3ENKA

1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
340
structure length
340
Chain Sequence
b'MSTKGTILVTGGAGYIGSHTAVELLAHGYDVVIADNLVNSKREAIARIEKITGKTPAFHETDVSDERALARIFDAHPITAAIHFAALKAVGESVAKPIEYYRNNLDSLLSLLRVMRERAVKRIVFSSSATVYGVPERSPIDETFPLSATNPYGQTKLMAEQILRDVEAADPSWRVATLRYFNPVGAHESGLIGEDPAGIPNNLMPYVAQVAVGKLEKLRVFGSDYPTPDGTGVRDYIHVVDLARGHIAALDALERRDASLTVNLGTGRGYSVLEVVRAFEKASGRAVPYELVARRPGDVAECYANPAAAAETIGWKAERDLERMCADHWRWQENNPRGFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucose 4-epimerase
molecule tags Isomerase
source organism Burkholderia pseudomallei 1710b
publication title 1.9A crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
rcsb
total genus 125
structure length 340
sequence length 340
chains with identical sequence B
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2008-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3enkA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3enkA02
3WLEA 4NG5A 4W82A 3WYBA 1R16A 3H9JA 4NBRA 1YB1A 3KSUA 4CMIA 3NT2A 1D1SA 2EP5A 4XEHA 3VH3A 5L4SA 4XGIA 1ZZEA 1LSJA 1YO6A 4ZVVA 1DIAA 3ZCXA 1GD1O 4KDFA 2SCUA 4E33A 5TLSA 4GX0A 1RYDA 2PA3A 2VOJA 3DOCA 3KVOA 4RGBA 5HS4A 1BTOA 4J7UA 1BSVA 3HDJA 3CEAA 2Q4EA 5CPBA 2C7GA 4EJ6A 2NSDA 1AXEA 4JP2A 3CPSA 3RFVA 4F6LA 3LT1A 5IN4A 5AOVA 1DLJA 4J16A 2NV6A 4YB8A 1CWUA 2E6UX 4Q39A 2Y68A 1E3WA 1ENYA 3D3WA 4YJGA 4FB5A 2V6MA 4XDYA 4XQEA 1H94A 1R37A 2VYVD 4HFRA 3MWDB 4QFCA 4DMLA 4DPMA 1ZJZA 2DFVA 4BNFA 1I30A 3SXPA 5B12A 3AY6A 2P5UA 4I5DA 3OEYA 4JCOA 2J5RA 3KM0A 2PKRA 3TWOA 2OGUA 1A4IA 4XQGA 1M67A 4DLBA 1EVJA 5TJ9A 1BXZA 2EP7A 1D8AA 2B0JA 3WYCA 2PK3A 2A94A 4YXFA 3U62A 2W2KA 1WP4A 3TFOA 3FTPA 7ADHA 4YT2A 3GC6A 4OIMA 2ZB8A 1YH3A 2H1SA 3K6JA 2YDXA 4PFJA 1GTMA 2AE1A 1MXHA 5HA5A 1C1DA 1YDWA 2HO5A 1B7GO 1TEHA 1ISIA 3AUSA 5U1PA 4I1IA 2C59A 5A9SB 1PJCA 4IXTA 1H5QA 2TMDA 4GGOA 5L40A 1XYGA 9LDBA 2X0NA 3AWDA 4OOFA 1R0SA 2NWQA 3W4IA 2PTGA 3N74A 4EUEA 2IYPA 1N92A 3H5RA 1SPXA 3E9NA 4ND2A 2B36A 1JU9A 4PVDA 1JVBA 3OFSA 1E3IA 1OZAA 1AHIA 3GY0A 1ZK1A 1WDLA 4JXKA 2A4KA 5CEEA 4I5EA 1SO8A 1GEGA 1GUZA 4UVIA 3AOGA 3LYLA 3AOEC 2JL1A 1W0CA 1Y8QA 4WLFA 4ZQFA 4BNJA 4BKPA 5AQ1A 5JAIA 1Y5RA 2G0TA 3DQPA 2BFAA 1Q2XA 2PFGA 4BV9A 1Q0HA 1U5AA 3DMYA 3I52A 5ENDA 3DHEA 1R4MB 3ZI0A 5FWNA 2IXAA 4BVAA 5JPIA 3RFTA 3AM3A 5KJ6A 3F5SA 3EZYA 3ZV3A 2IZ1A 3PGXA 1N7HA 3D7LA 3U4HA 2ZTLA 4MINA 4J0FA 4BO9A 2EKPA 1B8VA 1WWKA 3BZUA 3QVOA 4NIMA 4OGWA 4L73A 4BGEA 3KXDA 5I7VA 1WZEA 5IDYA 1M66A 4BO6A 1E77A 3UKOA 5CP8A 4WGGA 1SB9A 5F1PA 4QT0A 1Z73A 5IN5A 2VTDA 3LLSA 3H9UA 2RBEA 1KETA 3PLRA 3U09A 1P45A 3FNGA 3QHAA 1M75A 1PU2A 3EY4A 4UULA 1Q7GA 3BTVA 4Z9FA 4IDDA 1E7MA 4PG4A 3LT2A 4BV8A 4TZTA 1HLDA 3UOGA 1M6HA 4HBGA 1C1XB 1P31A 3FR7A 2WJPA 2AQIA 4NBVA 2Q45A 3F47A 4B3JA 4BB5A 1LXCA 1EZ4A 3IJPA 3LT0A 1AGNA 3FRJA 1NQTA 3M1AA 3KLMX 4XDZA 3GA0A 4J4BA 3WBBA 1P1JA 5KJ1A 4XIJA 4WCFA 3WLFA 4UUNA 1P1FA 3DXFA 5DZSA 2Z95A 1OAAA 1PWZA 4GVLA 4LVCA 3FBTA 3EMKA 3VOSA 5FF9A 5MDHA 4ZU3A 2EXXA 1NPDA 4A10A 1VM6A 4TRJA 1DEHA 1IYZA 3L9WA 4PLZA 3WDSA 4C7KA 4XYEA 3WGYA 5K0ZA 1VSUA 1XDWA 1NTOA 5JO0A 2Q1TA 4BNHA 1ZIDA 4ND4A 1SB8A 1M76A 3RBVA 1F8GA 3AFMA 3V8BA 1ML3A 3HE3A 2X4GA 5EERA 2RHRA 1C0IA 2B35A 3CZRA 4E30A 1ZSYA 4RLSA 1RPNA 1I24A 2PZLA 3PHGA 4YWJA 5FFFA 2NQTA 2NVWA 2WE8A 3AUTA 4WE3A 4AJLA 1B3RA 4E2WA 4OQYA 1QLHA 2ZB3A 3RUDA 4BO8A 4K26A 4D79A 4GMGA 2C5AA 2V6BA 4GAEA 1T1RA 5FEUA 5IDWA 5A9SA 3D4NA 3ZH2A 1XHLA 5I7SA 3RUIA 4DRYA 3BA1A 3C85A 5JAQA 3VH1A 1E6UA 4KUEA 4FQ8A 2X22A 1PL7A 1XKQA 5KTKA 2BH9A 4BO3A 3AFNA 4MVJI 3S2FA 4AJNA 3JQBC 3VPFA 1F12A 2RAFA 1U2DA 4XB2A 3WNQA 1JKIA 5JDCC 3BTSA 4TROA 1WZIA 1TT5A 3IS3A 3NKLA 2GF2A 3LF2A 1O5IA 3BMOA 4WLNA 2H63A 3C7AA 4L4RA 2CY0A 4QO7A 3TQHA 2WD8A 1ID1A 2DM6A 4CR6A 3ROPA 2OFPA 4M87A 2EKLA 2Y1GA 2YHIA 3ZV4A 4BO4A 2GLXA 4A2CA 4OXKA 1X0VA 2PLAA 2G5CA 2WTBA 4HADA 1OC2A 1HT0A 1PQPA 4I9UA 3WWYA 1R4MA 4AJOA 2GDZA 4R16A 4LVUA 2BRUA 1KY5A 1QMGA 4OYRA 4YT4A 1PJTA 5AXBA 4BO1A 2GZ2A 2VZ0A 3DFZA 1JW9B 4XKJA 4R54A 4R3WA 3H4VA 4DREA 2P9GA 4IY1A 4MP3A 5CEJA 4E5KA 2ZKLA 3I4FA 5KVVA 3L4BA 3ABIA 2Y1EA 3UCXA 3HUDA 3QY9A 4TVOA 3TL2A 3WS7A 4CJXA 5JMWA 4ONEA 3I9LA 5JC1A 1I5RA 4HP8A 5ADHA 3I1JA 3DZKA 4UEJA 4DMMA 1DAPA 5JCJD 3DZGA 3WGTA 3T7CA 4MVJE 4YT5A 4ZA2A 2CVQA 1U7TA 3D64A 4LN1A 3DZJA 4UVGA 4BS9A 1VKOA 1F8FA 5THQA 1KVTA 3OF2A 3PXXA 4IZHA 1JAXA 4E2YA 5DP1A 4R69A 1LC3A 3PJDA 3MTGA 3PPIA 3RUFA 3GGPA 1ZEMA 2VHZA 4W4TA 1VL0A 4NBUA 1J6UA 4XB1A 3IQDB 1NFFA 2DAPA 5DP2A 1NQOA 3O9ZA 5G0VA 1ISMA 2Q2WA 3OH8A 1YONA 4FW8A 3ZWBA 2VRCA 1HWYA 3BXXA 2B5VA 4B4VA 3RUEA 3RC2A 2EIHA 1X13A 3LLVA 3QW2A 1UAYA 3R1IA 2BFPA 3QVXA 1JVSA 3INTA 1AN9A 2C07A 4L76A 3BMQB 3JQAD 2IRWA 2AXQA 4GSKA 2Y1FA 1XGKA 4OMUA 1JLLA 4ZQHA 1LSOA 3BHJA 5HS6A 4N5NA 1ZUD1 3H8VA 3BYZA 4CPDA 4Y8VA 2FPGA 4UREA 2VRCD 1SOVA 3C7CB 3KHUA 4EW6A 1YS4A 2OP1A 1Y81A 3RKUA 2UYYA 3U49A 2WSBA 1MG0A 1FDTA 4YJGB 1PGQA 1VLLA 2X5KO 1Y9EA 4E0BA 2HUNA 1GPJA 4JGBA 1KC3A 2YFQA 1QYDA 1NP3A 1A27A 2D4AA 4WASA 4B4WA 3PWZA 3NTQA 4FSHA 3HFSA 3OJ0A 3ORFA 4PZCA 3WTBA 1E7RA 3MEQA 1U5CA 4ALMA 4NR0A 1PZGA 2EGHA 3I6QA 4RQUA 