUA 1B3RA 4ND5A 1PZEA 4OXNA 3IC5A 5A06A 5C7LO 2PR2A 3P5SA 4CLRB 4GGOA 2B5VA 1PJSA 2NADA 2POQX 3IUSA 3WMWA 1RPNA 3ROMA 4BGVA 3I4FA 4QT0A 5CPBA 1EUZA 4GH5A 1CDOA 3HB4X 3O03A 1UDAA 2PD4A 2J3HA 3JQFC 4MVJE 1MP0A 2YFHA 4I1IA 3FNFA 4A2CA 3B20A 1UH5A 4AJEA 1T24A 3Q0EA 4BMVA 4P38A 4OXKA 1C0PA 1LRLA 2X7HA 4NFYA 2J6IA 4BVAA 1NVTA 5JAIA 3I9KA 4FFOA 4RCVA 4MVJP 3M2PA 3IOYA 1I2CA 1DLIA 4OM8A 1TEHA 1ZUD1 3IDSA 3LF1A 1QLHA 3PLRA 2NTJA 1B8PA 1E1NA 4HFJA 4OKIA 2NSDA 4CQMA 4PVDA 2X22A 4IBOA 1YB4A 5L7YA 4HP8A 3G79A 3VKVA 4UUNA 5GZ1A 1E3EA 4N7RA 2QZZA 3LDHA 2O48X 1JN0A 2RAFA 2ZTUA 1H2BA 1PZGA 7ADHA 4L4SA 4UUOA 4BNTA 5T64A 2NVBA 1LC0A 2HUNA 1M66A 3HQ4O 1HE3A 4PIVA 2JKVA 3OJLA 4XYLA 4YPOA 1Y8QA 4RVFA 5KJCA 3VZPA 2BFOA 3D5TA 2X58A 4P4GA 3WXBA 2YQ4A 4GAEA 1LSUA 1ENZA 2NVWA 3GZ4A 2IZ0A 4RO0A 3KHUA 4XZ3A 3RSHA 3JQEA 1A4UA 3RC1A 3AU8A 4J0FA 4ZRMA 5L7WA 5TNXA 5C3MA 1O6ZA 4CMEA 1H2HA 1SNYA 5JCJA 2R00A 2B37A 2PY6A 4B3JA 4YXFA 2ZJ0A 1I3MA 3C85A 4UUPA 3ADPA 3ABIA 5JLAA 1D3AA 1NTOA 3ZWOA 4AJ4A 4PG4A 1GDHA 2QYTA 3DHEA 5L4SA 3IKTA 5DDIP 1FMCA 2EXXA 4EW6A 3V2GA 4M86A 3WGZA 1GQ2A 2EG9A 1MC4A 2P4QA 4WEQA 4XDZA 1UXHA 3DONA 4IDCA 4XWYA 3OJ0A 1SO8A 2P9EA 1U7TA 4PLYA 1K0UA 4BO1A 4RLSA 1Y8RB 5JC1A 3PRJA 4FW8A 4TRMA 3S2GA 1Y9EA 2AQIA 3H9QA 2HK8A 4CMKA 4EBFA 2HMTA 4NHEA 5H83A 2P5UA 4OYRA 1IHYA 2X1HA 4MP8A 3KZVA 4KUGA 3N7UA 4DLAA 5U1PA 4IMPA 4YRBA 4AVYA 4IGFA 2H6EA 3MOGA 4CMAA 5JDCA 2AG5A 3GA0A 4ND2A 1GZ6A 3A1NA 4D3DA 4EJ6A 2VYNA 2BLLA 2HDHA 3UKOA 1NPTO 4B7XA 4CMIB 2EERA 2CVQA 3Q2KA 4IJUA 1NQOA 4JQCA 4KOAA 3ZU2A 5JAMA 3L4BC 4XR4A 1K6XA 3W6ZA 1B3BA 4TQGA 3TOXA 1NWCA 5A4DA 3GAFA 2JJYA 4AJIA 1LQTA 1LI4A 4AG3A 1YDEA 1GUYA 1M75A 3ROKA 3PJGA 2NUAA 1DIHA 3RBXA 2HMVA 4L4RA 3CMCO 2VZ8A 2OP1A 4JCOA 4BMSA 3HJAA 3WIDA 3ONEA 2C59A 1RWBA 4J2OA 5T57A 3TJRA 1DRWA 5BSHA 2GR9A 4WKGA 2HKIA 1C3VA 4E2YA 4ZRNA 2ZTMA 3F47A 2HRZA 3JQGA 1IULA 2D59A 3UAGA 4R3NA 2DPGA 4HFMA 3BTVA 3C1OA 1P9LA 2DVMA 3GN2A 2JAHA 2GUGA 1HLPA 2Z1NA 2VWQA 4D42A 1WP4A 2DUUA 4ZHSA 1UZLA 1E3JA 1GQYA 3A9WA 1VJTA 1X7GA 4Q3AA 1WZIA 3LC2O 4UUMA 2G5CA 2PGJA 4WECA 1WZEA 1DIRA 1ZEJA 5COAA 4PCVA 2BFAA 2ZCVA 4S3MA 4M8SA 2C29D 4OIMA 4JBIA 4TVOA 4DREA 3VPXA 1N2SA 2BH9A 3RC9A 3GG9A 1GQQA 4PLPA 4RL6A 3BZUA 4RQTA 4ZJUA 4I9NA 2VCYA 4CV3A 4EEXA 3KSDO 2GN6A 3JQAD 4O5OA 4UVDA 5F1KA 3QWFA 3U09A 3VVBA 3HN2A 4YYZA 1IOLA 4FFPA 5CEFA 4IIUA 3D4PA 3MJ4A 1VJ1A 5FI3A 4BOYA 3DQPA 5L7TA 2D5CA 1YQGA 5CPFA 4OSOA 5I8WA 1UR5A 4GX5A 5U9CA 1B8VA 1QP8A 2VYVD 3Q1LA 4E13A 4NFHA 2PZLA 1P77A 1EVIA 5A3VA 3D64A 1E6WA 4BNMA 2VZ9A 2JFFA 3Q2IA 5IXYA 2WJPA 2E82A 2VN8A 4K28A 1ZK1A 3LC1O 1P1FA 5G4KB 1B16A 4HUJA 2V7PA 5G4LA 2IRWA 1EFKA 1GPJA 3T4XA 3WX0A 4Z0HO 2DT5A 4CLRA 2RIRA 4C4OA 3V2HA 2ZB8A 3T7CA 5I9NA 3JQGB 5LCXA 1LLDA 3DBRA 5A9TA 1I3KA 3BAZA 3N74A 1EE2A 4W82A 3UOGA 5CDGA 1DC5A 4UAGA 1BWSA 4KQWA 3GFGA 5B1YA 4BB5A 1J4AA 4FJ1A 1YVEI 2AW5A 3AWDA 1LSJA 5JDCC 1OI7A 1GZ4A 1IZ9A 4JJFA 3BMNB 4ND3A 1RYEA 1V6AA 3AFNA 1EQUA 4ZICA 4UVHA 3GZNA 3T4EA 1Z7EA 3G1TA 1AHHA 3DOCA 5IFLA 1SC6A 4KUEA 1WW8A 1PGOA 4IGEA 2VQ3A 2P5YA 1ZK3A 1XU7A 4HFRA 3U9LA 1DSSG 2F1KA 4J1NA 3RUHA 3NDRA 4GX0A 3WJ7A 3WGOA 1D7OA 1E6EA 2BFMA 1AN9A 1HDRA 4I08A 1ZK0A 2GSDA 4FSHA 3ZWMA 4BNXA 4RPKA 1WWKA 4MPDA 3QWAA 2HMWA 3OJEA 3WLEA 5JBIA 4W99A 2B4QA 1NR1A 3TRIA 1XCBA 2YHIA 3F1KA 3S8MA 3E1KA 1HDZA 1V8BA 4RDIA 5EERA 5EESA 4R4JA 2Q1UA 4B7CA 1EEHA 1MXFA 3AU9A 3EAGA 1DPGA 3WQSB 3OA0A 2D3TA 1DHTA 4L0QA 1G1AA 5TLSA 3ZWPA 2Y66A 3OA2A 4Q3BA 3RU7A 2PZKA 4LCJA 3U4DA 5KVVA 3ASUA 3FR8A 1YB1A 3LQFA 3U4CA 3I83A 4FIZA 1NFRA 5HA5A 3MTJA 2GYYA 4J7XA 2CMDA 3HADA 4GKVA 4J90A 1BG6A 4J0EA 3I9MA 3AM3A 4E5YA 2EWMA 4R3WA 4W7IA 1HDGO 1U8XX 4MVJM 4WGGA 1LTHR 3UCFA 5B4TA 2YDYA 1T2FA 3H5NA 3RCBA 2XXJA 1B7GO 1EVJA 4Z9FA 4YT4A 4WCFB 1RYDA 2VHWA 4KWIA 3DBRB 3JD1A 2A94A 3JQ9A 4I9HA 