3ENZA

Arsenolytic structure of plasmodium falciparum purine nucleoside phosphorylase with hypoxanthine, ribose and arsenate ion
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
244
structure length
244
Chain Sequence
NLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFLCVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHLLIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAVVEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKLATKYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Conservation of structure and activity in Plasmodium purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 83
structure length 244
sequence length 244
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3enzA00
4F3CA 1K3FA 4L5AA 4ECEA 4QEZA 4MCIA 5ETJA 2I4TA 2AC7A 5C80A 1Z39A 3PNSA 4L5CA 3K8OE 4L0MA 4QAQA 1U1EA 3ODGA 4KN5A 1OU4A 4R2WA 1Y1QA 1Q1GA 4OJTA 1A69A 2HRDA 5FAKA 4OY3A 2A8YA 3IOMA 1Y1SA 4WKPA 4GLFA 4G8JA 4TS3A 1PR1A 4LZWA 3UAZA 2QTGA 3QPBA 2ISCA 3UAYA 4DA7A 3TL6A 3DJFA 1Y6QA 3OZBA 1VMKA 4DABA 1B8OA 1PKEA 4RJ2A 4LNHA 5F7XA 1Z36A 3OZDA 4E1VA 1PWYE 1ULAA 1YQUA 3LBAA 5DK6A 1JE1A 1A9QA 1LX7A 1RXUA 2OC9A 1Y6RA 4FFSA 1U1FA 1JPVA 1ECPA 2BSXA 4TYMA 1SD1A 4OF4A 1VHWA 3E0QA 4EB8A 4G89A 3KVYA 5F7ZA 3OPVA 5EPUA 3P0EA 5CYFA 5F7JA 1T8YA 1VFNA 4UC0A 1ZOSA 4F1WA 4BN0A 1V3QE 4F3KA 4QASA 2QTTA 4GKAA 4TXLA 2AI2A 4YO8A 2QSUA 2A0XA 1VHJA 1Z5OA 1PR0A 1Z5PA 4YJKA 4DA8A 4GMHA 5B7PA 3NM6B 4MCHA 4OEHA 1OV6A 1I80A 3OOHA 3SCZA 1SJ9A 5K1ZA 1PR2A 2IQ5A 1QE5A 3DP9A 5IFKA 2AI1A 4TXNA 3BGSA 5EUBA 1WTAA 1ODLA 3GGSA 4G41A 1TCUA 1YQQA 1PW7A 1Z38A 1JDSA 3DDOA 1K9SA 4I2VA 4R2XA 3EUEA 5CCEA 4YMLA 1CB0A 3C74A 1NC1A 3E9ZA 3NBQA 2I8AA 1N3IA 5CYGA 1JDVA 5CXQA 3K8QA 3OF3A 3OZCA 1OUMA 2HN9A 1ZL2A 4LDNA 1T8WA 1RT9A 3FUCA 4NY1A 1T0UA 4QARA 3DPSA 2RJ3A 3UT6A 3BL6A 1M73E 1PK9A 1G2OA 4WKNA 1TD1A 4NS1A 5B7NA 4K6OA 1NW4A 1JYSA 4U2KA 4DA0A 4DARA 3UAXA 4OGKA 1Y1TA 1C3XA 4WKBA 5F73A 1PR4A 2ON6A 1PBNA 1PR5A 4M1EA 1OTYA 4TXJA 4GLJA 1TCVA 4TTIA 2OC4A 5CXSA 3MMSA 3O6VA 3E9RA 1T8RA 1RXYA 3P0FA 1K27A 3FNQA 1V45E 1ODJA 3OOEA 1YRYE 1Z5NA 1CG6A 4IP0A 5IU6A 1NC3A 4F2PA 4D8XA 3FOWA 3OZEA 4MARA 1A9PA 4DANA 1RXCA 4OGLA 3NM5A 1T8SA 5F76A 1JDTA 3FAZA 5JPCA 5EFOA 3KU4A 4QFBA 3OCCA 4D9HA 1PR6A 1JDZA 1A9SA 1V41E 4DAOA 1OVGA 2XRFA 3PNPA 3KVVA 4X24A 1Z35A 4P54A 4LKRA 2Q7OE 3GB9A 3U40A 5F7OA 1A9RA 4L5YA 2OECA 1LVUA 1RFGE 2PGAA 2A0WA 5F77A 5I3CA 1OTXA 3NM4A 2OXFA 1RCTE 3ONVA 2QDKA 3FB1A 1ODIA 1U1GA 2HWUA 1ULBA 1RR6A 4TXHA 4M7WA 3KUKA 1V4NA 1U1CA 4D8YA 4R31A 4D8VA 3PHCA 1XE3A 5B7QA 1RSZA 1LV8A 4NSNA 3BJEA 1RYZA 2P4SA 4F2WA 3EMVA 1TGYA 1YR3A 3DF9A 4DAEA 3LA8A 4WKOA 2HSWA 1V48A 3LGSA 5KB3A 4TTAA 3EUFA 1JP7A 3EEIA 4EARA 3FWPA 4QATA 5B7GA 3T94A 4BMYA 4BMXA 1B8NA 1Y1RA 4PR3A 4YNBA 1YBFA 3O4VA 4BMZA 3KHSA 1A9OA 1Z37A 5CCDA 4JOSA 3UAWA 4TS9A 3ENZA 1JE0A 4JP5A 3MB8A 2A0YA 4TTJA 4PNPA 3INYA 1FXUA 1ODKA 1Z33A 1SD2A 1Z34A 3KVRA 2H8GA 3D1VA 1PF7E 4D98A 3PHBE 1A9TA 1V2HE 4JWTA 2B94A 4M3NA 4L6IA 4WKCA 5F78A 3F8WA 1U1DA 2QPLA 4H1TA 4TXMA 1TGVA 2GUWA 1SQ6A 4DA6A 4LNAA 1PK7A 1RXSA 3UAVA 3BSFA 2AI3A 3IEXA 1JDUA
chains in the Genus database with same CATH superfamily
5IT4A 1F14A 4N7RA 1BZYA 1F4VA 3D3JA 3GZJA 4OA5A 2A30A 4QEZA 2WG0A 4W63A 4GPEA 4REMA 5BXYA 5LB4A 3GEDA 1QTIA 3RRNA 1U3VA 3KLPX 1JYFA 1GITA 4UTNA 5JNTA 2NTVA 4HDKB 2CZGA 4MGKR 2AC7A 3FTCA 1LDBA 2C77A 2H7VA 3HEMA 4WZAE 2WWWA 3ZQ6A 4CM9D 3S2ZA 1U4NA 3GJ3A 1GTJ1 5FR1A 1T0PA 3IAS6 3LLCA 4L0MA 5BSGA 3T6KA 3B8HA 5AKLA 1AQUA 2I6UA 2JBAB 5KWIA 2H07A 1LF5A 1L5WA 4UQOA 3RAJA 3K8YA 4DOMA 3DVAA 4C0HA 1JHOA 5DYWA 4P22A 4MYSA 4DVJA 1FA9A 2HW8A 1LI7A 2CL6X 1JWLA 3AM4A 1N4DA 4QFDA 3ZWCA 1YQ9A 2QWXA 1EUCA 2EG9A 4NABA 1H3FA 4RBNA 2P41A 1Q1GA 1AGRA 3OE1A 4YP5A 4FBGA 4HWSA 2NU7B 3CZ4A 1VCOA 1VIYA 3GYBA 3QBJA 4Q01A 1X8KA 2FRDA 2W2MA 5LB2A 3VR2D 1GCIA 3IO3A 4AXBA 4DY4A 2Y1EA 1IH8A 4G01B 1PJQA 2V7TA 1PR1A 1RWBA 2RG1A 2EZ4A 2YN0A 2FEKA 3GLHB 3VNBA 1Z8DA 2DT8A 2AQHA 4BNMA 4BQOA 1IHYA 2QTGA 2ZWPA 3F7MA 2XDAA 5BUZA 3IL2A 2AOUA 3VH4A 1L3BA 2A1UB 3QENA 4L76A 1E9FA 3PIIA 3OZFA 1FVHA 3FDJA 4KQ2A 5FFFA 3UAYA 3WBFA 4ZI7B 5KYYB 4QGSA 1PJRA 3DOIA 5ALGA 2X0EA 2QV0A 4ACAA 4ASUD 3CUWA 3R2JA 4XWKA 3A2KA 3HXOA 1H1TA 3DR3A 1Y5IA 2EX1A 1WUKS 1UM8A 3LKVA 4JT4A 3RIMA 4DKJA 2YXLA 2B0CA 4OB8A 1LDMA 2GOYA 4XVRA 4QLAA 3VOTA 1IOVA 4B31A 4C2AA 5B57C 3F2IA 3QITA 4OJNA 1Y0BA 2AW3A 1YCGA 1ZUNB 1OU0A 3ANYB 2VHWA 4JITA 3ZHBA 3ZIDA 4C4TA 4E22A 1DINA 2C5AA 3WTBA 2ANCA 3U4HA 3UMRA 4YT2A 3KZOA 2OC9A 4TN5A 3PRHA 2Q6TA 2FNAA 1SU4A 2L2QA 5DNWA 3MJFA 3A25A 4V0OA 2IPLA 3AHEA 2ADMA 3BTUA 4PXSA 3ZU5A 2OGSA 4JU8A 1LGYA 4BZXA 3DLPX 3QNMA 4EDFA 3OOWA 4F6CA 4LOJA 3AKZA 3SYMA 1T6ZA 3E5HA 2QE7D 4FZ5A 3MD9A 1II0A 1Q1EA 3F5DA 3P4YA 3VYUB 3UV3A 4MW0A 1OI4A 1W73A 2GLTA 1WMBA 3WJ7A 3IOEA 3WBJA 3HJTA 3S81A 2VT6A 2FMHA 3ON5A 1D0VA 2VH1A 3GK3A 4JY7A 1JLMA 1OI3A 3M6MD 4U39A 1QIEA 4WADA 3ZVKA 1UC9A 1KA9H 1VFNA 2C7GA 1II8B 4BMSA 2YN2A 3U4MA 2KQUA 1IBMB 4BCCA 2AYZA 2WTEA 4E4TA 3ZI7A 3G9ZA 4KG7A 4PPGA 4ZO4A 2XEDA 3JVUA 2B1QA 1V3QE 2X3UA 4WK4B 3EK2A 5AWFC 5AW8A 