4BNYA 1BHSA 3WBFA 1WNTA 3NDJA 5B4VA 3HWRA 1JN0A 5JAMA 1U1IA 4CQMB 3FF4A 3NGLA 1ONOA 1LLQA 3TOZA 1AUPA 3I9KA 3DZIA 3KYCA 5ILGA 1ULUA 3E03A 4W7IA 1C0KA 3VTZA 2FZEA 4J0EA 3QRWA 1I2CA 1FJHA 4K28A 1EK5A 2I3AA 4RL6A 1GFSA 1GUYA 3DBHB 1HYHA 1OBFO 3H9EO 3IIEA 2X5JO 3FN4A 3Q6IA 3OIFA 2WD7A 1DC3A 3NGXA 1P0CA 3F4BA 3WICA 1E6EA 1PJSA 4XYMA 3GK3A 2PGDA 2IDZA 5T67A 5DNAA 1NBOA 1JKJA 2DPGA 4CUJA 5B37A 5JYEA 3RC9A 4BNUA 5JXWA 1OC4A 3FPLA 5AXDA 1HL3A 3TOXA 3DAGA 4JN6B 4BMSA 3ITDA 4WUVA 1HDZA 1YE3A 1DIGA 3GPIA 3MJSA 4Q3DA 3V2UA 5KVSA 3PJEA 3KYDB 3H5NA 4RPHA 4YDRA 5T64A 2O3UA 2ET6A 6ADHA 5KWEA 5AXAA 1E3JA 1V3TA 1GAEO 3PJFA 2DUUA 2GN9A 1CETA 1Q1NA 4RF3A 1LRLA 3OEWA 4AJ1A 5K6AA 2IZ0A 1R15A 3EVNA 3JQDA 3K31A 3WG9A 1FK8A 1QYVA 1UP4A 2FY8A 2WYVA 4OHUA 4GMFA 1LDYA 1PR3A 3GG9A 3WFJA 1GQQA 1R4NB 2HLPA 1U8FO 1VC2A 2HQ1A 2NM0A 3MTJA 4I9HA 2WYUA 3IOYA 3WSVA 3G3EA 1TT7A 5BNIA 4FCCA 5K9ZA 2VYVA 4OJNA 5JY1A 4F46A 4YYZA 2VZ9A 1G0OA 4RZIA 4BKRA 2VQ3A 1LBEA 2GRAA 1BXKA 1KIFA 3BTUA 1N1EA 3L9XA 3AI3A 3AOEA 1K5HA 4DLLA 3DDNA 5TF4A 4E5MA 2DLDA 3PI7A 3Q9NA 3P2YA 1Z7BA 2W2LD 3GN2A 4O6VA 3RASA 2FWMX 3Q11A 3ZHYA 3OQBA 4J2OA 4Z3DA 4R5HA 1W6UA 1WPQA 2I99A 1YXMA 3FTNA 3JQ7B 4H7PA 4R01A 2ZTMA 2YQ5A 3E82A 5TC4A 1U4SA 2FPPA 1DOHA 4M8SA 4WEQA 4WCFB 3JQ6A 2YYYA 2Q99A 3EW7A 4YRBA 1IPEA 2DTEA 3C24A 2OL4A 2HAEA 4DTIA 1BW9A 1XA0A 3W8DA 3GRKA 4GH5A 3RUAA 5L51A 4NPCA 4TKLA 3GDOA 1I0ZA 5JBIA 2V65A 1ZSNA 3Q9UA 3CZMA 2WEKA 2Q2QA 5JYDA 5A9RA 4N5MA 4HXYA 5IAAA 3E6AA 4M54A 3WR5A 2QHXA 4Q3BA 1NFQA 3TF5A 4JBIA 2AEJA 3EGOA 1A9YA 2CF5A 3HADA 3ZWMA 3PZRA 1LNQA 4KOAA 4FFOA 1GDHA 2GD1O 3ROQA 4IQ8A 1K89A 5CG2A 2ZYGA 1M2WA 2DU8A 1ZNQO 3UICA 1ZXBA 1KVQA 3DOOA 4Z0TA 5DBIA 4HWKA 2A9FA 5BSFA 4MIEA 5T8KA 4M1QA 4R1UA 2GN4A 1K0UA 4BMVA 5IFLA 4RVHA 1HETA 4HNGA 5A1TA 4FIZA 4RO0A 3WGOA 2FPIA 3K96A 1EVZA 5A3JA 2HRBA 3NT5A 2W2KB 1I8TA 4D0SA 1HXHA 1MA0A 4PZEA 1A5ZA 1KYQA 2F1KA 4NK5A 2POQX 5JY6A 4FD3A 4OSOA 4YAGA 4XR9A 4Y9DA 5ES3A 2Q3EA 1N5DA 4R41A 5JW6A 4UUMA 4CLRB 4XRGA 2HMUA 2P91A 3AY3A 3TZQA 2DTDA 2D59A 2PWZA 5JS6A 5IF3A 3V2GA 4L4XA 2OHXA 2Y1OA 1LU9A 4MVJF 1KC1A 3ST7A 2FMUA 1H6DA 1Y9AA 4ZHSA 4NNJA 1JQBA 3JQ8A 4ZD6A 4J43A 4E3ZA 3PIIA 1VL8A 2VTEA 1L1FA 2G82A 1CF2O 1RM5A 3X2EA 4F45A 2G76A 1LDNA 3M2TA 1IPFA 1XEAA 3ZWOA 2WWRA 4YPOA 4MKRA 1ZBQA 2J3KA 2JFHA 2PZJA 4S1VA 5CDSA 3HDHA 3OETA 5BQFA 3JQ8B 3V1YA 5ITVA 3ONFA 4KUHA 4OM8A 2V6GA 4Y98A 4DQVA 1HDXA 2HMSA 1WW8A 5H82A 2CD9A 3FBGA 4LISA 1HE3A 2PGJA 1YKFA 5KJEA 3WJ7A 4XR4A 2I6TA 1F14A 2DT5A 5CG1A 2P9CA 2JFFA 2Z1NA 3LQFA 3ZW8A 1NXQA 1UDBA 3FI9A 3JV7A 5I7FA 4P8RA 2PH5A 4RVSA 5TRTA 5F1KA 4BNTA 1LDGA 4CM7A 1GYPA 1O0SA 1YQDA 1ZSVA 4LSWA 1T2CA 1LEHA 2FZWA 3BMCA 3W6UA 4CMCA 1DAOA 4G2NA 3PFFA 4D3FA 2ZTVA 2CDBA 4ND5A 4GSLA 2PKQP 4OL9A 5JCJA 2DBRA 1TXGA 3KRTA 2PR2A 3H3FA 3AU9A 1U3VA 3VZSA 4JQCA 5L7YA 2NU8A 2VHVA 1OI7A 2NUAA 3HDYA 1CJCA 1HDGO 3C3XA 2WYWA 4DPLA 3B70A 2O2SA 1YBVA 1ZK0A 4XA8A 1PJBA 1C1XA 2EKQA 1VRWA 2LDXA 2RH8A 1Y7TA 3FPCA 1Q7BA 1A7KA 3LVFO 5G4KB 1PTJA 4EYEA 3GG2A 1Z82A 2UDPA 5ER9A 1SEVA 4BIIA 3IP3A 1ONNA 2B83A 5B4UA 2BGLA 5TT0A 4IS2A 1MG5A 2D2IA 2I76A 3JD4A 4O1MA 4UUPA 5H83A 1HDOA 3G0OA 1DJNA 1ENOA 3L07A 2AE2A 3TZHA 4GWGA 3VPSA 1F06A 1X0XA 3C1OA 4RF4A 3E48A 4D46A 2Q1UA 3CUKA 3U3XA 1RM0A 1UAGA 1JWAB 2WM3A 4WLOA 3QP9A 4L4SA 2BKAA 3NV9A 2OUIA 3IKTA 1D3AA 3CSDA 2E48A 3DEYX 1H9AA 1B26A 5JO9A 2QRLA 3ON5A 1PJLA 2DC1A 1DSSG 2IYOA 3HB4X 4QTZA 4RORA 5A3VA 3ZNOA 3GH3A 5JSFA 3WFIA 3BMCB 5CDYA 2VWQA 5AVOA 4OXNA 2V6FA 4NDNE 1Y8QB 4NH4A 3TL3A 5T5QA 4CV3A 1LSUA 3RAJA 1UDCA 3STHA 2X6TA 2W2LA 2YV1A 4AJEA 4LSMA 3JYOA 3T4EA 2CDCA 5I8WA 1B3BA 3RJ9A 5IJZA 3GZ4A 2OBNA 3S2GA 2X0RA 1Z6ZA 1GEEA 3PDJA 5CFZA 1GPDG 4BKUA 1CYDA 3I9MA 1K6XA 1T2FA 4CR8A 3OMLA 4RCVA 3FHLA 4CLXA 4CM9D 3ICPA 4PGFA 2JD0A 3AU8A 2D5CA 3KBOA 1UP6A 4DGSA 4W6ZA 4CLOB 1GYQA 1IB6A 3VC7A 4CMEC 3W8EA 3IAHA 4Z9YA 3FCOA 3UN1A 2IXBA 4E4YA 4B8ZA 1UXKA 5G0SA 1ZK4A 5DF1A 4MVJP 2R00A 3DZHA 4YBZA 1EBUA 2UV8A 1EDOA 1GV0A 3LC1O 1PSDA 4U5QA 3WGGA 5ILOA 1XG5A 4GX2A 3MCVA 3PYLA 4M89A 3P5SA 4I9NA 3QLJA 4AL4A 2X7HA 2NVBA 4YAIA 1EBFA 2W90A 5KNLA 2PD6A 3PQEA 3SBOA 3VVCA 3O8QA 4GBJA 2ZQYA 1RYEA 2XXJA 5DN9A 3SJ7A 1I01A 1XWFA 3D4PA 3FNEA 3QJ5A 3MZ0A 4S3MA 3GVHA 2NTJA 5A9TA 4URFA 4BQPA 4XQCA 4ZRNA 4P4GA 2HK8A 4NK4A 5AYVA 5THKA 1LTHR 4XYLA 2YV3A 1T1SA 1UZNA 5ER6A 1JWBB 1B8UA 3ZN2A 2XAAA 4E31A 3TZKA 5KKAA 3RC1A 1FMCA 3DBHA 1E1KA 3ENNA 4WK6A 2GSDA 4CODB 4J7CA 2PY6A 1DC6A 4BNZA 4GX5A 3VZRA 4GLOA 4CMJA 5JFOA 2GGSA 1CIVA 3GHYA 4I08A 1X1EA 3WGZA 1VJ1A 1HSZA 2FR1A 2UUPA 3DO5A 4QX6A 1P1HA 4R51A 3OHSX 1R0LA 3F1KA 3K2EA 2NU7A 3IL2A 1D1TA 1NR1A 2Y93A 2ZIZA 1WVGA 5JMPA 4IGEA 1DFIA 1IZ0A 4PVCA 1ZH8A 2CDAA 3MWEB 5U4QA 3K2BA 1HTBA 2GN6A 3UH1A 4A73A 1A72A 1VJ0A 2Q46A 3PEFA 1YBMA 1IHYA 1NR7A 1ZCJA 5GZ1A 1B2LA 1GADO 1KVUA 3H6KA 1HZZA 3H2SA 4R3NA 1NNUA 2HCTA 3U9LA 3GFBA 3ZWWA 4OKIA 3I3OA 5A5EA 4KUGA 2H9IA 4BNGA 3FNHA 3VTFA 3JD3A 2Y99A 1HE4A 1V6AA 4UVEA 1PS9A 3F5QA 4G81A 1PJ2A 2GCGA 3NAQA 2V7PA 4WLEA 2AEFA 5F5NA 4RVGA 1R12A 4JJFA 1LA2A 3C7DB 3M2PA 3OQ6A 1NQAO 4YVFA 1A9ZA 3WXBA 3BHIA 4AJPA 2FR8A 4A7PA 2EV9A 3H7AA 