3EO0B

Structure of the transforming growth factor-beta neutralizing antibody gc-1008
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSNVISWVRQAPGQGLEWMGGVIPIVDIANYAQRFKGRVTITADESTSTTYMELSSLRSEDTAVYYCASTLGLVLDAMDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GC-1008 Fab Light Chain
publication title A cytokine-neutralizing antibody as a structural mimetic of 2 receptor interactions
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 47
structure length 220
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eo0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eo0B01
4URTB 3NA9L 3QI9B 3ULUF 1G7MA 1QRND 4GAYB 3E6FA 3D48R 1WF5A 4FTVB 4Q7DA 1EUTA 5JDSB 4UINH 5TJWK 3U4EB 4C58B 3WNMA 3U0PA 4A6YB 4MNQA 4XNMB 3VXSE 3MRNA 1F4AA 2UUDH 4L8DB 3OAZK 4G43B 4MAYA 3K46A 5FKPB 4RMQA 3P0VL 3I9GL 3RX7A 1KC5L 5EOTB 3MV8A 4FOMA 5F70A 2CGRL 4BFEA 4TSAL 2ZUVA 3PE9A 4ZS7H 4M7LH 5CWSA 2JB5H 1GGTA 2ZSWB 1E6JL 2HA1A 4ODWB 3EYVA 5F7UA 1QR1B 4O2EB 5EO9A 3OG6B 5L2KB 4KK9D 4MJIE 5FYJD 1EVTC 5FYLE 1BVLA 4DZBA 3WKNA 1NUDA 1B3JA 5LJYH 1QBML 2ATKB 4L1HA 1AXSB 1S5IH 2XXCB 5DHVH 3SGKC 1S9YB 5INCB 4MB4A 2VSCA 3QAZC 1KN4L 3OKEA 1UCBH 5JHDD 4M5ZH 4RFOL 4L4TB 3TO4A 3BZ4A 4KZEH 4HG4J 2FEDD 1JF6A 4MNHB 4X9IA 5HHOD 1A1OA 2YRZA 4XNYH 4L5FH 4PUBH 4NSKA 4Y2DB 5IT2H 2Z31B 4OCRL 3RL2B 1I8MB 2HRPL 5FUOH 2XZQL 2P5WB 2APXA 2AP2A 3TYGH 5I18H 4KFZC 3LS4H 4JZNA 2CO7B 3C5ZC 2WUCH 3DX9A 4HS3A 1IAII 5A16A 4XNUL 3ULUL 2OYPA 2F53E 5CJOH 5IFAH 4HJJL 4PRPA 4HIEA 1JNNH 1RUAH 5F88B 3WJJA 1RZJC 1QOKA 5HPMA 1CTNA 3NCBB 1IEAA 4ZTPH 1HYRC 3QXUA 1JGEB 4P3WA 5I66A 3H9SE 3FL7A 4NBXB 2G75A 2N56A 3B8SA 3I6KB 2ICCA 3SE9H 4XPBH 2NXYC 4WCYL 2XWTA 1G7QB 2R69H 2BDNH 2IFFH 1A3LL 2PR4H 5C7XH 1FSKB 3MC0A 4AK1A 1FP5A 4X6DB 4OT1H 3WD5H 4JFFA 1MQ8A 4YX2H 1NGQH 1ZHKB 5HJ3A 1ZXQA 2RBLA 5HGBB 4BA8A 4QRRE 1KIRA 4H0GA 4YHIB 3CFBA 3QHZL 3P73A 5IHUL 4GKOA 5JPNA 1K4CB 3FMGH 5LGJB 1WEJL 1NGYA 2DDQH 3C9NB 4KH2A 2J8HA 1WVZA 3MLWL 1KLGA 3BAEL 1F2XK 3MV7D 1FC2D 2E6QA 4U1NB 3T8XA 5E99L 2AJ3A 1P4IH 1CIDA 4M93C 3DYMA 5ITFA 5B38G 3O9WA 2ZUWA 5J0BA 5GGTL 1I8IB 1BBDH 3MJGX 4OQ1A 2UYLA 3VWKB 5I1IL 1MF2L 4X5WA 3CK0L 5HI3D 2ORBH 4FNLL 3AS3A 1CD1B 1TPXC 1EUUA 3THML 3KWWB 2PN5A 4HBCL 3QDAA 3SOBL 4CNIB 4WGWB 4IHOB 4X8JB 1UM5L 2H6PA 3PHOB 3LKPA 1CCZA 4G80A 3PL6D 4XPHL 4PGDA 1HIML 1CXIA 5BV7L 1A7PH 4AL8H 5EG6C 1BIIB 3PWPE 1XCQB 4NZTL 3DXAB 3V4PH 1NCNA 3UBXB 1NDGA 4KDTA 3LHPL 4RISL 1MCKA 4O4YL 2DBLL 3FQXB 1AJ7H 3FT3B 4NWTH 1SY6L 3QPQC 4R4BA 5A2LH 2F74A 5HSFA 3ZLQC 5T1MA 1ZT7A 4NC1E 4KI5D 5DF0A 5E8EB 5GIRB 3PUCA 3S4SA 1MY5A 3GI8L 2FL5B 2GY5A 4E41E 1QSEA 1T04A 2X44D 5BOPA 5KAQF 1FO0B 5L8KB 3RWCA 1INQA 3O4OB 4NO0A 2M1KA 4WW2B 2MOVA 2D0HA 4K3GA 3IFNH 4AENB 4NZUL 4X4XB 5IJVB 2P7TA 5I1DA 2ENSA 4X5XB 2XA8H 3OAYH 5ACMA 2FHCA 2NW2A 1FYHB 4HFWB 4L3EA 3A6CL 5BQ7A 2H9GB 2JK5A 5IVNA 5ESVA 3UTTE 4EQ2A 1A3RH 4KU1A 2KL6A 3QRGL 3L3DB 5JHLH 1RIHL 3VH8G 1FNHA 4GMTL 1JUFB 5F7KC 5KG9B 3ROOB 1OT2A 2LU3A 4UIMA 1XR9A 3V6OC 3WEXB 3GK8L 2YMXL 1AIFA 3QFJA 4K94H 5KS9F 4NM4H 1PZ5B 4F7CB 5I1CL 1OAUL 4JRYD 2B1HL 5FA3B 4X6CF 3K4DA 3QIWA 1EJOL 1C16A 2QSVA 3ETBF 3GSVA 4NZJA 5BS0D 1S7QA 2WLZA 3CVHA 4FQJL 1EFXA 3OKOB 4WWKC 5CCKL 1LO5A 3VXRE 4HUWA 1PAMA 4WI5A 1SBSL 1U3HA 3BPNC 3KYMB 4PJBB 3IB4A 2VDQH 1KBGL 2VXUH 4PGCA 2IBZY 1JL8A 4DQOL 1P2CA 1GZPB 1WWBX 1QSFA 4IIQA 4L4VA 1RZ7L 4M6MH 2C3XA 4U1KB 3HNTL 4QNPF 3CLEH 1U58B 3AS1A 4YPJA 5KSUB 5T1LB 1LEGA 2X4UA 3PV7A 4Y5XC 3T0BA 4GKNB 1R5IA 1BJ8A 1CR9L 4LDEB 3W5NA 2AKRA 5FIEA 1BFVL 3K3QA 15C8H 1RJYA 1WBYB 4Z7VA 4NT6B 3S37X 4L8CA 1IAOA 2X70B 5I1JH 4APQC 3SDCA 3QCVH 4G8EA 2ADFH 4OLUH 4NNYB 4GLRH 5GRVL 2R2EB 1DBJL 1RZGB 2BC4A 1FYTD 3U4AA 1P9MC 2EXWD 3O45A 3WKML 5GGSB 1FL5B 3AREA 3U36A 4BQ8A 1YY8A 3P40A 1MFEH 4D9QD 4YHZL 5D7SH 3GB7A 4ZO6A 2BSTB 1FZMA 4FFVC 4GQ9L 4NQVA 3R0MA 4Q0XH 2QKIA 3VI3E 1NCDH 4FQIL 2G5RA 3TJHD 5DD3H 1GVIA 3WNLA 3KPQB 3T0EE 1OLLA 5T3XD 3G5ZB 3GI9L 1KJ2A 5E8PB 2AK1L 2CUIA 3FRUB 4D0CA 4NQSA 4OD3L 2VC2H 5TQ0L 4M1GL 2B7DT 4D0DA 1UKTA 5DFTA 4E5XB 4KK5C 4DEPB 3D2UD 3FB6B 1HYSD 5E0QA 3QXDB 5J3HC 3RIFF 1A7QL 2NY0C 4IM8A 2GK0A 1URLA 4RFEB 1JF1A 2YA0A 2AJYL 3AB0B 4PB9L 3C2SA 5KZCB 1SJXA 4XC3L 5DO2C 3HI1B 4NGHH 5DRZB 4CJ0A 1IM9A 5GJTL 1X5KA 5DJDA 3S8WA 4NOFA 1AD0A 5DRXA 3DOSA 4F33A 4NUJA 3C60B 1KCVH 2W38A 1Z9LA 2JB6B 4JHZA 3CDGB 4UBDD 2X40A 4QGTA 3EDKA 1ES0B 4IRJC 1R5WA 4XPTH 4ORZC 2HJLA 4QRPD 4YHYB 5KSBB 1NMAH 4PJDB 5GRXG 3VFOA 3X12A 3EOBA 3VXTA 4HWZB 3O81A 4LLMA 4QHLA 3VJ6B 3DO3A 2V5YA 3EYFB 3RGVD 1XGUA 4LHUG 2EDJA 4Z78A 3MYJB 3MX0A 4WI9A 1MFCH 5DLML 3NZ8B 4KWUA 2R9HC 5ESQA 3QEHB 4F2MB 2R39A 1ZT4A 1XIWB 1CD8A 1MI5D 1OGTA 3RVUD 4O5LL 1ADQA 1NAMA 5MENE 4ERSH 1KPVB 2JJUA 5F6HI 3H42H 3QJFA 1RK0B 1ZVSB 3WN5A 1AGFB 3PWVB 4ZG1A 4ZFOB 4LSDA 5EUOA 4JFDA 4R0LC 1MPAH 1DLFL 2LVEA 1U0QA 4G6KH 2WP3T 3ZE2F 4KK9C 1XGRB 4N1EA 1RFDL 1CXHA 4L29B 2A6KB 1LK3H 1DBML 2Q7YB 4PY7B 1ZLUH 5C0ND 1AKJA 2DI8A 2VLRA 5C0BD 2NY6B 2Y36H 1DN0A 2A73A 3EYSL 3LN4A 4WU5A 3IJHA 2LQRA 2DLHA 1TQBC 3KJ4B 2BMKB 3OKDA 3X11B 3C5SB 1SJEB 4MSWA 4D94A 