4IXTA 5ER9A 1DFHA 2J3JA 5KVCA 2CDAA 3TFQA 1PS9A 3RASA 4EITA 5A9SB 4DBZA 3MJCA 3NX4A 3AY3A 3V8BA 4CV1A 1HLDA 5EQFA 5ILOA 2J3KA 1WPQA 2VRBA 3TPCA 1WAMA 3PZBA 1V3TA 1LNQA 4YAEA 5CG1A 3JQCA 1EZ4A 1JWAB 2IZZA 3TWOA 3F3SA 3H7AA 2HU2A 4W9NC 2PFGA 1H0KA 3E9QA 3MJVA 4M55A 4RORA 5IN4A 1WLYA 3E48A 3H2SA 4M87A 5KKAA 2WE7A 3NV9A 3EZLA 4LN1A 4QX6A 4E2XA 1R4MB 4PLTA 5K9ZA 1LSOA 4WLFA 2WMDA 2W2LD 2WDZA 3L9WA 3R3SA 1LSSA 3VH1A 1YKFA 3OQ1A 4JBGA 3KRTA 3WICA 3W4IA 2HJSA 2Y67A 1N7GA 2UV8A 3ICPA 1E3WB 4XRRA 3SEFA 3DZFA 3BTSA 3EUWA 4DMLA 2EHDA 1Y5RA 1SMKA 1Z82A 1KETA 4U6SA 4CQLA 2GCGA 3QRWA 5ENVA 3MOIA 4BO6A 4RF4A 1Z75A 4J7CA 5AXDA 4FCCA 3ZV4A 1DAPA 3WFJA 1D1SA 4GLOA 1R0LA 4DBVO 2WSBA 3IJRA 3SJUA 5IDXA 2FPIA 3DC2A 3PDJA 1HETA 4A27A 1ONPA 2X5JO 4RLHA 4C7KA 4MVJG 1I0ZA 4JROA 2BGKA 2PKRA 3R3JA 3I6QA 2CSUA 1C0LA 1CIVA 3QHAA 3W4KA 2R6JA 4BNUA 1VKNA 1T25A 3OFSA 1C1XB 2Y99A 1BGVA 1C14A 4CMBA 5MDHA 3VH4A 4E5PA 4XGIA 1OMOA 1SEVA 2PNFA 1VJ0A 4RDHA 4YQZA 4DQVA 3ANNA 3QQPA 3D4OA 1ZBQA 5L3ZA 4ALMA 4J1SA 4DYVA 5T6BA 4NBVA 1QYWA 4RF5A 1OFGA 3DO5A 3OQBA 4D79A 3WS7A 3GHHA 5IZCC 1AGNA 1MV8A 2QW8A 4NBRA 3WSVA 2Y1EA 3DTTA 3RC2A 3PWSA 3WDSA 3VPFA 4CMHA 2ZTLA 3PI7A 2JL1A 2GN4A 2XOXA 3LLVA 1G6KA 2PGLA 1U28A 3QWHA 3L0DA 4MOWA 4AFNA 3UCEA 1SPXA 5L40A 3U49A 3E9NA 4AJHA 2HSDA 4L4XA 1GPDG 1PGQA 1X0VA 3GNSA 3M1LA 2YDXA 2C7GA 2X9NA 1UUFA 3KUXA 4XQ9A 1LA2A 3G49A 5HBRA 1ADFA 1P31A 4W6ZA 3PYXA 3NT2A 4QFDA 4MIEA 5A1TA 1ZXLA 3BIOA 5KVQA 4XKJA 3U62A 2GGSA 3AM4A 4WNCA 5LC1A 5JYEA 2DU8A 5B37A 3RQSA 2HRBA 3BMQA 4NBWA 2AQ8A 3FBTA 1IB6A 1Q0HA 4WCDA 2FR8A 2EGHA 4J9VA 4CM7A 1E3LA 3GT0A 3A06A 4TZKA 1ONOA 5T8KA 3R6DA 1YOVB 4RPLA 3VPHA 1N8KA 1PS8A 3V1YA 2NTVA 2Q49A 3DOJA 4YJDA 2EW8A 2PV7A 3GK3A 3K2EA 4DIBA 1TT5B 4EEZA 1PR9A 1EDOA 2Q45A 3PPIA 3JQ6A 5EN4A 2DBZA 4CM3A 4DLLA 5DBIA 5I7VA 2X0RA 3DEYX 4TROA 5G4KA 2AEJA 4CLHA 4BKRA 3QP9A 2UAGA 4J49A 2O2SA 3PQEA 5JMPA 3H9EO 1VSVA 1NPYA 1GU7A 1NFFA 2J8ZA 5BSGA 2VNSA 1Y81A 4PFJA 1CWUA 4CM1A 4MKRA 2X6TA 3O8QA 2X5KO 4J7UA 4BIIA 1P74A 3I9JA 1TLTA 5TT1A 3H9GA 5DNAA 1UDCA 1GFSA 1SB8A 4IDBA 3RJ9A 4CV0A 2PKQP 1QORA 1P0CA 3ITKA 3FSRA 1ZSVA 2I65A 2PZMA 2RHCA 3ZWXA 3AJRA 3AUTA 2CZCA 3E5RA 4NNJA 4WCFC 5ADHA 4BO3A 2DBQA 4D0SA 4Y6SA 4GPD1 1PJCA 1HT0A 2ZYAA 4ITUA 2PH3A 3C1AA 3L4BA 2OUIA 5COBA 4R1NA 1GYPA 6LDHA 4RVSA 4BKQA 4GWGA 1VKOA 3JYPA 5JC8A 2BD0A 4NG5A 1SOVA 2QYSA 1O9BA 4F45A 4CLOA 1NASA 1QYXA 5DCYA 2Z5LA 3KBOA 4U0JA 3K73O 4J4TA 1GEEA 4BNZA 4FD3A 1NBOA 3OICA 1YBMA 1BXZA 3VKUA 4LRSB 3UHAA 3IP3A 1U4OA 1I36A 1E3SA 4ILKA 3VH3A 1DFIA 3HFGA 4GMGA 3ZWNA 1XDWA 4XIJA 3UCXA 4MVJD 3H8VA 2GF2A 4F46A 1ZMTA 1O0SA 4P4NA 1K89A 1EDZA 1XSEA 2Q1TA 4RPGA 2EJWA 5TX7A 1RM5A 1DRUA 3OJFA 2BI8A 3BHIA 1NVGA 3RFVA 2Z95A 3WGYA 2X9GA 1A72A 1YS4A 1UZNA 3GVHA 1ISHA 3UW3A 4G81A 4D44A 1LDGA 2GD1O 1I3LA 5L53A 5KJ6A 2DC1A 4UREA 1I5RA 1W4ZA 3DAGA 3ZNQA 3FCOA 1PGJA 4CM5A 4J4HA 2ZK7A 3ROQA 4XJTA 1SBYA 5HS4A 4PRKA 4XJSA 4K6FA 1N1EA 1VE9A 4GVXA 4K26A 2O50A 5F5NA 2YHIB 4HNHA 1K6IA 5AVOA 3F6YA 3WMXA 4KWHA 3PHGA 2X86A 4NFSA 5CAEA 2VWHA 3NDIA 1GD1O 4BMNA 1BW9A 2NNLD 4OGWA 3GHYA 3JD2A 3NRCA 4UEKA 1KVUA 3JQ8A 3RWBA 4K1LA 1PJLA 4OL9A 3OMLA 2DTEA 1HE4A 2FPGA 3DOOA 3CSDA 5HM8A 3HG7A 3ZHBA 3TZ6A 1SCUA 3PLNA 1SEPA 5AYVA 4CM4A 2YJZA 3FRJA 1U3TA 2ZCUA 1DC6A 4ALIA 4BNIA 4CM9D 1VL8A 1LDEA 1Z6ZA 1V0JA 5FI5A 3JYOA 1I8TA 3DZIA 4NZ9A 1KYQA 1BDMA 4Z9YA 2Y0DA 1BVUA 3RFTA 3GVPA 1TVEA 1HE2A 5L45A 1OC4A 3BTUA 5KWEA 3EZYA 4DYDA 3FI9A 5DP1A 2A9FA 3JD3A 4IXWA 3I9NA 2G82A 3RFXA 3K8ZA 2JD2A 4G2NA 3SLGA 4BGUA 3LT4A 4IQ8A 4CR8A 1X1TA 3H65A 4HFNA 1XGKA 1CEQA 4DQUA 4GBJA 2QRKA 4XYBA 4AL4A 4LMPA 1JW9B 4J9UE 5I8ZA 3G1UA 4YRDA 3WFIA 5K6AC 4CJXA 2X4GA 3ZWWA 2Q1SA 4J16A 5I9MA 1YXMA 4A5OA 2TMGA 3ZNPA 3IJPA 1T2CA 2VWGA 4R16A 5EQDA 3MEQA 3EW7A 1WDLA 4GGPA 4YEDA 5A5FA 3E5MA 4BKPA 