3GZNB 4YJDA 4EI2A 4CUZA 1B16A 3ZZNA 4J2HA 2B4RO 4D42A 3PGJA 2HJSA 4P22A 5L9AA 4YCAA 4JBHA 3KYCB 5BSEA 1HLPA 4HNHA 5LCXA 5I9NA 3TNLA 3ZWPA 4AVYA 3NRCA 2X8LA 1E1LA 3KETA 4TRNA 2IEBA 2ZCVA 4XJSA 4D0RA 4MVJD 3SJUA 3WGQA 5JNLA 3N58A 1ZVMA 4D45A 3QV1A 3MJCA 3RD5A 1LJ8A 4RPKA 2EW8A 3FSRA 4IJWA 3M1LA 4Y6PA 5DDIP 5HWSA 1LLUA 3CXRA 2YW9A 4JIGA 4MDHA 1DRWA 3VAZA 4IXWA 3SC6A 1GUFA 3AK4A 4J1SA 3RVDA 3K92A 1NAIA 3RIHA 2BMAA 1RKXA 2B4TO 2J3IA 3DL2A 4PLWA 3GGGA 1NASA 3PP8A 2HMVA 2FN7A 1ENPA 4FJ1A 4UEOA 2JFGA 5C7OO 1I3MA 4RQTA 1ZFNA 1OOEA 3I83A 2J6IA 3ZWVA 3E5RA 4GQAA 5G4LA 4CMKA 2O7QA 2J5KA 5TT1A 4AJHA 1NQ5A 1NHWA 1X7GA 5T57A 3Q2KA 5IDQA 4J9UE 1T2AA 3WJAA 2IZZA 3H65A 1K3TA 5JDIA 1NWHA 4IPTA 4B7XA 4N5LA 2BELA 5CDTA 3MOGA 1EMDA 1BXGA 3RWBA 4G65A 3ICCA 3L77A 3TPCA 2UUOA 5GZ3A 2CFCA 3H9GA 5FYDA 1G0NA 1D4FA 1P1RA 3ZU3A 3AI2A 2YHIB 1HZJA 4TVBA 1NAHA 1IL0A 1GV1A 4J4HA 5L53A 1P33A 5ICMA 1I36A 1PZEA 1YOVB 3TN7A 1MUUA 3MJVA 3P7MA 5KKCA 3DONA 2CNBA 3PK0A 3KB6A 4J49A 4CL3A 4CQLA 2Y1CA 4DXHA 4WLUA 5GZ6A 3PYMA 4J1TA 1UXIA 1YB4A 3KYBA 3HB5X 2ZQZA 1Y8RB 4BO0A 1HEUA 2X9VA 2VCYA 1HSOA 3GDGA 4K6FA 4NFYA 4R68A 3HG7A 1IE3A 3SLKA 4EGFA 5BNFA 1DFGA 1ONPA 3PHJA 1AXGA 1I3LA 4INAA 2RH4A 1X1TA 1MGOA 1HF3A 1W73A 2C0CA 3FR8A 1MC4A 1ADCA 4RDHA 3GEGA 1LDMA 4ALKA 4D43A 3ETGA 3EUWA 4E13A 1I3NA 4FOOA 3ULKA 2Q49A 3ONDA 2ZCUA 3DB2A 4DBVO 4NBTA 4KTTE 3W6ZA 4D41A 1GU7A 3RU9A 2BGMA 3RKRA 3JTMA 1DO8A 3U0BA 4RVDA 3ETDA 1GZ3A 1BXGB 1PGNA 3JQCA 2VZ8A 1G6KA 2OMEA 4TRRA 5DCWA 2GN8A 4LMRA 5G0WA 1EVIA 3HHPA 1ZK2A 3AUUA 4K1LA 2VNAA 5JCXA 4FGSA 2EG9A 3CE6A 1W4ZA 4U0JA 3VDRA 2JHFA 2VHYA 4AJ4A 3W4JA 3CMCO 4PZDA 2NQ8A 1H6BA 1DDOA 2VUTA 3B6ZA 3JD0A 2DPHA 4I8XA 3RUCA 2OZPA 4QFDA 1ADGA 1IULA 1HDCA 3B20A 4QO8A 1N2SA 4AG3A 4EITA 4BNNA 4WECA 1XIVA 4BHTA 1B15A 3N7UA 3U5TA 3QWIA 5GMOA 1EUDA 3VKVA 2OOSA 1LUAA 3OSUA 1PS8A 1KY4A 1HE2A 3GOHA 3MOIA 3PHIA 4BUCA 1SMKA 1ZEJA 4OOEA 1BWSA 2QYSA 5C7LO 1H2HA 3G79A 1NVGA 1Y6JA 1OMOA 1DIHA 3INRA 1TVEA 3WIEA 7MDHA 3DHYA 4MO2A 1DB3A 1NYTA 2X9NA 1FDWA 1GQYA 1T24A 4E12A 4CLHA 3D5QA 3WMWA 3JQGB 3PRJA 4J91A 5DOZA 3D4OA 1P1IA 2Q4BA 3DBLA 1GZ6A 4NHEA 4U6QA 4KDEA 1O6ZA 4KP7A 4PCVA 1AHHA 2D0IA 2WE7A 5F3RA 4CLEA 4IIUA 4E21A 3IUSA 4RZHA 3ANNA 4IM7A 5BNTA 2ZK7A 2AA3A 4GL4A 2P5YA 4ND3A 3UF0A 5IZCA 4BNLA 5TIIA 4LW8A 3LDHA 4YJHB 1WXDA 5IZCC 5U9CA 1GQ2A 4Q3AA 1S7CA 1O9BA 4DQUA 5EINA 3OA0A 2JAHA 3T7EA 1H6AA 2IODA 1E1MA 1DHRA 4PLFA 3A4VA 1HRDA 1KBZA 3G49A 1BVRA 4XCVA 4IQ0A 4QQRA 3SX2A 3U4CA 3GVIA 3EC7A 1MLDA 1LQTA 1P74A 3PYXA 1O8CA 4CV2A 4OAQA 2C20A 1VL6A 3EZLA 4K6CA 1UXGA 4R9SA 1NVMB 4II3A 3ROKA 5DCYA 1ISJA 3IUPA 5F1OA 2GZ1A 1E0DA 1ZMOA 4MOWA 1VE9A 1XR3A 5JLAA 4PG8A 5DBFA 1LDEA 3GAFA 1IZ9A 1YJ8A 2PGLA 2ZYAA 2Y0CA 3ASUA 2OP0A 3JYPA 3WQQA 1MFZA 2Q1SA 3UAGA 2E4AA 5KCZA 2YJZA 3ZHBA 4OXYA 3WX0A 3ZU4A 1AE1A 1CQIA 3F6YA 3PJGA 4IDFA 1EVYA 2QX7A 2O48X 2DVMA 5CDUA 3KEQA 1S6YA 3EHEA 3DMTC 9LDTA 2QYTA 1BVUA 2O3QA 4UVDA 3W8FA 2PKQO 4A27A 3DC2A 4KQWA 1P1KA 1QV7A 2D3TA 1U8XX 3LC2O 4H3VA 2I65A 1GCUA 3S2IA 1H6CA 4YT8A 1EFKA 4MP8A 2I3GA 3V1TC 2QG4A 2O23A 2VWGA 3GUYA 5EESA 3TSCA 1X7HA 4DBZA 1C1DB 1MFPA 3S2EA 5BT9A 8ADHA 3ZNNA 3ZWXA 2XXBA 2C5EA 4U7WA 1XLTA 4RVFA 4Z0HO 3ZHZA 1LSSA 1ADFA 3E18A 3QQPA 2CMDA 1Q7CA 4J9VA 2BGKA 1XSEA 5C3MA 4HFJA 4R1SA 1C14A 1LDBA 4ITUA 3RROA 5EPOA 4MP6A 1NWCA 2X0IA 2YZ7A 1ZXLA 3OQ1A 1PEDA 4MVJA 4IMPA 5EN4A 5T8KC 5L4NA 2EF1A 3GVPA 2FR0A 2CVOA 3GVXA 4I5GA 3I6IA 1UP7A 3JQ9A 4RLHA 2FOIA 2I66A 4A5OA 1PQWA 2DQ4A 2FHSA 1TLTA 3JQEA 5ITWA 4Z3KA 1C0PA 3NJ4A 3Q2IA 3JD1A 5C5IA 5KOIA 5CPFA 4DC0A 1WDMA 3LU1A 2NTVA 3K5PA 1YL5A 1E7YA 2GR9A 1V3VA 4MIYA 4DC1A 4XIYA 3GLQA 3GNQA 2YDYA 3L6OO 5L95A 4CQMA 2VUUA 1L7DA 2X1HA 3L4SO 4UVHA 4TWRA 4IJUA 2X5OA 3G1UA 3GAZA 1RJWA 5I9LA 4Z9XA 5LC1A 4BMNA 2ZJ0A 5EIOA 4ID9A 4NU5A 2GNAA 3HQ4O 1V35A 3IMFA 4FFNA 2W8ZA 4IBOA 3FWZA 2X86A 4IDAA 2NNLD 1A71A 4YTEA 1P44A 1E6WA 1PJQA 3PIDA 4YRAA 1E7QA 2P4HX 4BO2A 1EQ2A 3DHNA 1UJMA 2LDBA 1EQUA 5L4LA 4CV0A 1EFLA 3ZV5A 3UCFA 1O94A 1RM4A 3AI1A 3D5TA 4CM3A 3PTZA 4B4OA 1NPYA 1UZLA 3KV3O 1V8BA 4DIBA 4LK3A 1ARZA 2OORA 2BFMA 3C1AA 4PLYA 4W9NA 3I9NA 1ZKMA 1LRKA 4U6SA 5EQFA 5C37A 5K6AC 4YA6A 3HFGA 3GPDG 3QVWA 1JAYA 3UFXA 2VHXA 1TI7A 4K9DA 2XPCA 1A4UA 4ILKA 4MIOA 5HRUA 3QWBA 1J4AA 2O4CA 4BQRA 5DULA 4UAGA 4XGKA 3L0DA 2I9PA 3JQAA 3FWNA 4ZQEA 4DA9A 4Q9NA 3PQDA 4EUFA 4KWIA 4F6CA 3RQSA 1KS9A 2QW8A 3A06A 3QVSA 4KMSA 5FI5A 1B0AA 3GNTA 4W7HA 4ALJA 1QV6A 2CF6A 4HUJA 1BMDA 4ROSA 2GUGA 1SZJG 3F3SA 2Z1MA 3D1LA 3RC7A 3A9WA 1HYGA 4XGNA 1WDKA 2Q2VA 2X9GA 1PR9A 4EEXA 4G5HA 2HDHA 1SCUA 2Q50A 4OQZA 3UCEA 1JTVA 3HDQA 4PG6A 4EJMA 1E1NA 1N9GB 2HKIA 3WIDA 3B1KA 4A26A 1UUFA 5G0UA 3OBBA 3PVZA 4CQLB 3L6EA 1U9JA 1V3UA 1UZMA 1XELA 4NMHA 4ND1A 4CR7A 4J1NA 4WKGA 2NVUB 4F3YA 1HDRA 1KOLA 4BL5A 3UUWA 3NDIA 4PLTA 3RSHA 5LDHA 1XCBA 1Z7EA 4L0QA 5EL0A 1N9GA 2BFOA 2EEZA 4Y6RA 4CMAA 4P4NA 4Z6KA 1PL6A 1IUKA 3ANLA 1WAMA 2EGGA 1QSGA 2HMWA 1U7HA 2QRJA 3COSA 3HSKA 5IXSA 2Q1WA 3JCZA 3A28A 4GLLA 2HMTA 4WOKA 2VN8A 3T4XA 4YAKA 2IE0A 3D0OA 3JSAA 1Z75A 4Q3NA 2WD7B 3ZWCA 1KEUA 3KZVA 2Y05A 2E37A 4DIOA 3I4CA 4BNXA 1R66A 4GPD1 3OM9A 