3ENZA

Arsenolytic structure of plasmodium falciparum purine nucleoside phosphorylase with hypoxanthine, ribose and arsenate ion
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
244
structure length
244
Chain Sequence
NLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATKYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation of structure and activity in Plasmodium purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 83
structure length 244
sequence length 244
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3enzA00
2B94A 1JE1A 2QDKA 5F76A 4NS1A 1G2OA 3UAZA 1NW4A 4LNHA 4G89A 3PHBE 5KB3A 4GMHA 1OTYA 1WTAA 1YQUA 3NM6B 4F3KA 3F8WA 4UC0A 4EARA 4G8JA 5F7ZA 1QE5A 2AC7A 5F77A 1Y1TA 1V48A 3NM4A 1PBNA 1CG6A 3OF3A 2Q7OE 1A9QA 5EFOA 1JDTA 1U1GA 3BSFA 4OGLA 1A9SA 2AI3A 4I2VA 1YRYE 1JDVA 3KVYA 5CYFA 3E0QA 3UAYA 4M1EA 1PR4A 1ULAA 2OXFA 3PHCA 4QFBA 4TYMA 3E9ZA 1RR6A 1U1CA 3OOEA 3BGSA 1FXUA 3O4VA 4WKBA 1U1DA 1T8RA 3D1VA 3DDOA 1V3QE 2HWUA 4DANA 4G41A 1PK7A 2P4SA 4DA7A 4NY1A 1PR0A 4OY3A 1PK9A 1TD1A 5K1ZA 2IQ5A 1TCUA 4M3NA 4DARA 3P0FA 4GLFA 4JOSA 1OU4A 4TTAA 3SCZA 3EMVA 3LGSA 4YJKA 1VHJA 4MARA 1PR6A 4F2WA 1T8YA 1VMKA 4L5YA 4D98A 1Y1SA 4PNPA 5F7XA 2RJ3A 2AI2A 3FNQA 3OPVA 1Z36A 4TS9A 4IP0A 1JE0A 1N3IA 4H1TA 3K8QA 4BMYA 1V2HE 4X24A 4WKNA 4DA8A 3IEXA 4R2WA 4NSNA 1ODIA 3C74A 4QAQA 3IOMA 1YQQA 5B7QA 1ECPA 4K6OA 3LA8A 4OEHA 1RYZA 3UT6A 2QTGA 2OECA 4LNAA 2PGAA 3DPSA 1PWYE 1CB0A 1JYSA 1K27A 1T8SA 5EUBA 1PR1A 3EEIA 3FAZA 1OTXA 4LZWA 1NC3A 1JDSA 4DA6A 3BL6A 4DAEA 1K3FA 4BMZA 4JWTA 3K8OE 4RJ2A 3U40A 3PNSA 4D9HA 3KVVA 5B7PA 4F2PA 4F3CA 5EPUA 3EUFA 4QARA 3OZDA 1PF7E 1RFGE 4OF4A 1Z33A 5FAKA 2ISCA 4YMLA 3NBQA 1Z35A 2H8GA 1Z39A 2HN9A 2ON6A 4L5AA 3OZBA 1Y6QA 4E1VA 4WKOA 1SQ6A 4LKRA 4PR3A 1YR3A 1A9PA 1K9SA 4FFSA 1U1EA 4MCHA 2HSWA 1PKEA 3UAXA 2QTTA 4D8XA 2A8YA 5CXQA 3KVRA 4TS3A 1Y1RA 5IU6A 3E9RA 4YNBA 3KHSA 3FOWA 1RCTE 3INYA 5IFKA 3ONVA 1VHWA 4D8YA 4QATA 5F78A 1ODKA 2HRDA 5JPCA 2I4TA 1A9RA 4TXHA 3GB9A 1PW7A 4GKAA 3FUCA 5I3CA 1Y6RA 2QPLA 3BJEA 4WKCA 2A0XA 1LVUA 5B7GA 1A9OA 1JP7A 3P0EA 4R2XA 3KU4A 5CCDA 5CYGA 1Q1GA 4F1WA 4EB8A 1ZOSA 1JDUA 1Z38A 1TGVA 1YBFA 5CXSA 3OZEA 5B7NA 1V45E 3UAWA 1RXCA 1OV6A 4DABA 1Z5OA 4OGKA 3OOHA 4BMXA 2I8AA 4L6IA 1T8WA 3EUEA 1T0UA 1XE3A 4DA0A 4TTJA 1SD2A 4WKPA 1Z37A 4TXJA 1PR2A 1RXSA 4TXNA 1LV8A 1JPVA 1RT9A 4JP5A 1VFNA 3LBAA 4MCIA 2XRFA 1ODLA 2A0YA 1B8NA 4TTIA 1V41E 1TGYA 2QSUA 1Y1QA 5C80A 1OVGA 1I80A 1Z5NA 3GGSA 3OCCA 1C3XA 2OC9A 5ETJA 2A0WA 1SJ9A 4R31A 1Z5PA 1ODJA 4QASA 1U1FA 4ECEA 1A69A 3UAVA 4OJTA 4DAOA 3ODGA 1SD1A 1PR5A 3DF9A 5DK6A 5CCEA 1RSZA 1M73E 4QEZA 3FB1A 1RXYA 5F7JA 4M7WA 4TXMA 1Z34A 3PNPA 4KN5A 4L5CA 1OUMA 3NM5A 5F7OA 1V4NA 4YO8A 3TL6A 4LDNA 1TCVA 4L0MA 3DP9A 3QPBA 2OC4A 1LX7A 3O6VA 3FWPA 2BSXA 3ENZA 4TXLA 4P54A 1JDZA 1B8OA 4GLJA 3T94A 1ULBA 2GUWA 3DJFA 1ZL2A 3KUKA 2AI1A 3MB8A 4BN0A 1A9TA 3MMSA 1RXUA 1NC1A 3OZCA 4D8VA 5F73A 4U2KA
chains in the Genus database with same CATH superfamily
3GG9A 4FJ2A 4YCAA 2JG3A 3K2IA 4TT8A 1V35A 2QV7A 1Z7BA 4AY3A 4G0YA 1MHTA 5KSPA 4LNHA 4G89A 4YLEA 4E07A 4EL5A 1XLVA 2G07A 2H1HA 4ZXFA 4YMVA 3MJEA 5JIBA 4MV1A 1AU9A 4CWAA 3MGBA 1F2DA 3GJSA 4DLTA 1PWEA 2CK3A 2Z2IA 2XE6A 5JHHB 2XE4A 3EK2A 3LW7A 4G01B 4YPOA 2C1ZA 2ZIFA 4DXAA 2VTBA 4MEAA 4E30A 4EARA 4CYMA 1O9GA 4X54A 5BW6B 4OI0A 1WXQA 1VKHA 1WPQA 1UOOA 4MGZR 1SUDA 1LLQA 4JHLA 3SQNA 4GLLA 4XIGS 2GAOA 1PS0A 4V0RA 2JGEA 2XUJA 4MUAA 4IDGA 4N7BA 4ON9A 1F4VA 2IU0A 3NUGA 2ZB2A 1U0BB 2O8EA 1Z07A 3NX4A 1YHZA 4RU1A 2ONYA 4HDKA 2PSSA 1NSYA 1OBCA 3C45A 3GGPA 3CRQA 3LNCA 1ZIXA 2H6EA 3LO5A 2R5FA 2HLDD 3G1WA 4TM8A 1A9SA 4H77A 2RK3A 3AILA 4NZ9A 5G3YA 2AI3A 4EG1A 2F90A 3U7QB 1O5TA 3BDVA 4I36A 4DMLA 4FNOA 1I14A 4CLRA 4WOCA 3U3MA 1KMCA 4AP9A 3M6XA 4DWVA 2IPOA 1F8GA 1JHOA 2K6GA 4DMMA 5ED4A 4D25A 1NXWA 3VDQA 1FJHA 4JJAA 4PYLA 2FDRA 3MBKA 5E0OA 4BMNA 3KQYA 3OLQA 3QVVA 1XELA 4GWGA 4KK4A 4DV5B 3HXPA 1WMBA 2X19A 3IAFA 1M2FA 1RQNA 4G9GA 2CFSA 4O2RA 3KR9A 4BV2A 1E0AA 1CUEA 3VBCA 5GJCA 5HCUA 5F51A 4EB3A 3IQXA 4M0PA 3PWKA 4LHEA 5LQCA 5E6SB 4FYPA 3QF7A 4WKBA 3MTGA 5FPQA 1BEEA 4LWQA 5KYYB 5CPBA 1TQHA 2HRZA 5HQ3A 2POQX 2Q3LA 4X20A 2BEWB 2ZWOA 3GJQA 5BSUA 4O2AA 2IYEA 2Q5CA 4G41A 1V11B 5HYVA 2ORYA 3EGDB 3U7GA 4GKKB 1BGVA 3IVXA 4Q9HA 4PLCA 2XCUA 2YJNA 4DQVA 2VTDA 1V8FA 2B35A 2EKLA 2G36A 2XCOA 4JEUA 5EXDA 1BJKA 2F8TA 3T9BA 3F4LA 1XD2B 3EZXA 3PICA 5DW0A 4Z7OB 4CBVA 1IWOA 4DNXA 3D4IA 3CUVA 1CEQA 2IQ5A 4X3OA 4B4DA 2PRKA 3AB7A 4KSYA 4D9KA 2X58A 4MO2A 1KOFA 3OTQA 3JALA 2QAGA 4G0PA 2ODNA 4UM8B 1LTQA 4XD7D 4IQ8A 3BQ9A 2I29A 2VAVA 3EARA 2CNNA 2A5YB 2N9UA 2OM2A 3Q8MA 1E66A 2JHCA 1DJNA 4N0MA 2ZRFA 4N39A 1DP4A 3DDNA 2C4UA 3B5IA 1Z4OA 2HIAA 3BE5A 3CZMA 4REQB 2B5WA 2IZ6A 3P2KA 4E31A 1O6ZA 1TFUA 3LL4A 1U3FA 4HDMB 1U6JA 4F2WA 4PZAA 5BNWA 1G20E 1VMKA 4NJOA 4PONA 2E4WA 4H7DA 1OLXB 4J94A 3TIVA 3TXYA 4D9IA 2I0FA 4E5PA 1R6AA 4RTLA 1N2GA 1CJMA 1ZJ5A 2QXYA 1ISRA 2PX8A 3PC8C 4IPTA 4MUNA 2QROA 5ALDA 3BJZA 5ECDA 2XA1A 1X9IA 3X2EA 5F7XA 3IDQA 5HMMA 3PDCA 2Y9MB 3LP8A 3OJOA 1LPBB 1XYYA 1L7BA 1V71A 