1T7XA 4FQXB 4JGMA 3WFBH 1BJMA 4LSRL 3BKYL 4I77H 1FNFA 4U0RC 2FH6A 5T1KB 3HS0B 1K8IA 1MWAB 1FPTL 1LEIA 4NKOA 2AEWA 2ERJB 3EOYG 3UDWA 25C8L 3TEUA 1PX4A 2ICEB 2YPLD 3ARTA 4ODBD 5C86A 3VFPB 3I75B 3QEGH 4QT5A 4XNZB 2OTWB 1NGXA 3G08B 3BPOB 3Q1SH 5TF1H 2DB8A 1W0YT 4JO3H 2OJEA 1A22B 2FX9L 2EDYA 3K1KC 3DYOA 3V9FA 5GGRB 3H9HB 1H3WM 4JG1L 4LEOB 1XFPA 3EO9H 1I4FA 1IAIM 1QFWH 2LU4A 1OTUD 4LP4A 1PKQE 1T0NB 4GAJH 1LP9A 4PRNA 3BUYA 2CRMA 3PGDA 1BWWA 1R5VA 2EC9U 3M8OH 5C0JB 2MKLC 5FB8B 5LQBL 1CK0L 5C0CB 2EIDA 4ZFFB 1T1WA 3FOMB 4P2QA 5EORL 4Z7NE 2B20A 1NCWL 1QSZA 4IJ3B 4KJYA 3ROLA 1ONQA 1ZHLA 3LEVH 2BFVH 1IFHL 4Z7WA 5CD5C 1A1NA 3UPRB 1TTFA 5JQHC 3FO9A 5HHNB 1IEHA 4U1JB 4CW1B 5E6YA 4POZC 2VL5B 1YNKH 3EBAA 3WL9A 4ZFGH 4HS8H 2APFA 2W07A 5F7DB 3M07A 4Y1AE 5ADOH 4K3HA 1T5WB 4WDIA 1HHIB 5CFHA 5HDQL 3PL6C 4MYWB 1ZLSH 2NY5L 5F9OL 1IGYA 4RMTA 5C2UB 1U36A 2FCBA 1LD9A 5D1XA 1JZ6A 1BBJB 4JZJB 4Y16C 1WITA 4DAGL 1LMKA 1FGVL 2Y06L 2GY7B 5K9KA 3VXMD 5F96H 1QBBA 3QJHB 4NO5B 1ZA3A 4FRWA 1D5BA 4PRIE 3S5LG 1DQDL 1H8OA 5D7IB 5ALBH 4KI5C 4QKXB 3JWDC 3CCHA 4E41B 5I0ZA 4WTWA 3LV3A 2C3GA 3K2UL 4Z7VF 5E9DE 5D1QD 3RZWA 3R06B 3NCCB 1DQML 4J7RA 2JCCE 3ZKXC 3NAAL 4FXKB 1C5DB 4YBLC 2CRYA 2XZZA 5F7EL 2VLKA 1DANT 1PQZB 1PD6A 1U91B 3HG1A 1MH5B 4JRXB 3LPGA 3SDAC 1T1ZB 2J8OA 3UTTB 3OR7A 3BXNB 5CP3H 1ZWIA 3KXFD 1D9KD 3OPZL 5CJBA 4U0QB 4YEFA 3BGFB 2P47B 2Z91B 5FCUH 2XZAH 4Y89A 5CEZH 3FCTA 4F7PA 4Z7QE 3ILQD 2KH2B 3RIAK 2A38A 4GW4A 3TH4T 3CVHL 4RNRA 4YFLF 4D9LH 2HT2C 1U3YA 5IEHA 3DI2B 3LIZL 3TN0C 4JFXB 3OKMB 4JFOB 4PJXE 5DGRA 5MEPB 4PJCF 4MXVE 1W0WB 1QEWA 1RMFL 3C6LA 2XQBH 4Y4HB 4CADB 5GS1B 3S3PA 2AVGA 1F5WA 2Q7NA 3MRBA 4HEME 3MR9A 3QO1B 3UTSB 1M05B 4EDWH 3ULVE 2G5BA 1REIA 2L7JA 4I5BB 1ZGLP 4LCWA 5C9KA 3BD3A 2DRUA 5C0FA 4RX4D 5ICYA 2HWZL 4FP8H 1NBZB 3Q6FB 3MFFB 4JM4L 2LE9A 1DQQA 1MIML 4M43H 5DUBA 2YZ1A 4EBQH 4P23A 5SX5H 4UT9H 3NFPA 4AIZB 3ESVF 3HC0A 4G6FD 5CLTA 3QXWA 4ZSOE 4NQUA 5DK3A 4NYLA 2C3WA 1C5CH 2YN5A 1AQDB 1WIOA 5E6IB 4LF3B 4MB5A 3IDYB 3EYUL 2EE2A 1X5IA 3AM8C 4WO4D 4HLZG 4ZUUA 4N0FA 5I1KL 4G7VL 1BLNB 2KQMA 1OSZB 1BFOB 2BCKB 4BSVA 2MPAH 5DMGC 1NCAH 1HHGB 2XWJB 3WO4B 5AYQA 3X13A 4H1LB 3BFOA 2LFGA 3MOAH 1OP5K 2LU7A 2ARWA 5T3ZE 3SY0B 1T0MA 3QEQA 2ITCB 1F45A 4UQ3A 4MQTB 5H8DA 1RIUL 1Q9KB 4R90L 5E95B 1W8OA 3IJSB 2A9MH 4QHKI 5IOPA 5T33H 1K8DA 4TUKH 4XB7A 5I1LA 1M7DA 4X7SL 4ACPA 5F3HA 1A4KA 1KJ2L 4YPGB 3VXPA 2J6EA 2N4IA 1MRCL 2I5YH 5KTEH 3RUGA 4XPFH 1GRWA 3K8LA 5JMOC 2Q3AA 2X4QA 5EUOF 5FECB 1I8KB 4DCQB 2X1WL 5FKAA 1LVEA 2YD3A 4LKXB 4U1MA 4DWHA 1UH2A 1XR8A 1Z3GH 1N0XL 2CIIB 4UDUB 3EOTL 1JZ2A 4Q9BA 4UAOC 5DJCA 4OAWB 2OK0H 1GZQB 4OKDA 3UTOA 2NY3C 4PJ5D 2OQJA 2EDTA 4XPAH 1GGBL 1OAXL 1HZHH 3V5KA 4GKSA 2MHAB 1ZGLB 1XZ0B 4S1RH 5EWIH 4M02A 3IF1B 2IGFL 4MGXA 4X0KA 1VEPA 2FSEB 4M1CD 5C09B 1GAFH 4QF1B 3L5XL 3ARFB 3S3SA 2ZP0T 4GBXD 1MNUL 4Y4KB 1IL1A 1UXSA 5KOMC 4OUUB 1AFVL 1RZJH 4KRPD 3D39D 4QLRA 5CSZB 4BYHA 4GAGL 3W82A 5JHDA 3LQZA 4PRHD 3OWEA 2BNQB 4LKCB 2J8UE 1CFQA 5HHOA 4Q97A 4TULH 1ADQL 1NAML 1SQ2N 2X4OB 3S3JA 3FB7B 3MRJA 1UACH 3PIQA 2A6DB 2WM0A 3R0NA 4NOBA 2HFGH 5IG7B 3TZVD 5K59E 4LAJH 2LAGB 3ARDC 3DRTB 5J06A 1VFBB 4ZO7A 1MSPA 2F9BT 1OWWA 4HPOH 5MENB 4H8WL 1OPGL 3IFOB 1LP9F 1FNSL 4HULB 4W6XB 5H2BA 1I7ZA 3ZHKA 3WS3A 3FQUB 3VW3L 5HYQA 5EUKA 5GRYA 3O3DA 5GRJH 4JVPA 5H94A 3PDGA 3BI9X 1T66C 4XBGB 3SE4C 6CGTA 1FFOA 3QWOA 3GMMA 3T1FA 4H26A 1QHOA 2PYEE 2G2RB 4Z7WF 1S7UB 3SGJA 4ZXBC 5EOQL 4QRUA 1VA9A 3U0TB 3DVGA 5BV7B 1EIBA 3ARGD 4N0UE 1H0DA 4U1HA 1KV3A 1JZ8A 5AYUH 3ZKSD 5L2JA 5TDPA 4OIIH 3VXQA 1YPZA 4XP6H 3RX8A 1TJIL 3F5WA 2HFFB 2P48B 3OB0H 1EX0A 5D7JD 4OD2A 4Y5VC 4F7EB 1LO3H 3DV4B 1RUQL 1YEIL 3LRHA 3ARBD 3G5VB 4I13B 3TPUB 5DJ6A 1TMCB 4I2XB 2X7LA 5IGXH 1P7KA 5HYSG 4TSCL 4QXTB 2MCPH 1NKOA 2QBWA 5EC1B 2KDGA 3GSNH 5HBBA 5AAWA 5FGBC 1ITCA 5HYIA 1X7QB 5CJQL 5F9AC 4OZIA 1JWSB 1Z2KA 2V9RA 3PL6A 5D96C 4L8SB 4YHLL 3REWA 3L3KB 5A43C 3BH9B 4YK4C 2EYTA 2FNBA 3RNQA 3DVIA 4I1NB 5IFHH 1LO4L 4PD4J 1QBAA 2NTFA 2Q3ZA 5EDXA 3I6LD 2XZCL 4Y19E 4NNPL 3MGAA 3SQOH 1JGUL 4LQFL 2ZOLB 3KPOB 5CEZE 4FS0A 2K1MA 4KTYA 3O4LE 3FTGA 3DVNA 2PXYB 2UVFA 2WINA 3W0WB 5FHAH 4OF6A 5T5FH 4MJ6B 3KGRA 1MCEA 4FQCH 4PLKC 4NFDA 4XRCB 3B9EA 4I9WE 3MLSL 2WWMD 4WEMB 1MIEH 1HKFA 3GO1H 4HUUA 2FD6L 4MA3B 2Z35A 4ZUSA 4ELMB 1GYAA 4UT7H 3FQTA 2CLVB 3TO2A 3VDAA 2BNRE 1A3QA 5D2LA 1F02I 5D7LE 3CSBA 4YGAB 5FDWB 5L8JB 5LWYL 1KNOA 2KZWA 3QCTH 4Z95L 3NGBC 4JFZH 4JDTH 3P77A 2HG5B 1YEEH 1X6NA 1F6LL 3F8UB 2XKSA 1AC6A 2IBGA 3HMWL 3U9PL 4OTXH 4PPTA 3GUTA 1CBVH 4JRYA 1AHWB 2ADGB 4LRIC 4WFEE 4XCEB 4MA7L 4I48A 2HVKA 4I4WB 4YUEH 2AEPL 2Z8VC 3TCXA 4YHML 4U6HB 3P9LA 5FGCB 5BS0A 4P0DA 4LLDB 3H9YA 4AEEA 5KS9B 3TNMB 4PRIB 3BKCH 3E0GA 4UV7H 1U8OA 2FJHA 4IS6A 2E6PA 4NQCE 3SKMA 3W2DL 4JPKL 1OOAA 4X6CB 1R3KA 4NJ9L 4N9GA 3TT3L 2YD1A 3RNKA 2R23B 4P99A 2ICWB 5I15H 2FGWH 5DA0B 2NY7L 3I50H 4XHJD 2D31A 4HS6B 2O5ZH 2F54E 4C59B 3CGTA 5IROC 4HC1H 1EBPA 1DE4A 1N3NB 5GS0L 2R8SH 4ONGH 5JUEH 3S6CA 2X4SB 4HUXA 4XBEH 3BX7C 4RGNE 4JO4L 5ICXB 3MQIA 2M8XA 2XYCA 5DD6A 1I9IH 3MLZL 2WMPA 3DTXB 1MCNA 