1JDJA 3AW9A 4B8WA 4UUOA 4MKXA 3QIVA 1WMAA 3VH4A 4CMEA 4RF2A 3LSYA 4MKZA 4CLOA 4JBGA 4JNKA 4ZGWA 2PZKA 1IOLA 5L45A 1YBAA 4B79A 3CINA 4RPJA 1HYEA 4LCJA 3H5AA 3SVTA 1C3VA 3FNFA 2RHCA 3AY7A 4E2XA 2FRDA 1B8PA 3RBZA 4E32A 4FC6A 1BDBA 3F4LA 4GKVA 4JROA 4MVJH 4XX0A 2BD0A 3ZU2A 2CUKA 2I67A 1FDVA 4PRLA 1YRLA 4EUHA 4AFNA 4IJVA 4RPGA 1LLCA 1XQ1A 4EDFA 2B5WA 4M55A 4LCEA 4W99A 4YEDA 4E5YA 1ORRA 4YJFB 1PS0A 3ZDFA 1F17A 4YQYA 2AMFA 1PJ4A 1K6JA 4NJMB 1EE2A 3GUCA 1QORA 4HFMA 1T4BA 1DIRA 3DAPA 4AJJA 4FJ0A 2GERA 1YL7A 3PLNA 1KEWA 3KLPX 2QIOA 2NU9A 3HJAA 4JLWA 3CIFA 4IINA 1ULSA 4PIVA 4CLDA 1Q0QA 1E3LA 3LC7O 1MV8A 2HK9A 1YDEA 4XWYA 3KEOA 5KIAA 5AXCA 4AICA 4JJIA 3HN2A 2O3RA 3F1LA 1ZMTA 4GKBA 3AM5A 5ENVA 1NHGA 5F5LA 4CUKA 4ZQGA 4YAEA 3DMTA 2ILTA 4ALNA 3IP1A 3OA2A 1M6WA 4YRDA 1KERA 2RCYA 4C4OA 1WMBA 1T2DA 4IGFA 3UXYA 1LC0A 4Z0PA 3JQ9C 5JE8A 4B7CA 4FR5A 3CH6A 1H9BA 1X15A 3PWKA 3WB9A 4CM6A 1EDZA 3NTOA 5CHEA 1ISHA 1E5QA 3QSGA 3C1TA 1HKUA 1VSVA 3O4RA 3TRIA 1DRUA 4DVJA 4J6FA 1PL8A 3PHHA 4B3HA 2FP4A 4EZBA 1QYXA 4ALIA 4D3DA 2XOXA 2OO5A 1HE5A 1RM3A 3ADOA 4N54A 3DAFA 1LQUA 2Y0DA 2Y66A 1U3UA 1U28A 3ITKA 1XU9A 1D7OA 1I33A 3GR6A 3MJTA 4JJGA 1PGOA 2YFHA 1QKIA 1LX6A 4O0LA 3WOHA 4FFRA 4L74A 1OFGA 4CL8A 4IMRA 2A92A 2VWHA 3P2OA 4KZPA 4LRTB 1MP0A 2YHUA 1LI4A 4TRMA 4IUYA 3QA9A 4BNVA 1KVRA 1U3WA 1UXJA 4BNMA 2D5AA 3GMSA 3O8QB 4BNIA 5I7EA 2O3JA 3D3WB 2PV7A 5IXYA 5KVCA 2JCXA 2VRBA 3EK2A 3E5MA 3DR3A 3GT0A 2I5PO 3BAZA 3NT4A 1I3KA 5EMHA 4BO5A 2D8AA 2BI8A 3JQBA 2JCVA 2NU6A 1DXYA 5LDGA 3Q1LA 3R3SA 3GN1A 4FGWA 1DRVA 3GQVA 2O4UX 1UDAA 1NVTA 2J8ZA 4YJHA 1ISFA 2EWMA 3NYWA 4GVXA 2HRZA 3ZNPA 1NFRA 3JYNA 2Z5LA 1I10A 1ENZA 3VHRA 3DTYA 1ISGA 4CM8A 1EEHA 4LGVA 4FJ2A 3H2ZA 1E3EA 1V9LA 1TT5B 2O3TA 3BIOA 3VZQA 4DUPA 5KJCA 4CM1A 1MX3A 1PGPA 5BSHA 4IQGA 3BMNA 4DPKA 1ZW1A 2Y0EA 1E5LA 4TKMA 1YL6A 3NTRA 3TFQA 4FOSA 3NJ8A 3KTDA 4DIFA 3RCBA 4LRSB 1ZK3A 6LDHA 3O26A 3EYWA 3P19A 1UR5A 1YQXA 1SC6A 3GNSA 3H3JA 1DFHA 2P2SA 2VWPA 4M86A 4B3IA 4TSKA 4Y67A 4FPXA 1Z74A 2AG8A 1H2BA 4YAJA 3S8MA 3E9MA 4R9RA 3V1UA 3PHLA 4QUKA 1JA9A 1J49A 2AQ8A 3DZFA 1EUCA 5JC8A 1W8DA 4DYVA 3EDMA 1VI2A 3PZBA 1GCOA 5G0TA 5COQA 1DC5A 2JJYA 3NUGA 3GRPA 3I9JA 2EW2A 1MXFA 4PLGA 3UGKA 3JYQA 2AHRA 1KVSA 4YR9A 3I5MA 3ADPA 3TZ6A 3GVCA 1QR6A 1O95A 1CDOA 3ZWAA 3WWZA 3WGHA 5JAZA 4GWKA 3K8ZA 3RUHA 5A06A 1Y1PA 3K30A 2J5QA 1SOWA 4J90A 1QLJA 3GMDA 4PG5A 2JAPA 4RVUA 2NACA 3WSWA 2JCYA 4QSMA 1PZFA 4J3FA 2Y67A 2VT2A 4WNCA 4XYBA 3CKYA 5IDXA 2Y1DA 5TGDA 4IDCA 3EVTA 3E8XA 2QZZA 4Q3CA 3SLGA 1X14A 1VPDA 3DBRA 3IJRA 1BW9B 1EUZA 1P77A 3G1TA 4E5PA 4OSPA 1DBVO 2PH3A 5DT9A 4A03A 4RV9A 4MVJG 1PZHA 4BGIA 1Y8RA 5HBRA 4X54A 2W98A 2XF8A 2AW5A 4ESOA 3VPHA 3B1JA 3IDSA 3GDFA 5A03A 1U4OA 1O89A 1PWXA 5B1YA 1QG6A 2QZ9A 4I5FA 3Q3CA 3OIGA 5FI3A 4DQXA 4XZ3A 5DCUA 1CERA 4J1QA 3AUAA 5BSGA 4PLCA 1SEPA 1KEPA 4PG7A 4E2ZA 3VDQA 2EERA 4PLPA 3CMMA 2C29D 3C8MA 4IJKA 3FD8A 2VYNA 3WQSB 2A35A 4L9RA 4CMBA 1E92A 4DLAA 2DFDA 2ZB7A 2X58A 1P0FA 5L7WA 4M49A 4CM5A 1NX6A 2DBQA 5DBGA 1E7SA 3LF1A 4CM4B 5IG2A 2HSDA 4J7XA 3KO8A 2BF7A 5GY7A 1A7AA 1GZ4A 3RU7A 2O50A 2G1UA 3DFUA 3MJEA 3OECA 3WYEA 2C2XA 1DC4A 1QRRA 2P9EA 2BI7A 2EJVA 4BKQA 1I2BA 2PD3A 2P68A 4RF5A 3OJFA 4XJTA 1T26A 2YY7A 3SEFA 1EK6A 4GX1A 2R00C 3M6IA 3OJLA 3ZV6A 4WLVA 5COAA 3A14A 4XQ9A 4BKOA 4H16A 5KJFA 5IZ4A 2ZB4A 5JDIC 4FDAA 3VVBA 4IIVA 3ROMA 4NFHA 3WGIA 1YOVA 1DHTA 4Y6SA 5DOVA 3GEDA 5G4KA 4GGPA 3OP4A 4O59O 1U3TA 4B7UA 3HNPA 2JKVA 4WOJA 3WQRA 3R0IA 2AQKA 1K2WA 2QQ5A 1MC5A 3TZCA 2P4QA 3Q0EA 1I32A 1J0XO 2B37A 4L75A 2F00A 1CRWG 2NADA 3RI3A 5G2OA 4ZJUA 4FFPA 2O3SA 3B1FA 4YJFA 5COBA 1Y5MA 5A02A 3W1VA 3DWFA 2GASA 3UW3A 3SC4A 1YVEI 5TQVA 1F0YA 1PQUA 5A05A 2NVUA 4ZN6A 1FF9A 1BG6A 5TNXA 4HKTA 4PN3A 2C2YA 2G17A 4O63O 1KEVA 1PIWA 2E82A 4U8GA 3K9QO 1SNYA 2ZYDA 4D7AA 3F46A 1R4NA 1IHXA 1N1GA 4ZQBA 3E1KA 2FSVA 2GZ3A 4IDGA 1YGYA 3GHHA 1P9LA 3A1NA 3HN7A 3K73O 3OICA 3AM4A 4GI2A 2UVDA 4KTVE 5J23A 1FDUA 2C7VA 3DBRB 4W9NC 1UXHA 3ZHXA 3GFGA 1H0KA 3KOUA 1CEQA 1LLDA 2NTNA 3BMNB 3JD2A 4E6PA 3W4KA 3QWFA 3ASVA 1Q0LA 2OBYA 4IZIA 3PWSA 1B14A 2DUWA 1DLIA 4R1NA 4CMIB 1LRJA 2WDZA 3LZ6A 4TZKA 3JQFC 4JP3A 3ZU5A 1DJQA 3GZNA 3R3JA 4RPLA 3OJEA 3DTTA 4BB6A 5EJ2A 2VT3A 1T25A 2AQHA 5H81A 4CQMD 1FXSA 4CM4A 4UEKA 3UHAA 4WPGA 1NM5A 3H9QA 1GYRA 2GPTA 3BMQA 2DBZA 3L6DA 3OIDA 4NU6A 2R6JA 4IS3A 4N18A 5I8ZA 5I9MA 2EHDA 2H5LA 4WNIA 3KSZO 3WTCA 4FS3A 4N7RA 1R6DA 3HZZA 1N7GA 3VH2A 4NI5A 2VHWA 4TMFA 1I2ZA 1QP8A 4BNWA 1DPGA 2H6EA 1MB4A 2GYYA 3EAGA 3ENKA 1QYWA 2AEMA 1HDYA 2GO1A 2D1YA 3IKVA 4HY3A 4EJ0A 1E7WA 1BGVA 3ETEA 4JK3A 3F9IA 4R1TA 3V2HA 3VPGA 1SBYA 2O2YA 4WCDA 5TJHA 1PJ3A 4CV1A 4NJOA 4MJLA 3LT4A 1BRMA 4AJ2A 1G1AA 3WMXA 5ICSA 3ZWYA 3G17A 5A04A 4MVJM 4II2A 5BR7A 1J5PA 3PFWO 4WCFC 4R5MA 2ZJ1A 1FDSA 4JX8A 2VYND 3OJOA 3NDRA 3ZGYA 4CM8B 1YWGO 4C7JA 1DIBA 4XYGA 5T6BA 3KYDA 2HU2A 3JQGA 1E3SA 8LDHA 3NEPX 3KSDO 2C54A 1JKFA 2B69A 4WEOA 4QEDA 5TX7A 5EQDA 4HX5A 3L4BC 4P38A 5TSDA 4OO3A 4YQZA 1C0LA 3NX4A 3KUXA 1YQGA 2B4QA 2RIRA 4NFSA 2OXIA 3RFXA 4RJTA 1TA4A 4FBGA 4NZ9A 1WLYA 1VJTA 4IDBA 2YV2A 4DWVA 1NPTO 4OKNA 2R2GA 2JD2A 3AJRA 4R4JA 3JQ7A 