4PR0A 1NRIA 4TS9A 2ZE8A 3H2SA 6REQB 2GN0A 4UU8A 1BC5A 3MYRA 4C43A 3R8FA 4RMGA 1XZ8A 3BJIC 5DP2A 3ZE8A 1YJBA 2VNKA 4C4ZA 2GZHA 2EDAA 3HYSA 3MHPA 2QMZA 5ERXA 3X1WA 3CSSA 4F2GA 1TMGE 4HFMA 1UT6A 5G2OA 1IZ9A 2JAOA 2J3KA 1UJMA 2QTMA 4KQMA 3U9SA 1GA6A 3AIOA 4ZI5A 4O1IA 4HAUA 4HWGA 2QVLA 4K86A 5IAEA 4P81A 4DUYB 3IELA 2IODA 5JD3A 2PL1A 5EXXA 1E32A 3GT0A 3RJ9A 3RS9A 4YT4A 1JJIA 1HG0A 2P7IA 3RW9A 4EFMA 3VU9B 1AK2A 1UDRA 1ZHFA 4UNSA 1KVRA 3LVBA 2GJ4A 3NMUF 1RHRA 3PT5A 2FEOA 1RCUA 2WUDA 1QDEA 1CU1A 4LNAA 2IS4A 1YK1A 5JARA 2R7MA 4PAWA 4Y9RA 1DC6A 3Q85A 4Q48A 2XKJE 4X1YB 3R5TA 3FUVA 4OSEA 4FFVA 2BM8A 3X2FA 1E77A 1AKYA 1IAQA 1WHSA 1ZUNA 4BVKA 5J2TF 3JU3A 3W05A 5AUOB 1O2DA 3BMQA 4NS4A 4HYQA 3REQB 3VH3A 4B8ZA 4WUTA 4YMHA 3UPTA 4CEJB 2GLTA 4HQFA 1VG1A 3I30X 3GYGA 4HLNA 4C0SA 3BK7A 3MSXA 2ENUA 2VHTA 1X7HA 5HILA 1XQVA 2K5UA 2L17A 1H5NA 2LNDA 1H3FA 3V1KA 4L0DA 5JEDA 5M5BA 2HI0A 1YRWA 4WCFB 1RAIA 5DN9A 3NR2A 2FG6C 3IOYA 2GFHA 3V2GA 4U3JB 2EZTA 2ZETA 1CT9A 3H6HA 4KDRA 1RMTA 4GM0A 4MOWA 1W93A 3WRVA 2DWPA 2F62A 1J09A 1E2MA 4KE9A 3MWDA 4RD0A 4MQFA 2YNMA 1T8TA 4QYSA 3AHIA 3C7CB 2H48A 2OAQ1 3DEAA 3FCCA 3JQBA 1P4AA 1RHKA 2PSFA 3PE4A 1W35A 3IESA 4BNHA 3KNZA 3DFFA 3MTQA 5CA0F 5JDCA 3IUQA 3FOZA 2PZBA 3DEYX 3AEUB 1THTA 1DEOA 4M1WA 1QO0A 1I33A 1XWFA 2CNKA 2NT4A 2O0HA 3GT3A 3LCVB 4AY6A 2G0TA 2OFXA 2UUOA 2VHXA 3OQPA 4OYYA 5ALUA 5JXHA 2ISCA 1TMOA 4NU6A 5JJCA 5JHGB 2PSHA 4RAQA 2B7BA 2DR2A 2OO3A 4UPDA 2A1UA 4P0TA 5GJWC 1M1XB 2LZ0A 4J6FA 4TWAA 1KETA 1P4HA 3DDSA 4Z9BA 3KD3A 2OE2A 4PC1A 4GGOA 1NVXQ 1R1DA 3D8TA 5GVSA 5EHGA 4BX0A 1TF7A 1NKVA 2W4MA 3GPIA 5EQFA 1ZINA 4D74A 1DBSA 1O97D 3JSAA 4E22A 4TVSA 1VLQA 2FA9A 3OKFA 1ID8A 1ZUWA 2XH8A 4R71A 4AY4A 1G3UA 7MDHA 2VF4X 4RKQA 1K2WA 3B6MA 3KB8A 4CGZA 4TYYA 2XYHA 3ND9A 1VRVA 4KO4S 4FGSA 1H85A 4XR9A 3VVLA 3QI2A 2W42A 3ENVA 1Y1RA 1F2TB 3E9RA 4QBTA 3ZWXA 2NUAA 4OBBA 2G9UA 3UHFA 5DHUA 2DCMA 3DAFA 3I92A 2ORED 3F2VA 3I73A 1J0EA 1S8AA 2ODEA 3EDMA 3AXSA 1CP2A 1W88B 2FWBA 1Y82A 2BFDA 3EGVA 3IPYA 1G5FA 1JG1A 3HNRA 3OM8A 3FMVA 3QEMA 5EHIA 3AT1A 3FTPA 3ZHQA 4E1BA 1D0IA 2OY0A 3ZG6A 1DELA 5LQNA 3UGTA 4F4CA 2P9TA 1LB1B 1JF8A 3RF6A 3PU6A 2B2NA 3G2JA 3LRTA 1YXMA 4B6PA 2GWRA 1H3NA 3RNLA 3FFAA 1DTEA 5EHNA 1HZZA 1SXJB 4NHEA 3VDRA 4BVEA 2O8EB 4MVJD 1R6TA 2W2MA 1U4SA 2G5PA 4DCOA 1W85B 4NBWA 2IBSA 3E7DA 5LQAA 221PA 1LJ8A 2WU3A 5A3SA 2OLJA 1Z4QA 4IDAA 4AB1A 5I7FA 2PEZA 4BO7A 2FSFA 4BU1A 4YONB 2C9OA 4QU0A 4R1QA 4QBGB 2VZ9A 1R0WA 4KV7A 1K75A 1UDBA 1JTFA 4A36A 2QD1A 1AF4A 4B71A 1P0MA 4U8GA 1QJ4A 3GJ6A 4FGKA 4MTCA 4EY4A 2IHKA 2O5EA 4UTPA 3U1BA 1D2NA 2YFQA 3L7MA 3MILA 3RAGA 5BVHB 4RJLA 4NYJQ 2QP9X 3K4QA 3LC0A 2GM4A 4MJ3A 4ZI7F 1NFQA 4FLEA 1XVVA 4CIVA 1MBZA 4LVUA 1VJGA 5E6SA 4JXJA 3L6OO 1FUKA 1NWCA 2QLJA 4O2BF 3NASA 2APJA 4HY3A 3AQIA 4GSKA 1TVKB 4CCSA 3BTSA 3DHNA 3WKAA 1B43A 4E5UA 4P4TA 1M6VA 3K0BA 4UHFA 1W0KD 2JK0A 1Q1AA 3IPRA 3OQVA 3MUNA 5L45A 2JBAA 5ALIA 1KPHA 4K8RB 4RHYA 3A70A 3BL8A 2VQEB 3FCAA 2AFHE 4D5GA 3AVVA 1EVLA 2WG1A 1EVJA 3D0RA 4MV8A 1ISFA 3P0JA 1EDDA 2IOQA 2QTZA 1XA4A 5CEJA 1XD2A 1KYIA 4KPUA 1NYLA 5DIZA 4MNTA 5AMXA 3AX6A 4DABA 4ZAFA 4OBWA 1T1RA 3COZA 5L7WA 1BX0A 3ACDA 1QVAA 4I6JA 4AJKA 1Z5OA 2EATA 4CT0A 1ADFA 4Q05A 4KUEA 4C6TA 4GX1A 4YI3A 3N2NA 4Y6GB 1XX6A 5ALEA 3Q6NA 5FEUA 2X42A 3DE0X 4Q39A 1BKYA 1Z12A 3UQZA 3NP7A 3GRKA 4FILA 4M60A 2OR3A 1GG5A 1U8ZA 4ALJA 4PHTA 3MWYW 1A4XA 4I99A 1AMOA 3W6UA 4WKPA 1NW8A 2VP6A 1J23A 4TXJA 4AFNA 1JEYB 4EFLA 4LHXA 2FMUA 2Q2OA 2FWAA 4N5HX 4AXBA 4CF7A 1W5EA 1DAPA 4CDGA 1NLYA 3CKYA 3I5YA 5TV2A 3VKFA 3V42A 2UVPA 3K0CA 4H18A 1JHPA 4MGYR 8MHTA 4EMTA 1TUIA 3EOZA 3I1JA 5AW6A 3N59A 3AI1A 2RGRA 1CQIB 1FBNA 5BY2A 1M1YE 3VPFA 1M2VB 1TVCA 2I6SA 1W8IA 3SXJA 3NU1A 3STVA 3QE2A 1FFBA 1PFGA 1RJGA 1WVGA 4IWYA 1E4YA 4IIFA 3PCXA 1GOTA 2IVFA 3IV9A 3U4DA 1E7MA 2PMFA 2AKAB 4ZI7A 4R3WA 5L3VA 3V6LA 2E4XA 3LYUA 4ZC8A 5G4KB 1UH5A 1RMYA 1O54A 2HSEA 1CUHA 3O92A 1QG0A 3LT0A 4EELA 5IZ4A 4ZOAA 1XXHE 5FO1A 1OROA 2X2FA 3GOHA 2V7EA 2ZRKA 2ZM5A 3ICQB 3LH5A 3WYCA 5EPOA 4A8JC 1COWA 4M1ZA 3KWFA 3NIBA 1CJVC 4QUDA 4HNHA 2ECKA 4MVJG 3G0CA 4HDRB 4CM8A 4UAGA 2CDRA 5KYWB 4KU4A 1BQ3A 3PHIA 3HB5X 2UUPA 1WRBA 4O4JA 1LCIA 1DO0A 4BZZA 3B2QA 4R2KA 3VR1A 5EXEA 2CZGA 2VJLA 5LZ5A 1HDYA 5E8RA 3V3TA 2CYAA 2MIIA 2H7XA 2Z95A 3NIWA 5K7SA 1CD5A 4MA4A 1E3LA 2O52A 4AWXA 3R4CA 2G4LA 3CB4A 3P9IA 3U60B 1MABA 2YY6A 1M73E 1UANA 3KLPX 2XOKD 5E1OA 1QFXA 3UV7A 5A9SA 4KAJA 3I2JA 4TRRA 1HK7A 5GPBA 5F23A 2K7FA 5EMLA 1FPQA 4D96A 2QJOA 2ZSUA 5F4ZA 3BA1A 3PTLA 4TUYF 3EXHA 3MN1A 4R2IA 3CH6A 3EYAA 3Q8XB 4QO7A 5EE5B 4O4LB 3ZCQA 3ZIAA 2ZB7A 4M8IA 2CJXA 2LXNA 5AKGA 3PNPA 2YMQA 2UV8A 2N42A 2X6QA 3NM5A 4PHHA 2Z4TA 1WZIA 2ILTA 3IAM6 4MQ5A 5E4FA 3F78A 1G6KA 4E5DA 2JFPA 1M6HA 1WTCA 1JBEA 2CUKA 4FDVA 3A1FA 3OLVA 2DFTA 1SHLA 5AIBA 3M4NA 4YJFB 1XDZA 3OZWA 1JFRA 1QYWA 4QGGA 4AVYA 4YRZA 3BIXA 1ZG3A 3LPMA 3BJRA 2Q9BA 5AQEA 4NMHA 4V0LA 4CHGA 3HVIA 3OJEA 1LX7A 1OX6A 2NV2B 4ZEOA 5SYNA 2JHAA 1MH9A 2C83A 2CC2A 4UKDA 5DT9A 2W2NA 3I01M 4RPCA 2J67A 5IVHA 1RQ2A 2O59A 3L05A 3DGEC 4J16A 1I8TA 3AK4A 1B8OA 1K9VF 2J3LA 