1ZIDA 2FRDA 1E7MA 1E3WA 2PA3A 4MO2A 5G0VA 4TRJA 3PHHA 1W6UA 1OZAA 2HMSA 1ZK2A 3E6AA 1E7QA 2NTNA 1Z73A 4WK6A 1DXYA 3JQBC 2EIHA 1LC3A 1NWHA 2FY8A 3OP4A 1PJQA 3FTNA 1BW9B 1D8AA 1ULSA 2EJVA 4IPTA 4RF2A 1D4FA 4JIGA 5FYDA 2YQ5A 3PGJA 4P4LA 1O94A 3INTA 2IZ1A 1XU9A 1BDBA 3MTGA 4Q3CA 4D45A 5JCXA 2AMFA 4HX5A 2D4AA 3W8FA 1YL7A 3H9UA 3B1KA 3QW2A 2GZ1A 2O3UA 3PZRA 3TZHA 3DDNA 4ALLA 2PKQO 4WASA 4D41A 4BNFA 5B12A 1CERA 4Z9XA 1OOEA 4UVGA 4BQRA 1T4DA 2HK7A 3CUKA 1ZJYA 2E4AA 3ENNA 3KETA 4E30A 3PHIA 1R66A 3U5TA 3CPSA 3RVDA 3DAPA 2ZYDA 3RUDA 5BQFA 4ZQBA 4XD2A 3BMOB 4H15A 1KEWA 1BXGB 4BO0A 2OP0A 1AE1A 3ZGYA 4AJ1A 3MJSA 1EE9A 1J6UA 1HSOA 2W8ZA 1KEUA 1PJ3A 1HXHA 3EVNA 4E12A 2BGMA 4LMRA 3JCZA 1X7DA 3GN1A 3KYBA 4PRLA 1A7KA 2X0NA 1Q7CA 1LRKA 4O59O 4D3SA 1I2BA 3B1JA 3P7MA 3WBBA 3GQVA 3HDHA 5TF4A 5JDIC 4JN6B 3HN7A 1GADO 2WD7B 4YCAA 3E03A 4EUEA 4FBGA 3EMKA 5TIIA 4MKXA 2J3IA 1J5PA 4O63O 2X0JA 4XIYA 5L4LA 4GSLA 1TT5A 3ZV5A 1RKXA 1PL6A 4DPKA 4FFRA 1B26A 5KNLA 2C07A 5EL0A 1HSZA 3BYZA 4B8WA 4WLNA 3WGQA 2I99A 2YV2A 3H5RA 2FWMX 4NK5A 4DC1A 4YAIA 5I7EA 4IZHA 4I5EA 2LDBA 4LW8A 3H5AA 5KOIA 3FF4A 3B1FA 4CMJA 3HDQA 2O3TA 4ONEA 3QIVA 2OBYA 5GY7A 1F17A 1F12A 4N5LA 3G0OA 4ZQEA 2D1YA 4I5DA 5HS6A 1YL6A 4URFA 5FF9A 1MX3A 2PD6A 3PIIA 4E2ZA 1YL5A 4BHTA 1I30A 4FDAA 1IZ0A 2R2GA 1HYGA 1YQXA 3Q9NA 1XR3A 3DMTA 3ZHYA 4E2WA 1K2WA 3WLFA 3ROPA 1RM0A 1VI2A 4JBHA 5TQVA 3L6DA 3F46A 4BO7A 2E48A 3DZGA 1E0DA 1OBFO 3JQAB 2JHGA 3HNPA 1G0OA 2VOJA 3OIGA 1PSDA 4MVJF 1LUAA 3HWRA 2P4HX 4UEOA 3WB9A 5JE8A 4I8XA 1YBVA 4XX0A 4EDFA 1C1DA 3EK2A 4BO9A 1HZJA 4KQXA 4QECA 5KJFA 1ZO8A 3KSUA 1U7HA 4N18A 4Z6KA 1PJTA 4E6PA 2ILTA 2ZB7A 1NP3A 1KERA 3ZNNA 3GFBA 4YAJA 1ISGA 5DOVA 2DTDA 4NIMA 1CETA 4YRAA 1WVGA 4U6QA 5JNLA 3AFMA 3I5MA 3I4CA 3JQDA 3PWZA 1UP4A 3WIEA 4ZA2A 2VYND 2G1UA 2VHVA 1YH3A 3NGXA 2BMAA 5G0TA 4CR6A 4Z0PA 3ZU3A 2VTEA 5MGBA 5ILGA 2FP4A 5JPIA 1QXSA 1OC2A 2VHZA 2VRCD 2VT2A 4J1TA 1Q7GA 1GYQA 4CL8A 3F5SA 3H3FA 2CVZA 3HDJA 3QV1A 1X15A 4R01A 3TZCA 1G0NA 2EEZA 7MDHA 4HWKA 4OQYA 2NQ8A 5A04A 4L74A 2D5AA 2PWZA 2V6MA 1A9YA 3MWDB 4DQXA 4WLOA 2JD1A 4CQMB 3FBGA 1A71A 4XGKA 3KLMX 4KDFA 4YT8A 3FWZA 2JD0A 1Z45A 5EINA 3OIFA 3S2EA 1GV0A 1BHSA 4CM9A 1SB9A 3DL2A 3H2ZA 3LLSA 4B3IA 3UFXA 2UUPA 4ND4A 3ZN2A 4PGFA 3W8EA 1WMBA 1V3UA 2B36A 3NGLA 3NDJA 1GZ3A 5AXAA 2NVUB 4DA9A 4JGBA 1XHLA 3M6IA 4RF3A 4TZTA 4OAQA 2XF8A 1NAHA 2I67A 1FDTA 2NQTA 3DBHA 1HF3A 2WYWA 4U7WA 2YHUA 3H6KA 3WOHA 3JD4A 4PG8A 4KP7A 2XXBA 3PGXA 4CM8A 4HNGA 1IPFA 2VUUA 1ZSYA 4MVJH 3D1LA 2UVDA 2QRLA 2QG4A 2I3GA 1T1RA 4XYMA 4YACA 1PJ4A 1YWGO 4RPJA 3GNTA 4J4BA 4R68A 1YJ8A 1H6BA 4QEDA 4E0BA 2CD9A 1KC1A 2PTGA 4BNJA 1UP7A 3SC4A 1N5DA 3QWBA 4BGEA 1UXJA 5G0WA 3L07A 3O26A 3COSA 4L8VA 3F9IA 1A7AA 2ZATA 4Y6PA 2Q46A 2NU9A 1SAYA 1E6UA 3RUCA 3VAZA 4B4VA 1CQJA 1NNUA 5ITVA 4QO7A 2IYPA 2Y0CA 4YT5A 5ES3A 1X13A 4L76A 2ZB3A 1Q1NA 2Y93A 3GZNB 5EMHA 1U8FO 1VPDA 2I76A 1EFLA 1QYDA 2AEFA 5I7FA 3GUYA 2EKPA 4KTVE 4W4TA 4CR7A 3UICA 1JKIA 2OO5A 4I9UA 4NJMB 3PHJA 5TT0A 1Q2XA 5A03A 5TJHA 2CFCA 3A14A 3WNVA 4GI2A 4HBGA 2RCYA 1K5HA 1UXGA 1BMDA 2OXIA 3TN7A 4CMEC 1FDSA 4N5MA 1V9LA 3INGA 1P1KA 2DKNA 1K6JA 5T8KC 3MJTA 1Z7BA 4XB2A 1HEUA 3BHJA 4B7UA 2EV9A 3ONFA 2WM3A 4FOOA 2O2YA 4CMIA 3H4VA 2TMDA 4XDYA 4WEOA 4AJLA 2J5QA 3QVXA 2W2KB 3GAZA 3ZU4A 3AM5A 1DJQA 5HWSA 3DWFA 1E7RA 1KY4A 1E7YA 1W0CA 3KEQA 2P9GA 5F1PA 4EGFA 2OHXA 3DZHA 2BI7A 1S6YA 2P91A 1W8DA 3JQFA 1QYVA 4YTEA 3UVEA 1QSGA 4KZPA 4LISA 3BMOA 3PJEA 1ISIA 4BO4A 4XB1A 1UXIA 5CP8A 4U8GA 1U4SA 3GF4A 2EP5A 1AXEA 1HL3A 1C0IA 4IJWA 2YYYA 1YE3A 3IL2A 1ISFA 2V6FA 3KYCA 2FHSA 4LVUA 3VZSA 4CLXA 3HFSA 1LXCA 2FPPA 1TT7A 3STHA 4BNGA 3PVZA 1XA0A 4YA6A 5AOVA 2OMEA 1HDYA 3IP1A
chains in the Genus database with same CATH superfamily