4FFLA 3ZWNA 1EE9A 3ANMA 1XQ6A 2CSUA 1YJQA 2ZTUA 4LMPA 4FC7A 2FSSA 1P3DA 3I23A 3GEMA 4D44A 4L8VA 4HV4A 1R0KA 4PLHA 3CTMA 2EJWA 4BGUA 1IY8A 2J3JA 3TDKA 4FFMA 1CQJA 3VKUA 3IC5A 1U2GA 2JHGA 4AJKA 2CZCA 2DKNA 1X7DA 4CM9A 2DTXA 4IDEA 4FN4A 2X0JA 4KWHA 3DBLB 4CMHA 3I9OA 4EEZA 3GF4A 4E5NA 3DOJA 4QXMA 1QYCA 3QE3A 4ZICA 4KQXA 3V5NA 3PQFA 2NLOA 5L3ZA 3S55A 4NQZA 2VNSA 2DBVO 3QVTA 1ZJYA 3D3EA 4B4UA 1V0JA 3UVEA 2QRKA 4O5OA 1GL3A 4ZRMA 1H93A 1L7EA 3BTOA 1YB5A 3JYLA 2YUTA 4NBWA 3RBXA 4A0SA 1K6IA 4BNKA 4YACA 1ZO8A 2BLLA 4BO7A 3S1LA 2W4QA 2VOEA 4BOYA 3R6DA 2HK7A 4ALLA 1SAYA 1BDMA 3O38A 3JQAB 4H15A 2JD1A 3GGOA 3PDUA 1GR0A 4QECA 5HM8A 1XU7A 4D3SA 5A4DA 1N8KA 3VZPA 5L7TA 2AG5A 3O03A 4MPDA 3X2FA 4CMGA 1VKNA 5CEFA 3ZW9A 4DL9A 3RJ5A 3WNVA 3ONEA 3E9QA 4EBFA 3U4IA 5B4TA 1TB4A 3LK7A 4CLRA 3MJ4A 2HJRA 2PZMA 1UH5A 4PRKA 2E49A 5C7IO 2X23A 2BHLA 4WJZA 4OH1A 4Q3EA 3BHMA 2ZATA 1QXSA 3QWHA 4P4LA 3TJRA 2J3HA 3U4DA 1GY8A 1PGJA 2VUSA 1T2EA 4HFNA 5CAEA 2CVZA 2PNFA 4XD2A 3DBVO 1ADBA 4NJMA 1PX0A 2C82A 3JQFA 3ZNQA 5JDCA 5HTOA 4U0KA 1T4DA 4XRRA 2O7SA 1E3WB 4AJIA 4DYDA 1RWBA 4J4TA 2TMGA 3VPXA 1Z45A 2IEDA 4BGVA 2UAGA 5F21A 2WMDA 4PLVA 3QWAA 5KVQA 5CDGA 5A5FA 3BMOB 5MGBA 4RDIA 2YQ4A 4TQGA 2PD4A 5TS3A 3DZBA 3INGA
chains in the Genus database with same CATH superfamily
1XDDA 2BZGA 3LUFA 1TRKA 2Q9CA 4C0HA 4XIGS 4W82A 1WUHS 4L5CA 2C77A 3NT2A 2EP5A 1GXSB 1ACLA 4XEHA 5JVDB 1PW5A 3VH3A 2CXQA 3MG9A 3SF8B 1KZ4A 2MU1A 3MXTA 1LSJA 3TKYA 4NMXB 4UFNA 5E1DA 5TLSA 1ECGA 2PA3A 1V7QA 3CUSA 4UNSA 5HS4A 4PIPA 3EFEA 4TQ9A 1G9XA 5IKEA 2C7GA 3IO3A 1YTLA 1B2RA 3I12A 1AXEA 1PFWA 3RFVA 1IB0A 1QRSA 4F6LA 3OZVA 1XD2A 2PRSA 1FDIA 2EQAA 1BCRA 2WSSD 1RABA 3HJNA 2ECFA 2CNDA 4YB8A 1E18A 2FWJA 4G5FA 4P54A 4M7WA 3OZBA 3L8CA 4FDUA 5IS2A 4RK6A 3D3WA 3P1JA 4JB8A 4LXXA 1GR1A 3IQZA 4EKYA 4QWWA 2OBFA 3QTBA 2VHQA 3K20A 1T5OA 2VYVD 2O0MA 4I36A 4HDKB 3HDTA 1F8XA 4DMLA 4ENQA 5IJWA 1ZJZA 2DFVA 5ALQA 5B12A 2EFDB 3KE8A 5DK4A 2ZSBA 3OEYA 5A6SA 1TMKA 2H0RA 4LECA 2VTVA 3UMVA 2XH8A 2IWRA 4O4JF 4MK4A 1OTYA 2VXOA 3FCUB 3L49A 2GZDA 3SU8A 4R1OA 1RAGA 1BXZA 1KI8A 3HR7A 1DKMA 2GT1A 4F4JA 2HWKA 4LJ8A 2PK3A 3I09A 4KLAA 1VMEA 4Y7CA 1PD1A 4YXFA 4Q47A 3UHFA 1WP4A 3MSXA 3ZGZA 1CCWA 2O1SA 4JP5A 1CUUA 3FTPA 2IY9A 3UJCA 1P91A 1FTNA 5CLGA 5CXXA 3JWEA 4R8SA 1NOIA 4CE6A 3GC6A 2VJLA 1YH3A 2B4YA 1M1YA 1J2RA 2H1SA 3K6JA 1FNMA 5E2AA 1DKQA 3OIYA 2N75A 2ZYHA 2NO1A 3PA8A 2XUDA 4LQ4A 1YT5A 3LYAA 4FHFA 1YMQA 1X9GA 2GKGA 2YYSA 2SECE 1TAGA 2CLMB 3GLRA 4KIUA 2ABWA 1C3OA 1XVAA 2ZITA 4RD2A 5LBTA 3V6MA 4MPPA 1E6LA 1PNTA 2XGOA 1IEQA 3IE1A 3AR4A 4IXTA 1H5QA 1S8NA 4L57A 5HIMA 1QH9A 4TLEA 9LDBA 2XHEA 4F9TA 5B2EA 2FMTA 2NWQA 3L7AA 1U8AA 4QG3A 4NU0A 3HBAA 2XDQA 3GLGE 2PJUA 3N74A 1KJWA 4C5AA 5BSKA 5ADUS 4RIIA 3UNXA 3KAQA 3H5RA 3E9NA 2R8YA 3R7WB 2FV8A 2XJ4A 1WPGA 2YY6A 4XDGA 1A5SB 5AM4A 4YP5A 3SDBA 2RGGA 1GKIA 1OTHA 1IXZA 2GTIA 3FGZA 4G5OA 3UK6A 5B7GA 5KUTA 2QVGA 4U2DA 1DELA 3K0EA 4D8VA 1O96B 2A4KA 3MCUA 4PN7A 2I1VB 1NJGA 1GEGA 1KMNA 1TE2A 4BVJA 2HBRA 3AOGA 2KB0A 3P20A 1AGYA 1ADJA 2QG9A 1L3CA 4WLFA 5JH7F 1R0WA 3G9QA 2HF7A 5DX0A 5JAIA 4XSVA 2WABA 5DHAA 2WTNA 1T3LA 1K7FB 1USGA 4IEEA 2GLUA 4ZVMA 4J29A 5D3MB 3UT5A 3DHEA 4LTMA 4POAA 2IFTA 3ZCRA 3BZBA 3AM3A 3H4TA 3KWMA 1UKAA 2O2DA 4Q9AA 4QE3A 5B2FA 3T3OA 4X45A 2QROA 2WRZA 1H8ED 3EZYA 5B57C 1WP9A 1NRWA 2IZ1A 2WT9A 4B7ZA 1CR0A 1V41E 1VYVA 2ODTX 1N7HA 3QE2A 1EFHA 3D7LA 3SNHA 3V42A 4MINA 1PV1A 2EKPA 1M0SA 4L08A 3QVOA 5FNZA 4TOIA 3C8DA 4WERA 5HIJA 1M1ZA 2G36A 3I32A 3HLTA 3G8YA 3JR7A 2GBPA 4JYCA 3MTEA 1ECBA 3NZEA 2X6QA 4BO6A 1E77A 1E8MA 3UKOA 4ZOAA 1R8QA 2ZWMA 3T3MB 5F1PA 4QT0A 1QAMA 3WJ1A 2VTDA 2ZIWB 1RWMA 1ULHA 2WVHA 3LLSA 3QKUA 4NARA 3UJBA 3EZGA 1KETA 3DE7X 3QHAA 4LA4A 4OQNA 3T9EA 5K2MA 4Y2RA 5TF4A 4URXR 4PG4A 5FUYA 4MI9A 1K8XB 3CUUA 1W2GA 1SUBA 1G9SA 2HV8A 4NBVA 2QB5A 1E9DA 3WMGA 2AZTA 4LOIA 5BXYA 4BB5A 2PX5A 2CNLA 1WMSA 2JJ2D 2YMMA 1OIXA 3OM1A 1YDHA 4OGFA 4ZXPA 3EXHC 3S7TA 5ERYA 3Q0IA 3C98A 3C43A 3M1AA 4XDZA 4J4BA 4ARIA 3ILSA 1GPKA 4MS1A 4X64B 3FMPB 5CVDA 1QVVA 1IZYA 4XIJA 2QUKA 4DAOA 3RHFA 1BS9A 2FPMA 1WBDA 2XXAB 4MYUA 4MVCA 1OAAA 2XIQA 3NBKA 4MCIA 4MTCA 2XITA 4IMJB 4MWTA 3HO8A 2IC5A 3EMKA 5H0IA 4MRVA 2HNKA 3V55A 5HOEA 5MDHA 4ZU3A 2EXXA 1NPDA 3PUVA 1KMMA 4K9MA 4TRJA 2XHZA 3MD0A 3WDSA 1UMBA 3OG9A 4AMYA 3ENZA 2HCJB 4CKWA 5I9BA 3JQRA 4A6PA 1U8YA 4HZUB 4A0RA 1QV9A 3QU2A 1Z2NX 3CF2A 4L50A 4ND4A 4BNHA 1SB8A 3WB2A 1F8GA 1G2QA 1VHQA 3EPKA 1EGMB 1ML3A 1PFVA 4E7PA 1BE1A 2UYOA 1CVLA 1MTOA 2RHRA 3CZRA 2D4HA 2C7RA 4RLSA 1VJDA 3QOYA 5TE9A 4KPUA 4H3SA 4LNUB 4MH0R 4TKUB 3TLGA 4BVKA 1YMUA 4XFKA 1W76A 2BCJQ 4HTFA 4E2WA 1VFNA 3DNFA 2CXHA 4OQYA 3EFOB 4B71A 3RUDA 2P79A 3U48A 2C5AA 2H4FA 2N1BA 4GAEA 4ZCRA 1IQRA 2LCQA 2HHHB 1TM3E 4YRZA 5EP2A 1J8FA 3BGOS 5IDWA 4EJSC 4QREA 2B5OA 5HQ3A 3JAKA 3FYSA 1FZTA 3BA1A 2H2DA 4M46A 3MTDA 5JAQA 4HT3B 3DL7A 4FQ8A 2X22A 1SXGA 2AR0A 1YFJA 3TCNA 1RAHA 2QK4A 4G9EA 1ODKA 1KR2A 5IM5A 1ZHHA 5CA0B 3B13B 4KI0A 1FFDA 2E18A 1F12A 3K6SB 3KZXA 3QEKA 4UBIA 4C9BA 2HIMA 4O2LA 5C51B 1U7OA 1TT5A 3WV5A 2GF2A 5I7UA 1I7NA 1J42A 4WLNA 4P98A 3MBIA 1EPUA 3STYA 3FDIA 3NV7A 3GP8A 