1FZKB 4JM2D 4UNTA 3MODH 3B5HA 2Y5TB 1KGCE 4I3SH 2VLLB 2DQFA 4GOSA 5CGYC 1FRGH 1UWXK 2F5BL 5EU6B 1M71A 3BP5B 3MRLA 3NTCH 4LCIL 2DKSA 2DIBA 3ILQC 4PGZA 1CZ8H 2R4SH 1RAMA 3RUGF 1PEWA 4LCUA 4XVJL 3VRIB 4G8IA 1FYTA 1NGPL 5HD8C 4JE4B 5MI0B 3GSRB 5L7XL 4M6OL 3JTSA 4XZUB 5EU3B 4P4KC 3GSUA 3DSFL 1UQSB 3I3EA 4XMKH 2R4RH 1Q9WB 5D1ZD 3O3UN 4OM0L 2ADIB 2Y5EA 4G42A 3FO2A 1NC4D 2X1PA 1G7MB 4OLWL 4U2YA 4EXKA 4M7JL 2F8VA 5CP7A 4YBQD 4XVTH 4PV9B 1CFSB 4XCNA 2JIXB 3CFCH 3QUMH 1EEZA 5CJ8A 3FN3A 1TQCC 3VD5A 3MRNB 3RQ3A 1KSRA 3A67H 4I8DA 4MAYB 4DKEH 4JB9L 3HAEG 5CJXA 1OSPH 5ACZB 3MV8B 4ONHA 3BDYL 2H8PA 3WFHB 5DFVD 2F5AH 3ARPA 1ZS8B 5CWSB 4Q9RL 5FYKL 3QUZD 3PWLA 1E4XI 1BVLB 1MCQA 4N8VA 1AXIB 2FB4L 3CSGA 4Y4FD 4ZS6D 3BN9C 2GITA 2FR4A 3RJDA 5IWLC 3EYOA 1JI1A 4GJTB 4R97B 2J6EL 4XCCH 5KVGL 3OKEB 3E8UH 2IPTL 1T03H 4XX1E 4X6BA 3BSZH 4P3CL 5F97E 2XN9E 4W4OA 4Y8DC 4UOW1 2JF1A 4OCSL 2BVQA 5L2KD 2C1OB 4QRPA 1A1OB 1B2WL 3GHBL 4NSKB 3H3PL 4HFUL 2FX8L 4M4PA 5HGHB 3RGVA 4JZNB 2QQKH 5D7KE 5FOJA 3DX9B 2BVYA 3P0VH 1KC5H 2COQA 4PRPB 3AXLA 1NLBL 4TSAH 5H35A 1MI5A 5HPMB 3MRMA 3KPPB 12E8L 5FYJL 4K3DL 1E6JH 5T1DL 1MCOL 3KPNB 4Y2DD 3UPAA 1EEQA 2G75B 2XTJC 2P5WD 5HYJE 1T80A 3P11H 4X4YA 1FL6B 3IKKA 1YPZF 2XWTB 2FEEL 4JG0L 4LCCC 4Q2ZB 4HK3J 5DRWB 3PABB 4JFFB 1KN4H 1J0HA 5HJ3B 3U2SB 4N8PA 1KIRB 4RMSA 2X9WA 5C6TL 5E2VL 1NGYB 3E6HB 3MXWL 5ILTL 2NZ9D 2ZOKB 5C0BA 3BPCA 5CAYB 1H3XA 1U8MA 3L3GB 1T1YA 2HRPH 3FFCD 5CEXA 3T8XB 5D71L 1S8DB 1NMBL 1T7WA 2AJ3B 1Q9OA 5ITFB 2JE8A 3QXVA 4ELKA 1NBYA 2JJWA 4OZIF 1QTYT 2YN3A 2EDDA 4XNUH 5I8KH 2YWZA 3BPLB 1J0JA 3ULUH 3WJLA 4C83A 4ZUWA 4IRSB 2Q86A 3VWJB 4X5WB 3IU4L 3DX6A 3UYRL 5I19H 1CICD 2FHBA 3BKJL 2NR6C 2XACC 2B1AH 3EHBD 1X4ZA 3CXHK 3HZKB 4MD5B 1AI1H 4G80B 4NKMB 3V6OE 3ILPA 1XGPA 5GGQL 2ITDA 3MO1A 5ID0A 1MCPL 4RGMC 4B5EA 1NUNB 1BF8A 5SV3A 1GOGA 5HHXH 4PLOB 2ZNXA 4EVNB 3VWKD 4KI5F 2IQAA 3QHZH 5IHUH 1L0QA 2BSSA 3RWEA 4YHOL 3I6GB 4N8CL 4R4BB 4YJZL 4LGSB 3MLPA 1K6QL 2QSCL 3MLWH 3N9GL 2F74B 1HNGA 4PJHE 4PR5B 3LB6D 5DK2A 5T1MB 5D2LF 1ZT7B 1FFQA 5GSVB 4CDGC 1O0VA 2EKSB 2R0LL 5GGTH 1J10A 2H2PC 2YD8A 1UXWA 3N06B 3MV9E 2YPKA 3DXAD 1LDSA 1WBXA 1HSBA 4P5KA 1M7IB 3PWJA 3LPWA 5D7JC 3RWCB 1MF2H 1INQB 4RQQB 3AFLA 3STLA 3T4AA 4MA8H 1JRHH 1TVHB 4ZOBA 2R29L 3THMH 5I1DB 4OFKA 4HBCH 1R24A 1PG7H 2HN7A 1U41A 2NW2B 2B5IC 3IFPA 4M6NL 2JK5B 1AR1C 5ESVB 1HIMH 1L9MA 2GT9A 4XI5D 5EIQA 5D93C 5EZIL 4MD4B 1FZJA 4FQ2L 2VDLL 4U6YB 2V7HA 1FJ1A 1RQ5A 5EOCL 3JWDH 3IS0X 3O6ML 4M7KH 5KN5B 4KZDL 4O4YH 3TYFA 4MQSB 5EU7C 2DD8L 3V52L 3UBXG 1SY6H 3TV3H 5IJKC 4NN6B 3GSVB 1IMHC 3IDNA 4PJFE 1S7QB 2Z8SA 4DFHA 3CVHB 4JKPH 3F65A 1EFXB 4CJ1A 4KTDL 1QFUH 2E8YA 3VXMA 4HUWB 2YD2A 5EZJA 1U3HB 4YFEA 3WLWC 3U0WH 2WQRA 5C2BH 1MJ7L 4GG8B 1IGIH 4KVCH 3MBXH 4PGCB 3MGTA 5F9WC 5FUCC 4GUPA 2UY6A 4GG6A 2GSGA 4IIQB 2UUDK 1YEJL 3D69A 5IROA 5D1QA 3A6CH 3DPBA 2VDNH 1U2HA 3GBNH 2BNRB 1RIHH 1JMXA 5DI8A 1U6AH 4KKAD 1LEGB 2X4UB 3GK8H 2YMXH 3MJ7A 4JQIH 3F6IA 4RGOL 3KXFA 1OAUH 1RJYB 4MCYB 43C9A 5HGAA 1D9KA 5EO0B 1IAOB 2I9TA 3MRFB 2VZTA 4R7DA 4KJQC 4G8EB 4PJ9C 3RWIB 3CAFA 2BC4B 1U92A 2DQJL 3MLRL 1F8TL 4FQJH 4TNWK 1FQ9C 4HLJA 2AEIT 5D72L 5DMKA 3T2PA 3U36B 7CGTA 4WVRA 1ORSB 2MWCA 5FEBA 4PTUB 5TPWH 4FQ1L 1KBGH 2Y07H 2OP4H 2AV7A 5SWZD 4XGZB 4NQVB 5IMKA 1IC5L 3HNVL 1RZ7H 2EDQA 4PJCB 4G6JH 4OF8A 4RX4A 3QH3B 4XP1L 2F54B 3VGDA 1UB6B 4FMKA 3V4UL 3L7EA 4NO3A 5F6IB 2CXKA 4HWUA 1G9MH 4RMWA 4OV6F 1N59A 1BFVH 3LS5L 4D0DB 1QQDB 1B4JL 1UYWL 2R1YB 5JW4R 2GK0B 4WO4A 1JF1B 1MFDH 2HP4A 1JHTA 1NC2D 3NCMA 2VN7A 2DQEL 4HWBA 4OJFL 5MHSE 1L7TL 1DBJH 1SMAA 2CR6A 2H41A 3U7YH 1FNEA 5DRNA 2JELL 3AY4A 3QQ3A 2WANA 5DJDB 4WUUB 4WHDA 5DRXB 4F33B 5ALCH 2R0WL 3ZKND 4CDHA 3MA7A 5HI4C 3GIVA 2VKWA 4Z5RA 4YH6A 3VGEA 4CVZB 1J8HE 3DBXA 2H32B 4GQ9H 4K3EL 1R5WB 5GZNC 4OZFH 1YQ2A 2X10A 2HJLB 4LVHB 3SDXE 3QUYC 4DTGH 3VFOB 1F2QA 4UB0H 5KVDH 5CILL 3EOBB 4KVNL 2I60H 1B90A 5T3XL 5D1ZC 2D7TH 5EZOL 3RHWF 1XGUB 1CD9B 1VGKA 2AK1H 3RP1A 4ZOCA 2OS7A 3FJTA 4Z78B 4FFYH 3KLHC 4OD3H 5IB4A 3O3AB 4P5TD 4LP5A 2D0FA 4U3CA 1CVRA 1CL7L 3ELAT 4UNUA 3R4DA 1OGTB 1J1XL 1A7QH 1AY1L 5MEQA 1EHAA 2AJYH 3WN5B 4PJ5A 2DWDB 3F7YA 2NXYB 5GJTH 5DS8B 4JFDB 4P48A 1TZGH 4O02H 3QUZC 3ULUE 4NFCA 1XF5A 3L5HA 1A5FL 3OKLA 4QHMA 3VXSD 5DD1H 1XIWD 1CXFA 2R1WB 1KT2A 3U30B 4GSDH 4ZS6C 5CZXD 1QO3A 2WAHA 5DD0L 1BZ7A 3SDYH 2LVCA 4GBXA 1AKJB 1A7NH 2VLRB 4LNRA 5IVXE 1AO7E 1DN0B 4HIJA 2A73B 5MERB 3O41A 2VIRB 4G9FE 1TETH 4MJID 4ODVL 3OKDB 3D39A 3TBVA 5FYLD 2H1PL 3ZL4H 4PRHA 3O2VL 4M93B 5J9PA 4K7PH 4IDLA 1U42A 5DLMH 3OAYK 2YUZA 4HKJA 5IMOA 5K9OB 1K8IB 5DMJB 4H88L 4NKOB 2NY6D 5FOBB 5I17A 2GSIA 5TGBA 1TPXB 1NSNL 3TZVA 4S1SL 2GTZA 1BQUA 4QT5B 1SYSA 4OZHE 4PREB 2YPVH 4PLJC 4P59L 1J8KA 2OJEB 1HSAA 2IWGA 4X7FC 1DQLH 4O2CB 1VFAA 4MDJA 2VAAB 5GRUL 4KY1L 4TTDD 2NLJA 1RFDH 4ENED 5IHBA 1D5XA 2NY4C 4Z7UA 5T1KD 4JJ5A 2DAVA 1I4FB 3HR5B 3TBTA 1KEGH 2F53D 1R0AL 3LKRA 2EZ0D 1LP9B 3WHXA 5DZOA 2QHLA 1C1EL 3EIFA 3RPIA 5CMAA 2AK4E 3ARGA 3H9SD 3FB8B 1T1WB 1SEQH 4NRXA 4WV1C 4WFHD 3V79C 3OAZH 5IF0A 1ONQB 2AGJL 1U3ZA 4XMPH 4LSRH 5JLZA 