3KOUA 2YZKA 1NVEA 5IZCA 4EYGA 4KMSA 1KS9A 4YDQA 4C0HA 5CDSA 4ZQGA 4MJLA 3ZE1B 1HQCA 3GRPA 2A67A 3C7CB 4TTVA 5F5LA 4L0CA 1N92A 1TW3A 4DWWA 2NZXA 3CZRA 3DFUA 1FBTA 2BSXA 1NW5A 1GTL1 1I0LA 3EFHA 2EEPA 3IIEA 1ZA2A 3K20A 4RJTA 5KREA 1NSFA 2Y1DA 4QYXA 2JFBA 4B85A 2C4MA 4Q3EA 4GXNA 4OP2A 1OFUX 2P8SA 2R7NA 2WE8A 5DO9A 2HMYB 4DCJA 4D26A 1ZRNA 4A7PA 4CEJA 3BKXA 1BS9A 1JQ3A 3L6OO 1C80A 1AF7A 3MT7A 4OXYA 3RJTA 4BV3A 3OIUA 4CCSA 3H4MA 4YAGA 5KOYA 3WAKA 3ZBUA 5EHNA 3EB9A 1HX7A 2BEUB 3LC7O 1H9AA 3DYIA 1N6HA 1E2FA 1U3DA 2V58A 2V7BA 3DEIA 5CJ2A 9LDTA 2BELA 1E6MA 1N5OX 3EZNA 2IYTA 5ALUA 4WZBA 5ALLA 2AFVA 3FYDA 4CKXA 2FZCA 3RHTA 4JLUA 4Y67A 4LYGA 1XTIA 2HZBA 4NH4A 4ZVVA 2WI8A 4PYLA 3UAXA 5JOQA 3ICEA 1MU0A 3GA7A 3QEBZ 1QIMA 1FDWA 2AA3A 5FWDA 1XJCA 1UJ2A 2VF5X 3A3KA 3QLTA 4M53A 2FW6A 4PGHA 2I4NA 5LNK6 1MJHA 1MRNA 5FQOA 1L5FA 2ATCA 3GLVA 5IUKC 4ASUA 5JZMA 3T1HB 3NHMA 1MORA 3D9QX 2JIQA 4HAIA 4CCWA 2GKGA 1JYSA 4FHCA 1USIA 3OZGA 1DPFA 2QN3A 1YOBA 3A2NA 3UT5A 4EPRA 5KOJA 1MT0A 3DDOA 3NUGA 5E2AA 3C1UA 1MAAA 2YFYA 3KUUA 4PLWA 2V6BA 3RT7A 1AKUA 3ZYCA 2ZI7A 2WZBA 3SICE 5EYPA 2BRUA 3C3CA 3GCWA 1XMIA 1NXQA 2G1JA 2P9FA 3EYWA 2I2DA 1KNXA 3BTOA 3WRWA 2A2ZA 2C5EA 2B61A 1T6BY 4EJSA 1U5CA 1ZYUA 3LBIA 1T2VA 1MC1A 1YBAA 4J0HA 3JY6A 2JEOA 2PUTA 2Z0MA 4Q1CA 5IF3A 3HP4A 4DCOA 3R8XA 3JARA 2EP8A 1U9YA 1FPQA 3RC7A 5A7FA 1XRJA 1JIKA 4IMRA 3QOWA 3VZQA 4QOEA 5E9QA 4CEHB 4Z2AA 2XE4A 3L8EA 1E3MA 1H93A 4RSRA 1Z56C 4NYJR 5CDHA 2BBWA 2VL7A 1PZFA 4KQIA 4WNAA 3DL0A 5KNDA 3PF8A 1EPUA 1T2EA 3D5EA 3GFOA 3D4NA 4JX8A 3WYNA 2APJA 4NEQA 4UDXX 4IH9A 5A0TA 1IZYA 4PZYA 2MYUA 2P3LA 3EMDA 4XM2A 2H54A 4ARUA 4CV2A 3IBGA 1XCLA 3UPDA 4IS2A 3AIMA 3O47A 4CL0A 5I4KA 1E89A 2RGBA 2GEBA 3KSZO 1KJ8A 4IO0A 4P7BA 4POAA 4ECEA 2AX3A 3DV0B 3OETA 2POCA 3BFVA 3P9XA 4ESVA 1GRCA 3HB5X 4F97A 4PRYA 2D13A 1GSHA 2OHJA 1FA9A 3ZY2A 4R84A 5IUJC 2NPIA 3GGOA 3PEFA 3QUTA 4ZQFA 3X1ZA 1Z17A 3E5HA 4GM0A 4YONB 4B2YA 5JNTA 2GA8A 2OCPA 3WJAA 4OPMA 2OHOA 4H7KA 2W6CX 4WH0A 2LVBA 2AOUB 2AQKA 4FHEA 1A8HA 4XE5A 4OLAA 4XYEA 4JI0B 3TQCA 1UZUA 2NP6A 1NBIA 3UBTA 4Q37A 3ZJUA 5C5EA 1SM4A 4ZANA 5BR1A 5JJBA 2OCXA 2E1PA 1RWKA 5EIFA 1T6XA 4INAA 3VPAA 2A92A 3S2FA 4EECA 3TL2A 1I7NA 1ZOPA 3MCAA 4LOLA 3ZE8A 5ESDA 4K6MA 2W22A 4QJBA 4PFQA 5A05A 3UHJA 1O54A 4M1QA 1XNRB 5CXXA 3B6EA 1T3SA 5AW2A 3PFWO 1GEGA 3PFFA 3S1LA 3FKSD 3LT0A 4X6YA 1LZKA 2P9YA 2O8BA 2IPAB 4FSDA 4NOMA 4E5MA 5LD2B 2OFPA 4I4TA 4MV4A 3KQUA 3I9V6 1DHRA 3B9PA 4GT1A 4Y6LA 3CN9A 3CCFA 3EULA 4E1AA 3S4YA 4HLUC 3QJYA 2DCMA 2AE2A 2RHDA 4HWSA 4AJKA 4Z54A 3T8YA 3FGZA 1EVZA 1N1MA 4S12A 4YV7A 2FSGA 1K75A 4M83A 1O4WA 2C9YA 2Q4DA 2V3WA 3I9LA 3U3MA 3BJMA 3OT4A 4UCFA 1AZSC 2WYIA 4M7OA 1QS0A 3V7YA 5MGNA 4FU0A 1SCIA 1MEJA 1P9RA 3Q3IA 1H4VB 1IEQA 3RJ5A 1VL6A 5B6PA 3FB1A 1GL9B 3LWBA 4EB8A 2C3MA 2JGEA 3K70C 4OHZA 4QO8A 3OOJA 3UJ3X 3Q87B 3M4ZA 3IB3A 4FIDA 1NZDA 1W44A 3MXOA 4K3UA 4BZPA 1I6WA 4WOJA 4I55A 2IZ6A 4XFJA 2YX1A 4BVLA 3UXYA 2FEKA 1JKMA 2H4JA 4KIFA 1YR3A 3SG0A 3E84A 3OTGA 5CIWA 2BFDA 4AZ0B 4LZOA 4REOA 1GZSA 8AT1A 2Z2IA 2JIDA 3PNLA 3RVOA 1QQTA 2Q5CA 3I6MA 4YUXA 1AA6A 4KB5A 2GYVA 2W6PA 4MUXA 1PR6A 3OU2A 2WUFA 3OAAD 2GCEA 5K3FA 2HXYA 1QMGA 1O6GA 3OMWA 1ZUIA 4OOFA 4P82A 1S01A 2V45A 3SLKA 1Y3AA 3LYLA 3R0ZA 1D4ZA 4QKQA 1RP1A 4DY4A 1AU9A 2YXLA 1A4RA 3TQTA 1OV4A 4HNUA 3HWX1 1HDCA 1NUHA 4NJMA 4Y9RA 4MS1A 5D3KA 3BB3A 3NHBA 3CRMA 1NX9A 5F1OA 1FC0A 1HA3A 1EUCA 2EJCA 2GN2A 2QN1A 4BVKA 4UFPA 5B4VA 3EDMA 3BT7A 1F3OA 2VYFA 4PTLA 4CGYA 3O74A 3OFJA 4RMJA 5GONF 5ER6A 5K8JB 1FXUA 1SQ6A 3HA5A 4IFBA 2HHAA 1H2XA 1M10A 2Q4EA 4YWHA 5C1PA 5C5IA 4CKCB 3DB2A 1SC4A 4YRLA 4I1SA 5EMNA 1MTZA 5TY0A 2C61A 3OLVA 2Q27A 2G7MC 2C4HA 1NJSA 4PLFA 2XF2A 1JEOA 4RTKA 3EPJA 3NJ8A 3PQ2A 4W5NA 2FPIB 1NFQA 1GG8A 2X5OA 2QM7A 1LI7A 1F0NA 2FA9A 1WXFA 3KJNA 3LJKA 4LQ4A 3IP6A 5T4HA 2ON6A 2HCBA 3W8RA 4N54A 2VJMB 4EL5A 4OREX 4ZTUB 4CL8A 3PQFA 1TO1E 4FJ0A 