3ZI4A 1PK8A 2W5UA 1ZNZA 4E03A 1G6OA 2BZGA 3A1UA 4Y8VA 4GM1A 4WBSA 1QQTA 3PYXA 3T3EA 2YXBA 2QY6A 5CB4B 1YZFA 3L8MA 1EXVA 1T5LA 2QMQA 1QF9A 1VCNA 3NR2A 5T6MA 4D0LB 1H1DA 1AGXA 3LVFO 3K94A 1KZ6A 2VQ3A 2XWBF 4LSMA 4MICA 3IQDB 3VU0A 3KSDO 1GPUA 2ZAIA 3I09A 1RHJA 1VHJA 1ZJZA 1L8AA 1E2MA 1XCJA 1H66A 1U3FA 2AD1A 2JGRA 2Y1KA 3KOXA 4DUZB 2PZJA 2XXAA 1D7OA 1YT5A 4M6WA 1UKEA 3S2UA 1IVSA 2FPUA 1GV1A 1SU6A 1TJPB 5DN9A 3WE7A 3SQWA 1DKRA 4MIEA 2F90A 2ESRA 3E3MA 1N36B 1QS0A 1SQGA 1Y7IA 2C5LA 4HH3C 1FSSA 3ZBPA 3UOWA 1V3TA 2QI9F 5BV7A 1XKXA 1K1EA 3ETLA 4HMOA 4XB1A 2BGRA 4BLVA 4EQ6A 2BZ1A 4RQAA 2HLHA 1USUA 3Q9NA 4LPSA 4W1PA 2QE6A 4X8LA 4RAQA 2W4QA 2BKLA 3CEMA 4L6AA 4CMHA 4BJHB 5HQ3B 3U5TA 1PFGA 4P82A 5CNMA 1TQ6A 2MSDB 2WYIA 4M53A 4RHTA 2ZTHA 3UT0A 4WXRA 3K09A 1A8PA 1JSZA 1NJGA 4V0NA 4GPIB 1U80A 5AUPB 1V96A 4AZTA 3KV1A 3NHLA 4C4YA 1Y3FE 4ZYWA 5CA0B 2ZAMA 3KYCA 1QKJA 1KBOA 4E5DA 4JC0A 4XGIA 3GPCA 1QUFA 2NT4A 4W9MC 3T9AA 1M34A 1UOEA 2V55B 3HFGA 5JFOA 3ZJTA 4M55A 5H16A 4X1YB 3UKOA 4AQYB 1V8ZA 1EFDN 3VU8A 4JB8A 3ROTA 121PA 1G19A 2PA3A 2QM8A 1KI9A 1P2GA 3UW1A 4X7BA 2RONA 3D6NB 4FR2A 4RD2A 5HK8A 3ADOA 1VDZA 5LDHA 4D3DA 4YS6A 1J0BA 3KQWA 4RTKA 4N65A 4FHCA 2R8YA 4UNQA 2QAGA 2OORC 1SCAA 2XVMA 1Z47A 3PUHA 4YB8A 1DCKA 2YZKA 1PJ3A 4YMLA 3DV9A 4RFSB 3VX4A 4D9GA 1SCNE 4MV1A 2IWHA 4O0LA 1AGPA 1WW2A 1Y9JA 1VPDA 2AMFA 2C5GA 2YJ4A 3HVIA 4AJ2A 2DHDA 1D6NA 1T2VA 4FFVA 1IOLA 5UKDA 2IU0A 3S2SA 3ZXUB 1L9XA 1VJ5A 3IP7A 2H4XA 4ZQFA 1TRKA 4Q1BA 1A27A 1HLDA 3HA2A 3O8LA 3HWX1 4HDOB 1GLVA 2GBCA 3FDZB 4OQDA 4BNJA 2VBIA 3TSYA 1IZ8A 3OZCA 4DDMA 4XI9A 3IUNA 1RVV1 3N7UA 1IHPA 2VF8A 1XALA 2H5IA 5D7NA 2AD5A 1WSBA 1XOIA 2BYTA 2WSLA 1NFFA 3Q5DA 4F9FA 1T8UA 2VHUA 4TOIA 3IA7A 1A82A 4CTMA 3TSAA 4NYMQ 4QJ3A 5IJ9B 1E3TA 3I01A 4RY2A 4XWTA 1DJLA 3UGTA 1DOZA 1SKBA 5A9TA 2XUFA 2VK1A 3C6BA 2WVHA 3SKYA 3PQ3A 2LNDA 3DMFA 5LA6B 5A4KA 4WKNA 4UARA 5G4LA 1AURA 2CXSA 3MWGA 2PKYX 4ZKEA 2CGEA 2QYTA 4HB4A 3KDPA 1AKWA 3A9WA 3FKJA 2J0EA 1MQAA 3WRWA 2NW6A 4UOEA 5JYEA 5L4SA 3T9BA 4CMCA 3HCOA 5LQSA 1PP4A 5B3LA 3VSAA 2OKCA 3WLQA 3BCSA 5CM8B 4MRSA 1FFBA 3O2QB 2BMEA 5AJWA 3VOAA 2GM9A 4J0IA 1Y3CE 2CVQA 4LXTA 4URZR 5J4YA 1OH5A 3EZYA 3F3KA 2XZOA 5EGSA 1XLVA 2SBTA 5IAKA 1E1RA 4W8GA 3ZBQA 1TUGA 2PYIA 2AR9A 4QLOA 2YC4C 1B73A 4JV5B 3NJ4A 2PRSA 3QXGA 3GMIA 4HRYA 4UJ3A 1L7DA 4JXKA 5JS2A 4NCAA 1RQ2A 5T4EA 2OC4A 2X0NA 3A4LA 1HXHA 2XA2A 3SNHA 1ONNA 1G8PA 2KX7A 4D26A 1O87A 4AJKA 1T26A 2X8WA 3H87A 3P2JA 4MGZR 3AERA 2HOQA 3JY6A 4I9UA 2XZPA 5DLPA 1PJ4A 3MTDA 5HKLA 4YX9A 4ZMBA 5I51A 5SZJA 4BVGA 4ZZ0A 4KV7A 3U9LA 1CUIA 1S9DA 3MVEA 4YMSA 4LVOA 3TW8A 2YYZA 4JL8A 4IS3A 3KWJA 3LCMA 3V4SA 4BV9A 3OJ0A 3DV0A 3GZ4A 3ZU2A 2QZ9A 1QP7A 1ZMOA 4JL5A 1NMYA 1OBVA 3C85A 1YL5A 2YNMA 4KFTA 2BD0A 3CUUA 3OPNA 1GT6A 3QM1A 2V65A 1SNYA 4LMAA 4KR0A 4OGLA 4TRJA 1CULC 4HDNB 1CQJA 3ZIAA 3PWSA 2O8BB 1MCZA 4M37A 3UH0A 3KHKA 4A0FA 2W48A 2RHBA 3FAZA 1JRLA 1S96A 4RHUA 5IZCC 5IBPA 2OV4A 4QFBA 2QG4A 1R0BA 3DMYA 4PHFA 3LK7A 1I4LD 4RD6A 1IWOA 1OVGA 2HQBA 2OHHA 3SR0A 3PNPA 1Z4MA 2PCLA 3UFBA 4NWIA 2FR8A 3DE4X 1VXRA 4V0SA 2HA7A 4DQXA 4Z4QA 1UM9B 1MPXA 2QSZA 3IQEA 4PZLA 3GJ0A 4HP8A 4OHUA 4YRGA 2GK3A 3OQMA 3ZS8A 4I5EA 1P1HA 4N82A 3U40A 5KOYA 1A9RA 3OMLA 4MQBA 5FLXA 3BX1A 4EZEA 2QQEA 2R6FA 3L7YA 2UYGA 4H18A 1BKYA 1XPJA 4JJZA 3UJ9A 4ANFA 3DW3X 5A4JA 1SG9A 3PQ4A 1RFGE 5E1OA 3WR5A 3WHLA 2H7CA 2WWRA 3I6ZA 2CLOB 3A6EA 4I46A 4DCTA 1TE2A 4AY6A 1KYVA 2QM0A 1N1EA 4RL4A 2GWHA 3NM4A 1DTSA 1Q19A 4L5JA 3GA7A 5K45A 2Q46A 4Q18A 1ODCA 1UMBB 4ZN6A 3R3VA 4FU0A 4C88A 2FR0A 2IXFA 5H9WA 5FYDA 4L78A 3TCNA 1QCDA 1Q20A 2CDCA 2F1HA 1DKOA 3AJ9A 3L05A 3LZDA 5CA1F 1TM5E 1VE9A 3IPXA 4UPDA 5H80A 3ONVA 2IQIA 1H8HA 1JV2B 1N6PA 5ALNA 2FPPB 1Y1LA 2H31A 5DRYA 3RPEA 1SKYB 1U1GA 2I4OA 2XT0A 2XXJA 4ALLA 2F9LA 2ZE8A 3I9OA 4F4IA 3B9BA 3EIFA 3L6EA 4DR6B 3N70A 5CVTA 3COSA 3ZDZB 5KTKA 2OOKA 3FE2A 4PO1A 4P36A 5E0OA 3KUKA 3L1JA 5KYXB 4RZXA 4F4JA 1CV2A 3QPDA 4R9UC 1Q95A 1JDBC 3L92A 1YZHA 4LQDA 3RROA 4CVNA 1XE3A 1UBEA 1DLJA 3KCQA 4I2NA 2JBWA 4IBOA 1P74A 2ECKA 1TK2A 5BNIA 1PV2A 3FOZA 4EJSB 1S3IA 2ZJ7A 3FDFA 3LMKA 1Z16A 3AUFA 1NJ5A 4Y3UA 2DR2A 1FS6A 1C29B 1XZEA 4R7ZA 2C54A 2IP1A 4J8PA 1ZRNA 2P9GA 3PNMA 2NVUB 1XCGB 5SZKB 2LW7A 5LUAA 2Y8EA 2W2XA 1OIWA 3UATA 3GJRA 1R9MA 4FWBA 3P27A 4N5DA 2FSIA 4DW8A 3HBJA 1JBKA 1XU4A 1V8FA 3RUDA 5TLSA 1SHTX 5EXPA 2G70A 4ENPA 1EX7A 4HDSA 5C1DA 3VAYA 2B82A 2NAFA 4UM7A 4GE0A 1JP7A 4N9WA 3FETA 4MYRA 3FWPA 1GR0A 3T7RA 3JD1A 1S6YA 4BATA 3U48A 1G4AE 3T3IA 3PUKA 1VJGA 4AULA 4B74A 4RMIA 5IK2A 4DYDA 4LXQA 4QRHA 1CCWA 2AJ8A 4IWXA 2WJYA 5JRJA 1RQLA 1Y7HA 4AJ4A 3A4NA 3NRCA 4BNVA 2H59A 1E58A 3ZHTA 4PPYA 4V0QA 2VYVA 2NO0A 4MEAA 5BORA 3SYKA 1NI4A 3CSDA 3NKLA 1QRRA 3G68A 4I8XA 4X61A 2D59A 1UC8A 1QYCA 2POQX 2PPLA 3BL5A 1JI3A 1CX9B 1QNLA 2BEWA 4ES6A 2Y27A 4FD3A 2IYFA 4ARVA 1EUQA 1V43A 2YWRA 4NDNE 1U90A 4RKFA 3BHMA 4D80A 4DC0A 4XRGA 1RPZA 2X23A 4JBWA 2Z57A 2YFYA 4RD0A 4Q48A 3VKVA 1GUDA 1QQ7A 3LL4A 4DRXB 5AW1A 4RMGA 2FGJA 4IDCA 1ODKA 1XD2A 4LGMA 3SLKA 4AO7A 5KREA 4CKEA 1K98A 4KQWA 4TWZA 2QKYA 1Z34A 4IHJB 4JBHA 4IH9A 1N9GB 3EVEA 