4L4RA 2ZBFA 3AUXA 2CY0A 3JAWB 3OVMA 5EPEA 2AC2A 3GEEA 2B4AA 4AKTA 2NXCA 4OHVA 3S2ZA 3S1AA 1Z5GA 4D79A 1BDIA 4OV6B 3E15A 4B3TB 3EFOA 1ID1A 2DM6A 4M88A 1DXOA 3ROPA 4KXUA 4ZCQA 2ACWA 1LPMA 1TQDA 3RVKA 1BFKA 2HYDA 4DZTA 4OUKX 2J0UB 3ZV4A 1MABA 1JT9A 2HDOA 4M22A 2JIZD 4OXKA 4PZAA 4HAIA 1Q17A 1U8TA 2I6FA 2WIGA 1HT0A 3LXRA 1JFTA 1R4MA 2LCIA 4AJOA 2GDZA 3AILA 4R16A 4IIJA 4NBNA 5AVUA 4YMGA 1QMGA 1NF9A 1ID8A 4IRUB 3RK4A 3QYPA 1MJNA 3TKLA 4KBYA 1Z06A 4XKJA 1EUQA 3VJRA 4NNOA 3FWYA 2O8BB 1C9MA 3OT1B 1N77A 1KRXA 4HH0A 4MP3A 5CEJA 2BWJA 1NVVR 2ZKLA 3Q5EA 3CN7A 2IHTA 2GEJA 4U8HA 3KAPA 3HLKA 3UCXA 1A9TA 3HUDA 4CJXA 2G67A 2VSFA 5CFQA 1P39A 4LDQA 2I91A 2B7CA 4LJ9A 5ADHA 4RY8A 2R60A 2WV7A 3BRWA 3C6MA 3CPEA 4PGAA 2QNRA 2CCJA 3WGTA 4MVJE 3F7OA 2CVQA 3MWYW 1U7TA 4LN1A 1NN0A 3HS3A 4KAXA 4UVGA 4BS9A 1VKOA 1L9XA 4H1UA 3OF2A 4IZHA 3FDFA 3PXDA 1ZICA 4TYNA 4TVSA 4H0CA 6ADHA 3DLBA 1MO6A 4RKQA 3N0RA 4ZPJA 2HSZA 5DT2A 4AN1A 4P58A 3R6TA 4XB1A 3OZFA 2QNBA 3RFFA 3O9ZA 4HRXA 5G0VA 3AF2A 4D9HA 1YCFA 3OH8A 4ZZIA 1RIIA 1QAQA 3HJUA 1BHQ1 3BXXA 4QG7A 1CY1A 1Z34A 1NMXA 1WULS 1OSNA 1M74A 2EIHA 3KTAB 4RH3A 5GJCA 3RKSA 1X13A 1GJRA 3CR7A 1W4CA 2HEIA 3QW2A 4FK8A 4BMPB 2YFKA 4CEJB 3GNLA 2W6OA 1NJ2A 3H4IA 1PWEA 1TZBA 4K5QA 3PHBE 5HZKA 3JQAD 3MWLA 4X6XA 5BMVF 1JWLA 3MCTA 6ABPA 3BGDA 1Z28A 3QKRB 4LOLA 1Z0KA 4OK5A 4Q7MB 4HGYA 4CT5A 1KNQA 5MN5A 4GI5A 4MQUA 5I45A 2PBFA 4TWZA 1GTVA 3DW3X 3H8VA 2QJOA 3L92A 1CKEA 3PDHA 2QM7A 4LDJA 5KX5A 1SOVA 1CS0A 1QH8B 4LZJA 2OP1A 1Y81A 2ZRAA 3U44A 3OJXA 1UF9A 1QIHA 1GPH1 4P82A 3SY8A 1B93A 3U49A 2KS6A 3UMFA 4JYAB 1FX0B 3LUGA 3E81A 4BGPA 3U16A 1Y9JA 3MW8A 1DUSA 4I8IA 4DRXB 5LNK6 1IEWA 4P93A 4DEYA 2QAGA 1JDZA 3UBTA 4RA9A 5B3AA 4JJAA 3D4IA 1YKSA 1HFEL 3C3BA 1FFYA 3WRVA 2QLMA 4WASA 2BVNA 3AIKA 4TMKA 4BN4A 4DDHA 3HFSA 2ILVA 3OJ0A 4LJ4A 3WTBA 3F96A 1U5CA 2PXCA 1MX9A 3O4GA 3BDAA 1BHSA 1BEUB 1MEJA 2GHIA 2P1ZA 2IEYA 3N2NA 3WBFA 4BPRA 2WTUA 1CEXA 2YC4C 4TUYA 3ROGA 4GEKA 3NGLA 3T7KA 1FZQA 1LLQA 1VPEA 3HXKA 3U7HB 3OE7D 4N39A 3DZIA 3KYCA 3E03A 4LKOA 1V8DA 2FZEA 4GMDA 3CISA 2GMWA 1I2CA 1FJHA 3KZNA 4MWSA 3LH5A 1EK5A 1QHFA 1ZISA 5AUOB 3M5DA 4F5ZA 2I3AA 1CJBA 4FFWA 3SYRA 1WB6A 4WINA 4QVIA 3IIEA 1NUQA 4YRQA 5D7NA 3OIFA 5IC6A 5CNMA 2H2IA 3NGXA 3T34A 4RORA 1QZTA 2QLJA 1PJSA 4UHHA 1HQYE 2WR8A 2XUQA 2R6HA 1YACA 2IVFA 2QTVB 4WK0B 4CIBA 2XMQA 2PGDA 2IDZA 1KPHA 2Q6LA 3FPEA 3H11A 3K0KA 4I2VA 5E6SA 4C14A 3QF4A 3EGWA 4IJMA 2ZBRA 4YRCA 5DU2A 2ZZKA 1VL1A 2IXEA 3MVEA 5IMBA 1JKJA 2DPGA 1RE1A 4IZOA 2H1VA 2OCDA 1FFHA 1QDLB 1WU7A 3O83A 3QUAA 3ELBA 4I50A 4PGMA 3U39A 4ZJPA 1OH6A 1KO4A 1MOPA 5TQ0B 3RC9A 1O97C 1ZQ1A 1OC4A 1SIBE 4AULA 5JXWA 3E1GA 2OKGA 4JUDX 1V1MB 2XCTB 2IYVA 3IMEA 4BMSA 1EXMA 4WUVA 2P9ZA 5AKIA 1MNAA 5FPSA 1FSPA 4M4SA 3A9VA 3U37A 2J32A 2GPNA 4Q3DA 2IQIA 5CX4A 3ME5A 3MERA 4NC9A 1TU4A 3KYDB 3WWCA 5IABA 4MW0A 2VTBB 4OI0A 1V95A 1QZ3A 2ET6A 2K2QB 2O3UA 3HU2A 2ZSDA 3IPCA 5T64A 3T6KA 4KW7A 4DLYA 5KWEA 5LSAA 5AXAA 4Q7JB 1MF7A 3BD6A 4I1OA 5J4YA 4F86A 4S24A 4Y2GA 2DUUA 1SCIA 2KLHA 1SBTA 3OPNA 5KOJA 1CETA 5CGZA 1A2BA 4XE5A 3TW8B 2QE6A 3H13A 3JQDA 1CB0A 3S3TA 2V0GA 1MGPA 5KNCH 3TLYA 1UP4A 3NBYC 3CO5A 1R88A 4GMFA 1Z6AA 3G23A 5CURA 1XI2A 1NKSA 2QPLA 1SVLA 3AEXA 3GG9A 1BN6A 1QONA 3H0KA 2HLPA 3WIBA 3MTJA 2F59A 2NU6B 5G41A 3V4OA 1Z36A 3N2KA 3G3EA 4BDSA 4HMPA 1QF9A 3L7JA 1QH8A 4OJNA 2VZ9A 4RZIA 2H29A 1JHAA 4BKRA 2VQ3A 5FOQA 3FCAA 4BEBA 1BXKA 1V16B 3JYHA 1L4BA 4KX3A 5DSTA 3I6BA 1KI1A 3AI3A 4WQMA 5K3DA 2CVFA 4GXNA 2HF8A 3EXHA 1G7SA 1JSLA 1FP7A 2OB1A 4G1MB 2AJCA 3W5HA 4DLLA 5I3ZA 2RMKA 1RXIA 4G67A 5DXJA 3Q9NA 2W2LD 1T9DA 1V7PC 2NTYC 2QBYA 4DDMA 4HYEA 3L7KA 4R5HA 1R50A 1W6UA 4ZCSA 3EGVA 4D8XA 1WPQA 4CEJA 2I99A 1YXMA 3FTNA 3NAGA 4A8PA 2CB0A 1L5VA 3MB8A 1QZUA 5TC4A 1HI9A 4PZPA 5LIRA 2ACVA 4DV5B 4MWDA 2XCQA 1NU6A 2UZ1A 3TGPA 5EJIA 4A8HA 3EW7A 1RSZA 4BAZA 5JWOA 4JVMA 4ZVNA 1E6MA 3O2QB 2HAEA 3LPMA 4NP6A 4M0UA 4C0XA 4DTIA 3W5CA 1K97A 5FWYB 1KEEA 4FIDA 1ZUNB 3D8SA 4GH5A 1Y48E 3RFUA 3U1BA 4LV5B 1QHHA 4HDMB 1SVNA 1FFGA 1ZOSA 3CW9A 3LECA 2IOFK 3CZMA 4WV3A 1JQJC 2WEKA 4NAUA 3MFYA 3HEAA 3W06A 3OOWA 5A9RA 1VPTA 1XZEA 5JYDA 2ZJ5A 3QG1A 2EARA 2HJ9A 2QSYA 1R0YA 4FKBA 3WR5A 1O5TA 2QHXA 3QLVA 4HAOA 4JBIA 1AKRA 2AEJA 3ICWA 5JAOA 5KOYA 1V71A 2CF5A 1WW2A 3QLUA 3WHLA 1QTRA 3OP1A 3SS7X 4YCDA 3NM6B 2B61A 1ZD2P 1BOOA 1X7ZB 5JSZA 3PTLA 2OUKA 2H2AA 2H57A 4EOGA 2ATEA 4PAMA 4Z4QA 4P7FA 3ROQA 1JJAA 1LZLA 4IQ8A 4EA6A 1ZD3A 1K89A 2YKGA 4C4TA 1D0SA 1WDWB 2PEZA 1M2WA 3TNFA 5CTAA 4LYEA 1N4AA 4B3DA 2UUBB 5DYIA 1ZNQO 5LBUA 3R9XB 5CB4F 1YRQA 2IEIA 4Z0TA 1QP4A 2HIHA 2AJBA 3OSZA 5JASA 1PLJA 5C53B 2ES4A 3FTFA 3EWAA 3NM5A 4JR0A 1K0UA 2WJYA 3GDWA 3RABA 4RVHA 3IDZA 4C4XA 4YUAA 4OBXA 1U63A 3CNBA 3TXYA 1OX4A 1H4SA 1ABFA 4L4YA 1ONSA 2AK3A 4I4TF 3VRHA 1B6SA 2W2KB 2J0UA 1G3UA 1HXHA 2IWHA 2HGSA 3ZYCA 1MA0A 3FCEA 3HJGA 4PZEA 1KYQA 3LS2A 4MW6A 4NK5A 1XYYA 4YS6A 2G9ZA 4DQ0A 4KQGA 3V1MA 4C87A 4RJJA 3OQHA 1GAQA 2PPLA 4YAGA 1N6IA 1JIKA 1O4WA 1W1WA 4Y9DA 1MOZA 1N2CB 1N5DA 2Q3EA 1YSCA 1T2UA 4UUMA 5JW6A 1V39A 4XRGA 4DKJA 4WN9A 5IW8A 3OX2A 3ZHCA 1O57A 2DTDA 1ML4A 1Z12A 4F72A 1EGVB 1XMPA 2ODPA 