5AVUA 4OFBA 2QMQA 1V8ZA 3H05A 4DG8A 3CQ9A 1CZLA 3OT5A 2J32A 3G17A 3O9ZA 1GHTA 2HXSA 1RADA 3T54A 3UHPA 3WIUA 5IJWA 5KWJA 4GL4A 1NMSA 1KZHA 4RTPA 3B2EA 4AN0A 1OV6A 3VNAA 2RBEA 2L18A 8ADHA 1C3XA 3BRWA 4WLUA 1M7GA 2Q3JA 3I09A 5DX1A 4OB6A 1PLKA 1H1DA 4HAZA 1H2YA 1GQSA 3K0FB 3WGGA 1O8BA 2RHGB 5ITZA 5T3UA 2VHXA 4DVGA 4URVR 1PD1A 2RHWA 3FSGA 4MCJA 2O5CA 1DUIA 2Y1CA 2H85A 1ZEMA 4D9MA 2XNKA 1U6KA 3LHDA 1P45A 4MV5A 4JXKA 1X2BA 2SCUB 2XCOA 1WE2A 2FOLA 1FNDA 1R6UA 2H07A 3ILXA 4KN8A 4MAFA 2V8BA 1ZISA 2RJOA 1XNQB 1PSZA 1LGYA 5DGIA 4CM4B 4CG1A 2GRJA 3B70A 3O7WA 4JWKA 1NDQA 4KXLA 4ND8A 4FN5A 1MXHA 4YMGA 3E3LA 5DBGA 4I46A 4GRAA 5DNDA 4HB2A 1CLEA 5MFPA 5TV2A 4N0QA 5B1HA 2JHPA 3K53A 4R71A 1BXRA 5JAUA 1TL7C 2D2IA 3LO5A 3WWDA 2Q3MA 3W6UA 1IAQA 1LLQA 3SS7X 1HQDA 1J24A 1JLHA 2NP7A 4LYEA 1ZI6A 3GD7A 2CMHA 4QD3A 4RGQA 4ANFA 2B9EA 2H9IA 2IPXA 4BNNA 4EI9A 3E1SA 3RADC 3HRHA 4LHYA 1KOGA 3OIDA 5AI8A 1RJWA 2F3QA 1XWFA 3AUYA 4QE3A 1PZNA 1MENA 4QLOA 1EFTA 4TWBA 3I23A 3ZCSA 3TMYA 1DBVO 2O4CA 4LQCA 5F7JA 3IBYA 5J5AA 1TC2A 2XB9A 1X7ZA 2FPOA 1C0KA 3H5WA 2QKYA 4NPCA 5HCIA 1TAUA 1DWQA 1CF2O 4ZYVA 4I55F 3MC1A 2J0SA 4ZI7F 3HK2A 2QV7A 5KNBA 1VOTA 2WT8A 3HE3A 2FE4A 4MUAA 4P7GA 3IUJA 5JDIA 3KQYA 3WYFA 4QNMA 1J97A 3BOSA 1CTQA 4HQ6A 2A58A 5I9LA 1IN4A 1L6IA 4FQ8A 4M1WA 5GZ6A 4F7DA 2Z30A 1ZJ6A 3UKDA 2AN5A 3A1DA 1I6LA 1LKZA 1YULA 1JF8A 1K27A 1YDFA 1RRFA 2HNAA 2ACEA 1K8ZB 2JLUA 2H2WA 3HM9A 4LFAB 4OQQA 4EM6A 5T4BA 3V4RA 2NACA 2HN9A 3OEWA 2V65A 1DAEA 1WMSA 2JGDA 1I3NA 1AKMA 1YZUA 1JE0A 2HLNA 2BOVA 2G83A 2WM9B 2XB4A 2XDWA 3E22B 4UQPA 4PAOA 3VU0A 2WKRA 3VA7A 5C51B 1Y8CA 5ADWA 3T9AA 5T6MA 5EJ8A 1O8CA 1AUQA 3FCUB 4PYNA 4JLOA 4MKHA 4M6WB 1PZMA 3U0BA 1B73A 1PT5A 5AIBA 2Z58A 4IQGA 4X20B 2FVXA 4L75A 3RD5A 2HI0A 3U7HB 5GV8A 2NO9A 1UM9A 3SNKA 1NMQA 1RRKA 2EGGA 3R9WA 1GAXA 3OZCA 3NTQA 4J1QA 1BWRA 2N75A 4BL5A 2HPZA 2YOHA 4BV8A 3NVKI 1M5UA 2ID4A 3LVQE 3K8OE 3OO1A 1J0EA 1W2GA 3IAFA 4MV3A 1WUYA 4URHA 5HEKA 1OXTA 4O4HA 2H63A 1EA7A 2EZ4A 2BEJA 5A9RA 1HDEA 2XA1A 1CY4A 3ZD7A 1V6CA 3RC8A 3BFKA 2HT6A 4IG4A 5C35A 4FDLA 3SF0A 4L16A 5IPFA 3K30A 4K6KA 5ITZB 3WBKA 3JWGA 1QZTA 4E33A 3R76A 3CHYA 4HCJA 2NU6A 3QU7A 1M1YA 4Q39A 4L9RA 1OYVA 2K7ZA 1UAYA 2B20A 4JP3A 3REQA 1X7YB 4G8CA 3K5PA 3QTBA 4MEAA 5C9ZA 2BDUA 2J1LA 2D1TA 1J0DA 3H1BA 4DW8A 2ONZA 1JHPA 4EPYA 3ETEA 2HA6A 3KXPA 4YAOA 4EMUA 1T13A 4ISCA 1DO8A 3HVIA 2PZBA 1PWXA 1F2UA 3HJBA 3AJAA 4UPVA 5J59A 5LXTA 2RAPA 2VPYA 3DHNA 1L7AA 5C8XA 1UDWA 4FGZA 1FX0B 5K6RA 1XPOA 1Z5GA 3O2NA 3REFA 2BEVB 1MVNA 1OY1A 3X44A 3PXBA 4AMZA 1ZJZA 1GV1A 2JBWA 1ONNA 2XQIA 4TKUB 2NO5A 5EG5A 1IBLB 1GNSA 5FBZA 3TZQA 4J6EA 1IYZA 4MEBA 4Q21A 1B23P 3L1IA 4WE3A 1G42A 5DHPA 4D98A 3SJZA 1TTTA 1EDDA 3EFEA 2IEBA 3DLPX 1KK3A 3KKQA 4W9NA 4Z7QB 3OUTA 1ZXBA 3AJDA 1KZ9A 4O1IA 1WUKS 5JAQA 4HB0A 1N2CA 4YJGA 3SXPA 1ZN2A 3G02A 3MMXA 3DFZA 3ZUPA 4Q9DA 2WA2A 4P3KA 3LXUX 2GN8A 1CPYA 4X7RA 4ZAVA 3WLAA 4TMKA 3GPIA 1GPNA 1A1SA 3B6IA 3LCUA 4YQEA 1HTWA 3BCHA 4Z4QA 5FJJA 3WDKA 2BHRA 3EZFA 2QTFA 3OQVA 2IVFA 4LX8A 1XAJA 4MP3A 4TL8A 3IMFA 4LKRA 5ALIA 1FS6A 1LWOA 3AR7A 2JA2A 3JQPA 3DPIA 3PL5A 1BU5A 5AKHA 3UZUA 2C54A 2DM6A 3MSCA 5ALQA 4JDPA 1J20A 1MDFA 4B6SA 1QGED 1SXJA 2J07A 4DTCA 4C4PA 4F8YA 4EYEA 1FNMA 1E7WA 1KEZA 3A27A 1MW8X 3MGGA 4D3FA 3N2KA 2IPMA 3E2IA 1MJFA 1KY3A 1QV9A 1R4AA 5CHYA 1K8RA 2Q1WA 4D02A 1Z2DA 3CG0A 3T95A 4OGLA 4IXNA 3L0SA 4UARA 3GT4A 5KJ1A 1Y5MA 5ESRA 6ADHA 2KQUA 3ESRA 3OZEA 4CE6A 4AKTA 3GG2A 2WM8A 5TARA 4RV9A 1E5DA 4BV2A 1TQ6A 3AHIA 5FPQA 2C5FA 4D46A 2JFHA 4GM1A 2A88A 3LI2A 3L4EA 4TGLA 1KYTA 4YMLA 3D54D 4UNIA 5EVJA 5EQJB 1ES9A 4GQBA 2B1GA 5DBOA 3TL3A 3WLRA 4M8NE 1WXDA 4J76A 3LWNA 3O5AA 1EK6A 5L4NA 2GO1A 2Q4OA 3ZQ6A 4EHJA 4IHKA 2ZAYA 2ODQA 3UATA 1H2ZA 5EJ2A 2MWMA 1JG6A 2CBZA 1T5OA 3C6YA 4M9XA 4B73A 1TUBA 1JRLA 3K71B 1ECJA 2QVZX 2JLBA 