3EGDB 4XQ0A 3RC3A 4Q02A 2V74B 3S0JA 3WMWA 5AVQA 1X9GA 4EF5A 1RM5A 1EFPB 3QQPA 3ZE7A 3IKTA 3REGA 3CVUA 1OZGA 1XA0A 3TW4A 4C6TB 1DO8A 5HM8A 3DB2A 2P35A 3UN1A 4CLHA 1JKJA 5HZHA 1K88A 1CUFA 1S8AA 2IGTA 1F0YA 3EZGA 3SHWA 5JD4A 2FN4A 2O0JA 3NWPA 4HZIA 4MPRA 3WP1B 4D44A 5JNWA 4OPMA 3E1SA 2OLEA 1WU8A 1YZLA 4ZV9A 5TIIA 3B7PA 3R77A 1QP4A 1W0JD 2BN4A 2IDZA 4LA4A 2MJLA 4WESB 1JG4A 4RK1A 2WM2A 2UZAA 3NXKA 5C37A 1X1SA 4BQSA 2X9VA 4TN1A 3WZLA 4LNAA 4CR8A 3R8CA 2Q1UA 5B5SA 3LSYA 1I8TA 3QE0A 2NVOA 4ZQIA 3UMFA 4EMBA 3QFHA 4ZO8A 5LJLA 3ICWA 1NY5A 2YZGA 2PKEA 3EJ6A 3P9IA 3FPSA 2BTOA 2E4XA 5EINA 4BKOA 2PU7A 1TUIA 2XSZD 3PCRB 4FS3A 2ENWA 4X84A 5AJVB 5DHUA 3ZCRA 4AY3A 1VC2A 2FW8A 4B40A 4OJQA 1SCBA 5BN3A 3U7IA 7YASA 1F8GA 2CV0A 3AIKA 1RAFA 1ZNWA 1Z6QA 1R66A 5EWMB 5CB8A 3DMTA 3R74A 3KQMA 5FO0A 1R4MB 5TGZA 2XXBA 2ZBEA 1T5OA 2WZCA 3CC8A 3N2KB 4DCPA 2GNOA 4J2HA 1MF7A 2UUAB 5ALPA 3B1KA 3SQLA 5GVRA 3KAQA 3A6LA 5LP6B 1KFJB 1UMKA 1Q0SA 3IURA 4PYMA 3JRWA 4XJXA 3PNSA 3RBAA 4D0SA 3MCZA 2GD1O 3BA1A 1NP3A 5HNKA 3UK1A 3PQEA 2OQRA 1YQTA 2PH7A 4LCBA 2H11A 3T7AA 2JFBA 4LZAA 1ITZA 3URMA 4X62B 5C32A 1UK8A 1NLYA 4A1FA 5BMOA 4UTVA 4ZYTA 4FNMA 1QLHA 2JI6A 1Z4LA 2AHRA 1BJKA 2QP9X 4BHTA 5M2QA 1NJSA 4P84A 4D9CA 2ZJAA 2V3CC 3GNTA 5AW6A 3KCNA 1R27A 3DO5A 4FCTA 2J9FB 4GX2A 1PWEA 4DLKA 2XKBA 3B78A 4HUQB 3TVTA 5JVDF 3GJTA 3LBNA 4BO6A 3HYSA 1KIAA 2BMAA 4GYJA 4QTUB 5P21A 4URXR 2RD2A 3BWVA 4B4WA 2XCIA 2IU4A 4HQ6A 1GUBA 1TFRA 1XAIA 2C2ZA 5CEFA 4PZYA 2ETVA 2WV9A 3K1AA 1P4HA 4O08A 3L82B 5TVGA 3AX6A 1MV5A 2JBHA 3R7AA 4BE7B 2OAP1 3K0AB 1B0AA 1DUIA 1KTVA 1SBZA 4L74A 4U5XA 2YHAA 3TPCA 4UVHA 2IVZA 4NJEA 2RCNA 2CCJA 4ZT6A 4MVWA 1D2GA 1A9XB 2VG8A 1JU4A 1AQNA 3HQ4O 5IULC 3AUJB 5B58C 2WSSD 1VMKA 2WM8A 1RYBA 3ABRB 3GFOA 1IXSB 2ZDQA 4IRUB 4L5BA 5LYJA 2BSQA 1N2SA 2OGWA 2BM9A 1FS5A 2E55A 1Y6FA 4TQUS 5DK6A 2FX5A 1V5IA 3G1WA 4FPXA 2JCVA 5IF9A 2O2JA 4D81A 5BR1A 3PLRA 3DAYA 2PIDA 1VIVA 4AUMA 2OPBA 5DNVA 5CITA 5CDHA 3ONNA 1ZU5A 4TKUA 4D5EA 3B1JA 1GV0A 5H82A 3T34A 1G8AA 3THYA 5F3WB 1SG6A 1NA5A 1P8AA 4M1WA 4WCFC 3DTNA 3TG8A 2WVJA 4QM7A 2LIVA 4IV5A 4AXXA 4QL3A 4FFNA 3V48A 1G59A 4OF4A 4FCVA 4GIBA 1HWYA 5FLEX 3LDHA 5FOTA 3EIWA 1B93A 2F3UA 3FLMA 3CVYA 3RYFB 1GU0A 1XZAA 2ZTUA 2JLRA 4V0MA 4Y1FA 4ZRMA 3TQFA 3KE8A 3ZOKA 1C30A 1SCDA 4L51A 1FTGA 3T99A 3TKAA 3R40A 3GQBA 3PLNA 4JQOA 2J6BA 3CT6A 4RTMA 4TZKA 3PFHA 2ABWA 4PR0A 3USES 5H1YA 4MINA 4N03A 1JQLB 2V58A 5J2UB 2OXEA 4GT1A 3ZV6A 1OXVA 4F3KA 5AIBA 3IOYA 2VSQA 1IQUA 4FYKA 3BXZA 4I8IA 5G4KA 3RF6A 4DEXA 2REOA 1G5PA 3KXPA 7AT1A 5JS7A 1T9AA 2DBVO 1ZZGA 1P62B 2ZBUA 1ZGGA 5AXCA 3QPWA 4TZTA 2L42A 3D8BA 1CUDA 1CUXA 2H0QA 3H2YA 3OIGA 1T1RA 3N5KA 3M3HA 1QDUA 5C4GB 2HUPA 3RBZA 1Z13A 4C4XA 3ENVA 3LPNA 4O4IB 3FPEA 3JWEA 2NXEA 1CDEA 3RUHA 2OSBA 4MW2A 3LRXA 4WOPA 3NXSA 5B6JA 4MIKA 3ZZNA 1W0CA 4B6GA 5JJKA 2QQ5A 2BTQB 4D41A 1GTSA 2PKQP 1PL6A 3HFJA 3ZDBA 1I80A 2X76A 3EEQA 4TVOA 4DR7B 4NU6A 4DNQA 2XD9A 3ZXYA 5IRCD 1UBMS 1U7DA 1UP7A 2R6DA 1KE2A 1D6SA 1UKBA 1P0PA 2DFKB 5K0ZA 1EXDA 5BQPA 4OKIA 3GT4A 1X9HA 3UHPA 4PLHA 4AX4A 5IHPA 3FUXA 4G37A 4W5OA 1KJWA 2CJYA 4TVBA 5TF4A 1Z56C 4N54A 5FBZA 3I3OA 3IBGA 4ENQA 4BJ5A 1AUXA 1BMQA 1CLUA 1EVLA 1ZXXA 2O2CA 3K9HA 3P52A 3ENNA 3QMWA 1A5AB 3C1TA 4J91A 4ZO6A 4ZCSA 3TR0A 5AVTA 1PJ8A 3ZCQA 3TEJA 2AN3A 2OXRA 1QRTA 1NZFA 1J00A 1VI6A 2XNDD 2YHBA 4MQUA 3E5RA 4O1HA 4Q4AA 3EPKA 3AVUA 3KP1A 2P9BA 4MIYA 2JVJA 4MVJM 4WY5A 1HE2A 3KB8A 2DG2A 1QG2A 1GNQA 4Q19A 3P7MA 1OYWA 1ENPA 3R0VA 4PU0A 4X90A 5H9VA 4MQEA 2A9FA 2Q1SA 3G85A 4L2IB 4COKA 1R4NB 2WV7A 1K08A 1K8ZB 1NVXQ 3OKPA 5A3VA 2GQ0A 1DMRA 1EAMA 3TQTA 1PVDA 2G36A 3EUEA 1M6VA 5AJUA 4HAOA 4XM2A 2HSEA 2ZSHA 4PHGA 5CVVA 3BN3A 4J0KA 5IDWA 5F5NA 3Q4GA 3OCUA 4Q7JB 2YKGA 2DKNA 3RYCB 4X8OA 4WN3A 1NBEA 2QF7A 5JS8A 1O97C 1WCYA 3A4VA 3DXYA 1B6SA 1E94E 1FC0A 1O96A 4ZYXA 2QLMA 4RM3A 5ESDA 2OB1A 3K8QA 5FA5A 1IXKA 2GMWA 2I6XA 3M6LA 2R2GA 3A1FA 1OUMA 2EBHX 1FP4A 4QLBA 2WPDA 1QK3A 3OBBA 3FVWA 2H4JA 5J40A 1T8WA 1X7YB 1WNFA 1Y8QA 3DHYA 3LY5A 3TLCA 4XIFA 4Y1GA 1HFJA 3WL7A 2GYVA 2I3AA 3AUKA 1K5DA 1NBME 3U44B 1R9JA 2GNPA 2VNSA 1IVNA 5HOQA 4CL2A 1QYWA 1MAUA 3L6RA 4UCFA 3ZR4B 3HEBA 4DIMA 4OHOA 1M6NA 3UYKA 4E94A 2CFRA 2UXCB 4UEOA 1T9GS 1MEJA 3O21A 2XRZA 2ATCA 4BO0A 3NTVA 4Q03A 2HQSA 5TQJA 3WKCA 5KKNB 2G1UA 5TV2A 4N3GA 3I62A 2JJ2A 2O3SA 3SPXA 1R16A 2JLAA 2IU3A 4NULA 1V95A 3NEAA 5INTA 2JRLA 1ZN8A 2IPNA 2P62A 4H9GA 4HYQA 2QAIA 3E82A 5F73A 5HIAA 2JK0A 1QHXA 2XUGA 4JJ6A 4I1YA 4XAQA 1YDHA 4CCSA 1ZU4A 2QRNA 2WJJA 4C4AA 2ZEJA 3L5KA 2RGNA 4BQPA 1PSZA 1DTEA 2WF7A 1VZ3A 2R7NA 3I72A 4QKQA 2ATVA 1KJNA 1OYVA 3SBXA 2OEPA 2FW6A 5LXTB 1I2DA 4ALKA 4LZPA 3NHJA 2HJHA 3QPUA 2I1LA 4OQPA 3ORFA 2Z0MA 3P0FA 4IUYA 2WWYA 1RQGA 1JIIA 2M98A 1V45E 2FEOA 5ALJA 3HWSA 4U6QA 4HT3B 4UVGA 1SIWA 4BGIA 2ZR9A 4HO1X 3VR4D 1OXMA 4BNYA 4IGFA 3ONWA 2ZULA 3PCXA 1IG3A 3I6YA 3OZEA 3U9SA 4M83A 1S7GA 3L02A 1BGXT 4JB3A 3ASUA 1SC9A 3PLAE 4OUDB 2ZIXA 2PMWB 1O6BA 1YBHA 2OBYA 1PTKA 2WTMA 3RT7A 2E21A 4DQUA 1GEGA 3A32A 2P68A 1AJEA 5BY2A 3I9KA 3P94A 2QN2A 4B5LA 1IDN1 5BWNA 2A9RA 3NIDB 5C8ZA 2VQ6A 4JZKA 4B9EA 3OQNA 