5EIFA 5A06A 1CDZA 4PYRA 4UM9D 1WXFA 1YL5A 3P2MA 4IEIA 3RT7A 3EG5A 3RSCA 2BW0A 1T91A 3G8YA 2ZAIA 2ZYTX 4MKFA 1GZ5A 2OL4A 3RV3A 2OXRA 2XWJI 2PH3A 2C97A 2ONJA 2P9JA 5FUXA 3HA7A 4IBOA 4UUNA 3KUXA 2GHQA 4Z9AA 3NDPA 4F71A 1KI6B 4BAUA 4IOKA 5REQB 5DM2A 3KFVA 4G5OA 3FR7A 3O5AA 1GPNA 2JASA 3LQKA 4MWZA 5I51A 1RYMA 4H59A 2R8BA 1W94A 3KOZA 2O1XA 4IXNA 2EARA 3UAOA 2DERA 4D9NA 1TZBA 3GLQA 3FHLA 1JDNA 4K88A 2ERYA 4EA7A 5F76A 4KLNA 4F0JA 1WQ3A 1VIMA 3RVKA 1NOIA 1EYZA 2FMHA 2O6LA 4MINA 5DHTA 1E1KA 4OFZA 4H35A 4JVSB 1E3MA 2CNLA 4PN7A 3NT4A 2R8RA 4GLOA 4OUDB 1GGJA 3R40A 5AK0A 4UOQA 5J2TA 5SV2A 4OK3A 1PR9A 4QU9A 4RSMA 1RABA 3L7OA 2BKVA 4P6VF 1X42A 3C3AA 2ZTVA 1SQGA 2EHDA 3A3YA 3D6FA 3WYFA 4DMHA 1QHIA 2CXXA 3ZWNA 4MS1B 2KM1A 4KDCA 4ALMA 1D2GA 1ZNQO 2KX7A 1FP7A 3P45A 2VXYA 1NN3A 1QJCA 5LKRA 1FFAA 5HJ2A 1APBA 2O2XA 1STOA 2XVMA 2Y6UA 3D0KA 3NNNA 4L8GA 1VG8A 4YLYA 2WKRA 3SHFA 1BU8A 3UJ9A 5IARA 5A0VA 2EEPA 2WAYA 3K94A 3LQ4A 2WTAA 3LCMA 3PSHA 2YVAA 3WLMA 2WIAA 3H65A 4QRIA 4AO6A 3GMTA 2IIVA 3K32A 4I2VA 2XMGA 3AR8A 3HL0A 4LWZA 3WLNA 4KQ9A 3UOWA 1XJWA 3NJ4A 4E94A 3OTGA 5CT9A 4RS3A 3S5UA 2JLUA 3V2IA 4PSUA 3O3MB 4XEHA 3UCXA 5BW4A 3HU5A 1C7JA 5FIUA 2UYHA 1G2IA 1T1JA 1FEZA 5EJ8A 4JLNA 4J8PA 3PC8A 3F73A 1IBRA 1EA7A 4OK6A 1H5UA 3TH5A 1V3VA 3T3HA 2R7LA 1I2DA 3TOSA 2OP1A 2RBGA 4BVGA 4JBWA 4IIYA 3T8YA 1MB9A 2GOYA 4BJHB 3HEAA 2AN9A 4GBGA 2XMSA 2ZIGA 1P3Y1 4CTOA 4I9UA 4LJKA 4JASB 3L6RA 3ZX5A 2IV7A 1ZA1A 2WSLA 4OA5A 4D4IA 2O20A 3PQ6A 4Y2XA 5EVCA 4DANA 5A5DA 3WLKX 3VNRA 1Z68A 3B1ZA 1XGKA 1VOTA 1UBSB 2EV9A 2GEDA 3NPAA 4GL4A 3W1WA 4DA7A 3PUZA 4WVFA 3KS9A 3C6KA 2NP7A 1P8AA 2GK7A 3NOXA 3PG5A 2D8AA 1V11A 4R0NA 4LGYA 3DDZX 5JO9A 2XMQA 3ENQA 4ND6A 1P0PA 3A9UA 2IPXA 3ICCA 1J49A 3L8DA 4DR5B 2W6QA 2OBLA 4IV5A 1BA3A 3CX4A 4HVTA 4JUAA 3IUEA 4H3HB 1HKHA 3DKIA 4M3NA 3O47A 1E1QD 1RKQA 4P2BA 2V9ZA 1KDZA 4PFJA 2V7VA 2P9QA 3D59A 3T3PB 4BX3A 1PU2A 1R66A 1LWOA 4KIWA 3AJEA 1DEXA 3H4TA 5EIEA 3LMKA 3ROGA 1ECJA 1ZVJA 1IIRA 4QRHA 4CMGA 3TZQA 5HUHA 1GPMA 4ZYUA 2MJLA 3GUUA 5C8DA 3ROMA 5KVCA 4TWJA 2VQFB 2FP4A 2GM5A 1P4GA 4F2HA 4CCYB 4QYXA 1P1BA 1LPSA 1EWKA 2QLFA 2GXUA 1A7JA 4K46A 3WNCA 2Q2VA 2GN4A 2P0EA 2WF9A 1AG9A 1O89A 2IUYA 3NW9A 1ZCJA 2ONZA 1R0ZA 1XNHA 1WUTA 4ZU1X 4DRXA 2ZAGA 1G8AA 1L1EA 5TQJA 1LC0A 1U28C 2DECA 3BRSA 4GSYA 4OTZA 4RORA 4MVWA 3AJDA 1ENPA 1JFFA 1R4ZA 2FXIA 3OPXA 2A9KA 1UC8A 3P71T 2RCNA 4OHOA 4BASA 2OHHA 1WULS 1CHDA 2O9JA 4F93B 5C7LO 4PXAA 1X1DA 1H6AA 4OA8A 4F5WA 1MX5A 3OX2A 1LDNA 1ZIPA 5FOWA 5JATA 4CDRA 5DHAA 1V2HE 4AKHA 1AB5A 1VFPA 3D4NA 2WYUA 4R1LA 1QFMA 2DUWA 2R2GA 4J0JA 3G1UA 2C5EA 3FUWA 3LUHA 2QIPA 3WL8A 1FU4A 1DIGA 1TZMA 4EA6A 4K0KB 2R8EA 1L1FA 2AQ8A 1GG9A 4ZO4A 4C01A 3ZLVA 4HGOA 3Q0IA 5JFTA 1WL8A 1PWHA 3C74A 3EW9A 4MV5A 5TLSA 3JQRA 3T5PA 3FWZA 3OJ0A 4BS9A 1DJPA 3DCYA 1DRUA 1FQOA 5D3MA 4ZCMA 4E1AA 2M1XA 4XA8A 1T35A 3AH8A 1ODTC 4PRYA 1FMFA 4WPGA 1O5OA 3ESCA 1MABB 3ANYB 3TFWA 5I4IA 4JK3A 4B4VA 4OQXA 1TKAA 1RAFA 1YRBA 1RWKA 3D4PA 3DPSA 3K4HA 2PKYX 4JBLA 5D51S 5F5LA 4IDHA 3U56A 2ZB3A 1S2OA 1SN7A 3L7BA 1FUIA 2PT9A 1DOHA 3ECCA 1MJHA 4GIBA 4XCQA 4A2QA 2NADA 1EVZA 1OSNA 3NJRA 3UGJA 5JANA 3W5DA 3K6SA 2VYVD 3GOQA 2PQ0A 4FDTA 2E1PA 2J9FB 1OXUA 2A0KA 3CBGA 3JPYA 4HQ0A 4KG7A 4W9NA 5DI3B 3IAS1 1EDEA 2FRDC 1AS3A 3DV2A 1X2EA 1EFRA 1RU3A 2WJ6A 1JQ5A 3FFBA 2Z2ZA 2YL2A 4XB1A 5C18A 3L3BA 3ZBTA 1RYFA 5FWNA 3OZIA 3M0EA 3PGXA 3L7JA 5CGZA 4R1MA 2JLWA 2FZ4A 2Q3EA 5LMZA 1WUKS 1WF3A 3ESDA 4C7VA 2J7PA 4ZO8A 5FI5A 2ZJOA 5HKBA 1GFWA 3NHZA 3KALA 5H3LA 1JDPA 2ES4A 2IIPA 3UJCA 2YBDA 2YN4A 3CWCA 2XCIA 2F8LA 4H4EA 5LNK6 2OFWA 1PJRA 3RUPA 3ZDBA 1ZN7A 4BO5A 1D1PA 3IBGA 4TV8B 3S44A 2DTXA 1JEJA 4BECA 2P4UA 4LZNA 3VZQA 3EHEA 4WMLA 2LW7A 3HDJA 1KDYA 5CFMA 1F3OA 4XPIA 4RDXA 4FYVA 3IVGA 1ZVVA 4FFOA 1KYZA 1TZJA 1Z13A 3DV0B 3QWAA 4P38A 4TQAA 3G0OA 2YW9A 2F8SA 4BXOA 4A7PA 5JNTA 1YZKA 4YJHA 4HWTA 3GL9A 4ND8B 1YE8A 3H5RA 1FLNA 2WOJA 4YRFA 2I8LA 1K0UA 5D86A 1GV1A 2BBTA 2C3MA 3G2HA 2PLFA 4NENB 4UFNA 3KX2A 4XIIA 1MX1A 1K9SA 1Q7CA 3IT3A 1JG6A 2BHNA 3I0NA 4WA8A 3T99A 2P6UA 3QOYA 1XZHA 4GI3A 3T9EA 2HHLA 4FNGA 4PLVA 4OQFA 4D8XA 5CFOA 1OILA 4LJ6A 2C7BA 4CIWA 3GJ0A 4B7AA 4JI2B 1DWQA 1ZOOA 3OMWA 3JQGB 3JQAA 1HI9A 3VRHA 5TR9A 4MZXA 5AJZA 3C3WA 2AJ8A 3W77A 2QUKA 3OHMA 1OYWA 1VHQA 2D1SA 3MIZA 3ONVA 4P86A 4EF5A 4CIBA 4QLBA 2AMFA 1XDBA 1ZS9A 2D2VA 2HQOA 2VA9A 3S29A 5DM70 1KEZA 3IURA 4N3BA 4OIFA 2WE7A 4V2IA 5EFZA 2IYTA 3ZN2A 4URYR 4TYWA 2C4TA 2IELA 1YIDA 1AUPA 5JI3E 4HVLA 2ZI3A 3SF8B 1GG2A 4TXHA 3FSJX 4M8KA 4WN3A 1JIQA 4LHZA 3LZCA 4P9NA 5D87A 4ZFNA 1KS9A 2MSWA 3OAAD 4MCJA 1Q0PA 2IDMA 2YZKA 3HDHA 3OT1B 1EAYA 1JIVA 1FQWA 4JWKA 2ZYWX 1AGRA 3K9HA 5EE1A 5C8YA 3I9NA 3AONB 5FOTA 1LSUA 2AW3A 2PD3A 4HRAA 2QTAA 1IUOA 1PTKA 2FI1A 5KOJA 1A5SB 2FW0A 1B6RA 2I2XB 4X93A 5I7AA 2Z3WA 3NKFA 1C81A 1HETA 3D5QA 4UVGA 4XCVA 4XGIA 1C1DA 3QLUA 5L7YA 1V2GA 2ZRPA 3VSDA 2XUGA 4H9GA 3IAUA 2XDQA 3L1JA 3ZHSA 1ESZA 3M33A 1NV9A 5ITSA 1JFTA 1DADA 1AMNA 4ML3A 5I01A 1QKJA 2YOHA 4ND4A 3M6WA 4RDIA 5BYKA 3ERCA 5EZ6B 3GBVA 3VHXA 4Q93A 5M7EA 4GGMX 4RVCA 3L7NA 1M1NA 4PGMA 