3I6YA 4KQCA 1E1MA 1FS4A 1NJ1A 4KQ6A 3STYA 3W8DA 4AT1A 5LP6A 1BFUA 4WUVA 1HZZA 4CG2A 4YJFA 4LE1A 3OECA 1NQ5A 3MTDA 3LOPA 2QE7D 4L15A 1CIPA 4QU9A 3EISA 1QIKA 1SHLA 1T5SA 4OYLA 5H81A 3G0DA 4FOLA 3KTOA 1TXGA 3OM0A 2DEUA 3KB6A 4IV8A 3UK6A 4IQ0A 4FE3A 4BRWA 4DAEA 2RHLA 2QLTA 3KKOA 3WYEA 3IT2A 4BKMA 4IGKA 3DLIA 1JHDA 1R2QA 5DGCA 3STWA 3ST7A 2F43A 1BEUB 3WYBA 5EPOA 1SBTA 5DISB 4QVKA 2PYDA 3CVXA 3Q3GE 1ID1A 4HEA1 2BUCA 4QAQA 2YJ4A 3BGOS 2GHRA 6CHYA 3BRSA 2GYUA 4B1FA 5CFNA 4UVEA 3UJNA 1HORA 4JOBA 1GKUB 4K9LA 1QO9A 2C5SA 1LI5A 2JGFA 3PC2A 1PDWA 1RAGA 2OHIA 4Y6OA 4DSTA 5AJTA 3FAZA 2WZDA 4TXHA 1WTAA 1XVUA 5CLFA 4KYUA 4OY3A 4Z1MA 1U3VA 1DRVA 1GTJ1 4F6LA 4GBMA 3D6VA 4CM6A 4KE9A 2CDRA 4Q82A 4J1JA 2G6TA 3LBYA 3Q7SA 2A1TS 2C03A 2FFHA 3M5CA 1P60A 4ZCPA 4KR2A 2JI6A 1H6DA 1GRQA 3QYFA 5EWMA 3TS1A 3B6KA 2PWBA 1GN8A 1QK3A 2P9BA 4FHFA 5THKA 1NT4A 2GPTA 4A4DA 1T2AA 3I72A 5DM0A 1ZRHA 3DUFB 5TVGA 4PN3A 1B8OA 3LGSA 3U80A 1IHOA 4D0LB 1KIFA 2VF7A 4I1RA 5JBNA 5IHXA 3IIIA 4R8KA 3PP8A 4C05A 3ESBA 4CTMA 1NYRA 1YQTA 2IXFA 1VIDA 1VL5A 2P6PA 2X4LA 4DMCA 2BR3A 2O2DA 4R69A 2ZIZA 4XUDA 4NCHA 3JQ7B 4PAWA 2H48A 2IW1A 5A6SB 4D4MA 2WNIA 5B58T 5CM9C 3LCVB 5DGXA 4L6CA 4JYPA 1ZESA 5FPKA 4YLEA 1G5TA 1ZL2A 3PBKA 4Q3KA 3GRRA 3V55A 3LU1A 1XNHA 3PDIA 4OLHA 3LC0A 4NBTA 2V7UA 1YDMA 1U2GA 1J0AA 4BS9A 1QG4A 2RGGA 1E9RA 1VI5A 3DVLA 2H1FA 3H1AA 3TLJA 5JS6A 3UO8B 4IDFA 1XD2B 3TNDA 5TF0A 1WMDA 1RYFA 2E9SA 3MA0A 2VWPA 3OU6A 4XARA 1X94A 1Q16A 4DL9A 1V3VA 4F38A 1VL0A 3GFRA 3QFCA 5E95A 3V4VB 4F0JA 5KIAA 3OF3A 4FONA 5BQ5A 4DEXA 1XZFA 2J3DA 4LJLA 4HY3A 4U4AA 1AJEA 2OZPA 5A9SA 4DKXA 1WQ4A 2A8YA 2JBHA 1LRJA 2ZYGA 4EHKA 4B3DA 3ZD6A 4MUBA 1J2RA 1O95D 4BNHA 3EPRA 4RA6A 2YVLA 2XYRA 3FNGA 2HA5A 3WTBA 3MGBA 3CPJB 2WMOB 5IC4A 3SPXA 1BHO1 3LDUA 1ZGCA 2FGKA 4JELA 4NMHA 2A86A 3U7JA 2WJGA 1OX6A 3CUVA 1IXZA 2W6MA 3EGXA 4GF5A 3OPVA 5TC4A 2XOEA 2VPXA 1ENOA 3FWYA 2JFWA 3O3CA 7MHTA 1L7DA 1DAOA 3EFOB 1IPEA 2A7QA 1E1LA 5K03A 3K4QA 2JVIA 2P2LA 3GLQA 3PQ4A 1QHSA 2PSEA 2PZ8A 5EC8A 1PWEA 1ORRA 5D51S 4RHTA 5BYJA 2H4XA 3A1TA 4L6AA 1LX6A 1TX4B 4PAQA 5DSXA 1V5EA 2OBXA 2DJIA 3G82C 4LBYA 3NM5A 1NE7A 1NT2A 3D5QA 3KYCB 3QELA 3THYA 3CKMA 2GF9A 3L6BA 3VO8A 4RZ2A 1NL3A 2RH4A 3FUUA 4LK3A 2IXAA 2B35A 2BHLA 3UTDA 2VDKB 3SQNA 1WG8A 4TT3D 4CVNA 4CIYA 2ZWVA 2WFMA 5BSUA 1N3BA 3NHRA 3PJFA 4HV4A 1NF8A 2WAAA 1LY1A 5EKXA 4JT2A 4S0XA 4DUGA 4A8TA 1U1FA 3BXEA 1DB3A 4G9GA 4IQFA 3TNLA 2DFNA 4RMGA 1WLSA 4IW3B 4KN5A 4WFJA 4TXJA 3FKSA 3KKEA 2CJYA 1MJGM 3EW9A 3ULKA 1M2VA 1Q3KA 3HU1A 4NDAA 1Y1QA 1BQEA 4ZAWA 1Q0LA 2Q2WA 3P9ZA 1S7GA 4JL5A 4OB7A 2LCQA 4ADSG 2VTDA 4DE5A 1I1QB 3RWMB 1CYDA 2XUIA 1EXDA 3FFWA 2RHJA 1NPDA 1XG5A 3B6ZA 4QQRA 2BFNA 4CEIB 1AHNA 2B83A 2AUTA 4NCIA 5CA0F 4BNDA 1TUEA 4BLSA 5AW9A 2AKYA 3QHPA 4BFYA 1W2WB 5BNTA 4PX3A 4QYSA 1Z4OA 1YR6A 3K2BA 1Z13A 1N6NA 3H84A 3M9LA 4V1CB 5AK3A 1ZD1A 2Q8NA 3PHBE 1QV7A 1QGOA 1JFVA 2C2WA 3SC6A 2ZRBA 1BDIA 4F5EA 5J43A 2AR9A 1VRWA 2O8FB 3MS2A 5F9HA 1RWWA 1C8KA 3I1JA 4GDMA 4JP2A 3LA8A 4HAVA 5FJIA 1CR0A 1FSGA 1PT6A 3CNOA 4QUBA 3RVBA 3U48A 2HBZA 1FP6A 2GO7A 1ULAA 4ZN6A 3KJGA 2ZUVA 4H16A 5AJXA 2QP4A 3O1JC 3UNXA 3OQIA 1P2SA 4ENUA 1VL1A 3G88A 5SZHB 1Z68A 2QM8A 4KXUA 2HQBA 3DKRA 1YD7A 3ET5A 1NUAA 1Y7TA 2IHVA 2CN1A 2VHQA 1R0SA 3L7AA 4O2LA 1Y8ZA 5CLQA 3QVTA 2XZLA 2A9RA 2VF8A 2GD2A 1FXWA 2QRVB 2O2CA 3I2KA 2QQ0A 2UZAA 3T7EA 3FHTA 3F2IA 4TRRA 3VBCA 2PZGA 3C8ZA 3U4MA 3HEMA 2F00A 4RE6A 2PBFA 4ALKA 5IYZB 4ZTZB 1RQRA 1NBAA 4XFKA 3OWOA 3K0BA 1ML3A 5A5EA 1E94E 2VP5A 3A1UA 3STTA 3UB2A 5E7QA 5ALMA 3BQMB 1Z6PA 5BRJA 4G4GA 1F0YA 2ZJ5A 3KCQA 1GLGA 2V55B 4DZZA 5JQGA 3CWQA 1PR1A 1L5VA 1KBZA 2HQRA 3IQFA 3S5UA 4NMWA 1YB6A 1KC3A 2WC1A 3L8HA 5B7NA 5EXPA 2AV6A 3AF5A 5REQB 4GHWA 4AX4A 4Z1MD 4G4JA 4W1PA 4YAWA 2YWGA 2V6GA 4DJEC 1SJ9A 5CVVA 4Y0AA 3MQ2A 4FI3F 4G1CA 4XQEA 1UFKA 