3GUZA 1Y8RA 2IOQA 3IBYA 5DXAA 4BO8A 2EYQA 2I71A 521PA 1ETUA 2O5EA 3LWBA 3VAZA 1NVVR 1WXGA 3DNMA 1EFVB 1ZZEA 1QVRA 3UWOA 4DZRA 4U7DA 1NN5A 4MR7A 2NV0A 3UJHA 4YCJA 1MTOA 1ZH4A 3SJAA 5ADHA 4DR2B 2O7RA 4PSDA 4RHFA 3B9PA 3O38A 4LKRA 1ZESA 1N92A 5JS1A 4PAMA 4EHNA 4N48A 4G97A 3G8YA 3CE6A 3EEFA 4QQFA 1UT6A 1PS8A 2E9SA 1M74A 2ZJZA 4F84A 1OXBB 2ASVA 1G3RA 2HV8A 1DGQA 1ZLXA 2ZTMA 4FJ0A 2J5QA 5EKSA 3T3OA 3JVDA 1Q7CA 1DKMA 4IY1A 1ZICA 4QQ8A 3RS7A 3WLSA 2WU8A 3HNPA 3QXJA 4TTRA 2E2WA 2DXIA 1FFDA 1G5HA 1OTXA 1F1JA 3CEJA 3N59A 1IMOA 3S44A 5L3QA 2L82A 1E2QA 2Q29A 4KLCA 5LJIA 1W4CA 2Z5LA 1C9KA 3ILSA 5C1OA 1HNZB 1OR8A 2HBQA 5IEJA 3NEPX 4IZOA 1QKIA 1RWOA 3NVDA 3AU8A 2HTEA 1Y1KE 2IZOA 4BIIA 3OLYA 4PSVA 3RIGA 1Y3DE 3PJEA 1R6AA 5JO9A 4C3VA 5ITWA 3OAAD 3VYTB 4DBVO 5DWDA 2XE4A 1N2ZA 3B6IA 1IAQA 2YMQA 2OO7A 3I4LA 4EF6A 4EGSA 2VH5R 3RC7A 4NZNA 5HQJA 1DUSA 3NHUA 1BGWA 2VWGA 2V6MA 2W6JD 3KQLA 1N2BA 1NXSA 4EG4A 1SBNE 3CRW1 821PA 3RODA 3TZ6A 3UMSA 4JN6B 3V00A 3WHIA 5IAOA 2DUWA 2IYVA 2GYYA 2TMKA 1UKZA 3PHCA 1IPEA 1U94A 4N7JA 4NXNB 1QGUB 1NG1A 1DIAA 2DWOA 4IMRA 2G8LA 4N7MA 4RZHA 4R1UA 1RSZA 1GPH1 1L5RA 4OBWA 9LDBA 4QJIA 1RCUA 3PENA 3P2YA 3J81A 3DTVB 5A2GA 5LOVF 1NUTA 5BMVF 3HLKA 2NN3C 2X13A 5ERXA 3VPDA 3LOPA 5FLYA 2CJXA 5D1NA 4ZXPA 1ST3A 2QTLA 2CUKA 4AZ3A 4ARCA 1Z6AA 3U3XA 3N28A 3GH3A 3SC2A 1U2TA 2JVIA 1IPHA 4EPXA 3UY4A 2GN4A 5CFZA 4LX8A 4XLZA 4XQGA 2PS3A 3H2BA 4J9VA 4YREA 4CETA 2FY8A 3Q6MA 3E9YA 4JCOA 1NMZA 4EFMA 3W06A 1VJRA 2NU6A 2CNDA 4GP7A 1QFXA 4O5OA 1ZPDA 1QIMA 2OZLA 3H2HA 3Q2OA 3T94A 3MS2A 4MAMA 4CKBB 4WFQA 5TQ2A 2AEFA 3CZCA 4KDFA 4P83A 2XT9A 3CB4A 3DBIA 2ZITA 1SH7A 2E4ZA 1NBMD 5COBA 5L7WA 3O4VA 3UJCA 2V03A 1YR6A 1Q5PA 1VL5A 3V1NA 2VHYA 5JYBA 3AVXA 3OFKA 1GGJA 4KB5A 4IWYA 3DBRA 3Q12A 4J3FA 3REQB 4TS9A 3IA2A 4DMLA 4Q4HB 1NN0A 1BEEA 4KI7A 2WHEA 4A03A 3Q3VA 4PG5A 4PO8A 1QV7A 3TVDA 3L3BA 3AYZB 1R6VA 3AR4A 5JCJD 2JEOA 3FBGA 2QMZA 4RTRA 2IEGA 3RJZA 3JQFC 4X97A 2H9AA 2GHQA 3WJ2A 4V0RA 1P9WA 3AT1A 4NBSA 1EJ0A 3ES9A 1LDEA 4F06A 1S3FA 4CU2A 2Y1DA 1OAKA 4CMJA 1EYZA 1OXKB 3RVSA 4QTYA 3VNSA 3ZS9A 4BNTA 3TF5A 1W1IA 4BNWA 1PSWA 3QMMA 3UG7A 4F4UA 3NX4A 5BN4B 4BLSA 3DTVD 4P7FA 1DADA 1NYQA 3I8OA 4B48A 1BDBA 3GC6A 3MJRA 2YZMA 2YJ3A 4FYHA 3MAAC 1QHHB 4OBXA 1ZKDA 3R6LA 5ENDA 5BVGA 2C5FA 4JWTA 1V2HE 3PJGA 1ODFA 4PTZA 3ROMA 1RQNA 4JXZA 2HHCA 3KOWA 3L4JA 5LZ9A 1MC5A 3H75A 4JJ7A 2GXUA 3EQ2A 1JKIA 3G8BA 3I1YA 3KG2A 2GF9A 3C24A 3M8KA 4X0EA 3EGCA 4FVTA 1VDMA 2W2LA 3SF0A 2II6A 1XDBA 1ZVKA 4FYVA 2NTEA 2Q4RA 3VH2A 1AXEA 2IHYA 1E2IA 1YQDA 4MULA 4MYTA 3OX3A 4OXXA 4QYMA 3V4VB 4Y98A 3NAMA 5BSTA 1MRNA 3NBKA 1SQ6A 2D7CA 4DA6A 2F43B 3IKVA 4L4RA 1EFUA 5K8TA 3S1SA 1ORIA 3IAM6 1JFTA 3LFUA 2QTRA 5H68A 3W2TA 3FPCA 3F6BX 2HCTA 4AJPA 5H70A 3WK6A 8ABPA 4IXNA 3G6KA 2X1VA 3FG9A 3EF1A 4MP6A 3OF5A 5JMWA 4DDUA 5A1JA 2HSGA 2YZNA 3B3GA 1C9EA 1NUHA 3IEXA 1UAGA 4YJFB 2CFTA 4Q6BA 1WKVA 4OK3A 1VHDA 1YC2A 4OSPA 5GGYA 1IN6A 1OBOA 2F4VB 1NW9B 1UK9A 2WHXA 1EDZA 1YQXA 3M4NA 3FNHA 1I7NA 1GNTA 5CFRA 4HRAA 4OI0A 1DB3A 1CPYA 1RHUA 2QD3A 2VDKB 5ARDA 2XMPA 1D07A 4HGYA 3FTPA 4J3NA 4ZOCA 3THSA 3UENA 1XO1A 1N2GA 4P33A 4X64B 1BWQA 5K01A 1FY2A 5IT9A 1J8VA 1T25A 2HM7A 2PX2A 4MTLA 2PKWA 5HE8A 3WLOA 5A9SA 4AQ7A 4NJOA 1FMCA 4MUFA 4QBGB 2Q6LA 3CKKA 3SOPA 1L8QA 4B09A 4LNUB 1EPUA 1JHZA 1VSVA 3ENKA 3GOQA 2IT1A 3SX0A 2IHBA 1N8NA 3DE5X 3K9FC 4G09A 1EX1A 2ZJ6A 3DFZA 3B12A 4HEA1 4NBLA 4NPCA 2CFIA 2CJWB 3D3NA 1BHSA 3JQ8A 3QJYA 4TQAA 3AFIA 1MO5A 3FOCA 4Q9LA 3PF9A 4DMMA 1H4TA 2RHCA 1Q6ZA 1U8FO 2B25A 2HCRA 3ODGA 1JSXA 5BRNA 2P6OA 2PUJA 4UM5A 2YQ4A 2DQ4A 1GQQA 5REQB 3TLMA 1DDGA 4J6FA 3RU3A 3DBLA 2DCUA 3RTCA 1DRUA 4B44A 2H1SA 1AMOA 3GT0A 1FFGA 4MIOA 3ZVLA 2PJRA 1FVXA 4REQA 3ZY3A 2GPSA 1NX9A 2AE1A 1Z74A 4QGAA 2AF3C 5SY9A 1V9CA 1ZN7A 4GLFA 1H6AA 4YRTA 4INZA 3VR3D 1VPLA 1WCIA 4MUYA 4QXRA 4TS3A 4ZYLA 4KO3S 4P98A 1WPQA 4A0SA 5GJBA 3LY8A 1NBHA 2DBZA 5G1PA 5BUCA 3DDCA 3GJ5A 4PGFA 3WB9A 2J08A 4JZYA 2ZUCA 2QX8A 1I5EA 3NATA 4GW3A 1R50A 3PNOA 4RIHA 2EEPA 2WT8A 5IKOA 4PLFA 1B2LA 1W46A 2BUBA 3TL6A 1M6WA 4HHEA 2XB4A 2YFKA 3DJFA 1K4KA 1LX6A 1Y6QA 3KR0A 3OA2A 3LBYA 1MZVA 2VPTA 1GDDA 3GLFA 3QWAA 4ESHA 1I0ZA 3KWLA 2VCHA 1KJQA 4DABA 5I4BA 1E7MA 2XUIA 4RJ2A 5AOBA 3OU7A 2P0YA 3KJQA 3WK9A 2B35A 1P5FA 2QTFA 3AKCA 3AHJA 4CCYB 5IMSA 3DCNA 3WQQA 1KKUA 3CW9A 2B8EA 4AUKA 1VB3A 1X87A 4JENA 5DGXA 4QE3A 4Y9SA 3PG5A 4AO8A 5E3HA 4YT4A 5I9NA 4WDQA 3HPRA 2WFMA 1E99A 4M0DA 2J0QA 3LOQA 2F3TA 1AZWA 2PYDA 4ZT5A 3I83A 2BFMA 1FVOA 4TSKA 2J85A 3LC7O 4UDXX 3KWMA 4MWGA 3M1YA 4A0QA 4KPFC 5ILQA 3SF8B 1BE8A 1RRMA 1CNFA 5C7LO 2D62A 3QIAA 2EL9A 1GPWB 4WBNB 1GIAA 5IDYA 3WYBA 5KVQA 2IHJA 1NOIA 3NT2A 5IM4A 3MYRA 3O1LA 3VDRA 2AZMA 4GOJA 1M7HA 5C4IA 3R0IA 5TMDA 3EX7C 5DGTA 2DTDA 2GJ8A 1OXSC 3EZLA 3L0DA 1FDTA 1XYYA 2R48A 3IMCA 4QFMA 4RUKA 4AP9A 3QFTA 3GLIE 3MERA 1SUWA 3JARB 5F7JA 4DV6B 2OTCA 4A3SA 3SS9X 1U7ZA 3GJ8A 5IKMA 1XUOA 1C9NA 3SLGA 1OTHA 1ZGCA 2KHZA 3WBKA 1BU8A 2WMNB 2QJOA 1XTSA 2XCQA 1K75A 2FWMX 4L07A 2HB6A 1NXVA 2DR3A 3KYDB 5AKIA 2Y05A 3W6NA 1ZYUA 2WD8A 4H0NA 5E3JA 4J0DA 1OILA 4YJHB 2DZDA 1M6YA 4BNHA 4YAGA 4YMTA 