3DDOA 4OVKA 1DV1A 3IEPA 4O0MA 3DHVA 1KC1A 1GFIA 1SH7A 2J67A 3AB8A 2IVZA 1Y9AA 3E2IA 4QU9A 4EB0A 4ZHSA 3GLIA 3JQ8A 3FOEC 4E3WA 2EDAA 2ZYVX 2CJWB 2I8CA 5FNVA 4E3ZA 2WC1A 4K9PA 5EP1A 2VTEA 2YWEA 4F45A 2G82A 1CF2O 1RM5A 3KZKA 1DI0A 4DTCA 3HL0A 4UTZA 1DX9A 1NM5C 4L6AA 1E1DA 3FE2A 3NYRA 2IYQA 2Q5OA 3H17A 4GGMX 3G6KA 4CVNA 3CCCA 1AO3A 3KWFA 2JFHA 2PKCA 2VH5R 2YNMC 5CDSA 4QYXA 3V1YA 5EYPA 2QRVA 1V45E 2HMSA 1WW8A 3CLTD 1MPTA 5K7SA 1F2TA 2OO3A 4MGZR 1QUFA 4KE6A 3FA2A 1Y63A 5KJEA 1VE1A 1E2DA 1LJLA 2APJA 2M9MA 1TEXA 1F14A 2PS3A 2DT5A 3BRCA 1V26A 5K0FA 2CB9A 2J4FA 2JFFA 5K8UA 1QKKA 4RKYA 1HZZC 3WGJA 3ZZTA 5H80A 3JV7A 4FCWA 2C2GA 5TRTA 3M82A 3CX7A 3H83A 5F1KA 2W6PA 4IQ4A 4B81A 3WC4A 3LXMA 4CM7A 1SXJB 3QVJA 5KQGA 2G70A 5JPDA 3VKHA 4LGYA 1YQDA 1N2CA 1T2CA 2FW0A 3K1AA 4BATA 2J9RA 2OAQ1 2O6HA 3BMCA 4D3FA 4ND6A 4IQFA 3DM9B 1I4OA 4GSLA 5HUQA 3EDYA 5JCJA 5H59A 4NV0A 2PT5A 1AUQA 3KRTA 3NEAA 4DV6B 2PR2A 1KI6B 4HDSB 5KPDA 3VZSA 1QHSA 3NHBA 5IYZA 2ZGVA 2DR2A 5FA6A 2VHVA 3N0WA 4EG1A 3GXBA 2PUFA 4FGJA 3C3XA 4DPLA 3RTCA 5J4HA 5CA1F 1BVHA 4YI5A 2ODQA 3E7PA 4GUAA 2IPLA 2EKQA 2AG0A 1WVIA 3VO1A 1G5TA 3TAXA 1Y7TA 1FU8A 4M7OA 1KDZA 2FQWA 2VQFB 1PTJA 1OKKA 3LY5A 4FNMA 4EYEA 2DXIA 1FNBA 1NMSA 5ER9A 4BIIA 3IP3A 4KBFA 5B4UA 2RC5A 4Q4AB 5GPBA 5TT0A 1JSZA 4A4DA 4IS2A 4ZV7A 3H2GA 1MG5A 4O1MA 4U9HS 3G0OA 5K3FA 1YI0A 3K1ZA 3QVGB 3AR5A 3L07A 2AE2A 3HPRA 4RDCA 4DANA 5HIAA 5EE5B 1YIOA 2YNMA 4GDMA 5JSZB 4QM6A 1UL1X 2C42A 2GOYA 4RD1A 2Q1UA 1R9MA 2SHKA 5INTA 3OQOA 4LF6B 3LQ4A 1RTTA 1N32B 3A6DA 3KYJB 1SOAA 4WLOA 5E7QA 1XJCA 2BKAA 2BJWA 3OD1A 1VYUA 3V4LA 3CSDA 3WQBA 1LGYA 2XNKA 3ZDEA 4LTDA 3CSUA 4TZ6A 2QRLA 3DCYA 2PUWA 3EMVA 1DSSG 2PYZA 3L1IA 1AF4A 3HB4X 1NUTA 3A31A 1CZOA 1JDPA 2V9CA 1FS4A 3GH3A 4QTZA 3ENVA 4FYIA 3WFIA 1RAEA 2F3QA 3NMUF 3QNWA 4MVWA 3TOVA 3VR5D 2FRVA 2FZ4A 3CA8A 2VWQA 2L19A 1UBCA 2AFHE 2EBWA 5JI2E 3FYDA 4NDNE 3ZHRA 2J0EA 4NH4A 5CCBA 4O2BA 1D1PA 4GYJA 4MQFA 1VE7A 2OQIA 4PINA 5HCUA 4A0GA 2MT9A 2W2LA 1A76A 2YV1A 1GGVA 3JYOA 4LSMA 5EUBA 3H5LA 3T4EA 5I8WA 3B89A 4R7ZA 1B3BA 1YR7A 5FBKA 4V0ME 4C06A 4MQMA 5GJBA 1Z6ZA 2FG7C 5DSXA 4XUDA 3TTUA 1EB9A 3WYAA 4Q0MA 1C7IA 2CKDA 2O8EB 1GPDG 4HYYA 4BKUA 2NXWA 2ECPA 1ZS9A 3I9MA 5B1DA 2PANA 4M53A 1K6XA 1T2FA 1TEVA 3RAPR 4P83A 1UDXA 4HDQB 3IQHX 4IVNA 4JB0A 2JRCA 4M2LA 1C8KA 3EF3A 3OQPA 4NS4A 4CM9D 1DCTA 3ICPA 4MWOA 2G9UA 2JD0A 4PGFA 3KBOA 4TV8F 4FNAA 2BBOA 1VSQA 1FNNA 1MAVA 3RRNA 4AW9A 1X39A 1MJ5A 2DF8A 2VF7A 2OXFA 4IUBS 4W6ZA 3CTPA 5FL7A 3ZZ0A 1KH3A 3IAHA 4Z9YA 1EXVA 3CNNA 4E4YA 4AAYA 4JLDA 1W19A 3DH0A 4B8ZA 2GQ0A 4TWBA 1EXWA 1CPYA 5DF1A 4MHOA 3WB0A 4MVJP 1N6RA 4PXAA 3IODA 1QPZA 5F7JA 1L4EA 3AL0C 4FGZA 5FTLA 2ZYIA 3K9HA 4F04A 3ZCQA 4YFVA 4O8CA 3PSHA 2RGDA 1DCFA 2BR4A 3HCAA 3CWQA 3QLVC 4HDAA 4QNRA 3R4CA 5A7GA 1ZINA 4QQ8A 2ZR9A 2QMQA 4CKZA 2D7JA 3BZWA 1SQ5A 3CBQA 4C2TA 2NVBA 3PUYA 1IY1A 4IUCS 5FBLB 3C6YA 2ZG6A 2FMHA 3BK2A 4J0GA 5HRCA 1SIWA 4ISBA 4YECA 4KFCA 3LVRE 5LP1A 2ZVPX 4GBJA 3SJ7A 5CDHA 1YR9A 1PYDA 1UFOA 1Y3HA 1QPBA 2IV3A 1QB8A 1VLZA 4RPIA 1UKVY 2BFCA 1OWPA 4PYIA 1UMDB 3CRQA 4HUQA 1QVZA 4LI0A 4S3MA 1UOPA 3D6MA 4P4GA 2HK8A 4ENUA 1JEYA 1GM5A 5THKA 1XTSA 4F9EA 2OBMA 4XYLA 5PGMA 4ZIRA 1T1SA 5ER6A 1JWBB 3KJNA 4B0OA 1JDUA 2QF7A 4E31A 2GAIA 1QCYA 3SEQA 3REGA 3GH1A 4YROA 4Q1EA 4GUDA 3DBHA 3ENNA 4XUGB 4YO8A 3OY7A 2PY6A 2Y6UA 2I7XA 3CUTA 3EZNA 5J58A 3V1KA 4AI6A 2HQBA 2QLFA 2GEVA 3GHYA 2IHJA 1UEXC 3L0YA 1E64A 3DO5A 4QX6A 4I1YA 1P1HA 4F9GA 2JFPA 1RLOA 4DLSA 4S05A 4YRSA 2NU7A 3D6NB 3IL2A 1Q0RA 2Y93A 5K3FB 2V9ZA 4QRIA 2E4YA 1NNEA 2H2GA 3LP6A 4K0KB 1OZHA 4IGEA 3ER8A 1CFZA 1DFIA 2ZJ6A 1PV2A 1FLVA 4YRRA 2DKOA 3MWEB 5U4QA 2I1LA 4PBSA 4XLLA 3VHLB 1T1IA 4BMOB 4EF6A 4TS9A 3UH1A 1YHYA 2GJ8A 3N3AC 5H8WA 3WK7A 2QMOA 3EWSA 2C84A 3KOXA 2ZE5A 3SIRA 3H18A 4EG3A 2DUJA 5MGNA 3Q7PA 2H0QA 4K9QA 1NR7A 1FNCA 1ZCJA 1JJFA 1U04A 1B2LA 5A1JA 1KVUA 4BLSA 4KR3A 1T6YA 4S2UA 1E32A 3OAAA 4OGLA 1DBPA 3H2SA 4R3NA 1NNUA 3EA5A 1QP7A 1KYZA 1DPFA 3U9LA 3QVVA 4KHPB 4ZT2A 2ALJA 2FWBA 3FVWA 4QPZA 3NATA 3I3OA 3CR3C 2P9QA 1U0HC 2OK7A 5A5EA 5I51A 4EY4A 2H9IA 2Q29A 3VTFA 5IH3A 1NA5A 2Y99A 1HM5A 1S96A 2XUZA 3PA6A 1M2KA 4FE4A 2VF5X 3NAQA 4DNQA 1BQ3A 4BP1A 1NJ8A 4UNPA 2AEFA 2VBFA 2YICA 2CMKA 3CEMA 1HE1C 1H5UA 3FRIA 4RVGA 4JJFA 3UHJA 2ZT5A 4B35A 4RIHA 2PM8A 4YVFA 4YDSA 4LAFA 3C3JA 2XWPA 3WXMA 1Z5OA 4YJDA 3D3JA 1PJ8A 3KE9A 1W6RA 4XOIA 1Z39A 3D8TA 1Q83A 2FWNA 2HJSA 2YV5A 1U8ZA 4JBHA 4BU0A 5L9AA 1JX6A 3IQXA 1B1AA 1XZFA 2XYQA 1AQYA 4M9XA 4R1PA 4CN9A 5KNDH 3OKFA 3IVMA 3HK2A 2JK1A 1D0VA 1Z2CA 5AKYA 5ES4B 3TNLA 1SCUB 2VNIA 2X8LA 1E1LA 3G8AA 1T0UA 4HRAA 3WGQA 2UZIR 2ZDGA 5AW0A 2GO7A 1CIPA 4D45A 3FCYA 1NLMA 1EP2B 4RPKA 1Z2EA 5EIEA 3TTTA 3M1LA 2C4HA 4Y6PA 3CM0A 5DDIP 3BEDA 4JIGA 2YW9A 3QPVA 2PYIA 1BYUA 3HCEA 3G85A 2CVPA 4IXWA 5EHIA 4EM6A 2C8LA 4GBMA 2X15A 1GUFA 4GSYA 2V7VA 3K92A 2F43A 3G2NA 1T10A 3RIHA 5E38A 1M6NA 3DL2A 3GGGA 4H18A 3HCRA 4NFLA 1ILEA 3GPCA 4JP8A 2HMVA 4K2HA 5AK0A 2X0DA 4LCBA 4C08A 3ZD8A 3TEMA 1WUIS 3M0EA 3BXZA 5DB4A 4C78A 5JCOC 1I3MA 2HZ7A 1FQOA 2OCXA 2ZRIA 3K0CC 3OHMA 1NC1A 4OY3A 3HCCA 4TYMA 1XUOA 4NCHA 3MGKA 1FS5A 4GZMA 4JJEA 