1ZHLB 4R4FL 4CL7A 2A1WL 1A1NB 2IBZX 4F9LC 5C6PB 5DUML 1FPTH 3O6LL 3FO9B 2VO5A 4OGXL 25C8H 4QY8A 4QRRD 4ODUA 3ARBA 4P2CG 5IVZB 3C2AL 5DT1L 3VFUB 2Z8WC 4Z8FH 2IPUG 3WL9B 3MRHB 4MJ2A 2IAMC 2E9BA 5JQ6L 3BMVA 4JG1H 3SJVE 1TCMA 1ZK9A 3F62A 4PG2A 4CBPA 2PW2A 2XFXA 1LD9B 5I8OL 3B2VL 5IBTH 1OTTD 2NZIA 5DJAA 1JE6A 3KLAA 1GOHA 3VCLB 3TBYA 1F4WL 5LQBH 4GG6F 2NY2C 2XPGB 1CK0H 1A8JH 2R0ZH 2VQ1B 1NCWH 2W60B 2OM5A 4GW5B 2Q6WA 1MCDA 1ZA3B 3OHXA 1KB5A 5E7FA 3C08L 4JHBA 5BZDA 1BQHA 2DQCL 3WFCL 3BVNA 1S7RA 3CCHB 3PWPD 3LV3B 3HPJA 1WTLA 2P5EE 3NIDF 2P43B 4CN4A 1U3JA 2DKMA 2A0LD 4Q74A 3PQYB 2SEBA 1MRDL 4XPGH 2VLKB 1R6VA 4X80H 5CGTA 4X6EA 3HG1B 2C9AA 3WS6A 2NNAA 3OR7B 3B3IA 4Y5XB 1A64A 1ZWIB 3ZYIA 3ULSA 4Z0XA 4E41D 1MAMH 4B53A 4C57C 2VZSA 3RKDD 2HVJA 2RJMA 3FCTB 4F7PB 1TJHL 1MLCA 2WIIA 3SCMD 2W0PA 1N5AA 5IEHB 5C07B 4PG9B 4I18C 4ODSH 2Y06H 3IGAB 3MLUH 4LLYA 3C6LB 3UTTD 4PJFB 3K1DA 2G5BB 2DI7A 5I71C 1U8PA 4LCWB 2FLBT 3PHQA 2FIKA 2Q76B 4ETQA 3BIKA 1BMGA 3T2NL 3BHBB 3K2UH 3B6SB 3BH8A 1U8IA 1G7PA 4XTRC 3NAAH 4L3AA 2NX5B 4Y5YC 1WSST 1DQQB 4G8FA 3CFDA 1S78D 3L9RA 1DL7L 4NQXB 3K7UA 2Y6SD 4JR9L 3VXRD 3OPZH 1QBLL 4LARL 3WDIA 1D6EB 4M3JA 1UKSA 3LRGA 2EDXA 3DUSA 4Y2OA 5E5MA 3GBML 4ZDHA 4YDJA 4KKAC 4N0FB 4ZUUB 3S36X 3F7PC 3CVHH 2AJUL 5E5RB 2DJSA 3EZ8A 5IIEB 2XG4A 4ZQKB 4JM2A 5IB2A 3BDXA 1B6UA 2CLRA 5DK0A 3X13B 4U05A 5DYOA 2EEAA 1ZLUK 5C71A 5EBWA 3IKCA 1Q0YL 2FECI 4KXZI 4M9PA 5B21A 5E6ID 1FORH 4HK3N 1T0MB 3QEQB 4FN0A 5F1NA 1CD0A 1MCCA 2MMXA 3HAEA 3QISA 4QXGL 3TBWA 1MJ8L 3MCKA 1QFHA 5F3HB 1A4KB 4JLRB 4LSUH 2V2TA 3T0WA 4TOYL 1MIMH 5K9JL 3B9VA 2R0KL 5ICZA 5D1ZA 5FFLA 3SPVB 2GKIA 4UDTB 1NC4A 2DKUA 3H7LA 4K3JL 5B8CC 2X4QB 3CFKA 3IRZA 1QRNB 2HMID 1KLUA 3QG7H 3EYUH 1XR8B 4F8TA 1DUZB 4HWBL 3WLBA 3MRIA 1CLYH 5DJCB 3Q3GB 1JCKA 1IGTB 2A83B 4MNQE 5HYEA 3FQWA 2WV3A 4GKSB 2W9EH 3VFVA 3QI9A 2EC8A 4R0LB 4GAYA 3QUZA 4H1LG 5DZLA 1RURL 1Y6MR 3P9MA 5JDSA 2FRGP 2VJXA 3U4EA 2ED9A 4JVUA 1RIUH 2DF3A 4AZ8A 3VG9B 4Y4FA 3OJVC 1P1ZB 4XWOC 3OXRA 1JYWA 1KCKA 4L8DA 1Q94A 1S9XA 3NCJH 1ZANL 3OQ3B 4DN4L 5M95B 5EOTA 1UXSB 1KJ2H 4K8RC 1MRCH 5L6YL 4FMFA 1RZKC 4N0CC 5I73C 5JHDB 3GM8A 3LQZB 2HTLD 3HNSH 5L2KA 1H15B 1CFQB 2D7NA 4JPVL 5HHOB 5DMIL 3D0VA 3LH2L 4YHNB 4E0RB 1JPST 2ATKA 3GMRA 3PGFL 1AXSA 4X99B 4XMLL 3PIQB 4WTZA 1N8ZB 1N0XH 3EOTH 1S9YA 3ZT7A 4G6AD 5H2BB 5HYQB 2V6HA 5EUKB 1OCWL 3NPZB 4MQXC 5H94B 3NVQA 5KJRL 1MAKA 2IGFH 4HPYL 2F8OA 1FFOB 4Y2DA 2CRZA 3CIQA 1E6OH 3HR6A 3GMMB 4KPHL 4RRPA 2P5WA 4H0HB 4H26B 1K2DA 2DL2A 1UKQA 3TCLA 1WZMA 1EO8L 4TVPD 4LLUA 5GJSL 1FIGL 4QRUB 2GI7A 1G6RA 2FX7L 1OB1A 2B2XH 3KHOA 5MEND 1H8NA 4GH7B 4Q58C 1G0YR 1GGYA 2DYPD 3PJSB 5CZXC 3KPRE 3OXSA 2E27H 4GAGH 1H0DB 4NUGL 4TPRL 3O2WH 4LVNC 1FAIH 2ZPKH 1JGEA 1YPZB 1I3UA 5FDYA 4K23L 1ADQH 1NAMH 3F5WB 3MZTA 4QRTB 3MV7B 4OD2B 3FFCA 1NLDL 4B7LA 1BIHA 5ESAB 1O7VA 1ZHKA 4H8WH 1MHCB 5DJ6B 3CSYA 1FNSH 1P7KB 1K4CA 1OAYL 4HMDA 4O58H 4QTIH 4JFEE 3C9NA 1CICA 1DVFD 3UYOD 5HHPA 1MVUA 2CK0H 3QQ9D 4YXKL 3BEVA 4OZIB 1RUML 3F7VB 4TUOB 3PL6B 4X4MA 2FYYB 1I8IA 5DGQA 3REWB 1C5BL 1I8LC 1TITA 5T5NG 5AG8A 2EYTB 1EGJA 4XNXL 1MVFA 3EW3B 3RNQB 3MXVL 3VWKA 4LAQH 4DW2L 4Y16B 3MJ9A 5F9JA 2NTFB 1K4DA 1XGQB 1CD1A 2GQHA 2NW3A 2AK4B 2EC9T 3WO3B 2DJUA 2R1XA 3CVIL 4CNIA 3MFGB 1TJIH 1IAIH 2OSLA 3G6AA 3RVTD 4IHOA 4OB5L 1LE5B 4KRNA 3S37L 3AGVA 1BHGA 1T89A 2VAJA 1Z0MA 43CAA 3MCLL 3ZDXF 3TH3T 5FF6A 3FTGB 5H37H 3DVNB 4X98A 5SX5K 2L0DA 2WINB 1A0QL 1BIIA 2W1NA 1XCQA 3DXAA 3INUL 3GMLB 3OZ9L 1QSEE 9CGTA 4IMKC 3DGGA 1UC6A 2Z35B 4YBLB 4XVUD 3FQXA 3FT3A 1NANI 3FQTB 2Z93A 4P57B 3BP7A 5D2LB 1JGLL 5CJQH 1BREA 2FBJH 4F7TB 4FZEL 4YIQB 4L3EE 4N5UA 1WFTA 2X4RB 4OIAA 5E8EA 5GIRA 3S98A 2ESVE 3P77B 1LK2B 3VXUB 4LIQE 5JMRA 1RJCA 5K9QG 1FO0A 3QZWG 3WUWA 4WW2A 4LSVL 2XZCH 4AENA 3GUTB 1KB5L 4I18A 4X4XA 4JRYB 3RAJL 5IJVA 4R4ND 4DKAA 4MB3A 4NNPH 3MNVA 2HVKB 1OTTC 3WXWL 4HFWA 1OAZH 1UM4H 2AQ2A 1V05A 2H9GA 4P49A 5F21B 1F13A 4ZUTB 3VFMB 5BS0B 3L3DA 2X9XA 1AP2B 5KG9A 1JUFA 1I85A 4MAUH 3ROOA 3S96B 1U8OB 2FJHB 2KPNA 4IS6B 4OCYL 3RVXD 1PZ5A 1R3KB 3D25A 4F7CA 2VDML 4N9GB 3RNKB 5HY9B 4HT1L 4JCLA 4KK8C 1UZ6E 1YEFL 4JM2F 2DQUL 2EDBA 1DE4B 1QSFE 4L4VE 5C08E 5LWYH 1HXMA 3DURB 4PRID 3BRFA 5TH2A 1NCTA 1OP9A 3B2UD 4I0KA 4PP1C 5C0AE 5E00B 1I3VA 4HCRA 5DMYA 4NC1C 5DD6B 3KYMA 2VWEC 5KAQG 5L9DL 3P30L 3RDTC 3GNML 2CMRL 1UENA 1EHLL 5E9DD 1UWGL 4C56E 4KMLB 4PB0L 1M71B 1KXTB 4X7TB 3MRLB 4MA7H 2VLJB 3LQAL 1JGDB 1CT8A 4EXPX 1K3IA 3QDJE 1D5ZA 4XBPB 4LCUB 4U1KA 1D3CA 4G8IB 5B39A 1FYTB 4ZAKC 5I0DA 3T2QA 3JV6B 1U58A 4PYGA 2X1QA 4OLZL 2RGSA 3Q0HA 3JTSB 4R26L 3LAFA 3RPKA 1HEZB 3ZE0F 1HH6A 4NJ9H 1FBIL 3GSUB 3TT3H 1YEDA 5EU6D 4NT6A 2NY7H 1A21A 2YHGA 3LMJL 4G42B 5IESH 3RBGA 3FO2B 2D2OA 2XICA 3RWJA 3QQNA 5HI5C 4NNYA 4FG6D 5DVOA 1MEXH 1F90L 5CP7B 1RZGA 3X3GL 1A6TB 3IFLH 4JO4H 1EEZB 3RIAF 4AH2A 1FL5A 3ULVD 1EV2E 4UILH 4O9HH 3MLZH 5A3IC 4UAOB 4MMZC 3QFDB 2VRAA 1HH9A 2VOTA 2NY3B 3DLQR 2BY2A 3B43A 3BYYA 3D2UB 2F5BH 3KNBB 5JXED 2BSTA 4LCIH 1KJMB 3PP4L 4OCXL 5C0DA 1X3DA 3PWLB 3FRPA 1GGIL 3HZYA 4KROD 35C8L 4GQPH 2JIXD 4N8VB 2IH1B 4GRLC 