2DE0X 3CH5A 3S1AA 3ABQB 1NT4A 5FP0A 4CV0A 4DIEA 4EUNA 3G8CA 1JDBB 3OEHA 3R9XB 2CB0A 2A88A 3JVVA 2OFFA 2A9OA 1LW7A 3LXRA 4IV8A 1OXTA 4LHWA 2FPLA 4UMVA 1I7QB 3H2JA 2J3IA 4LFBB 4BVEA 4I50A 4ARBA 3HU5A 2X3FA 3TQSA 2G76A 3AVVA 4YT8A 4G84A 1YFZA 1R00A 3EZ6A 4BVHA 1WSAA 5C52B 3IERA 4YRPA 4Q3AA 1V6CA 1LS1A 3EGXB 4NOLA 4UZFA 3TZBA 3SYNA 2A9JA 3UCXA 3UJ6A 4DLYA 4F86A 1DJMA 1QIDA 1U31A 4YJ3A 1CYDA 3G2NA 1H6BA 1WETA 2QORA 3EMBA 3WLKX 1C80A 4QELA 1NMXA 1QMGA 1ZGZA 3BMQB 3TAHA 3FRIA 4WX2B 2O19A 2PGOA 1EBUA 1NVDA 1UDXA 4ERXA 5B4VA 3CVWA 3PFBA 2AQ8A 2ZSAA 2VT3A 1XT6A 3LDFA 4IJKA 3BL8A 4JGBA 4NFHA 4ESVA 5JNUA 5J47A 1QE5A 4RSGA 1NXQA 2H5JA 4ZQBA 4NE2A 1NF9A 1RLMA 3CLVA 3FCUB 3TZQA 4LV6A 1Q0PA 2ZI7A 4B5KA 1LI5A 4H7IA 3HJFA 5L8VA 2ODPA 2M1XA 3M6IA 2JJMA 2ZJ3A 1F2VA 4RKYA 5K9ZA 1GXSB 2CBGA 3EFOB 3L0SA 2JW5A 3PNYA 3Q7IA 4H7DA 5ELMA 3ZXSA 5J4HA 3V2IA 2BEUA 3X1JA 4EVSA 4B80A 3X1YA 2J9RA 2J7PD 2KS6A 4CYMA 3O84A 3TMAA 2ACEA 5EJ2A 3LVRE 2C99A 3DUFA 4X7MA 5F51A 4ZOQI 4PSAA 1Z12A 3W1WA 2UZ4A 3GDHA 2JCXA 1KOLA 1RWVA 2X8JB 4MQMA 5EMNA 4CM1A 2HU7A 1NGSA 2E4VA 2ZPAA 3KHUA 2BKXA 5HUQA 4BUZA 3VKFA 1TM4E 4JVSB 3A3KA 1IZZA 2QX7A 4HNHA 1UR5A 2V45A 3A2LA 3TL2A 3WYGA 1W36C 1QFJA 5M29A 1CSEE 2YQZA 3PC8A 3V4LA 4U8GA 3TE7A 3E8SA 5DKFA 5B6IA 1E6UA 1T13A 4AIRA 2WJGA 2D0OB 1IJEA 1R64A 2Z2XA 1GPLA 2WFAA 3E5MA 2DQYA 4YP7A 1H85A 1FYDA 3AUAA 1WB4A 4QUAA 4MS3A 5ILGA 1ZI8A 3GLIB 3SFVA 3B6KA 1YTUA 4PLGA 4NEHB 2RK4A 1GZ3A 4K2HA 1U9IC 3RSQA 3SVTA 3AI3A 1ADGA 4JSYA 2C42A 3IEIA 4DZTA 2Z5VA 4BWFB 4LTDA 4TTTS 3FUVA 4I4TA 1MA0A 1TNDA 3FPJA 3NIGB 2ZVQX 3S8MA 3ZWXA 1NQTA 2JI7A 1Y6ZA 2RMKA 1TYZA 1ZGJA 4QU0A 5A04A 2O8DB 1AGYA 3L8EA 4ZO9A 2YS6A 1KGDA 3LDGA 3ORHA 5BRAA 1ESDA 2VYCA 1BC5A 4QBTA 3EODA 1RPAA 2VDVE 2V7BA 4K6OA 4CW7A 3GAMA 3IP5A 2K7ZA 3GHYA 2FPWA 2YN4A 2VATA 4LJKA 4D9IA 2R8RA 5JTTA 1G38A 1E59A 1TKRA 2P9ZA 1IHXA 1Z88A 1GNLA 1WOMA 1HOXA 1TL7C 1A5TA 2NUPA 3DMGA 2Z83A 3MJVA 3NWOA 1DE0A 4MQ6A 2ENUA 2HMAA 3OCYA 4QUBA 2OM6A 3BJIC 2JASA 2Z08A 4FJ1A 3TKYA 5TF0A 3UCFA 3D4IA 4FJ2A 3VSDA 4F91B 1DU4A 1QWOA 5K3FB 2EFGA 4ZHSA 4Q1DA 4EGJA 1C8BA 2P9EA 3OQVA 1EFRA 1IUPA 5KO2A 1MC4A 2HRCA 2R8OA 1TCVA 3MRVA 3P8ZA 2FN3A 1ZD5A 2UKDA 2WJWA 4HL6A 4AG3A 1J90A 2OLJA 4IH4A 4XM1A 1JIUA 1NF8A 2JANA 2LE0A 2MOKA 4X1KB 4Y2TA 2G5TA 2OD7A 4CMAA 3T5MA 2BR3A 2VRNA 1IY0A 3CNEA 3L6BA 3R5XA 4S35A 4YC7A 1XWFA 1N78A 3DAGA 4RKEA 4PAQA 4AS3A 4B4VA 4E7OA 2JFPA 1GPMA 1X77A 2DLNA 2QGNA 5AQ1A 4OGKA 4LDAA 1WD7A 2NNLD 2E4AA 4X7PA 3C6YA 1KK2A 2D0PB 4C4OA 2P30A 3U1VA 3PVSA 5LP1A 2R68A 1CEEA 2EKPA 2BFOA 3FUTA 2EXXA 4ZVQA 1RXCA 3WHPA 3LHKA 1D6JA 2DMRA 4ARZB 4ND2A 1PGJA 4D6PA 1DIHA 3VR6H 2FSGA 1E6EA 1IJFA 1JDTA 2MINB 2JLVA 5CG1A 3RU2A 2I0FA 2VUUA 4JGGA 1XHLA 3V1KA 5EHZA 1L7AA 1PI3A 1ST2A 1JJAA 3A0RB 4ZGWA 1L5QA 4BUCA 4HLQB 4KRFA 1DAFA 3HS3A 1OKKA 2J0UB 3RRXA 2WIGA 4P53A 4J0GA 1ISPA 3W3AD 1T5DX 3H5VA 2HHAA 1KEZA 3R09A 3MEQA 2C2OA 1UKVY 1A97A 3E53A 3R7FA 3W5SA 4LQ4A 3M34A 3WYNA 3KKLA 4XR4A 3HL4A 4GLOA 1TJNA 2XCOA 3T95A 1TUBB 1Q0HA 3WMFA 2JGFA 2XW6A 3UZUA 4CEJB 2GAIA 1Z8HA 2JHGA 3OUTA 3RO7A 3PITA 4PINA 3VO1A 5I9IA 3E23A 3OQHA 2O7NA 2H65A 2IOHA 3AF5A 3MTJA 1ACLA 4UE6A 4XSVA 3E3LA 4MHOA 3TGLA 1UPTA 2IYEA 1E9BA 2O4UX 4FX5A 4K6HA 5F77A 3OX4A 1IJKA 2AJBA 3R3SA 4QOFA 2P6PA 3TAUA 4R3WA 2WHPB 5L40A 5AJYA 2O8CB 3AG6A 1ZMTA 5C81A 2QNRA 1Z82A 3L7MA 2GESA 4QUHA 1AK1A 3CZ9A 4MGHA 2HA3A 1CTQA 1RRPA 1JKFA 4J4TA 1F9AA 1VSQA 2B5OA 2Q3EA 1PL7A 3P9ZA 2IYQA 5K0EA 2C9OA 3EA5A 1SUAA 1X94A 3ROXA 3QXXA 4WXPA 1P60A 5T4FA 4DNPA 4QT4A 2VPYA 4YP6A 2NO7A 3MYYA 1UMCA 1E1CB 4IIDA 3WO1A 1HH4A 4M7PA 3KPJA 1OFGA 3UGJA 1RPJA 1G2IA 1C1XA 1VPWA 2BW0A 2QMHA 1XRSB 4OXKA 1NY6A 3DKVA 4R31A 3ZVRA 4UNRA 3KEOA 4QU5A 5SZHB 3SXPA 1R9NA 3DB1A 3RTGA 2O48X 1TT5A 5IUNC 4GI1A 2PSFA 5TPZA 5J58A 3V33A 1EX9A 2EFYA 4O2AA 1LV8A 5AVOA 1XMJA 4OGWA 1MO6A 1EE2A 2IDJA 4GL2A 1WTCA 4XWAA 2P4SA 4IYRA 2PRIA 1HDCA 3WRYA 1O5IA 1MAHA 1KI4A 1T1IA 3D9QX 3G2HA 3JASB 4DSAA 3WYEA 2X6QA 4EGCB 1RRCA 2YJZA 4GNRA 4N5IX 4KQMA 4PGGA 5J4LA 3T7EA 1C7EA 5AP9A 5CJ2A 3CZPA 5HEKA 3RU9A 2B8NA 2Y1FA 4DJAA 1U7WA 3CW2A 4FUTA 3DF9A 4P31A 5IT0A 2H1OA 1HR0B 2OB2A 2W2VA 3KV3O 5DGHA 5CW2A 3PKZA 2GN8A 1IHUA 4N0PA 1PS0A 2OFWA 3C7DB 2OESA 4D56A 1UIRA 3HVKA 4DMGA 1X9IA 1QHIA 1AQLA 3U13A 1LJUA 1E0JA 1ZHHA 3E27A 4MVJA 3NETA 5EVCA 3OHSX 1Z2CA 4KLZA 2ZS8A 3VO8A 2AK3A 2XMBA 3O1IC 4I66A 4Y2UA 4CEIB 2D2FA 4WPGA 1VHTA 2VHTA 3BMCA 5T3YA 3P32A 3MT9A 4LSWA 1T0JB 1G18A 3OQPA 1US8A 1GGFA 3G7SA 2XQFA 1KDZA 5CLHA 4F5YA 4CLRA 2I7DA 1V1RB 1EGVB 1THZA 1JQ3A 3P0HA 1I5RA 4F6RB 1TYAE 1W1WA 1AF4A 3CCBA 1L7NA 2FXVA 4HDRA 3PZRA 1AXGA 4DIKA 4S24A 2EP7A 5CVJA 1NVVQ 1O95A 2PZEA 5EVJA 1PLKA 4OQXA 2CLFB 3Q41A 3QEMA 5F1OA 3UMBA 4D1YA 2QTMA 3WIBA 3C7KA 5C2JB 1Q6YA 3O8QB 3DQZA 3FYUA 5HGJA 1NPDA 1S2NA 4DT1A 1MW8X 1A71A 4M46A 1UXIA 2Z4TA 2IE0A 4ENWA 1Q1ZA 1TM3E 2ZRIA 4KACA 3KZVA 2HY7A 5TMPA 2BBSA 4YJGA 2VPPA 1DBSA 1SD2A 3RC8A 3GV0A 4ZVTA 4L9WA 5JSZB 2BL4A 3DOOA 3O8DA 3B85A 3D8NA 1H5QA 1GG8A 2OGTA 1UKAA 2BI8A 3PKIA 2JNWA 4RSRA 2FPIB 1L5OA 2XADA 4D9NA 4Z7JA 2O57A 5T6BA 1N2JA 6NULA 1MORA 