2ZT7A 3H04A 3Q2KA 2HWUA 5E0KB 1T2AA 4IIEA 2IZZA 4B7XA 3TLZA 3JTEA 2BELA 4LS3A 5CDTA 2OECA 1LH0A 2ZWPA 1BXGA 4RVCA 2VYCA 2NSYA 3ZD9A 4F91B 5K3AA 1PG5A 5D3ZA 4U4AA 4PC7A 2TYSB 4RV4A 4YR7A 5HGXA 4CQNA 2YIDA 3BXPA 4ZEVA 3TZLA 1G0NA 1ZVQA 1D4FA 3JQQA 3TRDA 2GA9A 3AI2A 4RMIA 2ZAOA 2PUDA 3ZBQA 5L53A 3A2LA 3K72B 2ZJYA 4I3FA 3DAHA 1UBFA 3F9RA 4R2HA 2XWQA 5GADl 3P7MA 4J49A 2P35A 3PK0A 2F90A 3KB6A 5BYJA 3TCKA 5K6TA 3ZDDA 1T2VA 2Y1CA 2Y2UA 2ISSD 4WLUA 3V4VB 3L3BA 5LYJB 2AJTA 1XTIA 1UXIA 1QC5A 4GC9A 3UK2A 4YPVA 3KYBA 3D7SA 4HNAB 4BO0A 4K6FA 2VCYA 3GDGA 3L0SA 5BURA 3K2IA 3IKTA 4PSCA 3B9PA 1ABEA 3PHJA 3NIBA 2P7HA 5KDLA 2JB9A 2DMRA 2P3SA 2VK1A 1E6CA 3EXG1 2Q4OA 4BPBA 2ZANA 1VIDA 1HF3A 5DGCA 3G2HA 1ADCA 2ONKA 3U81A 4QXRA 4D43A 2DWUA 2R7MA 4MA4A 3LA6A 4BECA 4E13A 3BX1A 5EWLA 3ULKA 3IEVA 1UKEA 2P65A 1YJBA 1VGQA 2I78A 1W9HA 3MQ2A 1T91A 2QL7A 3G2IA 1N34B 4L4UA 1GGNA 5HQ3B 1DGQA 1ZBDA 1XHFA 2A9RA 3DB2A 1XHEA 3LC0A 1L5LA 4A6EA 2PZBA 4JYMA 2FXIA 4X5OA 5IANA 5GVSA 3A9SA 2JDID 3RU9A 1VHWA 3EGIA 4LRUA 3H8SA 3QLUC 1NJSA 4P1ZA 2Y27A 1GPUA 1E1QA 2DFPA 4OBEA 5K0SA 1ECCA 1YZLA 3L06A 1BXGB 1PGNA 2I2BA 2Q5LA 4B85A 1NQUA 4R31A 1GQRA 1NXXA 2J33A 3WL7A 4TRRA 3AONB 5DCWA 1KQOA 1LK5A 4D0GA 1ZA2A 1GUBA 4XWGA 1U2SA 4LMRA 4AD8A 1JAHA 1P60A 1Z8FA 3ZI7A 1WU8A 4K1LA 4ZDIA 2F48A 4AB1A 4W9MC 2R6R1 3VVLA 2JI9A 4QSHA 1XNQB 3BWMA 3PRKE 4KDCA 1JKMA 5KHOC 2Z9BA 1WG8A 1H2EA 3MMZA 2DPHA 5F77A 4I8XA 4XWWA 2LPMA 2OZPA 1PKEA 3HGTA 4DR6B 1IULA 1R0CA 1HDCA 2WM9B 3B20A 1Z88A 4X7BA 3SYNA 1AMNA 2IBSA 1YB2A 4IDOA 3CVVA 2HSGA 5CT9A 4MV8A 1B15A 2QUHA 2W5UA 2A33A 2RGNC 3NPMA 3GT7A 3QWIA 5GMOA 2ZSUA 3MUEA 3U5TA 1LUAA 2G0NA 1ZD9A 4PS1A 1PS8A 1KY4A 1I1QB 1BWPA 3SSMA 4MRNA 3IJ5A 1CS4C 1XZJA 1F2VA 1IN7A 2JAUA 1UPAA 1KI2A 4IILA 4MO2A 4HEHA 1ODJA 1FB5A 1FPMA 3THYB 1XXHE 2VP3A 1GITA 1XLVA 3UC9A 1E1YA 1N8NA 3D5QA 4ID3A 2NMVA 1KMCA 1UPFA 1R0RE 4UQLA 5LQNA 4YUWA 2F8TA 4KWEA 5DWDA 3D4OA 1EP1B 3DBLA 5AR1A 2P0YA 2P75A 2D13A 1UBUS 4U1RA 3U4GA 5AFSA 2MSKA 3RU3A 5H4HA 3SFZA 4D92A 4I0WB 1W85B 1UDRA 2D0IA 5F3RA 4IIUA 4XW2A 2VFAA 3NBMA 4E21A 3IUSA 4RZHA 5JQGF 1FVOA 2W2TA 3ZIAD 4YIHA 4WZBA 4N03A 1POWA 3QEBZ 1HNZB 2ZK7A 4YJ3F 4OLBA 1XPRA 5IZCA 1OUMA 1V47A 1J8VA 2A4MA 5TIIA 3KQUA 3LDHA 5FORA 5FWYA 1BCSA 1GQ2A 5A3RA 5REQA 1S7CA 1UJ2A 1SVIA 4UD6A 4TLAA 4MYRA 4K8RB 1NBEA 1Z4JA 3T9AA 4B83A 4CDNA 3B7PA 3KPUA 2IODA 4YH1A 1E1MA 2X1VA 3D8HA 4PLFA 4EY8A 2Z08A 1USKA 3R5FA 3F98A 4X8OA 3U2QA 4IQ0A 1KDVA 2O5CA 1B6TA 1YK1A 3SX2A 3C8UA 3EC7A 1LQTA 4KREA 3PFBA 2GCNA 3PYXA 3Q6NA 4OAQA 1Y89A 2I1QA 2WF8A 1VL6A 3U3RA 1T5BA 3L6CA 1ZMBA 2P3LA 1NVMB 1Q0UA 3P0HA 5F1OA 3IUPA 1TM5E 3FKSD 5IFKA 1E0DA 3ENQA 2XLCA 1KARA 4AT1A 5HF6A 2ZIXB 4B5KA 5J2UA 4Q7QA 1RKUA 4QASA 3THXA 1U31A 1RVV1 2OLEA 1USVA 2QP9X 3I45A 3KJGA 4BU1A 4DCMA 1OQAA 2IIPA 1MFZA 4KN6A 4OG2A 3RM3A 4Z1OA 2YJZA 4INPA 5TS2A 1FL9A 5KCZA 1SG6A 1TQ8A 1CQIA 1JU3A 1V48A 1SN7A 1T8WA 3D43A 3IT2A 3PJGA 4IDFA 3ZLAA 2PQ2A 1GQFA 1RBQA 4EI7A 3NB0A 1S6YA 1MOQA 2PL9A 4FKMA 2XA2A 2OCYC 1IC6A 2REBA 4L0DA 3TQTA 3FYTA 1BVUA 1UFRA 4HWPA 1X80A 3S81A 3R7NA 3T7TA 1YQWA 4FMDF 1H69A 2P3OA 1P1KA 1QV7A 3WLNA 2I2DA 2I6QA 3HA3A 2I4OA 4PANA 2P40A 4IIDA 4N3GA 2I65A 3OESA 4DJTA 4AQDA 4AUNA 1QIEA 5AW5A 4WUTA 1OI3A 1L5OA 2QG4A 3GUYA 3I2JA 4RHXA 4X00A 3U44B 4YJ2F 2QSJA 4UASA 1ZCZA 4TXNA 2P78A 3VR0A 2E3JA 4NYMQ 2O1WA 4YRLA 3DM5A 4MUYA 8ADHA 4XJVA 4YP0A 3ZNNA 4DABA 1ZAKA 3HGMA 3OLQA 2JNWA 2A3RA 4EA7A 4LC0A 3I2HA 2CMDA 3NBAA 4J9VA 4JKIA 4NMMA 4F4UA 1LDBA 4ITUA 4L6CA 3RROA 3AF6A 4OHRA 5IEBA 4ER6A 4FHZA 2X3FA 4LZNA 3RC8A 1RXSA 3W7BA 5T8KC 3STXA 4JEHA 5KYNA 4CF7A 1PX2A 2TRSB 4QBHA 1X8LA 2FQQA 4HWRA 3E2PA 2ZIGA 5CFLA 1LB1B 3I6IA 1O58A 4D1YA 3IPAA 1SBNE 3N0TA 2FOIA 2DR3A 1BMQA 3H5OA 4Z4EA 3MUFA 1KO8A 2AK2A 2FHSA 1C0EA 5ALMA 1TLTA 4XIFA 2WUFA 1IDN1 1TU0A 1C0PA 3UB3A 5C5IA 3TLJA 4EYOA 3GLGB 1DQNA 2QP3A 5EIWA 3FCXA 5KOIA 4B2LA 1PR5A 4GKAA 3L1VA 4RQAA 1N5RA 1RLJA 1NVXQ 3O73A 1JBEA 4QT4A 1E7YA 5IAKA 5LZ4A 2H4YA 1CY4A 3LUAA 2BJHA 4WI1A 3SGLA 4D8UA 1P7PA 5CIWA 2YDYA 4LJKA 4A2QA 1K3FA 1SZDA 2BT4A 1WQ3A 3DE5X 2NNWB 3NETA 4S2EA 4WXHA 5I7OA 3T61A 3FOCA 4ER3A 5DLYA 2DH6A 2D1QA 3OZEA 3G1UA 3CC8A 1ZCBA 2PMCA 1IHOA 1JHMA 3A4TA 2ZJ0A 5SYNA 1NXVA 2BP7B 4NPAA 4JMPA 2ONZA 4KSBA 4FFNA 3HQ4O 1L7OA 1V35A 4WVLA 5DPMA 1OKKD 2QGFA 3GJZA 3CCFA 3K1JA 3HYNA 3JSXA 4IBOA 3RIXA 3U31A 4ZEMA 1SKUA 3CRW1 1A71A 4GR5A 4XARA 3WSTA 4AMGA 1P44A 5I7WA 3PWTA 2NU9B 3BT7A 4M0LA 3KBBA 1FQKA 1T0HB 1RWOA 3IHLA 2QE7A 3ACBA 3B51X 3KKMA 5BPHA 3K09C 1EQ2A 4BFCA 2XWJI 1UJMA 3BFVA 4ND8B 4A15A 4PHTA 5CD9A 4KL8S 5CFMA 2FSHA 1NLYA 2AN1A 3AI1A 3GX1A 4B0PA 4CM3A 2JAQA 2EU8A 3PTZA 1IRIA 4YMIA 1BNCA 1IWPB 4QD3A 2BGUA 1SCNE 4BCCA 5LQRA 1NRJB 2X2OA 3N7AA 4D81A 3OU6A 4EL5A 3KV3O 3PC3A 1UOEA 2I87A 2Q0HA 4LK3A 4LPSA 2DSTA 1T4GA 3IUQA 4ARVA 5I5EA 3FHTA 4MA0A 4W9NA 4M8LA 2Z2JA 4HRYA 4TTRA 2CFRA 3EXFB 3EUFA 4NG4A 2C9YA 5EQFA 4ZKEA 1Y8AA 2RJOA 4DYHA 5JECA 2FLWA 3Q98A 1KKMA 3LCMA 3HFGA 4UBOA 3ZCSA 5IUJC 1RYZA 4UXJA 1EVEA 2ZJFA 4LZLA 3UFXA 5B3JC 2FPKA 3DW1X 1TI7A 4K9DA 4Q9HA 3ZDYB 1E4OA 1EFPA 1JEDA 1YC5A 3AR3A 4ZO8A 5HRUA 2J5XA 2IL1A 3VJMA