1G9NC 3NCFB 3BKMH 2XWBA 1VFMA 3G5ZA 4PJ8C 1AQKH 5E8PA 4M6OH 5HHVL 2Y7QA 3NA4A 3SKJH 3L3HA 2DQDH 3FB6A 3OB0K 4JKMA 4XB8A 4X6BB 3B9DA 3RZCD 3QXDA 3CXDL 4AM0A 2EYSA 2BVQB 4KJPC 4QRPB 1MHHA 2NTSP 1FH5L 4M7JH 3QUXD 1BM3L 2EEDA 2CJUH 4NQDB 2EH7L 4Z7OF 5T3ZD 5HTSA 3RGVB 1VGEH 4Y0GA 1PLGL 1INDH 1TCRA 4JB9H 1MQKL 2HMIC 4P5TA 3AXLB 2YEZA 3BDYH 4JAMA 4MXQD 5JIKA 4ZNCD 1MI5B 3GRWA 1YY9C 5FYKH 5KSBA 4PJDA 2B4CL 3IDIA 4HWZA 1A7RL 3VJ6A 3BT2L 1R3IL 3RVVD 3MYJA 3T0EC 3NZ8A 1N5YH 1KEML 5I1EL 3MBED 1XIWA 1UT9A 4P3CH 1V3KA 1GPOH 2IPUK 4OCSH 1JN6B 4WFGD 2ADJB 3AMKA 3UZVB 1G1CA 4S1QH 1XCTB 3GHBH 5C0BB 1U8MB 1RK0A 1B0GB 1ZVSA 1JTTA 3PWVA 5B4MC 5CEXB 2FX8H 1ZLVH 4L9LC 4MJIA 1Q9OB 1ZVHA 2HTLC 1ZAGA 4MHHG 4JREC 3VRLE 4C83B 4ZUWB 4L29A 2A6KA 4F57L 2Q86B 2Q7YA 5C8JB 4LSSH 12E8H 5T1DH 1HE7A 4NO2A 4KC3B 2YPLB 3ARUA 1JTOA 2R15A 4RA3A 1CXEA 2OMBA 1PKOA 4KKLD 3EAKA 2YUWA 3B9KD 5J12C 1G6RL 1HILA 5TDNB 3HA0A 4AY0A 4BFBD 1SJEA 3MO1B 5D96B 5ID0B 5E2WH 1U2CA 4IRSD 5EU7E 2YC1B 1H5BC 4YK4B 3VWJD 3D0LB 5EA0L 2IQAB 2AJSH 5T1KA 3HS0A 1MWAA 4GAFB 1S7XB 1JGVL 3MXWH 1E4WL 3GJFH 5BXFA 1PYWA 2BVOA 3VFPA 3I75A 1NUFA 2OTWA 3G08A 1VEMA 5DK2B 4L4JA 3H9SA 1A6VL 4R9HA 1UXWB 5GGRA 4KKCC 2YPKB 1YQVL 2AAVA 2PYED 1G1YA 1WBXB 1HSBB 3NACL 5I1HL 3PWJB 4EZMA 5K9QI 1DQTA 3I2CH 5F93C 4PGEA 3STLB 1KB9K 1T0NA 3T4AB 3IU4H 1NL0H 2GW5A 3DO7A 4IOIB 3NIFF 3BKJH 1CE1L 4WW2F 5BO1L 4QRRA 5ACLA 4AG4H 2W65B 2ZCLH 5FB8A 3U1SL 5C0CA 4ZFFA 2V5MA 5BMFL 5J13C 3H3KA 4JFEB 3BE1L 4PGBA 1EGJL 4EUPA 5CBEA 1FZJB 4PRBA 1FJ1B 3MJ9L 5I8CB 2AJVL 2ZUQC 2VKXA 1CGTA 2FO4A 3UPRA 2OMNA 5HHNA 2CKBH 4I0PD 4U1JA 1UWEH 3QNYA 1WZLA 2WZPD 3DHMA 1K6QH 2QSCH 4CW1A 4PGJA 3L5JA 3U9UB 2VSDA 4MMXC 5CKAA 3IDNB 5DD5L 5CLWA 4XCFH 2J2ZA 3O11B 4ZTOH 3T3MF 1JHLH 1Z9SA 4AT6A 2R0LH 3P4LA 2HKHH 3RY5A 3NABL 1T5WA 4POYA 1PY4A 5EZJB 1YEKL 3S4SG 3SDDD 4MQ7A 4XAWH 3HZVA 3P0YH 3LVEA 1EEYA 1Y6NR 3MGTB 1T21A 2R29H 4GUPB 3HI6L 3MUJA 2O5XH 3NOIA 1KELL 4GG6B 3UMTA 1BBJA 2XI9A 3D69B 3RI5F 3NPSC 5D1QB 5IUSA 1JYNA 4M6NH 4Y19D 5TE4L 4UOJA 1A47A 3GIZH 4JQVC 1E4KC 2FJFB 5DI8B 4NO5A 4MD0A 2G9HA 5CEZD 3SKNB 3MJ7B 5DJ8A 3O4LD 2OL3A 3TJEL 4K94C 1I7UB 3O6MH 3KXFB 2ESVB 4OM1H 43C9B 4KZDH 4E41A 3WFEH 1HINH 2ICWI 5BZWA 1T7VA 3R06A 1BJ1J 3SCMA 4PJ7E 5HHME 3T77B 4M3KB 3D18A 2BNRD 2GHWB 3VGGA 5D7LD 1T20B 3QPXL 3VFSB 3UTTA 5DMKB 3T1WA 3BXNA 3TBSA 5ID1A 1MJ7H 2Q8AL 1JWUA 2CD0A 4CGTA 2AV7B 1DFBH 5JXAH 4GMSL 1TENA 5I16B 5FM8A 4P2OD 5DEZA 5IMKB 3P4MB 3WBDA 2PCPA 4LFHD 5BVPH 4ZO8A 4UIKL 4DVRL 4WFED 4WEBL 5MEPA 3EYQD 4KGLA 4HCRL 4NN5C 3G5XB 3MOBH 2C4FU 3L7EB 4NO3B 1D5IL 4JQXA 4MA1C 1TQCB 5FGSA 4F9PC 5IHZB 4G6FB 1N59B 5F6HJ 4CVUA 3EFDL 4NKIH 1HKLL 4I5BA 2AXGB 3ARZA 4U1GB 4AEIL 1P84J 3VXRA 4DGIH 5DVLA 1FE8L 3X3FL 4NQCD 3U4BH 2O5YL 1VHPA 3T3PE 4DN3L 4WO4B 1IJ9A 3HRZB 3SE8H 3LD8C 4LSPL 2BZDA 1PX3A 1PG7X 1P4LB 2F54D 2DQJH 1FVDA 3MLRH 4CN6A 3ECBB 1F8TH 4UTAL 1A02N 3QQ3B 5C1MB 5D70H 4AMKH 4RGND 1AQDA 3G6DL 5E6IA 4LF3A 4J8RB 3BP4A 3GIVB 2VXSL 2DLFH 2EDKA 1KCLA 3DBXB 4IRZH 3VXOA 3MPCA 1IC5H 1KGCD 4G8GE 1BLNA 2YS4A 5E70A 1CFVH 4PJDF 5KVMC 3TNNA 4PJAE 3V4UH 4EN3C 2E7BA 2QHRH 1VGKB 4WUUD 1OTSC 2BVPA 4TSBH 5E4EB 3SY0A 4EOWL 2ITCA 4M6AA 4RMRA 1U9KA 1B4JH 1UYWH 3H7BB 3OF6D 1UJ3C 1IARB 3T2OA 5MEQB 4OI7A 1YEGL 4OJFH 2DQEH 1L7TH 3P4NA 4M7ZC 1RZKH 1N26A 2XTJB 2UVEA 1Q0XH 4LCCB 1XF5B 3C5ZD 3MYZA 4MHHI 1AC0A 3WIIH 4KROC 5FECA 1I8KA 3OKLB 3G6JE 4QHMB 5DHVA 3V8CA 2C7UB 4LKXA 1KT2B 5C0EA 3O6FD 3SBWC 4KDVA 1QO3B 4WHTA 2CIIA 2MQCA 1BZ7B 1GZQA 3O3EB 2OCFD 5CILH 4YZFF 3W81A 1J1PL 4WI2A 5T3XH 2NXYD 3RZCC 5DJ0B 5J6GA 1ZGLA 3D39B 3TBVB 1XZ0A 3OTTA 2FWOA 5J9PB 3IF1A 3QUXC 2FSEA 1EERB 1WZ1L 3GRWL 1S9WB 4OCWL 4QF1A 4JCMA 3V0WL 1AY1H 1EAPA 1ULVA 4JDZB 4Y4KA 1QSVA 1YMHA 4R3SB 3TZVB 2XN9D 2D7QA 2GTZB 1SYSB 1RJLA 5ISZE 1ZGLM 5IW3A 4PJIE 4DGVL 2BNQA 3FB5B 5GRZA 4DGYL 2HKFH 4ZMAT 2V9QA 1VFAB 4MDJB 4RGMB 1BZ9A 5LCVL 2X4OA 4NN7C 1D5XB 3RFZC 1J86A 2C3VB 3FB7A 5D7KD 4JJ5B 3TBTB 4NRZA 1IC4L 1UA6L 2YK1H 4OF5A 5IG7A 2EO9A 3WHXB 3N1GC 2CDGB 1JYVA 1EZVY 3RPIB 1CLOL 5CD3A 5CMAB 3CDFA 5MENA 1OAKL 2PKDA 5J1AA 5FYLL 1DEDA 2DYPA 5I9QC 3ALPA 3QCUL 2H1PH 5HYJD 4XBGA 1JPTL 1M6OB 3QIUC 1JI2A 1SHMA 3UC0L 2HT3D 3PXHA 4JFHE 2Q87A 2WUBL 1KULA 5D7JB 4BM7A 2W9DL 3QPQD 1NSNH 4HBQA 3U0TA 4ODUB 4ZOEA 3ARBB 1NFKA 1MHEA 2B5IB 1Y0LA 5MEOB 4NZRL 3SGEI 4YDKL 4P59H 5TFSL 1RV6X 1FFPA 3VFRA 2AQ3A 4YQXL 2AW2A 4ZNEE 1DVFA 1BX2A 4KY1H 5GRUH 3PGCA 1MWAL 4P2RB 3U7WH 2IANE 2R56L 1IRAY 3U46B 1YYLL 3DV4A 4BZ1H 4OV5A 1IEBA 4PY8I 4UOW0 5KSVB 3G5VA 5DJAB 3KLAB 3TBYB 4LK4A 2D9CA 4LGRB 4BZYA 3QXAA 1JBJA 1YYMH 1P7QD 5EC1A 4NRYA 2IG2H 3OHXB 1KB5B 2FZ3A 3KHQA 3RX5A 4XWGH 5BZDB 1IKNA 3OKYA 1J0YA 1AXTL 1JWSA 1S7RB 3O6LH 2OXHA 3HCVA 4L8SA 3HPJB 4OGXH 3L3KA 5F9WB 1XF3A 3BH9A 1IT9L 4OCMC 1RVFL 4WI3A 4ISVA 3ET9F 4GO6B 2ATPB 5DT1H 1SEBA 2QQNL 2SEBB 3OKKA 5F9DC 1J18A 2EYRA 4WWKD 2A9NL 3RU8L 5HVHB 5FYKU 5J4MA 3RBSA 2AI0L 1CDIA 5GRVK 2VDPH 3KPOA 3O6KH 1MCFA 5KW9L 4B7IA 1FGNL 4Z0XB 1X5AA 5E1AB 3MV9D 3U83A 2AJXL 3L3IA 2HVJB 3ZHDA 3V6ZB 3TGXA 2BOCA 3O3BA 1W2KT 3QQ4B 1MLCB 