2I55A 2C5LA 1MV5A 1ZM7A 3ETCA 2QD3A 2FNAA 3PC3A 3JQ9C 1QOQB 2HB6A 4D99A 3HYNA 4UPEA 2IUTA 1HYQA 2DPHA 4KVFA 3X2FA 3V34A 3U4HA 3PEYA 2IYEA 1QGYA 4AG6A 2XCIA 4CUKA 3T0GA 4D6PA 1ADCA 2HADA 5C18A 3KHSA 4HQ0A 1MFPA 5L9AA 3DT8A 5CCDA 3HB1A 4O4IF 3EXFB 2H4YA 2ZSJA 2ODNA 5CLHA 1DOAA 4CM8B 4YRKA 2C3YA 4RTLA 4TWRA 4PQRA 4Q19A 2GAJA 5AHRA 5HF9A 4F3CA 2JIBA 3Q7EA 1C9JA 4Z7NB 4WK2B 3A4VA 3DMHA 1Y37A 1QE0A 1YDWA 1ZI8A 2QE7A 3K31A 4UU8A 4YO7A 5DULA 5G0SA 3SEAA 1I7PA 4JV5B 2ZANA 1GYRA 1TQ8A 2GJ8A 3ZI0A 1AKWA 1YB5A 1SQ0A 2FFJA 1AUVA 2ZKIA 1Y4ZA 1DKMA 2IXBA 4PLZA 1GDDA 4PGMA 1FNCA 1E3IA 3TZKA 5IH3A 1AMUA 3ZGNA 3JZIA 2GZHA 5ADUS 2PUFA 1AKNA 4IDQA 2QEQA 4CKZA 1GLVA 1WKCA 1YGYA 2QMZA 3GJRA 3TF5A 3D3WA 4F2HA 2Q0XA 3UGKA 1W4CA 1P3DA 1RYYA 2CE2X 1VE3A 2IPLA 2V4MA 2XMRA 2XWBF 3F9RA 1G7SA 1KVQA 4IIGA 4LG1A 4YP5A 1MQSA 2XNJA 4PBTA 4S0ZA 1TADA 5GV7A 2REBA 2I5PO 2FWBA 5A3QA 2BHTA 2NU7A 3LP8A 4IFIA 4PGGA 4L8LA 2NUBA 4BN5A 2V0CA 4HDAA 4OQZA 1PV4A 4JUAA 3Q15C 1MW9X 4N12A 3ZDYB 4MHTA 2ZI6A 3O4GA 3PD1A 3EQ2A 2N1MA 5BPFA 2E3JA 3CLHA 3RGWS 4B7AA 1QHGA 5M04A 2AI1A 3ZNOA 3WNCA 1JECA 4EDHA 5AFSA 4TMYA 5B6JA 4KACA 2C4WA 2PSHA 3DEZA 3RYFB 5IXSA 2ZJAA 2CHUA 2EKBA 5KDOA 4JMLA 4L28A 4M0UA 3IAS1 1H6AA 4MO9A 4V02A 5EEHA 4EIWA 4ABTA 2PTHA 5CDTA 5BUQA 1ZBDA 3IQEA 4PEVA 2HIAA 2Z98A 3MILA 3HMKA 3C5VA 1RQPA 4JJGA 1PG0A 2XNSA 2WU4A 2COUA 1M5TA 3FOAA 1XDZA 5DCUA 1T8UA 1XLVA 4BZQA 4CIVA 3QVSA 3ILVA 3OE7D 3E18A 2XKBA 4L5JA 4WINA 1T36A 5CBPB 3CW8X 4MEJA 2CKDA 2D1RA 2Y1GA 3MINA 3DVRX 2HK9A 3AETB 1SOAA 2W2KA 5JFOA 1QC5A 4YAKA 4RU1A 3UENA 1A9ZA 4G0VA 5TQ0A 3N8GA 1BHJA 4NAUA 1ZK4A 2H7CA 1VBKA 2J5KA 2P68A 2W6JD 3CTMA 3GJ6A 3NR2A 3OOEA 2NWQA 3R5KA 5CJPA 3CUUA 2HYIC 1L0BA 2GF0A 4DDMA 3VOAA 2R7KA 2HSJA 5ESXA 2EJUA 1E8DA 1KJZA 1JLRA 4R7ZA 5CYPA 5C31A 3VU8A 3UGTA 5C7IO 5JXWA 3ADDA 2X8LA 3P45A 3UUWA 3V1TC 4YCSA 1NM5A 2AMVA 3DM5A 2NO0A 2WM2A 3D3KA 4OXNA 5I7AA 2ADFA 5C7LO 1CV2A 1QGUA 2QAJA 3FJYA 5JHHB 3QUAA 5CB8A 2X5XA 3QVJA 1H9CA 3C6XA 3FHCB 3L92A 1FTNA 1PJSA 1K7YA 4W5WA 2SICE 5FNVB 1SVIA 1QU3A 1I4OA 5IANA 1IFXA 1KAQA 1KI6A 1HC7A 3GROA 1G3QA 4H7FA 5K4AA 1EUZA 2R60A 4GH5A 4M1EA 5IAGA 3W5UA 4XGQA 2PD4A 5HUHA 3THWB 1LPNA 1TA9A 4OHKA 3PENA 1MP0A 1RWPA 2AFRA 4I1IA 1E8MA 2H3HA 4AJEA 4DT1A 4CKWA 3MYYA 4MLCA 2CXUA 1Q1QA 2MHCA 3GYGA 4OXKA 4JBLA 1M2OB 2ERXA 2X7HA 3PCXA 4M0CA 2HCFA 2J6IA 3TLGB 4KZKA 1SCUB 3ICOA 4MV8A 5H80A 2FRVA 5I9SA 2ZDQA 4URYR 2QX4A 1YUBA 2Q4RA 4RCVA 2X3UA 5C1IA 2YZ2A 3OQHA 2G0NA 3UT0A 2E0IA 5FV7A 3W7VA 1ZOIA 1E6LA 1ZUD1 3PDCA 1ABFA 2D00A 4JEIA 1XZNA 3RG2A 2EL7A 2F90A 4DCMA 4E46A 3IDSA 4C6HA 4QDUA 3R7AA 5FV4A 4HFJA 5AHKA 3D3JA 4NV3A 4OKIA 3ZG6A 4TQAA 3RBAA 4CQMA 1DCKA 5GJVC 5G1NA 5EHIA 4BPBA 3GEIA 1DAGA 2R96A 1IATA 4MUMA 1DE0A 5L7YA 5LYJB 3TB6A 2VDUE 3NOVA 1DAKA 4J0CA 2PYIA 4MS1B 1GL7A 3QEOA 1U04A 3HCNA 4UUNA 1QTNA 4A6EA 2PXAA 4JYAB 3SN6A 4NCNA 4WRRA 1G7TA 2GBIA 3KKNA 3MAGA 1IM2A 3NAMA 4L4SA 1KDZA 4CKCA 2PUWA 4GU5A 1P7ZA 4UUOA 4FE4A 1KFEB 5HKBA 2NVBA 1USVA 5E6RA 2ZXEA 3CNQS 3EX7C 4QARA 2YBEA 4LVOA 1FYXA 4O4JB 3OJLA 1TU4A 2XBLA 1XVIA 4RVFA 1HUQA 4RLFA 4QRHA 3RS0A 3HKBA 3P20A 2KE5A 4FMCB 5KJCA 2BFOA 1VIYA 3AEQA 2X58A 3OPNA 3ZBPA 4QC2A 1Z37A 3O0TA 2Y3IA 1R9NA 2PRKA 5FA6A 2B6NA 1ENZA 1IC6A 2NVWA 2OFWA 4E14A 1F2DA 3OJCA 2YIJA 1R0YA 1Y5IA 3JQEA 1PP4A 2EG5A 2BZ1A 2ZJ4A 4Z99A 5KQLA 2EQ5A 5TNXA 5C3MA 1OFTA 5LQNA 1H2HA 1L7VC 3JATA 3E05A 3KUDA 4DA6A 3ETNA 3RVSA 1MNQA 2QYOA 3QMVA 3M83A 2ID9A 2FMXA 2GTIA 4BVBA 3EBPA 4YXFA 2AF4C 3C85A 3WRXA 3ABIA 1IUNA 3OQPA 4F3KA 3OZSA 1LS6A 3AL2A 4JI3B 1DTWA 4QTUB 3HYSA 1IEVA 2GI4A 1SFRA 2L19A 3KVRA 4PZZA 4HL6A 3WGZA 1KSHA 3AVXA 4IVPA 4LGYA 1MC4A 3GUVA 4AP9A 4RZSA 3UG6A 3KOWA 4XDZA 1UXHA 1KP3A 3EQ6A 4LJ6A 4M8IA 1AQJA 3OJ0A 1SO8A 4C76A 4UUQA 1DJPA 3UC5A 1SXHA 2PUVA 1F3LA 5F35A 5FCDA 3PRJA 1XEXA 4B0OA 