1QVVA 1Q0ZA 1QC5B 2MIIA 1ORDA 1EM8B 2HZBA 2VPZA 5GV7A 1TJ3A 4GD3Q 2X7XA 1S8OA 2FJ0A 3EC7A 1QGYA 1EVQA 1T3SA 3GVIA 4G0PA 1LRLA 3IJ5A 1KXZA 4RIIA 4E3ZA 1EG2A 2PGNA 4GSYA 4IFBA 3CY6A 4NOKA 4PZ0A 4OB7A 4W5RA 1SU8A 3F3SA 4XWOA 3GW8A 3C1OA 4YLGA 1DWOA 5JD6A 4FFMA 1KEEA 4Z53A 1TA4A 2X5KO 3LY7A 4RVHA 1DAOA 2GZDA 3VMMA 4F9GA 1U0NA 1ZEJA 3MW8A 4WN9B 5AXBA 1GA1A 3RKUA 4C0BA 1N0IA 1QLWA 3P9YA 3MCAA 13PKA 5DOVA 3MWEB 4BFLA 1U8AA 3SKVA 1XXLA 3L43A 3ZUPA 1P1FA 1C1DA 3EY9A 4QDUA 4ME6A 1B8PA 3FFAA 4M8KA 3U4GA 1RRVA 4MQFB 3F49S 4E51A 1XN1A 4Z54A 4N5HX 3CNBA 4EMUA 4HB3A 2GGSA 2AFHE 2H18A 3T3PB 3QVKA 4F3CA 4JS0A 3M6WA 3HRKA 4HQRA 1XBTA 4J7XA 4QPDA 1TU3A 4WIAA 3CXUA 4QBFA 2Q3FA 2A59A 3AFGA 3B7GA 2P2LA 1Z0ZA 2WZQA 3BH0A 2D5IA 3OFVA 2RHJA 1J1IA 2GLUA 2GSDA 2C7VA 2ZXEA 2G8NA 3GFTA 4L5CA 3V3KA 3ORSA 1MQ9A 3N0TA 5JZVA 1GFIA 3X1WA 1M1YA 3H9QA 3WO0A 1NXXA 3AVYA 1Y33E 2R751 3CN9A 3GEGA 5TVKA 2ONJA 5C18A 4R1QA 2GKGA 2OZPA 4URFA 4UTOA 2ZRQA 1RHMA 2GD6A 2G28A 5FNVA 3HB0A 3THRA 2VLIA 1KY3A 4ZU6X 4LDQA 4R6WA 2XVYA 2BM1A 4ZU3A 4F56A 5EQDA 1JI0A 1RTTA 2D4AA 1M2VB 3OC0A 4HLUC 1VCHA 2NXNA 1XZPA 4IJWA 2W7TA 3SSAA 5IMBA 4RIEA 4DKXA 3NRJA 2JHAA 1WMSA 2A8YA 2RH8A 1BD3A 3THOA 1G8HA 3TM5A 3BULA 1V1MB 4UBJA 1N0HA 3WSWA 3F6PA 3B6JA 1YKSA 1OVMA 4PZDA 4Y1RA 1E5TA 1FDOA 4JB0A 1T9BA 4A5SA 1A04A 4XX0A 2FDXA 3PJFA 5DBIA 4IFTA 9GPBA 2OG2A 3BKWA 2CFOA 4PRLA 3U3OA 2I80A 1BWSA 3FDIA 1MRZA 2RI0A 3HV0A 3EB9A 3K31A 2VJAA 1W96A 4E07A 2BEVB 3IMEA 2AFIA 3KT0A 4UMFA 4E5KA 1IWBB 5K6RA 3GLGE 3NZEA 3UK2A 2WJAA 2Y4OA 2AB0A 2EWMA 4B6OA 4HAUA 4JBLA 4XD2A 2CVOA 1WQ4A 1DV2A 4WZBA 1MN6A 3QELA 1UPXA 5KTNA 3O8BA 1PWYE 1VIDA 5IVIA 5TJHA 3S28A 1MB9A 3QOYA 5ILOA 3OPQA 5KU7A 1Z75A 3PX7A 4PBSA 4AMUA 1KTIA 1GJRA 5EJGA 3R7DA 2FCRA 3A6JA 3WAKA 1G63A 1AGNA 1X1TA 3CRRA 1RQPA 1YD7A 1Y6RA 1F2TB 2P9QA 4PLYA 3MS7A 4K1XA 4DLPA 5K0SA 1ZA2A 4CEHA 2YHIA 4FGLA 3X1XA 4CM7A 1X8XA 1YC5A 4D4JA 3WKEA 5IHXA 1R37A 1H42A 1FFAA 1DKQA 1X42A 1BCSB 3VNQA 4UAVA 3OIYA 3H16A 3L40A 1YHNA 3V8VA 1SBCA 3QX8A 2GCNA 1WXDA 1R2QA 1BROA 1MLDA 4XUDA 5LYJF 8MHTA 1IEXA 3OTOB 3O92A 3W5VA 2ZRHA 1V16B 3GGDA 4WH0A 4BU0A 5CCXA 3NLLA 3HCRA 2OFXA 2NLOA 1U0LA 3NHBA 3ICQB 1CUBA 2JFUA 5HZMA 4Z4IA 4JLNA 2AFHB 1C14A 4C14A 1YOVA 4H7EA 2P9YA 4ZAZA 1ETHA 3L6DA 5B12A 4HAIA 1GL7A 5AKJA 3RWBA 3S55A 5HK9A 3E9MA 2QTTA 3G0GA 3MBKA 3H97A 3PIRA 2H0AA 4N01A 4UTXA 4CI0B 3CVXA 4WKGA 1OFVA 3RRZA 1K63A 4ESOA 2X9QA 5BN5B 4HMPA 3O2NA 4O6VA 4W5NA 1WZNA 1RFLA 4OBEA 3RVLA 4Q7QA 2HXSA 2H29A 4YO8A 2W4IA 1UBJS 1U81A 2SHKA 3A3OA 4N5NA 2JAOA 2EEZA 1J9ZA 3VU9B 4D57A 1XTPA 5EE9A 1FFCA 2O59A 3PFNA 2WJ3A 4G9EA 3IDFA 4IIYA 5HJ7A 3AHIA 1W8IA 1YR7A 5LZ8A 4EA7A 1XZLA 2IH5A 2ZWMA 4N49A 1ZOPA 8OHMA 1KYTA 2J4DA 5EWJA 1CR2A 2BDTA 2MSCB 3O90A 2Y93A 3GEMA 5A2QA 3A6ZA 3R4CA 4ZAVA 1XTVA 1PKXA 3OPYI 1J24A 2BGMA 4YMUA 3TXYA 5IN5A 3G0CA 5TS2A 2RHOA 5U1PA 1ZFNA 4B7XA 5AYVA 1K5HA 1YZGA 5PNTA 5FUQA 4QQKA 1E6MA 4AAYA 1STOA 3SCZA 5FRDA 1EDDA 1QUEA 4DBLC 3EULA 3HO6A 1I3OA 1WU7A 1QM5A 5DM0A 2PRKA 4EIWA 1DBRA 1SXJD 2ANBA 2MSLA 2NZWA 4W82A 3UV7A 3C6ZA 4YRKA 5MDHA 3PXDA 4ETNA 3DP9A 1BQ4A 1USIA 4Z1MA 4QHYA 3BM5A 1N32B 3CRNA 3UT5A 3V4FA 3CISA 4NMMA 3SZUA 2MMGA 1HRKA 3DKIA 1ZIDA 4HWRA 4OHYA 1JU3A 1X7ZB 3ABZA 4REOA 2NM0A 2W2QA 3TTXA 4X8MA 1FU7A 2ISQA 3FW1A 4RV4A 4S2UA 3GLGB 2BR4A 1QZTA 1T2FA 1T43A 1E89A 2WFLB 1E1KA 4EB6A 3IHKA 3D4PA 4XYMA 4Q9AA 5CR9A 3NHYA 4I55B 4QNMA 4U2GA 4HZGA 3IAAA 2DQSA 2HREA 5DYTA 4IHAA 2R6HA 1E6KA 4ADSG 7GPBA 1KZ1A 1JA1A 1IM5A 4DXDA 1QRDA 1ZCBA 1F17A 2E5WA 3BFJA 4FN4A 4GVPA 3MZ0A 3GF4A 3RW9A 1EAYA 1X70A 3EQZA 4B3BA 5AD1A 2GRJA 4MLZA 5JPIA 4ZVPA 1AVTA 1WXQA 3FPFA 1YMUA 2PAFA 3I04A 1DEHA 2XKJE 2VUTA 3DNPA 3PNVA 1Z6PA 3DHVA 4B7CA 2W98A 2K4MA 2KLHA 4CRWB 1UT8A 1E63A 1JDVA 1E8DA 1WHTA 2NV2B 3IALA 1V9SA 2XWSA 5MGBA 2JEYA 3ETCA 4ITUA 4ZWNA 4B82A 1K3UB 4MV7A 1JIXA 4DWVA 1LSSA 5IJ0B 4JU9A 1WKBA 2H0RA 1RS0A 3F7TA 2O1SA 2PBLA 2GJSA 3H13A 1FDUA 2R86A 2DUUA 3A6GA 4GBMA 4FZRA 4IJUA 1KJIA 2H85A 1F3OA 1PTJA 2O05A 2PUWA 2W6OA 3KT8A 5IASA 3HU1A 1Z63A 1A4UA 1MAWA 1KYZA 2BAGA 2ZRKA 2HIMA 2WT9A 1OLSB 3FMGA 3PQ7A 3VOSA 3D7NA 1BFUA 2HPZA 3ESAA 4G5OA 4BX2A 4ZEVA 1SCJA 1RYNA 4EA8A 2EWVA 2BFEB 3RQSA 2PZFA 4KZKA 1W19A 3AB3A 1R8JA 4HWOA 5B7NA 3LUFA 4KC0A 2RGBA 3FHLA 5A62A 4Z3OA 3CGWA 1EXNA 4OHKA 2C3PA 4X45A 4Q9JA 5DTQA 5DSXA 1DARA 5A03A 3S8EA 4ILEA 3GMSA 3I1JA 1MH9A 4JIMA 4UNSA 3TLJA 4CIXA 3GRAA 3G1TA 2ONCA 4X3CA 2QRGA 5EHQA 2DPXA 1MOPA 3GHHA 2QRMA 2BMVA 1SD5A 1RKUA 4UBLA 3DZIA 2ZG6A 4FBLA 4JODA 2F17A 4QX6A 1SC6A 2Z5GA 3IVXA 4TWAA 1Z07A 5FWAA 3TBHA 1CUYA 4NE7A 5E1MA 2I91A 1NXPA 3JWPA 3H9UA 1YDFA 3L6OO 3O6VA 3HA3A 3CIFA 3O83A 3QGMA 4AN1A 3C3BA 1LJLA 4F8EA 5B2EA 1TXGA 3OBIA 4UM9D 4CM9A 1TLTA 2A9KA 1S2DA 3UTDA 4EUSA 2P3QA 5G02A 1ZD8A 2G1PA 1IB0A 2HL6A 4AYXA 2GF2A 3NJRA 1XU9A 3OF2A 4IGEA 5FT9A 4BMDA 3FFBA 5J59A 1H22A 1Z2OX 1FNNA 4YGXB 3A11A 4PNEA 1QH8A 4D8XA 3LIPA 1KYIA 2CL0X 2PZMA 3B48A 2K87A 5M3BA 3N8HA 3STXA 2ZRPA 4EAQA 2G9NA 4G0YA 3CB2A 5AUQA 1QNFA 3RE1A 2C9ZA 1FF9A 1RBMA 1VFPA 2QRHA 3D2LA 1P29A 3D7LA 4N40A 5CHEA 1YTLA 4Q6WA 3TZHA 3EVAA 