1H5QA 2DFKB 4ND5A 2IX9A 3L0ZA 3T35A 4ISBA 1THGA 1KH2A 1ZI8A 2PXAA 1JLSA 2RAUA 3G6WA 3LO8A 1K68A 1PUIA 4ND7A 4G2NA 1M5RA 1GCAA 3I2GA 2DKOA 3UAWA 3N75A 1O6CA 5K0GA 3EXFA 1NZDA 5H16A 3NIGB 1O8CA 2P11A 3X1DA 1W44A 4FFDA 5L6MB 3OQJA 2KJQA 5JEEA 2CL0X 2YWCA 3RSZA 4LA4A 4BKRA 3JWPA 4DIDA 2DUMA 3HJCA 4RHUA 3FW1A 3LCCA 3LIPA 4KYIB 1PLJA 5BMVB 3EUEA 1J8MF 1HE8B 3FFWA 4MUXA 5A5FA 4MV4A 4D6YA 1Q6YA 4QYTA 3K7EA 4KR9A 3RK1A 5C5IA 2CFIA 1WU8A 2NO6A 5SZHB 4IGAA 2HMTA 2Q4RA 2PD4A 4JCCA 1JSCA 4TL8A 5K03A 2JF0A 5CDUA 2PN1A 3DHWC 2BFNA 1O0SA 3MG9A 4OJMX 5CA0A 5JTTA 3DBOB 4IF6A 4RNCA 1QMPA 2UZAA 3LDAA 4TXNA 4UEOA 4JI1B 1H1TA 1QVZA 4MYCA 4WXPA 5CVDA 5B1HA 3ZQ4A 4EYEA 4M6WB 1GRNA 3T7JA 3SVLA 5CLJA 1T2FA 3AIIA 3VR2A 2PWYA 4ZYZA 3GA0A 1WMDA 3HDYA 4MCIA 4RK7A 1T36B 2BFFA 2O23A 1RRVA 1EXMA 1ZVKA 3HU1A 1TTPB 4PLWA 4QAJA 1Y8RB 2NAFA 2P6PA 2KHZA 1Z08A 4R84A 5BV8A 1M2JA 4C6RA 5LU9A 1RXIA 5C3UA 5EWLB 3VJKA 3QTBA 4IDBA 4ZHQF 1P44A 3NDJA 1ZGBA 2Z6VA 3GEBA 4BNFA 1BOFA 2F00A 1L5YA 1DWPA 2BDTA 3HYLA 4YUYA 2BZ0A 2FQWA 2GO1A 3IKLA 3RDPA 4YFYA 3TTUA 1QOQB 4M49A 1E1NA 2XMBA 4DIMA 2GD2A 5C4MA 4LJ4A 1M1UA 4B76A 5B30A 3GEHA 3O93A 4DBLE 4JQZA 4CQLB 3LT4A 2WHXA 5LZ9A 2OC9A 2C4MA 2OK7A 4DBZA 5L4SA 4YWJA 2VWGA 1F6DA 4M9RA 2QQFA 4EDFA 5EJGA 5LMUB 2AQIA 2EP5A 3EWNA 2J0UB 3CUUA 3STYA 4NCIA 4JENA 3ZD6A 3SC2A 4OXKA 4E13A 2YHIB 3E18A 1TKCA 2XB8A 1Z22A 3F9RA 3SS9X 3S1AB 3PPYA 5IAJA 3P2OA 4G4SP 2W6JA 1UCFA 1HDOA 4CMEA 2ANBA 5DBIA 1Z5ZA 4OVKA 3W8DA 5JDIA 7YASA 4KQ2A 3IQWA 4B85A 2GDZA 5KYWA 4Z5XA 3GLIA 1WKCA 4N3AA 3LTNC 4K1XA 4FZ3A 2PMEA 2H1VA 3VKVA 2YVKA 3AJ9A 2L2QA 1ZHHA 3PC4A 4UVDA 1MO2A 3GV0A 7REQA 4YDQA 4UTVA 8LDHA 3DW3X 2YFKA 2GA9A 3FMPB 3ORYA 1LBEA 3DF7A 3QF4B 5BUCA 1A98A 3UBTA 3CH4B 4TTTS 2XLCA 3PC2A 1NX9A 4IWXA 2VWHA 1ECCA 3S2UA 3BBPA 5F7JA 4G23A 1U0SY 2IE8A 3GHYA 4DHEA 2BGGA 3QU4A 1CUUA 4QGBA 1WP4A 3ILHA 4TXMA 3EY9A 2QIOA 5JVDF 1AXEA 4WNAB 3JVDA 3UHOA 1ML4A 3RARA 3ZE0B 3OCUA 2PKXA 4KO1S 1JLLA 4MW4A 1Z8DA 1X92A 3H1TA 3WL3A 3ORRA 3UJAA 2O2HA 4DYHA 1FTWA 1YQTA 1KIAA 4Q7EA 5C1PA 4CR8A 4UQOA 1DJOA 3OWXA 3G2IA 5BT9A 1ZN2A 2Z9DA 4CV0A 4DJDC 2MU1A 4J7AA 4CT5A 1X1CA 1YB6A 1U8CB 4AY2A 5CDTA 2AFHA 4OHRA 4HS4A 5TPZA 3SD7A 5KTPA 1D03A 4I0WB 2QRLA 3LF2A 4KODA 2ZEJA 3KT6A 3VYUB 3PITA 1ZJJA 2NZXA 5HXAA 3MGCA 4A82A 1RJ9A 1X0XA 3TNJA 1JYFA 1ZK3A 3K6JA 2P5YA 2BFEB 2WICA 4TWZA 2V6GA 1PL7A 4B8YA 4F04A 2I67A 3KQUA 2EKZA 2QG6A 2ZIVB 2W6IA 4JIMA 4F8YA 1AGYA 1U7ZA 3L92A 3A1WA 4P5PA 5F2OA 3AL2A 2RHJA 4HUJA 1ZL2A 1ES9A 2CMDA 1XO1A 2HU2A 2QJTA 2R9VA 5BNFA 3QNMA 3ZXUB 3L7IA 4YJGB 5KCMA 2E0IA 1Q0SA 1VLJA 1PG5A 3QTLA 4WNYA 2XB2A 2M6RA 2ODTX 3MCUA 3ILSA 3PJFA 3QE4A 4D5EA 4Z4IA 2NSLA 3JQAB 4F7DA 4DCVA 5TMEA 1HZZC 1QGUB 2E89A 2RB4A 3V97A 5JCJD 2FZGA 1KFKB 4CG2A 5F73A 3CXUA 4P31A 3TVYA 1FE8A 1IPHA 1T1GA 2QDKA 3PCTA 2O3RA 1XEWY 2VPWA 3MTJA 5DNEA 3K1AA 3KPWA 3BKWA 4MQEA 5KTRA 3PHGA 2IV3A 1B8PA 1PD0A 2Y1WA 4TVOA 1XVAA 4E4TA 4R2LA 3CXRA 1OTYA 1PS8A 1L5OA 2GI4A 3LL7A 4JLSA 4LC0A 4C0BA 3QFRA 3OWOA 3BULA 4G4SO 1TCCA 1L8AA 2AZTA 2XTNA 3C3EA 2FVYA 3SNHA 1OLUB 2X77A 5ESWA 4JXZA 1TW2A 2SCUA 4D79A 4ID3A 4XUDA 3WNBA 2V45A 4CMJA 1KGSA 2V0CA 3E9MA 4NCXA 1L6IA 1Q20A 4B6SA 1FFDA 4AX8A 3LV8A 2BCEA 3U4HA 3L4BC 1PNVA 2AVDA 4I46A 1E69A 5TXGA 5I9IA 4J7UA 2ZSJA 1FOEB 1L6RA 2I3BA 1RQGA 2YY7A 4OHBA 4F6LA 3EEOA 1KAMA 1KMMA 1PCXA 2CMGA 3JYPA 1KYYA 1YRYE 4EJMA 4HT3B 5EMKA 2ZSEA 3I8XA 2A9OA 3OQOA 1GWNA 1W25A 2Q62A 3RS8A 2E48A 5DYGA 1WXWA 3GAZA 4P7GA 3FYCA 3BWMA 4NG5A 4MW7A 5B3AA 5KTKA 4HUQB 3QTTA 2QVYX 2VDPB 4UZSA 3TKYA 1OVMA 4FWIB 1C0PA 2ZR8A 4KDFA 1DS6A 1YWGO 3MRSA 1YTUA 4DLWA 4RFVA 5JOQA 4G1MB 5K3EA 1X2BA 1RR6A 5E7IA 4DIUA 1Q5PA 2RHCA 2XB9A 4YX9A 2XXAB 5FTMA 4GQBA 1UKYA 1W73A 4KCGA 3JYNA 1WW3A 1OIXA 3Q9SA 3UHJA 2NQTA 4DB2A 3JQPA 2IWHA 3KQWA 4KJZA 1EX9A 2VHUA 3KJEA 3MTDA 4FYWA 2F9MA 3GN1A 1XR3A 4Q01A 3QX3A 3T9FA 1IEVA 1OGIA 5E7JA 3VR5D 3ZU3A 1AO3A 3R74A 1F12A 2Q4BA 3BH7A 3I2KA 4BGVA 3ELDA 2ALJA 2SKEA 3ME5A 4PQEA 1XTPA 4NY1A 1BS1A 4IJMA 2Y1DA 3UN1A 4DA9A 1DPGA 1N6LA 4C0KA 4BGUA 4PS1A 4DV4B 5HIJA 2HV9A 5K4AA 4C4SA 1YJ8A 3HB4X 3PR3A 4BNJA 3NHSA 1SHKA 1H4QA 3NHJA 4AG6A 3EF0A 4INZA 4QDUA 1AKTA 1NFFA 4CEIA 5JPIA 3V4VB 4N6GA 3RC3A 1JPNA 5EMMA 1Z3CA 2QMYA 4ZJUA 5B55A 3LIIA 1PJSA 5H80A 4BQRA 5JH7B 4M6WA 1U9YA 3SCZA 2RHDA 2XMRA 2I9KA 1KMHB 1QH1A 5JG7A 4GUAA 4BBPA 1MNAA 1UAAA 2GFIA 4S2UA 3T1OA 3ZWMA 4LQDA 2FG5A 2ZIXA 1Q0UA 4KX5A 4MJ7A 5D7BA 4C3UA 3U49A 3PVZA 5L4LA 3AJRA 2I6TA 1EZ4A 2HWKA 2R1TB 3AUFA 1QLWA 2VHCA 1FDUA 4GKBA 5CNJA 1JEQA 4DV1B 1RM5A 2YNMD 2REQA 2R8OA 1KK1A 1A9ZA 1WCIB 2D5LA 2XEXA 1UPTA 1EINA 2GM3A 4ND1A 4BBAA 2ZJYA 3K9FC 3C3JA 2NZ8A 5EWJA 2HQ1A 3W6NA 5KQMA 3DL4A 1FNSA 3LXXA 4ZYWA 1UC5B 4LECA 4ER0A 2K87A 1CUVA 2FY8A 1KJJA 4KRXA 5CNKA 5TX7A 4A6EA 1N3IA 3BILA 2DUUA 1E4EB 1SZPA 3Q7SA 4BMYA 3A1EA 4AWAA 1T5TA 1VE6A 1JJVA 2KQUA 4YRBA 4HPXB 3Q98A 4BFTA 5I8WA 2XT0A 3PQ2A 4ZOLA 1KRXA 3TOZA 1G8GA 1O4WA 4Q5IA 4IXMA 4N0EA 1QTIA 2X4IA 2X7HA 5J2UA 2I2WA 4ENSA 3ABOB 5GM2A 2BR4A 1ODIA 3NCHA 2VQSA 1JECA 1WXEA 2JGLA 3TFQA 4B6EA 4GAEA 5NULA 2C98A 4R5HA 