4KEAA 1NATA 1Y89A 3H2KA 4RGVA 1M2KA 1Y9EA 1YF3A 3N9IA 1PJ8A 4CMKA 4RD3A 5CNJA 4ESEA 4LZZA 1EU1A 1M1YE 1XN1A 3TLMA 5JS7A 1KWGA 2BTQB 1V8FA 1VJ5A 3ZDRA 2X1HA 5AVQA 2ZT7A 4KUGA 3SOPA 4B9AA 4MV6A 3WLIA 5KX5F 4IHJB 3UQZA 3NC0C 2ZQ5A 1EDEA 4IMPA 5D6OA 3VYSB 4OLBA 3ABRB 3SJCA 4AVYA 5A3SA 2EBFX 4HDNA 1INLA 1Q12A 4MLDA 3BM5A 3KWLA 5FYQA 3L06A 2XNDD 5LQJA 3R3ZA 1RC1A 4ZHQB 3HP7A 4D3DA 2BSQA 3MLEA 2C98A 3SIRA 4BE9A 3U61B 5F3WB 4N7MA 1B0UA 1NPTO 3GLHA 4B7XA 1YQ9A 2A0XA 4PCLA 3N70A 4JQCA 2YICA 2DZDA 2JIRA 4F96A 4JA2A 4YO8A 3ZU2A 4QPNA 1QYIA 5JAMA 2C3UA 3W6ZA 1F2TA 3ZD8A 5AVKA 4F4DA 4X60A 4KJXA 4WKNA 1YZVA 4TLDA 1NWCA 5A4IS 3B13B 5A4DA 3GAFA 3LYUA 2WJWA 1LQTA 1CZUA 1LI4A 3HKEA 4L5CA 4MRAA 5K3DA 3TAUA 4AG3A 4F1KA 3GIWA 1GUYA 3AHEA 1NN0A 2NUAA 3M0EA 3RBXA 1ZCBA 2OHGA 1Y3IA 2DFKB 4U00A 5JXHA 1KWKA 2WWFA 3M3DA 4J7AA 1OA0A 1P4GA 3LD9A 4P84A 5LB4A 1MHTA 2IY7A 2YHSA 2DR2A 2DJ5A 4NYMR 5ECWA 1C3VA 2F6RA 3LPCA 5BWLA 5K0LA 2ZTMA 4C0AC 1AXRA 1NBWB 3F47A 3JQGA 1IULA 3O84A 5HIIA 5DHUA 2VBFA 3UAGA 3VR5D 4OA5A 4EA6A 2PKEA 1DL5A 1AK1A 3BTVA 3C1OA 2ZAIA 1T10A 2DVMA 3MUFA 3WGUA 4LOKA 3Q8MA 1EP1B 1NUPA 2FN8A 3G85A 4MA5A 2XZDA 4YJ3A 2C9BA 5BN5B 4OX9B 2DUUA 3N05A 2XADA 1DTEA 2O6HA 5AI9A 4AUMA 1S3IA 3COYA 1YS9A 4D96A 2OCGA 4NRDA 3EG5A 5K3AA 2O52A 4RDXA 3L1HA 1L4HA 1QAMA 2GCOA 2FQ1A 1KQPA 2J87A 1NW8A 3LC2O 4E7OA 2OTCA 5IWAB 1GTVA 1KNQA 2G67A 2WTEA 2PGJA 4ZI3A 4I66A 3O93A 1WZEA 3HCOA 4BCCA 4PCVA 4WDQA 5FWYA 1WVIA 1V26A 2C29D 3RYHA 1WB5A 4D8XA 1VP9A 3RC9A 3F6BX 2VH1A 4I8DA 4ZPJA 3SR3A 1GQQA 5JXJA 4RQTA 4DCUA 1MAHA 1XMSA 1U80A 4OBEA 4S1PA 4ZJUA 2QY9A 2NIPA 3U7RA 3K7EA 3SYRA 3ZIDA 2IH5A 1AF4A 2VCYA 3WLHA 4YALA 4HTFB 3I0NA 4UMFA 2CEKA 1OLSB 5FTNA 3H17A 3JQAD 4O5OA 3ZUGA 5BV1A 3BERA 5LOVF 2ZRNA 1MH9A 4G8BA 4OF4A 4DLVA 3ZQKA 3DE5X 4HN9A 2FQWA 2PJRA 3KSAC 2P3OA 1IOLA 3AX6A 3GARA 3NALA 1RQNA 3NWOA 4IIUA 2NZYA 2RK4A 1VJ1A 4BOYA 1ZNXA 3DQPA 3NCHA 2RBKA 2I7VA 5AM3A 4MW5A 2RGRA 4Y2QA 1UR5A 4X7BA 3FMPB 1W5EA 1B8VA 2Z8YM 1ODKA 2OBFA 1QNFA 1P77A 2PZLA 1PFKA 2VCHA 4KGXA 4YLGA 1EUQA 4ZI2A 3PC4A 4BNMA 2D0PB 3H2YA 4HZUB 3RK1A 2WJPA 5KTOA 3QEMB 4QOSA 3BULA 4TQUS 4EELA 2WICA 1YVPA 4QPZA 1U28C 2J6CA 4HUJA 2CCKA 1U0OC 2YH2A 4G09A 4PZUA 3PSAA 3PEEA 4Z7JA 5FOQA 3OCUA 2YKGA 2V8OA 3LUPA 2C4KA 3GJ3A 4DARA 1FVHA 1XZKA 2W4IA 3IIKA 5K8UA 3G2MA 1F4LA 3QMMA 4CNQA 4CLRA 3CNBA 4CYMA 1YKSA 1SVMA 5JAOA 2RGYA 3AG5A 2PFSA 3DBIA 3ENZA 3O95A 3TZEA 4FBMA 1SK8A 3DBRA 4XDGA 1TAHA 1WABA 1E9SA 2TSYB 3LWZA 3L18A 3N53A 4QZVA 3D7RA 2ZUEA 2R4UA 1K7XB 3UFXB 1DC5A 4C3UA 4UAGA 3JAKA 3TIGA 1UC5B 2P9HA 3PKJA 1T5IA 3L7LA 1GKIA 1SUDA 3QVGA 3W3AD 1J4AA 1HK7A 4A16A 1E1QA 4NZZA 1JYFA 1YVEI 3PFIA 1G2OA 3AWDA 3EF3A 2X8WA 4QGBA 4A0QA 1II8B 3B48A 1GZ4A 1IZ9A 1OX4B 2HJ9A 2HF2A 4YHHB 2CLCX 1XVTA 1QZZA 1Y9ZA 4XDHA 1EHYA 2ZRKA 4KIJA 1CD5A 3U9TA 1ESNA 1PUIA 1OHHA 4B17A 2CBXA 2P1ZA 3SP1A 4IGEA 4B40A 1JFFA 1ZK3A 3RTAA 3SQWA 4HFRA 3U9LA 3IOBA 1MOQA 3NHWA 2GZAA 2HPHA 3N7TA 2IF0A 2EFHB 3NDRA 5LUBA 3RUHA 1WM1A 1D7OA 4KXQA 1E6EA 1UK8A 3WLMA 4EGJA 1HDRA 3H1FA 1EG2A 2MIIA 4MX8A 4RPKA 4K6OA 1WWKA 4Z1OA 4US2R 5T7BA 1TZMA 3HCCA 4L9AA 3DCNA 2B4QA 2P41A 2XE6A 2C2MA 1JG7A 2A0UA 4A0HA 3PT9A 3QUBA 3S8MA 2QX8A 1FSPA 2Q1UA 3HO1A 1WSWA 3CF4A 1U9ZA 2OLJA 3NGMA 3T5CA 1EEHA 1MXFA 5CW2A 5KTYA 2H2AA 4GECA 2DFLA 1N5LA 5JNUA 1N3YA 4L0QA 4MV1A 5TLSA 1KA9H 3DNFA 1NBME 1YHNA 2Y66A 2XYHA 3WKAA 3FGOA 3LQFA 1NJ2A 2C96A 4ZVOA 4FIZA 4MUJA 2I80A 3MTJA 5BW6B 1JDUA 4C2UA 5JPCA 1BG6A 5GJCA 2ACKA 3B82A 4ZEXA 3RSFA 4C43A 1VG8A 5DYIA 3OJWA 2OG1A 2V96A 1GR1A 4NESA 4AUNA 1HDGO 2EZTA 3I62A 1AGRA 1ICEA 5BQPA 1OYWA 2NUPB 1R0WA 3DNMA 3KBBA 1CUAA 4MQEA 2B1QA 5T41A 1UBJS 2IU4A 1FNBA 1B7GO 2XXJA 1EVJA 3TLKA 4WCFB 3DVAB 2XMQA 4I3FA 4MR9B 3EC2A 1IDOA 2QLFA 2XLCA 3KOOA 2B2CA 4KWIA 3JD1A 3DJFA 3KWFA 1SG6A 4Y9TA 2A94A 4XGRA