4KQJA 5BV8A 1X8LA 1KHHA 2GN1A 1JF8A 3PX3A 4L4YA 2IUYA 2C9BA 3D6UA 4L02A 1V7ZA 2FUKA 3UEOA 2ZSUA 1CUJA 3OE5A 4AFNA 4G81A 3N7AA 3TCKA 4X24A 1RE1A 1RI5A 3IR6A 3COPA 4LEIA 4EENA 3JD3A 3U7RA 1V3VA 2JFXA 3ZDAA 2IV3A 3INTA 3L18A 5E0KB 2DHEA 1HRDA 1E61A 2CZCA 2DWUA 1N5DA 4H0FA 2NU9A 2WLSA 5GVSA 3WRXC 4XH9B 1ZGBA 2OECA 4HVLA 3WGHA 4WRRA 2PFGA 4ASUA 5FUMA 3EA0A 1K68A 1XHEA 3B5JA 4G5FA 3FVRA 3IPRA 3RJ5A 1PT6A 2O23A 2EIHA 4WOBA 3HY4A 1VM6A 3AF0A 4C0AC 4M0MA 4JLWA 4R7TA 4TMWA 1NNLA 5ICSA 2DCMA 2D1RA 2E6KA 2QR3A 1Q2UA 2QPAA 2Y0BA 3EPPA 2J32A 4PQEA 5KNLA 4CMEA 4DRZA 1QU2A 4FMCF 2JH3A 3T4PA 1VG8A 1RCTE 1Z0AA 4IIGA 4UE2A 1PG2A 2A58A 2YWGA 1DEAA 2PUCA 4V1CI 3PT5A 3NALA 1UWLA 2AG6A 2GAJA 3GEIA 3NDIA 4ENVA 1SWVA 4F92B 4HC4A 2QD4A 4F97A 4XRRA 5AI9A 2IDMA 4Q9NA 2JBAA 4ID3A 2WDPA 3AEUA 4J7AA 1XZCA 5EYPB 2XVXA 3UXYA 1FDIA 4JQSA 2XE7A 1X0VA 4FKBA 1NW8A 2OUIA 2QE7A 4FHDA 3RRBA 2D6FA 1IZYA 2FZKA 1RYMA 3U17A 3EXFB 1V4NA 2PKQO 5DVZA 1AHPA 4E5UA 3K1YA 4I9HA 5FL7D 3JZAA 3NB0A 1HF3A 2ZYDA 4RM2A 5AVYA 2X9LA 4W8HA 3TINA 1NONA 5HE9A 5KTPA 2RCYA 4V38A 2DBQA 2GCOB 3IP1A 3ZLTA 1PJLA 4TWIA 2FN7A 4QO7A 4YAKA 3KSBC 4K88A 2HRBA 3JATB 2NU7A 3QKWA 4NH4A 1FW8A 3H17A 3TW0A 1XZKA 3NORA 4PGHA 1T0BA 4ACBA 4FOOA 1FBNA 5AMXA 5L4LA 1OHHD 2QDXA 4CLEA 1SK9A 2FRVA 2Q5JA 3AKDA 3L8CA 1E2JA 1ZS9A 2X4LA 1XP8A 4GM0A 3HKDB 4WMLA 1MR3F 1S2IA 1YH3A 2A1UA 1GZHB 2G9RA 2HSJA 2LTAA 1EKXA 3L6UA 3LW7A 4FWIB 3F9IA 4Y6GB 1KZ4A 5BSUA 3O2JA 3RS3A 5KYYA 4ENRA 1VLHA 4FINA 4LGVA 2FPGA 2QRVB 2QYSA 1AZSC 2HSWA 2ZIFA 3AEQB 1V48A 2QP3A 3CLTC 4PSUA 3EUFA 4YP9A 4YPFA 3HI6A 2PUAA 3FHTA 1A50B 1G41A 3IUQA 1SIBE 2R00C 3JQ6A 4IXTA 4I3GA 2EIXA 3NFRA 1EUYA 4GX0A 1S89A 1A8QA 3RC2A 5CXUA 4TL7A 3TZEA 1SCUB 2AFVA 4MS1A 2JAUA 2Q7DA 1JXMA 1XKLA 2IYPA 2ID9A 3T38A 3HXLA 4KYIB 1AKYA 5DT9A 3HVRA 1YBFA 3IUYA 3AL2A 1UT5A 2HK6A 3L84A 4N3NA 1B1CA 2I2AA 1Q17A 2QPOA 3LQQA 1Z7WA 4M76B 5T8KC 2A33A 3CR8A 5JAHA 2HC9A 1N4AA 3C7CB 1B15A 4F96A 2KE5A 5K6AC 3AXTA 1TYBE 3KSRA 4UVEA 5AT1A 3TNDA 2BZ0A 2X9NA 4J0HA 4WSOA 2PM8A 5GZ6A 4OI1A 1E7QA 3N0WA 3TG2A 3S1LA 2N46A 3JQBA 4KO1S 5CRIA 9ABPA 2JGJA 4FXPA 3DV2A 3RHFA 3MJ4A 4Y2HA 1GKLA 1U8YA 4DUPA 3R44A 2FN8A 1ID1A 4FOTA 1N6HA 3B1FA 4JI5B 4X1KA 5CIQA 1I10A 2G77B 2NPIA 1SQSA 1VECA 1VHQA 2QLLA 3QEKA 5FI1B 3QTTA 4O4LA 5I7HA 3WL8A 2X5NA 5CGQB 3Q98A 1KAEA 1F8FA 1E96A 3D7RA 4IIUA 4OKNA 4OQFA 5ITSA 4IKOA 1BAPA 4EJMA 4B3RB 1ZSYA 4U6SA 1XVAA 5T3UA 3ZHUA 3RVDA 1VG1A 1A7UA 3VBCA 1P5RA 4D98A 5CB4A 2PS1A 3PHBE 4WZAA 3H42B 4G5QA 5CFNA 4C03A 1UKCA 2OBMA 2I33A 3AOEC 3IKMB 1Z5ZA 1Y8CA 4G3XA 4HNAB 3ROFA 4EYQA 1ZR4A 4V3CA 2ZSIA 3COYA 4GZLA 3VPBA 3SOZA 2FE4A 3SK0A 4WKCA 4WK0B 3WSTA 1GSHA 4BNFA 4CLOB 2A3RA 3H5RA 3ROPA 1W36B 1TZ2A 3QPAA 4K9NA 1L1QA 2OV1A 4IJ6A 3LD9A 1QOZA 4LZZA 4Q1AA 5G3ZA 4NECA 3DVQX 4P08A 1KORA 1AKUA 2Y1OA 3MHPA 1XCMA 4ZIRB 2RHWA 2ZRGA 2IUFA 5EJIA 1DXOA 1FJXA 3IEVA 3CZQA 3V7WA 2Q6KA 3RFUA 1MG5A 3FTNA 2DC1A 4KMSA 2YCBA 1T6NA 1Z5UA 1N8KA 4OI4A 4IIEA 2WICA 4EEKA 2SCUA 4RS4A 3ICVA 4IIFA 1LLFA 2AW5A 3W8NA 3SEZA 1J5XA 1WMEA 1WQ1R 2IITA 2IUUA 4PG4A 3ZY6A 1VBNA 1GVHA 4DRYA 2G1KA 1IUNA 3R3HA 3K72B 5EMMA 3FRHA 2X0KA 3W79A 4FNOA 1K7XB 2ZIGA 2G80A 4TQ9A 4ZOEA 5GQSA 4PAWA 3JQAD 1E4VA 5CA0A 1KY2A 4H7JA 5H02A 2I9KA 4NG5A 1CETA 3MMPA 5ETJA 5BYJA 3RAPR 2H2IA 4AMBA 1NDQA 3CHYA 3K4HA 5B6PA 3PHHA 4X1YA 3HYCA 5AJXA 3SY8A 4DNOA 3CSSA 2NPFA 3RQIA 3LX5A 4LI3X 2H6EA 4A73A 1CUHA 4BPBA 2OVFA 2CXPA 1LQTA 1WCWA 2YCLA 3GRFA 3K9CA 4ZC8A 1GM5A 3Q1KA 5JFTA 4DR1B 4KR2A 2VDRB 1I32A 1NBIA 5ALIA 1XRRA 1FTYA 1E3QA 2ZWIA 1JBQA 2MSEB 3LX4A 1N7HA 4I4IA 4LJAA 2PG3A 5AKZA 3EVTA 3MINB 2OYRA 1CZRA 3W34A 4D92A 1HE4A 2E4YA 3EJWA 2Z3ZA 3SE0A 2FEMA 3GVPA 1Z28A 3MF4A 3Q0EA 721PA 1KSJA 3K92A 3OG9A 3ESRA 3LWZA 4I36A 4KBFA 4TV9A 3LXMA 5HS6A 3TX2A 1IUOA 3VNAA 4C0KA 3R7LA 3BFKA 2PMBA 3R23A 1M0EA 4KGVA 3CU5A 3C3MA 3OVMA 4GZ6A 5ITZB 3BPSA 4C08A 1ZCZA 2G63A 1ID8A 5LLTA 1EDBA 1K4YA 1ZIOA 1MTZA 4J3JA 2LZ0A 3V6MA 4J49A 3VZPA 5KX5A 1A8SA 1QLJA 1JSCA 2DUMA 1L7EA 1MC8A 3I61A 1EVKA 4FZVA 5WRFA 3HDYA 2J9GA 3HKCB 3KDAA 4PBTA 3RG8A 3WQBA 2P65A 2PV7A 4DIFA 4LBWA 2C5EA 1UJ6A 2FFAA 2YFQA 3I9JA 3VTZA 4EG3A 3PHJA 1K8YB 5EJ7A 4LXYA 1EGQA 3DM5A 3KOZA 1Z4QA 4ENUA 1VE6A 3K2EA 1L5KA 4L28A 1BQEA 1L5VA 4L8GA 5F7XA 4HWPA 4FZ3A 3AVOA 1U3UA 4D0RA 2F1KA 4OQLA 4JLDA 1DQSA 2C29D 1Y9AA 5KYVA 1KEUA 3MFQA 4YFYA 3S8YA 4C07A 4C0QC 1Q77A 3T3NA 3I6IA 2IYNA 4KSYA 1JEDA 1Z0UA 1I1QB 3G9TA 3Q15C 1A8UA 1RQ7A 1U5AA 3H2SA 1YA6A 1F2DA 4JUDX 3GRKA 1T2AA 1XB2A 3WGTA 3W2EA 3EYAA 1KPGA 4C0LA 1DZ3A 1JHPA 2IDKA 3NKVA 5JECA 1L0BA 3DZCA 3NNDA 4FFLA 2IHVA 5EP3A 3W6OA 5CLIA 3RSSA 4AICA 4KWIA 2GEDA 2UXBB 1BYUA 4WLUA 1E77A 2RH5A 4KN8A 4K9KA 2B2CA 3DEHA 1QZZA 3K7EA 5BSMA 2IY9A 4RV5A 1K7FB 1ZAKA 1OZ0A 1RC0A 1XX6A 3OPVA 5CK4A 4EPRA 3MTBA 3QVTA 2NP7A 4YECA 1ZOSA 2ZTVA 2QZJA 2G67A 4KFSA 3MUOA 1Q44A 5IABA 1U2QA 3A9CA 2Q99A 5I8PA 1CHNA 4NOJA 3SFTA 3BJZA 3HXTA 4IEFB 3MMZA 1JVBA 2YHUA 4DMFA 3I8SA 4BLOA 3FCXA 3C3EA 4IHKA 1P6XA 3MQFA 5GOTA 1SIUA 2GUGA 1H1LA 2D2EA 2CLEB 3ZHZA 4BNXA 4V1CB 4BUJA 4LYFA 2QVYX 2VUHB 3MJDA 5HBGA 5JW6A 1FP6A 1ICIA 1O1YA 