3FA2A 2VRBA 4CI9A 4AUEA 3AEYA 4ZEVA 3QA9A 4TMTA 4L74A 6YASA 1JQJC 4HTFA 3OZVA 3SJUA 1LVGA 3H2YA 4WFQA 1PYOA 5K0FA 2OECA 4RTSA 2V03A 5CDGA 1MEOA 1NW6A 1SCIA 2VBFA 2VUUA 3RRNA 1G8YA 1U5BA 1CF4A 4DBLC 3PEUA 4NV0A 3UG6A 3TQQA 1NR5A 1Q0HA 3VOBA 1IM5A 4QG7A 1J24A 2JH9A 1Z73A 2IVZA 3FROA 1W2GA 3Q9NA 2R65A 2W0SA 2NPOA 5E1BA 3EMKA 5C7YA 5KNLA 2XCSB 1OOEA 3EH2A 4JJ7A 4F06A 1TZ2A 1J0BA 3IOBA 5G4LA 3PYLA 2VDRB 3KAJA 4U3JA 3HUEA 2R3SA 2FQQA 2XITA 2DGDA 4J9UE 3LDFA 4ZVQA 1NLFA 2ADOA 3F7TA 5H9WA 2Z43A 1HRDA 1SCAA 1T3SA 2FK8A 1L7QA 2AMJA 1M2OA 1V8BA 1SB8A 2PH5A 5EE3A 1U3DA 1C7FA 5DI3A 4BV9A 1JH8A 3ANTA 5DBFA 1U9IA 3A4LA 2FDXA 1FTNA 3TLGB 2GPNA 2V0NA 1Z5UA 4KPGA 3TR5A 3R24A 1B0AA 2Y1EA 3D0OA 3IO5A 1VKNA 2ZQ5A 2FYTA 1JLMA 2V9PA 1Q95A 3R3YA 3ZGVA 2X8LA 3WLTA 5TE9A 3SICE 5C35A 3SIXA 1MQ9A 4U9UA 4TLMB 3F49S 4C6HA 4M83A 4JITA 3PLAE 1Q74A 2WIFA 4KE6A 2C2MA 2IKSA 3DDCA 1ZQ1A 1ZXXA 3D54D 4BO0A 5FLEX 3ISJA 3R7AA 3AOGA 5HWSA 1E9FA 1SXIA 3IKVA 4L2IA 5BN3B 4QPNA 4WKGA 5FYQA 2V5VA 4DDUA 2FJUA 1JMYA 2P4HX 1NVGA 1EX1A 4BFWA 1DDOA 4MAFA 3WZ2A 4GKJB 2NMVA 1NVFA 3WYBA 1B00A 4CM3A 2OCXA 1BJRE 1CRQA 1YOVA 1QZUA 4E5MA 2B21A 2ZUBA 4LKRA 5AM1A 2FX3A 5AW9A 3RREA 1I0LA 3WL5A 3F6RA 4I55B 5BSEA 2JFXA 1SVWA 4PGHA 1KAOA 3RCBA 3EFOB 2A3NA 1P1KA 3ETHA 2HHCA 2YMPA 3UAXA 5KKCA 4XX0A 1N2SA 2VSOA 1EVKA 1MZVA 1N2JA 1QYIA 1VI5A 3AESB 4S1VA 2QU7A 4DZRA 2BFDB 1JNXX 1KP9A 4PG4A 4E4RA 4P7FA 3NORA 1EG2A 5AYVA 1GZ7A 1D4FA 1T0BA 3HUTA 4JJIA 3LLVA 5E9WA 2MT9A 2NXCA 3JZAA 4RHFA 2WY2D 4DY4A 4Z53A 1JHZA 1XEXA 4DZTA 1JL3A 3BWEA 1GFZA 1S3GA 5EERA 5IJ9A 1N78A 1JWBB 2O2SA 1C2TA 2HV8A 2PBZA 4MQ6A 2Z8YA 5EYPA 2OYRA 4CR7A 2DAPA 1FDVA 2EKQA 5H68A 2RSLA 4FYYA 1VHWA 4EUHA 2AR0A 1C3OB 4HGRA 4B3BA 1QBKC 2CL5A 2IZ5A 3PPWA 5IXSA 4II3A 1V7ZA 2X5XA 1VA4A 3UENA 3STUA 4X41A 2HRDA 1AURA 3PQ4A 4CN9A 1NQWA 3KDSE 2IXGA 3ZE1B 3PX7A 1WZ2A 2ZYDA 1N3LA 4RK1A 4OQLA 1UZAA 3A58B 3QBJA 4QECA 3ADCA 2VPPA 3KKNA 3OP4A 5LDGA 1DV2A 1PW7A 3EEYA 4IIJB 5YASA 4E2FA 5I3CA 4P36A 4Z0HO 1Q7GA 2VTBB 2CXOA 4WGGA 1HT0A 2C00A 3VYTB 2FRXA 1LX6A 3KVOA 5EIXA 4BMDA 2Q0HA 4JGBA 3NYIA 2QPLA 5BXQC 1ZK1A 3B1KA 3JYOA 4CEHB 1XZDA 1WDLA 2GAIA 3KE9A 2C5AA 2G71A 2LDXA 1C9NA 2QVCA 1TRHA 3O03A 4HWRA 4L3WA 1JMKC 1IU9A 4C5CA 5DXJA 1J4AA 4L6CA 2DHCA 2PRJA 4U7JA 1YL7A 5E95A 3IEMA 5AKIA 1OWPA 3SR0A 3DMRA 1R9NA 1K7CA 1HSZA 4KKXB 3CLHA 3SXUB 2ZP1A 1VLLA 3KP1A 4ZOCA 1GPBA 1C41A 1WNFA 2Q41A 4ZVPA 3LPCA 3NONA 5BNIA 2CL7X 3PYXA 3JD0A 2BM1A 2F3QA 3DLAA 3HCCA 4A0SA 4Q4CA 5CCDA 4LG1A 3PFIA 3H19A 3WIUA 1OBFO 5B5SA 4TN1A 1JWAB 4I50A 1PL0A 2EJUA 2R00C 3BXOA 3B89A 3UOGA 5KJEA 3M1AA 1GO2A 2WSMA 2EHJA 1RWVA 2AE2A 1E7RA 2JCSA 2QXUA 3WHIA 2PIDA 3FN4A 1Y7TA 3D8SA 4E2WA 4C6TB 5IYZA 2N0SA 4L73A 4B6QA 3K8YA 4AG3A 2I2CA 2BDUA 3C8ZA 3N2YA 1KHHA 3NBFA 3PIRA 5D8DA 2W6ID 3CT6A 1G8SA 2X0RA 5AXCA 1SUWA 3OX3A 3WLSA 3F6PA 4B4KA 1GTRA 5KTMA 3EMDA 4ZI2A 3X43A 1ST2A 1T2AA 1W36D 3H4MA 4JR2A 3WGOA 3KHTA 1N5KA 2ZVJA 3RR2A 3AW9A 4A8JA 4YRNA 4OXYA 1D09A 5HZHA 4K9QA 3G7UA 1OC2A 2EKPA 1YCHA 5DU2A 4D9JA 5CVCA 2NO0A 5JW6A 3Q8LA 5JJKA 2A33A 3LKVA 2BM9A 3U31A 3MINA 4FZ5A 3K5WA 2F17A 5A9RA 1SCDA 4YUWA 2AG1A 4IMRA 1AX9A 2ZS8A 2ZS9A 4PSKA 4V38A 4U2EA 2A9FA 3AETA 3L79A 4X7MA 1CCWA 1TQDA 1Z29A 5B4UA 1W9HA 5D2CA 2BYTA 1O0CA 3RABA 1SVUA 4S1NA 5HK8A 4Y0VA 3QH4A 4TLDA 3F7OA 1YAJA 1T5BA 1EGAA 3QFSA 3C5EA 2LPMA 2ZRJA 5LU8A 4PO9A 1LRKA 5LP6B 1FXSA 3FCYA 3W6PA 5FX2A 3V7YA 3G0GA 4BKQA 2MSCB 3QLUC 4N5MA 2P30A 2VCEA 3OPYA 1SC1A 1AUQA 5JCOC 3LQ2A 5IT0A 2GESA 3GUYA 1E89A 1MHPA 1ZONA 2Q1WA 3KOMA 2AXPA 5EWLA 1X1TA 5CXUA 2DP4E 1SU8A 4Q9JA 5ALLA 4H0FA 1YC2A 4UU0A 3RK0A 4XEUA 1IJBA 4MB2A 5I7UA 5CT5A 2DHQA 4QDZA 4P4SA 2GAFA 4JVOA 3UGQA 4FB5A 1ZJ6A 1R10A 5BRJA 3NOOA 1CQZA 2NU6A 3Q2KA 3QBVA 3QXXA 3EC1A 3R7SA 5MF6A 1C1HA 3HJHA 5HTOA 3JQ8B 4QTTB 1ODJA 4ARCA 4Q7JB 3R5HA 2ZUDA 1OTHA 3CZCA 4JXXA 4E5VA 4CM9A 4U6NA 2Y68A 4PSVA 3RT9A 3T12A 2H17A 4IVRA 4B9EA 2HM7A 1NZFA 4FP9A 4NU5A 3F7MA 2BEVB 2YXBA 3EDQA 3RYTC 1M8PA 3RC9A 1MGPA 3MS2A 2EJWA 2YCBA 3S1AA 3HVHA 5KJ1A 3FVTA 3WGYA 5KNBD 4Q37A 5I9MA 2VDOB 3ET5A 5CAEB 1RC1A 3N7AA 4C87A 1KJNA 3GGOA 3GZJA 4YV0A 3GLIB 1QLJA 1H2WA 3WB9A 4B7ZA 2QF7A 1WHSB 4ZPJA 5FFNA 3JQ9A 4KXWA 3CS3A 4PLZA 4BGIA 2ZBRA 4YHHB 1KRWA 2WYIA 2H9YA 4NAVA 4Q4LA 1IAVA 3PGVA 2GF9A 4OHFA 3GXOA 4X1IA 3UQYS 4I8XA 1BMFD 2EGHA 3MMPA 1RM4A 2WHPB 3H5IA 4XIYA 2X0EA 3TIFA 4YO7A 1I7DA 4XTRA 3JASA 3QFCA 1N6NA 1E7QA 3LYAA 3ROPA 5CIYA 1TU3A 5ALKA 4YVFA 4MYHA 3ZHTA 4FE4A 4UHEA 1GKIA 5FUVA 4WXYB 3CVUA 3IAM1 4G4JA 1UDXA 4WLVA 1XVTA 1S7CA 3ILVA 4BFVA 1R0RE 2CLMB 3AEKA 1EP9A 3MWDB 2H63A 4ZVUA 2J3IA 3CUWA 3Q6MA 5DTJA 4YTEA 3HFRA 1NDUA 2NSHA 2GCEA 2BKAA 4ALIA 4BZQA 4E09A 2OXTA 4RIEA 2VHQA 5A6SB 4F2DA 4PX3A 1CY4A 2AS0A 4L95C 3VR2D 4DR6B 4X90A 2X14A 1GTG1 4GECA 1N9KA 4RC9A 4N65A 5HZGA 3F71A 4P4GA 3GEDA 4BQEA 3IE2A 3M4YA 1XQ1A 4U0KA 4LDPA 3WLLA 3KQNA 1CIPA 4AKGA 3UIEA 2H5EA 2HSJA 4PFSA 1AS2A 2BUCA 3ICPA 1YA8A 1M6YA 4MGIR 4W5HA 3CCCA 4DC9A 4FB4A 4QZVA 1ESCA 1GYRA 3AMVA 2EWVA 3KL4A 5EKXA 5BO5A 1RXUA 1SGWA 1W47A 3NVDA 1TI7A 3HYRA 1UIRA 4INPA 3RS0A 