4MJ6A 1TFHA 2WIIB 3UP1A 3BD4A 4QXUH 2PTTB 1N5AB 3PQYD 1F4WH 1TVBA 1TJGL 2DTMH 2N1KA 4ELMA 4LLYB 1JPSH 3TWCH 1ZEAL 4OIBA 3C08H 4QHKJ 3J8F7 2DQCH 3OV6A 4WUKL 4YE4L 3D9AH 3D3VB 5AWNL 1U8PB 2DQHL 1X5YA 2FIKB 1YN7A 3BIKB 4APQD 1MRFL 2QQLH 1KIQB 4GRWH 2O26U 1U8IB 5C07D 2WNGA 1DSFL 1FNGB 2VUOA 4LVOB 5D6DC 4U7SA 2V17H 2E9JA 2ADGA 5JW3H 3CFDB 5FYJU 2OL3L 1FLTX 4I4WA 3MSPA 4JO2H 4F9PA 4GS7C 1BAFL 1H3PL 1YECL 2NXZD 1AR2A 4G3YH 1SM3L 4Y7MA 4GFTB 2YZ8A 3RY6C 3HI5H 4PRIA 1TJHH 4FFVD 4ZDHB 4O2FA 4YDJB 4HW6A 5E2JA 3WHE1 4YFLI 3HLAA 2NX5D 1OQXA 3MREA 4LLWA 5E9DA 2EE3A 1U8NA 2G60L 3QDMB 4DKFH 4PJ7B 5EBWB 5LXGL 3IKCB 1N3NA 4KK5D 2AS5M 5F1NB 2X4SA 4YDIL 2B0SL 5J3HD 1CG9B 2NY0D 3T2NH 1A6WL 4MS8C 3TBWB 3MCKB 3WIHA 2Y5TA 3EOAA 1AGEB 5D9SA 5DO2D 1RZFH 5EU6A 3BP5A 1NFIA 3KLSA 5D1ZB 5ANME 4E9LA 2ZCHL 2M26A 2XQYK 3VI3F 1I3GH 5F1SA 4AEFA 2B8OT 3K74B 1F42A 1WLHA 1QBLH 1KLUB 2KKQA 1UJ3A 4FFZH 4IRJD 4XZUA 4P5MA 1F11B 1N4XH 2AJUH 3NFSL 3KYOA 1RULH 5FA4B 3EZJB 5FO8A 1IE5A 4XXCA 1Q9WA 1XF1A 4TNWF 4LHQB 2APBA 4JANB 3MJ8A 4YDLB 5JXEA 2IALB 3NZHL 4HLZH 4KQ4H 3QUZB 4OFVA 2E7LA 3P9MB 4JO1H 4PV9A 1CFSA 2R9HD 5EU4A 2JIXA 1T6WA 4Y4FB 2VH5H 1RPQA 3OXRB 5CUSL 4RGNC 3JWOC 1Q94B 1S9XB 3KLDA 4DJMA 5ACZA 4UINL 5DC4B 2EICA 4TOYH 3WFHA 2R0KH 5MHSD 3OR6B 3RZCA 1ZS8A 3V5DB 4BUGA 5EU5B 2N7AA 4KMTL 4S1DD 2X4NA 4PJAB 3D0VB 2QV2A 3GMRB 4NDMB 4HWBH 1RSFA 4ZS7L 4M7LL 1HQ4B 4ZPTA 5E03A 1J8HD 1JHKL 3M17A 3CXHJ 1S9KC 1KPRB 4HK0A 3LEXB 2O61A 4RWYH 3BN3B 3DJ9A 2C1OA 2FHFA 4Q6IC 1ETZB 1UCBL 1K2DB 4M5ZL 5HGHA 3TCLB 5F7NC 2D7PA 4LLUB 5HDBE 3AU1A 1G6RB 4XNYL 1OB1B 1ZANH 4L5FL 4PUBL 4DN4H 5IT2L 1CI5A 2QEJA 1BD2B 3W39B 1U8JB 5FUOL 5CSBA 3O6FC 5L6YH 3MBEA 3OXSB 2YD5A 4MXWH 1DBKL 2DN7A 3KPPA 3LS4L 4V1DE 5LGHL 3KPNA 2WUCL 4WV1B 1S3KH 3C6SA 4JPVH 1F4XH 2YWYA 3MGOB 2AXHA 3ZYJA 5DMIH 4B50A 1JNNL 1RUAL 1FL6A 4XVSH 1QD0A 2H2SC 3P9WB 4YWGH 1J05A 3FFCB 4U3XA 4XMLH 1VFUA 4ZTPL 1NGWB 4Q2ZA 2V5SA 5DEFB 1AD9B 3JVGA 3PABA 5DRWA 5HGGS 3UO1L 3H3BC 1E4XH 1A4JA 3U2SA 4XPBL 3CSYB 5J11B 1AO7D 2BDNL 3V2AR 2OR8A 3E6HA 4BQBA 2PR4L 4G9FD 5C7XL 1CICB 4HPYH 2ZOKA 3P0GB 4HV8A 4OT1L 4WNQA 3WD5L 5HHPB 3L3GA 5ISZB 1KTRL 1G7HB 1NGQL 1MVUB 1TTGA 5CD5D 3BEVB 4NC0B 1S8DA 2IMNA 4TVPL 3CX2A 3B9KA 4FQPA 1G7LA 2GJ6E 2JJTA 3FMGL 3HE6C 3LKQA 5GJSH 1FIGH 2DDQL 4UU9A 5FK9A 2FX7H 3RGHA 3L95A 1W72H 4IRSA 4POZD 3QWRD 1CGSH 2HTKC 3VWJA 5BW7C 5F9JB 2QADC 4NUGH 1K4DB 1P4IL 2NY2B 2A77H 2NW3B 3S35X 3O0RL 3BIBX 2R1XB 5FM5O 1DTUA 1XMWA 2OSLB 4K23H 3G6AB 1BBDL 3HZKA 4MD5A 1JK8A 4QYOA 3LKOA 3LEYL 4NKMA 1F97A 1RHFA 1NAKH 43CAB 5FF6B 2BOBA 4Z7NF 1IGCH 4X98B 4EVNA 3RKPA 2HT3C 2VDKH 5KVFL 5GZOC 5JW4Q 4Y16D 2PYEA 3F12A 3KPSB 3DGGB 4TRPH 1J5OL 2AK4D 5LBSH 3I6GA 2KQNA 1A7PL 4AL8L 1MJJA 2RHEA 2VL4A 2Z93B 4N0UA 2VABB 3BP7B 5GISL 3GM0A 4ELMF 1JZ4A 4PR5A 3V4PL 2BXYA 5HDLA 2X4TA 3AAZB 5GSVA 2VWEE 4GRWE 4XP4H 2EKSA 1AJ7L 4NWTL 4N5EC 2UWEE 4OLYL 1C5BH 3ZDZE 4NKDA 2IANB 3JUYA 5ABDE 4XNXH 4NIKB 3MXVH 1M7IA 1EFQA 4DW2H 4RQQA 3WUWB 4I18B 1TVHA 4FQXC 3F58H 4F15B 4I0PA 3MNVB 3SDAD 1EO7A 3L7FB 3BWAA 5DSCA 1D7FA 3SJVD 5JR1L 4WIQA 3IFNL 5I71B 1IQDA 4MD4A 3VXUD 4PS4L 1J88A 5TE6H 1EXUA 4U6YA 1A0QH 2XA8L 3DUUB 1LEKB 1HXYB 3DECA 4HF5H 8FABA 2HT2D 3INUH 3BPOC 3SDDA 3D25B 3TN0D 1XGTB 1G84A 5KN5A 3WE6A 1N64H 5JHLL 3QDGB 4K9EC 1WWAX 4R6UA 2ZJSH 4WGVB 3LKSA 4G5ZL 2JCCF 4Y19A 1HXMB 4J1UB 3HUJE 5CP3A 5CGMA 5TH2B 1CGUA 3FT4B 3GKWL 3RTQC 3C8KA 4P2YA 5EH1A 3UAJC 4FQQB 2PW1A 1WAAE 2P5ED 3D1MC 3O4LA 4GG8A 1MHPL 2Y25A 3EJJX 3RAJH 1Y18A 5E6ZA 5FV1L 4Z7QF 3IU3B 3R8QA 1JPFB 1CT8B 5I8EB 2QTEA 1D5ZB 1I1YA 2VDQL 5B39B 2BNRA 2VXUL 4MXVF 5D2NE 5D7LA 2Z92B 4IMLA 4P9HH 3ARSA 1QNZL 1X4YA 3EFFB 4OCYH 3OGCA 2IH3A 1DLHA 4M6ML 4MDIA 1HH6B 2VDMH 3ULVF 2BK8A 4MCYA 2HLFD 1YEDB 1MFAL 5DMGD 5EO0A 2PF6A 2VLJD 3MRFA 5SWZB 1WFUA 3RWIA 4P2OA 1FLRH 3RWJB 5IQ7H 4RFNB 3BZEB 5BJTA 5B8CB 1ZVYA 5F89A 1F3RB 1KCUL 4NQEB 2HAZA 1BPVA 2XY1A 2X5PA 4LVEA 5I1JL 3AROA 4AH2B 3QCVL 2IF7A 4JZJC 5CEYB 2ADFL 4OLUL 4ONFH 1OW0C 1FG9C 1ORSA 3MLVH 1JPGA 2GAZB 4PTUA 3P30H 2NXZC 3UTPE 1NCCH 1HH9B 1EHLH 3IDGB 3S97C 4IOFC 1KOAA 4XGZA 5AZEH 4J4PC 4NQCA 4FXLA 3LQAH 4X9FA 4KJWD 4YAQA 4PJCA 5C0DB 3U82B 3VFWA 3HZYB 1NC2B 3QH3A 1J0IA 4OQTA 2F54A 5IMLA 1U8QB 1UB6A 4JY5L 5D7SL 2XWBB 2JJSC 3WIHL 4R26H 2YBRB 4R96B 5JW4N 2VQTA 3UJTL 2NY3D 2Y7QB 1IQWH 1QQDA 3L3HB 2D03L 4QOKE 3RA7L 4RAUA 2R1YA 4OD1L 1PGRB 4AM0B 2EYSB 1MHHB 2VC2L 5KVEH 1F90H 1CTOA 2D4DA 3ULVL 2GFBA 2QR0A 2JKXA 4UT6L 5GQBA 1MFBH 3MNZB 4WUUA 4WI6A 2X1XR 3SN6N 3SGKA 1TCRB 5FGRA 4P5TB 2DI9A 4PYHA 2YEZB 4JAMB 2FEEI 3KYKH 4CVZA 1X6LA 4Y4HC 5CINH 2H32A 3NFNB 3OF6A 1A1MB 3HRPA 4WY7H 1N6QL 3E2HB 4OCXH 4J23A 1OARH 1UH3A 2DQIH 3IDIB 3CPLB 1HHJA 3HAEH 1MCWW 2DM4A 4NQDD 4YDVB 3DNKA 4PJ5E 4N8VG 1GC1C 1WIPA 1OVZA 3GHEH 1DDHA 3ARDD 3O3AA 4OSUH 3C5ZA 1IM3A 5F1IB 4LHUB 3IAGC 3VXSB 4XP5L 4Y88A 1FCCA 3O6FA 2OTUB 4FZ8L 3MMEA 3DGCR 1T66D 5TE7L 1MFCL 4LVNB 4KK6D 3FAXA 1MCWM 3FO1A 2DWDA 3QUKA 5T3ZL 3K0WA 4KHTH 1XF4A 4OKVB 1OP3H 2EH7H 1G6VK 5DS8A 5IKCB 4MJIB 4WU7B 5J6HA 1HHKA 4ZXBD 3SE3C 2D7OA 2J8UF 1MQKH 1I9RL 