3D2AA 5F52A 4RFVA 2A67A 2FMFA 1IULA 5IM4F 3BT7A 2WG1A 4ZTZB 1VBKA 4HMQA 3E4DA 4RLFA 1UK7A 4ROTA 3ZQJA 3BKXA 3ELDA 3L7BA 4DLVA 1RXEA 2P9CA 3CURA 3N86A 5AI4A 2CYAA 2ACVA 5KQRA 4XVQA 4QYWA 1D04A 3V8BA 3SS7X 1GRVA 5LPNA 1SOUA 2F9FA 3CEAA 5IDQA 1SK8A 3U37A 2G72A 3ENQA 3CN7A 4RA9A 4ERNA 2H08A 3EOAI 4JBGA 2H1RA 1G6HA 3MBOA 1ZQ1A 1MW9X 4C7KA 2PJZA 3OIUA 3NC4A 2E3JA 4HYTA 4D8TA 1DEKA 2OD9A 3GRRA 2GRAA 1TO6A 7ABPA 1N77A 4KFUA 2IYUA 1GADO 3SR4A 1UH5A 1W6UA 3H2GA 5HGXA 4C06A 4L0CA 1OH8A 1ZH8A 1CF4A 2PRZA 3EH1A 1FMTA 2HMSA 4LW8A 1SBQA 5CLJA 2D1TA 4DS3A 4CQLA 1AO0A 2I29A 4N6OA 2HDHA 1M0WA 2JZNA 2OHXA 2PMFA 1TW3A 2V3WA 2IODA 2YASA 3GMTA 1K9VF 3LL7A 4I50F 4IXMA 2PT7A 4KMRA 4RV9A 5DWVA 1UMBA 1AT1A 3BA6A 4BN5A 4OIMA 5KC8A 1W8DA 1KDVA 2C8VA 1KJ8A 2ZIZA 3TBFA 3GGSA 4YCSA 2PZAA 2W70A 2E5LB 2BMJA 4B3MB 3PTZA 2NXCA 3DE2X 4H4DA 4YJ3F 1JKXA 1ML4A 3M2PA 4E5MA 3E1GA 4NJMB 2QN1A 3PA6A 1QFYA 2EZ9A 2VK2A 3QPVA 2O0HA 4E2FA 3GCGA 1U0SY 3IPCA 4IYJA 4JMLA 3U4DA 1IQRA 2PSEA 3RJTA 3BICA 5FOQA 2YY7A 3U19A 4IQFA 4EABA 4XEUA 4RK5A 3VU1A 1K6IA 3FGOA 4JJAA 4RH3A 3I42A 3MXOA 4X3PA 3MBIA 1HE1C 2O3QA 1AZTA 1NC1A 3LUJA 4BFYA 5AVXA 5AVWA 1PDWA 3IRVA 3KFLA 2UYHA 1E1NA 3EZ9A 5K0BA 2XAAA 3D2BA 3PQ6A 4EJSA 2JDID 3THXA 2SECE 2HF9A 2ZROA 4ZT4A 5A6VA 3TH5A 4E31A 3AY6A 4BKUA 3P97A 4AO6A 2O54A 3PICA 5JAMA 1MEOA 1T29A 3HABA 4YRBA 4UQLA 2SICE 4PYJA 2QTZA 3E22B 4OMDA 3TSCA 2YJTD 5JJBA 3SC4A 4GLLA 4NY1A 4EB8A 2XYPA 1VYTA 5IBRA 2ZCJA 2NSJA 3NASA 5EZQA 2K2WA 3ASZA 4H6XA 3FMVA 5E9QA 1W0JA 3L41A 3LYUA 3WWDA 4B2YA 1DDIA 4JKYA 5AFSA 4DQVA 4NU0A 1G2OA 1L5HB 1SVNA 3TQOA 3P9XA 5EHIA 5FFMA 5JD3A 3NUQA 2EC5A 3W9SA 2Q3DA 1MA3A 1NAIA 3B1XA 5SYMA 3OD1A 4QOGA 1VL2A 2H17A 4U2KA 3L7CA 2C8LA 2I6QA 2R5FA 1YRHA 1LB1B 3I9V1 4ZVMA 4CG3A 1IN8A 2GWRA 4TSRA 1FP2A 1PR4A 1T9CA 4OXNA 4BFCA 1MKYA 2OO3A 5GP1A 2JFGA 4WVFA 1J8FA 2NTYC 1E2LA 2ZOSA 4IPTA 3TTVA 4B9AA 1TQ4A 2XSZA 2FB9A 4X54A 1SVKA 2EFCB 3ZKWB 4AROA 4AUNA 2QAGC 1ZL0A 1MRSA 2QZ4A 3GDFA 4BZZA 4I4TF 4CM5A 1OTYA 1EWVA 5C51B 2VDNB 4ATNA 3MELA 4I8DA 1PFUA 3WVNA 3NGLA 3R6GA 1XZGA 3VI4B 1E0SA 1VZ2A 1E9AA 2ZB7A 2VEOA 2ZUEA 1HFKA 1QFSA 2AMVA 3DBOB 4PCLA 3I5MA 4FTWA 4LRXA 3K8ZA 1K27A 2JPDA 1J8YF 1EP3B 3TVYA 2O2DA 1BW9B 1JEYA 3DPIA 3OT1B 3DZJA 2VJMB 1UQTA 5AHRA 2E89A 1LDGA 3NTRA 4FGKA 3VR5D 1ZBDA 4AZ0B 3O95A 2AXQA 3H7IA 4TKLA 1XMIA 5DHQA 2O8EB 3WGYA 1CZHA 2Q8PA 2QUJA 4MCAA 4MMYB 1DIBA 5AIAA 5KYTA 5CPFA 1GDHA 2AUMA 1LPOA 3KQNA 4XYLA 3L9XA 1GGNA 1UPFA 1GHTA 2A94A 4I6JA 4KNVA 4OHPA 4C6TA 2Z56A 4Y2XA 4M4SA 1PWHA 2L69A 3BMOA 1PU2A 3M5CA 1RKBA 3OJOA 3GAZA 3AESB 3HCBA 3RJMA 3MD0A 2WAXA 4PXAA 3WG9A 5JCOA 1BXRB 1PDOA 4NCNA 2NV6A 3DFFA 3OTIA 2VL7A 3EPHA 1P6UA 5K8UA 4BOYA 3L4EA 4DDWA 1Q14A 3PGA1 5IF3A 3GP5A 2WRZA 1I2BA 2PX5A 2Z04A 1YU6A 2GBFA 3V8QA 5BSWA 2O8FB 1Y3AA 4EBBA 3HE3A 3RUCA 2HYDA 1G20E 4UHEA 3TTUA 1E4OA 3LRPA 2ZSKA 4YAIA 4ZAFA 1XRPA 4MWCA 4LOIA 4UXHA 4W5WA 3EW9A 4LYEA 2BGJA 1RP1A 1T36A 1W88A 3GB9A 4RGQA 3BRWD 1IBLB 1CT9A 2CVZA 2G17A 3R5KA 2JI8A 3F6RA 1T2UA 2R9VA 4Q3CA 3F73A 4LF7B 4Y6LA 2FZ5A 5K4HA 1LVUA 1N6IA 1NIJA 4YYZA 4MRMB 2XUHA 2PDAA 2WSSA 1QJCA 3HWRA 3OO0A 1B16A 2O06A 1RC1A 2IEYA 5JVDB 4FSHA 3SSMA 2M6SA 3S70A 2VJPA 5HJEA 4DWOA 1LD3A 1N8SA 3N2KA 4YUZA 1YXMA 1P0FA 2EDCA 3IPYA 1B23P 3MT0A 3WX0A 1BXGA 2HDOA 1C7IA 4JI0B 4ZQHA 4IVPA 7MHTA 3PRJA 4U7TB 5IBQA 1ISFA 2UZ3A 3WNQA 1EWYA 3OU6A 5DBOA 1QCYA 3AHDA 3PEFA 4G4JA 5FUXA 5KINB 4L57A 5CDFE 2G9ZA 1U11A 3LGAA 3QHQA 5FUBA 2C83A 5LD2C 3FTEA 2QLTA 2VTEA 1BDIA 2ZGVA 2Z6AA 1IJBA 3D43A 1W52X 3LUAA 1MIOA 1E1MA 5JH7A 4J0FA 2YX1A 4HUQA 2AJLI 1V35A 2JCBA 2YJ5A 3OFND 4HAWA 3KQVA 1HOTA 4XD7D 2H4YA 3AOGA 5JSUA 1RIFA 3NHMA 4KOAA 1E6WA 1P9LA 3BRQA 3ANMA 1DV1A 3FR7A 1I2CA 3HV2A 2EKLA 1OFUX 3AP2A 3L7NA 2GBGA 3LDAA 4NYIR 4XXHA 5AH0A 5K7SA 1KRXA 1LPMA 2IS1A 3OCJA 2XZLA 4ZVNA 3T5CA 4XCXA 3K71B 2JJ8A 3U3MA 4J94A 3UMMA 2ZAGA 4Z4GA 3OCZA 3FUWA 3NBMA 5JJLA 1BE0A 3K0AA 4IGIA 3LPCA 2QUBA 2XYHA 3IBFA 1ATZA 1MX3A 3M3PA 3TWOA 4K0KB 4D99A 4Q3EA 4Y30A 2WA2A 1FNSA 3KJHA 4ZP1A 3A1CA 4OA8A 4FEAA 3EEIA 2ET6A 3KKKA 3WB0A 4DDTA 4PO9A 2EJBA 2V1XA 3CJRA 2QHXA 4O2AF 1LVHA 1P8JA 2A9QA 4BMYA 2KW5A 3AUTA 3ETEA 2C4HA 4QSMA 1B76A 1FRQA 2ERYA 4Q3BA 4B71A 1DCFA 3NW9A 2B8WA 4H3VA 1KFBB 4G26A 5LQRA 1P3JA 2WKWA 1CR6A 3ESBA 4WUTA 5BNWA 3GYGA 3QZUA 2OHVA 3ZY5A 1M3SA 1P2VA 4M0EA 2OUKA 1G20B 2FUCA 1JHDA 3WOHA 2YIJA 3R3WA 3GGJA 4EFLA 4WFKA 3EPLA 2QVXX 4NEGA 1LRJA 3OJFA 3OSUA 3MB8A 1AHNA 1OJLA 1R4ZA 1WEKA 1YJXA 2QOEA 3EEBA 4JLSA 4P32A 1VMEA 2A3NA 3QVOA 4QIHA 4MWDA 4MVJF 2X14A 1RM3A 4EW1A 1K0FA 2PZBA 3IPLA 3M2TA 1E2GA 1SRRA 2BRUC 1QAOA 1F5SA 2JATA 2XNDA 3U0BA 4CM8B 3QG1A 2BT4A 4PC6A 3QSGA 3ZWQA 3TUJC 4FC6A 2XGMA 1TC1A 4YGYA 1J8MF 3O75A 4AJOA 1JB1A 5AM1A 4WERA 5J2UA 1XMVA 4RPGA 2Z6QA 3SI7A 2H1VA 2KBEA 3NHWA 1LPSA 4KAFA 5DDIP 3SXUB 3WGJA 5HJ5A 3P26A 1KO4A 4RD4A 2CEKA 1Z2EA 2VDOB 4O33A 5AW4A 4HPWA 1JG1A 3T9CA 3R7WB 3WGMA 4B6QA 2YMPA 3E18A 4OFXA 1YL7A 1QO0D 3H8JA 5JWHA 3TMKA 1JVSA 3SZRA 2VSNA 3UJ8A 5JASA 3ZDEA 1NLZA 2PEZA 5KYKA 4YRCA 1E2NA 3MS4A 1PJSA 1ZY2A 4P93A 1N5MA 4FYYA 4D2IA 3MAGA 4H1TA 5H7XA 5