3MLAA 1L3CA 3NS7A 4M53A 1OFGA 3UMGA 1ZLXA 1NF3A 4NXMB 2ACWA 5KJ6A 4GL2A 1EEXB 2EP7A 3CKMA 1B8UA 3SKYA 5IVIA 1SULA 2OM6A 1EI9A 2J9ZB 3DE6X 3QYJA 4UD6A 2L0XA 3SJCA 3RVBA 2C3UA 2G9RA 1N2XA 1VCHA 2ZRCA 3IHTA 1EWTA 4PWZA 3N76A 2H1RA 3TJMA 3GP3A 2JFHA 4C78A 4QQNA 1XPJA 3MJFA 2BTOA 1QE5A 1XQ9A 2AC7A 2AN4A 2GZ1A 4OIMA 4Y2VA 2CL6X 2DWOA 3ETLA 1R8YA 4B87A 4MLCA 4ZK2A 2WU4A 3TN7A 4BNNA 2RBKA 4UUBA 5EMHA 4DQLA 2Q7OE 2QMUA 1Y3CE 1AH2A 2H1SA 3VH4A 1DSSG 1HF3A 2EVWX 4CMEC 3AV0B 4JR1A 2GHTA 3HI6A 5LQDA 1T9BA 3WA6A 2C31A 3WE7A 3Q7IA 2BT4A 4JEMA 4JUCA 3KDPA 4BNGA 1LDEA 1XDGA 4ER6A 4XVCA 2GPYA 3EVBA 4RJKA 2UXBB 3T9DA 1EUCB 1Y37A 3WLEA 4NEHB 1USWA 1XWWA 3IVRA 3SEQA 5JXIA 1C9DB 1Y8QB 3EIQA 3QVGB 4IQ0A 4K9PA 4JP1A 1YCGA 2KMLA 4OAOA 2NU9B 3VAAA 3GP8A 2C7OA 4BO4A 2MSEB 1NBAA 2XD9A 1D9XA 4NF2A 3OVMA 3BF8A 2X8BA 5H3HA 1B3RA 4OXXA 1I4DD 4LDAA 3HN7A 3TNLA 4CM1A 5DNYB 4FDMA 1AV6A 1LQTA 1Y9AA 1KE2A 3LCRA 4OO3A 3QA3E 4TYMA 1G7RA 5LLSA 3P9CA 2IYYA 3VR5H 1XCOA 2V97A 3EFHA 4W8OA 5TPZD 1EP1B 3GZTB 2Z5LA 5CW2A 3L8FA 3AKDA 4DG5A 3Q8WA 3D6JA 3VKGA 2O8FB 1R5NA 2ZE7A 4BGEA 4AQYB 4IUYA 5DYIA 2R1VA 4HAOA 1GCIA 1TQ2A 4OXIA 2TECE 3K0HA 1CFZA 4RIIA 1O6GA 1USGA 4LQ4A 4RUKA 3UWSA 3OMLA 3WLJA 5ITVA 1JJBA 4RY8A 2E5FA 2WJZB 1BX3A 3IQEA 2WM9B 5BT8A 1KIFA 3MOGA 3B60A 2X0IA 5BYBA 2B0JA 2G5CA 1X0VA 4MR9A 3TZBA 2VDMB 4ZDJA 5GZ3A 4L9SA 4PC3A 5A05A 3I9MA 4LFBB 5JNUA 3ZU2A 5H1YA 2EIHA 1QFYA 4AMBA 3GT4A 4CG1A 3I58A 3OJLA 1SBYA 2HT6A 3AWDA 4GOND 4QXPA 5CJ2A 3SFZA 2FP4B 3IKTA 3AWIA 3L8MA 4TZKA 4D3YA 4UCWA 5LLTA 3AR7A 3ZLJA 5IBCA 1W9MA 2ZI7A 1V8DA 1L4HA 2Q6KA 5BURA 1DAOA 3ZDFA 5HS6A 3OOYA 3U17A 3F98A 4U9IS 2DQYA 5F2NA 4L5BA 4RHTA 2NYRA 5A71A 3WY9A 2H2DA 2GDJA 4P7KA 3HVRA 1RP7A 4MPJA 3QPUA 3AJ8A 4RVNA 3BRQA 4A0RA 4IGFA 3HXLA 4X0EA 1NU8A 4C7OA 3IDOA 1Q22A 2AFIB 4ENQA 2X4LA 1V1RB 1VG0B 4D98A 3UB4A 3VHQA 4Q4AB 3WK5A 3ID6C 2PVCA 3NO4A 2O5VA 3O4IA 4PNPA 5ALNA 5DB4A 3IUSA 2WQ7A 4EBFA 1JBKA 1MXFA 2P1DA 4UUOA 3RT1A 3VVMA 1I3LA 3OPVA 3WIBA 4YCNA 3REFA 4HI0E 2SECE 1JE0A 3UUFA 2Q9UA 4WZAE 1AKEA 4YRQA 3NHFA 3C1TA 1C50A 2G82A 1C1XB 2I1QA 2OQIA 3HXOA 1V37A 3HHPA 4L4ZA 1RKBA 2XA2A 1TECE 1ZOIA 2HPVA 3PE6A 5AM0A 4DADA 5JS6A 3NHRA 1EWRA 2ZBDA 4LUCA 2BHRA 2JJMA 4ZVMA 5TMPA 3IEXA 1E3EA 1PGJA 1IOVA 1R4NA 3SYMA 3HCDA 4R2WA 4CUKA 5AVQA 2H7YA 3IA7A 1ETUA 2WWGA 3IC5A 3M7IA 4Q9DA 1CYEA 1USKA 2CFTA 2FN7A 3DZCA 3OU2A 3E3NA 1F6WA 4NDZA 2P40A 5CYPA 2ECOA 2Q29A 4X8MA 2IU3A 3E03A 2WZBA 3GGDA 3X0DA 4ZDKA 3W2EA 1ORTA 2JARA 4UBNA 1MRZA 2WFLA 5CBPA 2JJ8A 3DSRA 3PDIA 1FNMA 3L8ZA 1IB0A 1ZKDA 5IBQA 2YMLA 2CDNA 4FLFA 3KBBA 4FHGA 4FMPA 3KZCA 1A8SA 5FRDA 2Q3BA 3VXKA 1ZRHA 2WM8A 4R0VA 3O8RA 2IZ0A 1F9EA 5DLDA 4RPIA 1LPOA 2AOTB 2F64A 2R84A 3ZJVA 4Q4HA 3W7BA 1I36A 3E22B 2W11A 3ACCA 4KJXA 3WB1A 4CIXA 1PKXA 2VBGA 4V1CI 4BNMA 2O0LA 2QX8A 4RJ2A 1KK2A 1I13A 1KY3A 2OCDA 1QRAA 2J6BA 2O2JA 3LX4A 5FTKA 4EGCB 1VLMA 2CXNA 3TLEA 2H85A 1L8LA 1V9CA 2GHRA 1YACA 3K2BA 4NFLA 3OUUA 3CRZA 4OYRA 2IWRA 1NBWB 2OWDA 1CXZA 1J06A 4C9BA 4FFMA 4XB2A 3T7EA 2CV0A 3PUHA 3L82B 2RHHA 3MAJA 1G9TA 3TR0A 5IC4A 5D84A 3LC1O 3EZFA 4M1QA 4UAUA 4EHIA 1PP4A 3RRJA 4N82A 5H8WA 1DEKA 2BBWA 4QUKA 2UU9B 1V5EA 2HQSA 4ZQEA 2BEKA 2I1WA 4XPIB 4JQCA 1AE1A 4YJ2F 4UTNA 3JWGA 3DB1A 3IUJA 4OSPA 4S12A 2HHHB 2C54A 2C7GA 2FKNA 2W8BA 1NTRA 3I2YX 4DFDA 1P80A 4O3MA 1NUUA 1F1BA 2CJWA 1HE2A 4KUHA 3ON5A 2E21A 4GXNA 2IZOA 4DV6B 4L5AA 2H7CA 1J5XA 2NTNA 3PPIA 3ECSA 2CN1A 3ZI0A 2XPCA 1H9BA 1XRLA 3HRHA 5JS1A 4ITVA 4LCEA 4RTNA 5FWYB 2W58A 4FVTA 5I7EA 6PFKA 5LZ8A 1GZSA 2P9FA 4NV1A 2NP6A 5ER9A 1ISGA 1XAIA 1EFPB 1ABFA 2ZGVA 1U6IA 3QEOA 3JS5A 2J6IA 1XMXA 4BLOA 3VJLA 3V2HA 2PMKA 4OJKA 2F55A 5F98A 1LDMA 2Z4RA 4F4JA 5IUNC 1QQBA 4UE2A 3BTOA 1YH3A 5GY7A 4B34A 2A8YA 1E3IA 5IT5A 4LDJA 3SR4A 3TW6A 4YV7A 1O57A 3KU1A 2VQ6A 1W581 2ZWAA 1F7UA 2HIHA 3KHSA 1TJ5A 3RYIB 2C20A 1QFSA 2Z2KA 3FOWA 5HCIA 5CB0A 4YAOA 5ALJA 3M83A 3D6TB 3SY8A 5FPSA 4E46A 2WJJA 1GNQA 2PUVA 1ULZA 4DM7A 3CNEA 3L1HA 4TWIA 4D8YA 3CF6R 1GDTA 2BV3A 1O9HA 1Y7IA 5F78A 5KINB 1FLDA 1U3VA 3L0SA 2RCYA 4FNMA 1SHZA 3H5OA 3MT0A 4RTRA 1YQ9A 3QXJA 1VA5A 3SNKA 5ALZA 2OHFA 3OKAA 2PRSA 1W4AA 1RQXA 1BN6A 1NRXA 1C3LA 2QLBA 3DLTA 2CKDA 3EQ9A 2GCPA 3H8JA 3R0QA 1MEEA 3DO6A 8ABPA 1XMOB 1SRRA 2O0MA 3D8BA 1GSOA 1G1AA 3JARB 3WR5A 2RGYA 1AQYA 5FKJA 5AUQA 1II0A 2C92A 4FFWA 2BFOA 2IYLD 4NOJA 4YAIA 1ESDA 3I12A 4BO2A 2QUIA 4EFKA 3CGWA 3T7SA 1KYWA 4TWRA 4DM3A 4CKEA 2PUDA 2PGOA 3A3OA 3Q3GE 4IKPA 2O2DA 4RH1A 2WC1A 3LUCA 1CUJA 3OIYA 4CV1A 2VYFA 5ESDA 2PMCA 2D2IA 4BNDA 4YIHA 3C24A 1NW9B 1ICIA 3UBMA 1N5JA 3ZD9A 2HA4A 4GI7A 4JJFA 2H11A 1RAGA 1GLVA 1L7RA 3SM9A 4LOKA 1RRPA 3NIFB 3W5IA 4PYMA 3QFHA 3OF2A 4HZIA 5JQGB 1MG0A 5KOIA 4GZLA 1EA5A 1D1QA 1I51A 1YUBA 2YWRA 3HU3A 1U7UA 5KTOA 4GZ3A 2JFZA 2IEBA 3B5EA 4CI0B 1UF9A 5LWQA 4AN4A 3COJA 3K0FB 4KYVA 3TZKA 2HK8A 4DDVA 3QV1A 3KXKA 3QBTA 2D4HA 1UK9A 2PJDA 1G18A 3CNNA 4EL0A 4Q1DA 3IHWA 1QC5B 2PSDA 5L3QB 1YI0A 4TMVA 5T4FA 5CFZA 3PEYA 1IY0A 2HA3A 3GVPA 1KQFA 4HB2A 3Q4GA 4LXHA 1HYBA 2PX3A 4FCCA 1H3EA 4A8TA 4EPRA 1IN6A 3KWMA 1EXDA 4P3XA 3QSGA 1NVAA 