4PRHE 4S1DC 3H42L 2VNCA 1Q72L 4R8WL 2R1WA 3WO4C 2XY2A 1MPAL 4NKQB 4G6KL 1NFDE 3P3YA 4NO2B 2B4CH 5DQJA 5K59F 5MERA 1IGJB 2VIRA 4A6YH 4JHWL 4MZ2A 1LK3L 1QYGH 4JRWA 4CRPA 1HILB 4U7KA 2IQ9L 4NBYB 3PF2A 3ZTJH 3WDJA 2Y36L 5LKNA 3LZFL 4KQ3H 3ARQA 2MNUA 5K9OA 4Z7UE 5JIIA 2F53B 5FOBA 5F7MC 1F4HA 3EKCA 1I9JL 5BXFB 1PYWB 2BVOB 1MCRA 2X4PA 1NPUA 3B4NA 4PREA 3H9SB 3MLYL 3HC4H 1JMZA 1V5JA 4O2CA 1RJZA 1UVQA 2VAAA 2XKNB 1LDPL 3QEGL 4F57H 3ULUC 3CH1A 1NMCB 4HWEL 3HR5A 4PGEB 1VESA 4JO3L 2QLVB 2QQQA 5L0QC 3DO7B 1A6UH 3KPRD 4GXVH 4HGWA 4QRRB 3QEUB 3GSNA 3ARFC 4CU8A 1QFWL 3FB8A 4P3DA 2MTPA 4GAJL 1KXQE 1RIVL 2WK2A 4PGBB 4MNGE 3TVMC 4EUPB 5CBEB 1C12A 4HJGB 4HMCA 1OHQA 3N1PC 4PRBB 2J5LC 1VPOH 4PLKD 3M8OL 2DQTH 3IDXL 3LSOA 2GJ6B 2FO4B 4WHCA 3X14B 3QNYB 1E4WH 4DZ8A 1CDYA 4U1LA 1T83C 4GXUM 1GL4B 4JN2B 5IVZA 2BFVL 1MCBA 4QTHA 3VFUA 1HWGB 4JFED 3MRHA 3S36L 2ZG3A 3MLXH 4AT6B 3W9DB 1P7QA 1J87A 3I6LE 1AGCA 3GSWB 3HZMB 3V6OA 5I1HH 4MQ7B 1YNKL 4ZFGL 3HZVB 3OB8A 4YC2C 1EEYB 2B39A 1IAKB 1T21B 1CE6B 1N2RB 3PWPB 5BO1H 5ADOL 3D85B 3T0DA 2ZCKH 3VG0L 3VCLA 2J3SA 3U1SH 2XPGA 1ZLSL 5BMFH 4UTBH 1VDGA 2VQ1A 2W60A 4AIOA 4XH2A 4PIRF 3VI4E 2CLZA 5E08L 4GW5A 4WWKA 4MD0B 2G9HB 5BV7C 2AJVH 5DJ8B 4D8PA 3A6OA 2OL3B 3O8XC 5C6WH 3RDTB 3MV9A 3S5LB 5F96L 2QJDA 5BZWB 1T7ZA 1RUKL 4G7YL 5DTFB 3SCMB 4WJ5A 3D18B 2FJGA 3PQYA 5DD5H 3T0VA 3DETD 4R2GC 5AAMA 4FQLL 4ZAKB 5INDA 1OGAE 2F15A 1OLZA 5E8DL 3NABH 3KYAA 4Y5XA 3TBSB 2IPKB 5ID1B 2ESVD 3GMQB 3TH2T 1JWUB 3V5HB 5CGYD 2PYFB 4NCC2 1KELH 4OFIA 1R3HB 4APQA 2PCPB 3OJ2C 4N0RA 4JN1L 2PUQT 2YRPA 2AXFA 4UUJA 5C07A 4PG9A 5TE4H 4HC1A 4ZYKA 4M9OA 5FCUL 3IGAA 1FVEA 4RMUA 5CEZL 5HD8D 4G6ML 1SMOA 5GGSY 1P9MA 1FO0H 4CVWA 5BRZE 1CYGA 3DYPA 4PJFA 1GHFH 4P4KD 3QIBC 3VXRB 2Q76A 3BHBA 2XQBL 3B6SA 3ZTNH 4YNYA 1BGXH 5TQ2L 4EDWL 4TUJA 2NX5A 1FVDB 4GRLB 3QPXH 4X7CC 1G0XA 4NQXA 2RFXB 5C08D 4PJ8B 2JJSA 4Z9KB 4UI2A 1EAJA 5IVOA 4FP8L 5C0AD 4NHUA 4RAVA 5C3LD 3BP4B 3DRQA 1D6EA 4AQOA 2WW8A 1ZLVK 4GMSH 5LAXA 3VXOB 5I1GL 4LLAA 4PJGE 3HB3C 4C56D 3ZSTA 5IIEA 2VXVH 1CL7I 1KTLA 4W4NA 3BRGC 4ZQKA 4ODTL 2HLFC 1R3LA 4LBEA 3BN9D 4LGPB 4HIXL 3TNNB 3QDJD 5FUZL 1D5IH 4M00A 4M4RA 2BVPB 2DL9A 1I3RA 1G9MC 3JTTB 3K4AA 1AHWC 2BSRA 4AEIH 3SGDI 1FE8H 5HHQB 3UYPA 1DCLA 5JOPD 5GSRB 1ZOXA 1ZT1B 3JWOH 1FL3A 2R2CA 4RWHA 4IRJA 3MOAL 4JFQB 4OQTL 5BVJA 4LSPH 4BQ6A 3P4NB 1B6DA 4JLRA 5D5ME 3CMOL 4U6VL 3EJYC 1KN2H 3SPVA 3D6GA 4UDTA 4KJWC 1PJ9A 3GJFK 3LOWA 4TUKL 2Y9RT 1II4E 1QRNA 4KAQL 5DHVB 3T0EB 5IM7A 2BJMH 4FTVE 2BX5A 5C0EB 2EIZA 1DUZA 4WHTB 3BEWA 3Q3GA 1IGTA 2A83A 1OL0A 4BJLA 2MQ3A 2XTJD 2VQUA 3HC3L 1P84K 5CZKA 1L7IH 4EEEA 5J6GB 2E3VA 1DBAH 4U1IB 1AE6H 4OLXL 4R0LA 4L9LB 2FWOB 1IAMA 2K9UA 2LTQB 4XPAL 1HZHL 1QLRA 3WFZA 1BVKB 5A2KH 1P1ZA 1EAPB 2Z9TA 4K7FB 3N85H 4F58L 1YEGH 1YMHB 3RY4A 4KXZH 5ETUB 1J8HA 2E9WA 2AERT 1GAFL 1RJLB 5MI0C 3CFJA 1I1AC 1I7RA 5HVGB 1Q1JH 1OF2B 1H15A 4S0TD 4L4TE 4YO0A 4OLVH 1BZ9B 1ZKAA 4LRNL 1H5BB 1RZJL 4YHNA 4E0RA 4L8BB 1BOGB 4X99A 3DIFA 4LSTL 1N8ZA 1U95A 4NRZB 4C4KO 4OGYL 2DTSA 1LO0L 1NBQA 2NR6D 4TULL 5CD3B 4C55A 5J1AB 1V7NL 4H25B 1I7TA 2DYPB 1UACL 5DVNA 4M8QA 4MAYC 5GGVH 2HFGL 3L5WB 5FAAA 4D0BA 6FABL 4KK6C 4PJEE 3RVWD 3FT2A 3S7GA 3GRWH 4HPOL 1J1OH 2ZG2A 3V0WH 1QLEL 1CDJA 5CHNA 5IMMA 1YJDH 1NEZA 2R2HB 4YXLH 1RUPH 2X6MA 4X6DE 1MHEB 3PJSA 4KTEL 1Y0LB 5IVXA 3QB7C 5M94B 4OI8A 4NZDA 5J13B 5GHWL 1FFPB 3VFRB 4MWFA 4N68A 3G5YB 2H2PD 4G9FA 1DVFB 1BX2B 2W0FA 3PGCB 4QRTA 3ES6A 3UXFA 3MV7A 1A7OL 3TO4C 4HQQH 3I02B 4KUZL 1EMTH 3S88H 4OV5B 4X83A 5ESAA 1IEBB 3ZT5A 4OIIL 2DMKA 1CLOH 4K2UL 1OAKH 32C2A 1MHCA 1NDMA 3B5TA 3QWRA 2HYMA 1AR1D 3QXAB 3QCUH 5DJ2B 4NRYB 3BWUC 4OZHA 1OAQL 2FZ3B 4P2RD 1Y6KR 5EO1A 1QUNA 4PV8A 3WJJC 5E7BA 2WUBH 3F7VA 4PJHF 4TUOA 3HCVB 2FYYA 2W9DH 4QRQB 2MCPL 1IC7L 1O7SA 3GSNL 1XF3B 3W5MA 5F7WC 4ISVB 4MVBC 3ZDYE 1PKQB 1SEBB 3GSQA 3NPSB 4Y16A 1PW3A 2ENYA 2IADA 4JHAH 5EIIA 4HUKB 1XGQA 3OKKB 4HAGA 3MNWA 2EYRB 5TFSH 2AK4A 3GZKA 4NCDA 3OJDA 1MWAH 3BGAA 1LE5A 5HDOA 3WLWD 1RY7B 2Q8BH 1D6VH 1CFTB 5SV4A 1YYLH 3V7AG 3U7AA 3L3IB 3WXVH 4TTGA 2BOCB 3O3BB 3CU7A 3SQOL 3DUHA 1T2QH 4EI5D 4LLQA 3EDJA 3OKNA 2VXTH 3GMLA 1CLZL 4X5LA 5F1OB 4QWWD 1ODAA 4K9EH 3O9WC 5IK3B 1TVBB 1DBBL 4P57A 1WCQA 1JP5A 5T5FL 4FQCL 3V0VB 4HX1B 3SDAA 4F7TA 2L4OA 1MIEL 4YIQA 3GO1L 4PJFF 4Y1AB 1BQHG 2X4RA 2E7CA 3SJVA 4UT7L 1YN7B 4KHXH 1LK2A 1UGNA 3VXUA 1IT9H 4KJQD 4PJ9D 4PRDA 4KMQA 3MUGB 4M62L 3TN0A 3EO1A 5D8JH 2YUVA 1P7HL 2A9NH 1B0RA 4NN5B 4M48L 4CN1A 1K85A 1TLKA 3U6RB 4GT7A 1ZHBB 4MA1B 4XNQA 1KTDA 1VERA 4KDTC 3D3VD 4JDVA 1S7WB 4ZUTA 3TFKC 3VFMA 1D5MB 1G9EA 3OL2A 1CBVL 2EXYC 2AJXH 1AP2A 2NY5C 1KPUA 3CUPA 3QRFM 3S96A 1B9ZA 2V5RA 4O2FB 4LPXA 3HLAB 4U33A 1NCBL 3CFEB 3VGAB 2P5EA 3QG6A 5HY9A 4PJBE 2I24N 3MREB 2GEEA 4W81A 4LLWB 5E9DB 5C0GB 1U8NB 1A9EB 1W8NA 3HMXH 2JCCB 2OR9L 4TN9A 5C9JA 4Z76A 1FVCB 2NYYD 1KCRH 1J11A 1L0YA 4ODHH 4YE4H 3ZE1E 3DETC 2XRAL 3OX8A 2Z8RA 4DUVA 1OGAB 2DQHH 3DURA 1IILE 1N6VA 5JW5A 3JV4A 3I50L 5L88H 1MRFH 3AM8A 5E00A 1NANH 4MZ3A 2O5ZL 3BGMA 4HC1L 2R8SL 4I0CC 2Q20A 4ONGL 4HKZA 3EOAB 5D9SB 3QDMD 3VA6A 