4G4GA 4AIRA 3LHIA 3T41A 2QTLA 3ZHBA 3EBLA 1PFQA 5DX0A 1Z6QA 1X1RA 1L7VC 4DNQA 4CTMA 4GBJA 3L07A 5IAOA 3COVA 1B7GO 3GI1A 3O74A 1FUUA 4RE6A 3JCZA 2XYVA 3ZKWB 2FPXA 2PWBA 4D3SA 4ED9A 2BFMA 3KPJA 2P6RA 2F9FA 3H1FA 5I9BA 3LNTA 3ULKA 2M6KA 5UKDA 4B09A 1NDHA 3DHVA 5FNVA 3GH1A 3AM5A 1JPVA 1B15A 3AG6A 1TT7A 5FHQA 5FV4A 4EYQA 3ESBA 2A9PA 1HE1C 3I9V1 1GD1O 1FMJA 2WHYA 4QBIA 1NBHA 2A5DA 1S2MA 4XJTA 4BE4A 3BVPA 3V1UA 5ALFA 2RGBA 3CTMA 1RPNA 1Q19A 3OJXA 4JUIA 1SUBA 3O4RA 2W2QA 3BXHA 4INAA 5DYTA 4ZGBA 3CF4G 1E6LA 4NMLA 2JEOA 4IO1A 3L0BA 3KIPA 3RJMA 1N32B 2Q8PA 4RCVA 4IS3A 2RKBA 5GWXA 4G1VA 3VNUA 1OLOA 3D3JA 4O02B 4R40A 3PL5A 4TVKA 2AN5A 3M4XA 3K31A 4YJ3F 1Y8ZA 1IFXA 1OKKA 5DGXA 2BUAA 4R2MA 4RL6A 1UJCA 1NQ5A 2Q50A 3TM5A 4DCTA 4HXEB 4EHDA 5JSHA 4LBYA 3T5AA 3DMTA 3BORA 3FVVA 4EATA 3AM3A 1ZEMA 5FPHA 1UXJA 4JCOA 1U99A 1NPDA 2Y3IA 4R31A 4KR2A 4MR7A 3OE7A 3LK6A 4K9LA 1TUBB 1J5PA 1DBQA 2FN4A 3M9LA 4AICA 5GINE 2GKGA 1WBDA 2DY0A 1EWQA 4DV7B 2VK8A 3DFMA 1NURA 3M6FA 3DH0A 4I1IA 4OJTA 2QX4A 3UT5B 4YLGA 2Y92A 3M8KA 1J0XO 4NBVA 2ID4A 2OBYA 3O90A 1V7PC 4RFLA 4DAOA 4B45A 1NF9A 1BRMA 1ZOPA 3ETDA 2B78A 4ZU6X 3TEJA 3ZHOA 3AHDA 2J32A 3GARA 4CTNA 4AZTA 1AUOA 4EHAA 4EJSC 1I4WA 1VSTA 5HVNA 5D7NA 3HG7A 1EUZA 2FZEA 1ISMA 2O48X 3OIUA 4N1AA 7AT1A 3RS7A 2Q27A 1BWPA 4KRYA 3AUKA 4U00A 4WNAA 2CLEB 3DEKA 4X1YA 3HBJA 3IUMA 4ZZIA 4MDFA 2XMDA 3DMYA 3K6RA 2EAUA 5ALTA 1HQDA 3AY0A 3R5KA 1T9CA 3B9RA 2WRZA 1WXXA 3OIVA 3H1AA 4JROA 1YIOA 3AZQA 2QRKA 1W1WA 1WXDA 1GVNB 1LNQA 3NWPA 3I42A 2ODAA 5IZCA 1T2VA 5JY1A 1YZTA 2HGZA 1G9SA 1V4NA 2DUJA 4LHVA 5ELLA 2IH4A 4FWBA 1I9GA 4D3ZA 2QMEA 3C3MA 3K0CC 5LUAA 1M66A 4JJZA 3WGLA 2NZYA 5JJLA 2QMHA 5H3CA 1AN0A 1RM3A 3OEEA 1G66A 4Z54A 4RW0A 3UC5A 2B69A 1XZNA 3V9AA 1D6NA 4BO3A 3GPBA 4IV8A 4X8LA 4QU8A 4KFTA 5CRIA 1CEEA 1G21B 5A0TA 2P4EA 2W2TA 2IXBA 4WA7A 5I6DA 4KTTE 2CFRA 1OBOA 4FC7A 5HA5A 4AM8A 4UEKA 2DVMA 4IF4A 2B92A 4IJVA 3RANA 4Q6WA 4G8BA 4CLOB 2XCLA 4G5SA 4OKNA 4CM5A 2Q6OA 3JATB 4P3YA 4WX2B 3JQ7A 4YJ2A 2O07A 3CCBA 4KQKA 2OMKA 3GBPA 2UZIR 4TRJA 1O94A 1QZ3A 1MV8A 3A6ZA 1LNSA 3CX3A 5CUQA 5KNBH 5FBVB 2DPHA 2ZR9A 4RO0A 3TSYA 2PUCA 4QEDA 1JKFA 4G0UA 2P4QA 3WKDA 4J9VA 5AI8A 4B35A 3NTLA 4JZYA 4EKEA 2C3OA 2PVSA 1E1QA 4ZVRA 1EBBA 2CSUA 1ZUHA 3LWDA 3OJCA 5LMCA 2IDZA 3A3NA 2DH6A 1T25A 3BKXA 1MIOA 3DZBA 3TQTA 2PDAA 4QT0A 3DWGA 4KR0A 3UKJA 2IL1A 4YP9A 4ZVLA 4GP9A 5JD6A 3EX7C 1XJ0A 4EMSA 1MEJA 3EA0A 3KYIB 3E23A 4D44A 5EMNA 1V7QA 1EH5A 2VXOA 2H1WA 3PHBE 4G63A 4UMFA 3CCFA 4X8OA 5C1BA 1JR2A 3BMXA 1MJGM 3MELA 4GVXA 4NARA 3PPXA 4D4JA 4Z2AA 3FSGD 2FSUA 2PS1A 2FLVA 1DIOB 3VYWA 4KQ6A 3C16C 2OBFA 3RYHA 4F3KA 3F8WA 4KW7A 4FWTA 2Q4TA 1CUWA 4HK4A 3LCUA 5BVGA 3UMMA 2JBHA 4XJVA 3EVTA 2FW7A 3WZMA 4GO1A 1T9GS 4ERNA 3FJ1A 1PBNA 2IXDA 4FSHA 2FUNB 3UPUA 3RS3A 2F48A 3DNMA 1CQWA 2G83A 4FFLA 5T4HA 2VJMA 1BIFA 1AQNA 3HRKA 1XQXA 2DBRA 2R47A 4C4TA 3O1HB 1QH8A 2Q5EA 4FQ5A 4NPHA 3UHAA 4A03A 2ZUFA 3ZVLA 4DF3A 4EJFA 1NMQA 2NT3A 2DT5A 1U28A 4G6ZA 4CG0A 4LX0A 2WU8A 1C5KA 3OKPA 4FOOA 3S2FA 2I2FA 4HTAA 2GTPA 2XNDD 4I66A 4P1ZA 1OWNA 3TIGA 4F7WA 1Q0LA 2WSIA 3TF5A 2E9SA 5FLKA 2LIVA 4NXNB 1GGFA 2NVOA 1JA1A 1VPVA 3A1CA 3CIFA 3KOXA 2H54A 4AROA 4MEBA 5JAPA 1R0SA 3U7QA 4CLRB 1EG7A 4AY5A 5CLIA 4IHJA 1JN0A 4P7JA 4LWPA 5CNIA 4B43A 4DNOA 1XMQB 1R0XA 4ACBA 1KYVA 4IWNA 1ZBQA 2ZVPX 4ENRA 2WKPA 3FMIA 3IERA 2CCJA 5BRNA 4BNTA 4KPUB 3V32A 4MVXA 3DZKA 2JIQA 1IDOA 2WV9A 3D1VA 4NBRA 4B3MB 2FE4A 4J0EA 1RWOA 1SA0A 5TT1A 3PJEA 2H2FA 3ZGXA 5AM2A 4QE3A 5CG1A 3PNOA 1FP4B 4HRVA 1PDWA 1S9DA 2JGJA 4BNXA 3FYTA 3GRVA 5C5DA 5IWAB 3ZZ0A 1UBLS 5BSTA 4UXJA 1MMFB 4LOAA 5AW1A 1R6BX 4YXFA 1HM5A 2UXDB 2I91A 3W1EA 3H3FA 2CWWA 1RLJA 2O2EA 4X7BA 5ALSA 1VSQA 2QP3A 1D8TA 3B7PA 4MQBA 2CUTA 5DTRA 4ZZ3A 4DYDA 2PRIA 3R41A 1YIAA 4JP2A 4RWZA 4B4UA 3LS2A 5E6UA 2FVXA 2VBIA 4JSYA 1KBOA 2AN3A 5HMLA 5COBA 5DN6D 4LXQA 4C76A 3LRPA 2Y67A 5AHOA 1U3WA 3DQPA 3MVEA 3LQFA 4F5EA 2VJCA 2WUFA 1QIMA 1ZL0A 1G6Q1 2Z04A 3N53A 4CGYA 2IHNA 1T4MA 1OJ7A 2PNFA 2ZSHA 3WK8A 4B75A 2HPZA 1SY7A 3OCVA 2JPDA 3FPGA 3VISA 4C0AC 1D1SA 3A11A 5JYBA 1OXTA 3ST7A 4EKDA 4F4FA 5KMGA 3HVUA 2W4QA 2IITA 4AQDA 2XHZA 1T0IA 2OO5C 4X45A 3ICEA 2JRLA 2V7QA 2JIZA 1Z8NA 4PLPA 3WSTA 1Q15A 1R8SA 4B0PA 5JXWA 2R1ZA 3EGXA 1XB2A 1K2VN 3V1LA 2FPOA 3LC7O 2X9GA 3G2NA 3CUEF 1JLHA 4TTVA 5KNBA 4LRYA 3S6JA 4K6CA 4RGYA 2OD2A 3OE7D 1X1SA 3NG1A 2ZT8A 5GVRA 5CFRA 2F8MA 3EAQA 1ZM7A 4H1TA 1F2UA 4KFSA 2BF7A 1WDTA 4HB3A 4Y67A 5MFZA 2C2YA 2A57A 3MS4A 1ZJ4A 4DGQA 1NJ6A 5IF9A 5JZOA 1G1MA 5D5QA 4JXKA 3I9V6 1NIPA 4FEEA 1M6NA 2UVQA 3K72B 4NG4A 4IH9A 3IIKA 3QQ5A 1HFEL 3UT5A 3VPAA 1G3QA 1RI2A 2DBYA 3W7VA 4NSNA 2RK6A 1PEAA 4A23A 3RSSA 2B83A 1GAJA 5AKXA 3VNVA 1LA2A 3B3GA 4NE2A 4DRYA 2GK3A 3O8DA 4D9BA 3TEFA 4CQMA 3RAFC 4O8CA 5HFNA 2PLRA 3H6KA 3I01A 4QU5A 3P5BA 2ZUTA 1RYZA 4R8LA 1IHDA 1AS0A 4RA6A 2O3UA 2RGWA 1L0BA 3TD9A 1V5GA 1SUSA 4XTCS 2C61A 4EKNB 3PRKE 1RACA 4FR0A 1NLUA 5A4FS 5DWDA 4ZAYA 4EY8A 3DTVA 1EQUA 3OETA 5IM5A 4V2UA 4UDYX 4OXRA 5EXTA 2HJVA 5HCNA 2WVAA 4FX2A 2X0FA 2AFRA 2GQ0A 4OLAA 1K6IA 3ZBQA 1NC3A 2EFJA 3RC2A 5J43A 1BSVA 3SP1A 2WSBA 3G9UA 5HM6A 1MQSA 2CFCA 3BPSA 5I47A 2NUPA 1UAYA 3KAKA 4BMZA 4JLKA 4KSBA 2QX7A 4GOLD 3SSMA 1J21A 1ARZA 1YQEA 4JP8A 5A9SB 4GR4A 5AJVB 3SC6A 2WVHA 2WFAA 1GT6A 4LMAA 4YJFA 3DMHA 1N7JA 3BF7A 1NF2A 1JYEA 2HZ7A 3A10A 3NETA 3OM9A 4ZCTA 1WCV1 3NJ8A 5GONF 3RAPR 2BHTA 1GQFA 3ZOZA 3CONA 3ZHUA 4RABA 3QLEA 4XDZA 5JVDA 4O4LA 4H6PA 2HHJA 5TT0A 3V4FA 3P2EA 3WL7A 4GI1A 4MB6A 4JNCA 3U1TA 1SOWA 3FKSA 3HCAA 3PXAA 3Q3EA 1TYEB 5TSDA 3B6IA 1PV2A 2VCYA 1I3OA 1UPCA 3FLMA 5BORA 3D2LA 4OAPA 4CCAA 1TJ3A 1OV4A 1MT0A 1P62B 1ZD1A 2YS6A 1QANA 5KC8A 3PRJA 2AMLA 4UNPA 1VJ5A 1ZD2P 3DOFA 5IEBA 1XNQB 3B7GA 4AYXA 5IDWA 2QBYB 4XWAA 3R3WA 4U2BA 3HWWA 5B3JA 3Q8KA 2YDYA 4IDPA 4KLRA 4M9UA 3HP4A 1UINA 4KVGA 3HJUA 1CUDA 3OEHA 3D7LA 2OV2A 3G3EA 5TVGA 4E1VA 4Z1MD 2PY6A 3K0AB 1N0WA 1YZYA 3KYBA 2BTQA 3H83A 4D6XA 4C29A 1ZMOA 5GONB 5IEJA 3IT2A 3FD8A 1E98A 1E79D 3RH0A 5HF9A 3E8SA 1JLRA 3QX7A 1R7RA 3ZXXA 1Y3BE 3ABIA 3RIYA 2FPPB 4M76B 1WB6A 1ZW1A 3C4VA 4CR6A 1YASA 2NSDA 3HKBA 3IODA 3IR5A 3EIUA 5DYYA 1TO6A 4BATA 2VDWB 4QOFA 1X7WA 4YP1A 4OUDA 4IJ6A 4P98A 4PVCA 5AJYA 1I3MA 5BSGA 1PVVA 2F6RA 4U7WA 1U4NA 2OESA 3BRCA 4HPJB 1V47A 3THSA 1Z45A 3GRUA 2FCAA 4A1FA 1ZSYA 2QEQA 3HR4A 3UCEA 4MUMA 4FKMA 2D2EA 4M36A 3RIXA 3IXQA 4YBZA 1UZNA 4DB4A 4JSRA 1JJ7A 2AOUB 3KSUA 2HMSA 5JI2E 3FDZA 5J1TB 1MAHA 1G19A 4N9QA 3WHKA 1ZIDA 5I45A 4IZIA 3OEHD 2FW6A 4E4YA 2GN9A 3FNBA 1IC6A 4QWWA 3KCNA 1R27A 2F3TA 2QVGA 2XNDA 1XDDA 1E60A 1TU4A 4PRKA 4RV4A 1RCFA 2I4MA 1H2YA 3A4MA 3ZCPA 4JI6B 1E2PA 2O8BB 1A04A 1SKYE 2BLNA 2QM0A 2R6GA 1GYQA 1MB2A 5B53A 1SVOA 1T9ZA 3QJGA 3ABRB 3UUGA 1W5FA 2QR5A 2ZIZA 4HSGA 4J16C 5BWBA 4HEA6 3USZA 1KZGB 3CC8A 5LD2B 3DVAA 3VZSA 2AD1A 2YC2C 2BGUA 2RAPA 1YDMA 3BFXA 4PNHA 3RTCA 3P1JA 2BKXA 3Q5EA 4LZLA 4WE3A 2UAGA 2A6PA 5B7GA 1C0KA 1FDTA 4KO2S 3NC0C 2PANA 3ZIAD 3X2SA 2HSZA 2IDKA 7ABPA 2CNBA 3D9QX 3QUTA 3U7JA 4FD2A 1SKBA 5I7RA 4P3NA 3RUHA 1H4SA 5I3ZA 2NPFA 5IDXA 2PE5A 4KKVA 2J3MA 2OFPA 2QL7A 2F43B 2K2QB 1YA6A 3U62A 3VZPA 1L8OA 4TTQA 2DKFA 3FWNA 4KE8A 4RPHA 3ASYA 3ZGYA 5CYGA 3EPHA 2PL3A 2VKTA 2X23A 5AW4A 4EB8A 4LFCB 3KSRA 4RPGA 4Q3DA 4TGLA 1XLWA 3QELB 1MN6A 1ZW6A 2QNRA 3AEZA 3OIDA 3U3ZA 3R9XA 4XFKA 4ZKDA 5DGTA 3FF4A 1TVKA 4RF4A 4ZCPA 1V45E 3GLGE 4G97A 3FHCB 1M6VB 1RXCA 3PZBA 5TPWA 5JDIC 1PFKA 4F4HA 3GGGA 4BC1A 1KK3A 4ZRDA 1RYEA 3KB1A 3AFIA 1QGOA 3JRWA 1B23P 2PS3A 4PPNA 3G68A 2B2XA 4UFPA 2XIJA 5ALYA 5JAMA 2E82A 3KKOA 4AG5A 4CQNA 1FTYA 3HCBA 4RM3A 1EK6A 1HDZA 2AXEA 2D8MA 1SOMA 5JYEA 1XZKA 3DL0A 2GN2A 1SRQA 4KIJA 1NN5A 5FDFA 2W2LA 1TTTA 1PDOA 4MUFA 4OD0A 4AULA 1DC3A 2O7RA 5T4EA 4Q9LA 5JD4A 5AESA 3PDHA 1FNBA 3L0IB 3E48A 4O1MA 4YAFA 5C8YF 4YCCA 3ZE9A 2HBQA 2RH8A 3NCTA 4DSOA 3FGNA 1W0JD 3WJ1A 1Y8CA 1KS2A 1A8QA 2EGGA 2Z2YA 3EJ6A 3BFPA 5C81A 1Q1BA 3W78A 4GXTA 3EGEA 1JEYA 4FW9A 2HA0A 3TPFA 2YYSA 1P91A 5FAXA 5EWMA 4S2EA 2ZIXB 2CWDA 2GCIA 1QQAA 2A4MA 2RH4A 4TYNA 4V0QA 3RS4A 3UV3A 1R5OA 2XZTA 2QD5A 2G1JA 2C88A 4QGFA 4MVJF 4WI1A 4ODIA 1E7SA 4RV5A 5T6BA 2VP5A 2XUDA 5JNLA 3E2IA 2YIDA 4M2LA 5TNXA 3I6ZA 1E9CA 2G9ZA 4Q4JB 2BBOA 5M2QA 2R0QC 1IG3A 4CLEA 3R6WA 1ZXLA 2NU6B 3JQFA 3JQBC 3VH2A 2I4IA 2R4QA 4MIOA 1HZJA 3ZZNA 5CLLA 1L5GB 1YMQA 3MFYA 4C20A 2YXNA 2AG8A 1UQTA 1ORRA 2O19A 1EKXA 5K0TA 2L82A 3STTA 2VPZA 2PL5A 4L3VA 3WGVA 5JSZA 1SJ9A 2H2IA 3VJRA 2IYOA 5KAPA 2WYOA 1YDEA 1Z4NA 4HDNB 4H15A 4IGEA 1XZLA 1PEDA 2V9CA 2HA5A 1DG3A 1XK7A 2QZZA 3FI0A 5TJHA 1IXKA 3GFOA 1P74A 2X6TA 1HEYA 3W90A 2XBLA 4EUFA 1G63A 4ZOBA 1QAMA 2AYXA 1GXSA 1OYYA 3DD5A 3T1VA 4JODA 5C32A 3RRYA 1MRSA 2GVZC 4Q3OA 1SC9A 5IKPA 2AXNA 2R5NA 3DMDA 1FB5A 2Q3FA 4YB8A 3LFTA 1VBFA 1D07A 3GCGA 3LY9A 3N2EA 3E1GA 4IOJA 4RF5A 3TR6A 1RSZA 1SBTA 4M55A 3PKIA 5A4DA 1GGEA 4BGDA 4E3WA 1FFCA 3CG0A 3V5NA 3GRYA 2ZTUA 2N46A 3GCZA 3ZZMA 5I7WA 3D3NA 3GLFA 1FC0A 2D59A 3WRXC 3ZGOA 2ZUEA 4YHBA 1IN7A 4HFNA 4P22A 3CM0A 5HJ7A 4DL9A 3FKSD 4DSNA 3JAMA 1PJTA 2ZKLA 1DOZA 3DR5A 1G4AE 4MRPA 5I9SA 4BEBA 5LQSA 4S35A 3X1JA 2AGVA 1I7QB 3K6SB 4YREA 2I1LA 5LL6P 2V7XA 3ADPA 1GGMA 9ATCA 4BQIA 1JQBA 4D9CA 1X9GA 1PTJA 3WXBA 3ZEIA 3H8VA 2HU5A 2WWTA 3CNQS 3KZVA 3FGZA 1M8JA 3PHLA 1TO1E 3SJBA 2Y1CA 2FFHA 4LV6A 2XYPA 3KEFA 2HZBA 4FLMA 4DTCA 4JI3B 1V5WA 4O4IA 3FZYA 4OCZA 2PUBA 3GFSA 1E2UA 3HBAA 3M5CA 1SQSA 1Z6TA 2F1IA 4HAYA 3E84A 2QPTA 4UUPA 1H9CA 1AK9A 3GLGA 2VAXA 2FPLA 4B73A 2EQBA 3G13A 4LGVA 1EFVA 2WP0A 5F1KA 1HTBA 1LLFA 1YT5A 3DQQA 4EHNA 5EHXA 2J7PD 1O77A 3K0AA 2FX2A 4EW2A 1H2HA 1Z6GA 3UH0A 3J7TA 4MHOA 4L7QA 1Z4IA 4KXVA 4TKZA 4WLEA 1VL5A 3A32A 3L6CA 3PENA 3Q12A 3R5JA 2EFYA 1YZNA 4LE0A 4ZT7A 1EK2A 3GWGA 2GUWA 3UB3A 6CHYA 3JR3A 2HJ9A 3KUUA 3QU5A 4IIBA 5AI9A 4CIAA 5HRCA 1ETHA 1GQRA 1K8ZB 3KB6A 5LJIA 5JWHA 1WS6A 4BWGA 1QIJA 5KQLA 3BBLA 4FFRA 2ANCA 2P0AA 3N7TA 1MQAA 3NTUA 2EYUA 1Z63A 4ZRNA 1GRRA 5DSXA 3QPAA 2A0FA 2HNAA 3I5MA 4WZ6A 5K5EA 3BMOA 2BKEA 4YRSA 4IHAA 1P19A 1W29A 3MPUA 4FFPA 3ZHCA 3F5DA 1AZSC 1NC1A 3L0CA 2NTYC 4EG7A 2V6IA 2FWPA 3ZEAA 5L8VA 1WV1A 2J46A 3KSDO 1BCRB 2V1XA 2IHBA 2ZE6A 3ENWA 3RSQA 3CFYA 3ZY3A 4ALKA 1TK2A 3AGQA 4NS1A 2GF0A 3L84A 4L9AA 3H42B 1TLFA 2YWBA 1Q7EA 3E3AA 4QBKA 5CDFA