5HHMD 2Y23A 1NFIB 4X7TA 2VLJA 3MTRA 4EN3B 1JGDA 1I9IL 1U93A 4PJXB 4Z18A 3NBNA 5DURD 4XBPA 5I30L 5B22A 2W9LA 2C4FT 4I3SL 5HI4D 3BZFB 3JV6A 3NH7L 3QIWC 2EIBA 1LNUA 2DM2A 1UJ3B 3NTCL 5GZND 1QA9B 4P5MB 3QUYD 1CZ8L 2R4SL 3KYOB 3KPTA 1HEZA 1BEYH 5J89A 5SWQA 5FO8B 3LDBB 2P42B 4WFFE 1ACYL 1WQVT 5FM4A 2G60H 3MJ8B 4OCNC 4U6XA 7FABL 3KLHD 3VDCA 3DV6A 4LASL 1JJUA 2ZUTA 2BRRH 4EDXB 4KROB 5HVFB 5EU4B 4XMKL 1A6TA 1CF8L 4ZSOB 4JPWH 1FV1B 4IIQC 1EZVX 4LSQL 2F58L 3QFDA 4XVTL 1FDLH 1T22A 3CFCL 1KCSH 3D2UA 3KNBA 3RWFB 1FNAA 3RZCB 5F7YC 3IETB 1KJMA 3RRQA 3A67L 3SDXF 4UZGA 4DKEL 3EJZC 1OSPL 2X4NB 3AS2A 2IH1A 3QUXB 5KANI 5FXCH 1GC1H 1MCHA 1YNLH 4OFDA 3SDCC 1RI8A 3FZUC 5E8OB 4LU5H 1CU4H 2DMCA 8CGTA 4ZPTB 4DVBB 3M17B 1YC8A 4M5YL 4G8GD 2MSPA 4HK0B 5DR5L 2O61B 4OF3A 3AREC 3F7RA 3H9ZA 4HJ0C 4MX7B 3NA9H 4LL9A 2F8XC 1M4KA 5KSBE 2CUMA 1MREL 4CVXB 3BSZL 4NN7B 4NQDA 5DJXA 1VCAA 5CUSH 1MAJA 3AU1B 3I9GH 3ARDA 4BZ2L 4H1LH 1TZIA 2CGRH 1P4BL 5F6IC 1FNLA 3MBEB 3MRDB 5JA9A 3ZTJG 4PLJD 5I9QB 2QQKL 5JNYA 5IVXF 3QIUB 3C6SB 3BQUD 4KMTH 3SE4A 3IVKA 1KIUA 2NY4D 3QO0A 1QBMH 4X4ZA 5AUMA 1J05B 3WFDL 1KB9J 1U8LA 1WV7T 5DJYA 2YOCA 1JTPA 1QR4A 4ZXBA 4WTZG 1JHKH 1BD2D 4X6FA 1UM6L 1A4JB 1YMME 3P11L 1RK1B 1NEUA 4IBLT 4RFOH 4QRSA 1WGOA 1JN6A 2DJ4A 1EK3A 2ADJA 1XT5A 4NC2B 1X5FA 1XCTA 4YZFE 4HV8B 4WNQB 1E28B 1B0GA 4OCRH 4V2CB 2ZG1A 2J1KA 4N0YL 5CZVL 3KDMA 2XZQH 4OZHF 2OI9C 4LVHC 2J8UB 4Y5VA 3B9KB 3OG4B 1G7LB 4RRPG 3LKQB 5EBGA 4NJAL 4ZODA 4UU9B 5FK9B 2E8ZA 3HPLB 3L95B 3UPCA 4HJJH 3SO3C 4PLNC 5DQ9A 1YC7A 1W0VA 5I2IA 4ZFZA 2IAMD 1DBKH 3UJIL 3K81A 5C8JA 1VB9A 5LGHH 5ISZD 5T5NF 4S11A 5I8KL 2YPLA 3IDMA 1JK8B 5FGBA 4QYOB 1MCLA 3LKOB 4WCYH 4OZGE 1C8PA 5TDNA 1FG2A 3V6FA 2H3NB 4PJEB 2BOBB 1A3LH 5I19L 5E8NB 2GUOA 3AVEA 3UO1H 3WN5C 3ALWA 2YC1A 3RVWC 3TA3D 2B1AL 3D0LA 4WFHE 2PYEB 1AI1L 2NY2D 3F12B 4J2XA 4H8WC 5EC2B 1QFPA 1WEJH 4D9RE 1S7XA 3CZFB 1MJJB 4N0UB 5HHXL 1X5JA 3BAEH 3KPRA 3ZSSA 3U30C 3VMOA 1A6PA 5E99H 4TVPH 3B83A 3FN0L 2X4TB 5SWSE 3GGWB 5C0CE 4JFHD 4NKDB 4E42A 5I1IH 3KPSD 1SYVA 3CK0H 5F72S 4FNLH 2AABL 1G0DA 1KFAL 4IOIA 3O0RH 2YD6A 4I0PB 3SOBH 2E7HA 1UM5H 3W9EA 3BWAB 2W65A 3LEYH 4XPHH 5DSCB 3L3JB 3BP6B 4JFEA 3P4OB 4MA8L 3UDWC 1IQDB 5BV7H 1JRHL 2IAND 4YFDB 1EXUB 3ISWA 1OD9A 1PG7L 5I8CA 5KVFH 4NZTH 8FABB 3SDDB 1BQLL 4LPUA 4RISH 3LHPH 3WE6B 2DBLH 1J5OH 5DUPL 4BFIA 1WIUA 4LRIA 5GISH 1WJ3A 4XXDA 3U9UA 3LKSB 4CMHC 3JWDL 4KKBC 4F80A 4Y19B 4LLVA 4M7KL 4GS7B 2W0LA 3O11A 4OLYH 3GI8H 3BISA 3C8KB 3TV3L 2P8LA 1KIPA 2PO6D 4XTRD 2DLTA 2IFGA 2PW1B 3O4LB 4GKZA 3QDGD 4JKPL 5B3JE 4NZUH 1QFUL 5D7IE 3WUWG 3H0TB 1Y18B 1CGVA 3MV01 3MUY1 4YGVB 5FM5M 1QPXA 4EI5C 2RQ8A 2UY7A 1V3MA 3U0WL 5C2BL 1I1YB 4QWWC 1IGIL 4QGYA 4KVCL 3QRGH 5JR1H 1INEL 3MBXL 2FJFA 4GMTH 5D7LB 4PS4H 2R2BB 4IMLB 1KJ3L 3HE7D 4MCZA 3SKNA 3HN3A 3OGCB 2IH3B 3G04B 1DLHB 4JRXE 4HZLA 5F8RC 4MDIB 2UZIL 2GK2A 1I7UA 5I1CH 2ESVA 2VDNL 2B1HH 3GBNL 2ARJQ 2CDEA 4KV5E 3KPLA 1EJOH 1U6AL 3Q6GL 1HN1A 4P2OB 4JQIL 3T77A 4G5ZH 1G7IB 5BJTB 4JEGB 5F89B 4OF0A 2BP3A 1FFNB 1T20A 1EO5A 5D1XC 5CCKH 3GKWH 2EDWA 4A2MA 3VFSA 5F8QC 1SBSH 2VR4A 5C0IB 1JPGB 3WSQL 5DVMA 1KJVA 5I6XB 3L3OA 4P4KA 4XP9L 1MHPH 3UTSE 4G9DA 2V2XA 4HUNB 4DQOH 5I16A 4NQCB 3P4MA 3N0PB 1XH3A 1ZV5A 4YAQB 3VFWB 3NIGE 1MJUL 4NQED 3HNTH 5TPWL 2Y07L 5IMLB 4UNVA 3G5XA 2OP4L 3M1BA 4L3CB 1DN2A 3CC5B 2I9LB 3I84A 5B39G 1QNZH 2NYYC 5IHZA 5C08A 1CR9H 1H8SA 4G6JL 3CU1A 1T4KA 4RGNB 2AXGA 4K7PY 5C0AA 1MFAH 5IFJB 4RAUB 5FCSH 5DWUL 3HRZA 3WYRA 1G9ML 4X8XA 3STBA 4C56A 1P4LA 3VGBA 5GS0C 3ECBA 5HGDB 1KCUH 3ZKMC 2GFBB 1WC7B 2QR0B 3WKMH 4XWOD 4L1DA 2A6IA 3BO8A 3QDJA 1MFDL 5IWLA 2ZUUA 4YHZH 3QAZB 4J8RA 4K8RD 3U7YL 3C6LC 4N0CD 5DFWH 2CIKB 1T2XA 4FQIH 1FC1A 4ALAL 5ALCL 4S10A 2ZSVA 1HHJB 2CSPA 4NM8L 3FRPG 5B3NA 4PP2A 1RHHA 4JY5H 4Q6IB 3GI9H 2HJKB 4B41A 3WIHH 4DTGL 4UB0L 5TQ0H 2M2DA 5KVDL 1DDHB 4M1GH 2J4WL 3C5ZB 3UJTH 4L9DA 1ND0A 2I60L 1IM3B 2D03H 2ZWLT 3OGOE 2ARJB 4P23C 4QCIB 3RA7H 3H7BA 2D7TL 4OD1H 1Q9LB 3O6FB 3DX7A 4MQXD 1YN6B 3MMEB 4FFYL 4PB9H 5IW1B 1S5HA 3C09C 1RZIA 3FO1B 1GGCL 4XC3H 3QUKB 3ULVH 3BMWA 1XF4B 2MQ0A 4UT6H 4RCAA 5CJ5A 2FIRT 5J6HB 4LCCA 1HHKB 4HSQA 4H5SB 3WHE0 4LHUD 1UFUA 1NBVL 2C7UA 5ADPL 4X7EC 2VE6B 2BSED 2A74B 5C09E 2P24B 1N6QH 1TZGL 4O02L 4POUB 4JZOB 2V5TA 5IB3B 3O3EA 5DQJB 1HQRA 2XN9B 5DD1L 3F7QA 5DJ0A 5HPOA 4GSDL 1Z6JT 2DMBA 2ZZUT 3S9DB 4DUWA 5EN2B 3SDYL 4FXGA 5CKGA 1A7NL 3HE6B 2YXMA 2BNQE 1S9WA 2P1YA 3I85A 4XP5H 4BK5A 4O5LH 1TETL 2QADB 4JDZA 4FZ8H 3ZL4L 1UJTA 4HH8A 4K7PL 4R3SA 5TE7H 4M03A 2DQGL 4KRLB 3QNZB 3Q48A 1A9BA 4TVPE 3C5JB 2X4PB 4LMQI 5T3ZH 2LV4A 1U8KA 3FB5A 1DLFH 3WNOA 1RJZB 1UVQB 5HYJB 1YEHL 1SJHB 3BQUC 1YDPB 1I9RH 1Q72H 4R8WH 3JV0A 2C3VA 3CH1B 3BOVA 1IZKA 3PWUA 1DBMH 2YPVL 1H3VA 3GSXB 1GCFA 4UQ2B 1DQLL 2CDGA 1YMMB 1KG0B 1P5VA 5ERWB 3D5OF 3EYSH 4HGWB 3MRCB 4JHWH 2BXZA 3GSNB 4V1DD 5E94B 3VMPA 3VG9C 2P46B 3BW9A 2RCSL 1KEGL 4P3DB 3AC0A 3Q5OA 2IQ9H 3BIAX 3V95A 1M6OA 2CRIA 1C12B 5J57B 2Z0BA 2ICWJ 1UCTA 3BKYH 3LZFH 4GRMA 4Z6AT 3LSOB 4D3CL 5D7JA 2NPLX 1SEQL 4KRMB 4RDQF 3N1FC 2FEDC 3VFNB 4D2NA 1HI6B 4DZ8B 1I9JH