3EODA

Crystal structure of n-terminal domain of e. coli rssb
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
115
Chain Sequence
QPLVGKQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAGLKLLEHIRNRGDQTPVLVISATENMADIAKALRLGVEDVLLKPVNRLREMVFACLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hnr
publication title The structure of RssB, a ClpX adaptor protein that regulates sigma S
rcsb
source organism Escherichia coli k12
molecule tags Signaling protein
total genus 38
structure length 115
sequence length 123
ec nomenclature
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3eodA00
1QQBA 3TMYA 2MSKA 3N0RA 1JYEA 2I6FA 3RVNA 1DC7A 1T34A 2WJWA 4ZPJA 1ZHHA 1ZGGA 8ABPA 2YHBA 5D2CA 2IOYA 3O1IC 3D8UA 1DJMA 4OLAA 1DRKA 1SXHA 3JPYA 4PEVA 3HVRA 1SD5A 3QLVC 5DTEA 3Q9SA 1PEYA 3QK7A 2FVYA 4G0XA 3S99A 4MQFB 3A0RB 2PUEA 4Z4FA 5FWYB 1E6MA 4Z4HA 1H9CA 4XARA 1NY5A 1K66A 3HO1A 5FBKA 3KHTA 3KG2A 3T95A 1DBWA 3GT7A 3LMKA 1SRRA 3LUHA 3DLHA 1RZRD 3O2QB 5TPWA 2JVJA 4YV7A 4HNSA 4MQEB 4RWEA 3IDOA 4W5RA 3DGFC 3Q7TA 3IP9A 4RU1A 3D02A 1JDNA 2MYTA 4ETNA 1M2FA 2FTKE 2E4XA 5EWLA 4EVQA 4Q7EA 2QZJA 4JOQA 4KMRA 1D4ZA 3N0WA 2GWRA 4GPAA 4ML3A 4H60A 2L17A 4KREA 1Z16A 3LUAA 1FQWA 3MQ4A 4XASA 1DBPA 3QELA 4DADA 3SY8A 1USIA 3QLUC 5KQPA 4RK1A 2O20A 1XWWA 4MS4B 1QKKA 4NQRA 3VNAA 1BA2A 1QO0A 1W9HA 4EYQA 4F06A 1BDJA 2FSPA 3JS5A 1OXKB 3CG0A 3G85A 3SNKA 1D1QA 2ZAYA 2HSGA 4G0YA 3CS3A 5KWSA 2JVKA 3GV0A 3HUUA 3GA5A 1NXSA 5TQ2A 3M9XA 2A9RA 5JNWA 2HQOA 5HM6A 1PNRA 1TM2A 2LIVA 2LUOA 1JFSA 1C0EA 4QPJC 2FMKA 3N0XA 3F73A 3ROFA 1EWVA 4JB2A 3N6VA 4Z99A 1DC8A 1XHFA 2JCGA 5KI6A 4EVSA 1Z18A 2L19A 2R47A 2RDMA 4KVFA 5KQMA 2RJOA 5BRAA 4XAQA 4Z9BA 1UDRA 4OBBA 3HK2A 4RK4A 1J56A 2B1JA 1JH9A 1QP0A 3QX8A 1DCKA 4LE1A 3CFYA 1Z2DA 4HNQA 4N47A 3HEBA 2BGGA 4G0ZA 1P6UA 1YIOA 4B09A 1KRXA 2ID9A 4UHKA 2H3HA 2GBPA 4JAVC 1ZY2A 3W9SA 3BREA 3BRSA 3OQMA 1JF8A 3MMNA 4OLBA 5TQJA 2MYUA 2R48A 1MIHA 2FKAA 2ZWMA 1DP4A 4RS3A 3EGCA 4IILA 4WUTA 1ZN2A 3H1FA 4WWHA 3JVIA 3KTOA 2N9UA 3DZDA 1CYEA 4RKQA 1MAVA 2FXIA 3JVDA 2E4WA 2P4UA 2PL9A 3RVOA 1VPWA 1PEAA 1LBIA 1M5TA 2E4VA 3LFTA 4YLEA 1ZITA 2JBAB 3HXMA 3R0JA 3OM1A 3I5AA 3H5IA 1DZ3A 3M6MD 4O1HA 5EWJB 3L6UA 5JNUA 3MF4A 2FMIA 3NNDA 2WMYA 4YCSA 4HYEA 3CZCA 4KPYA 4KRFA 5T7BA 3NNNA 4RXUA 4YRZA 3UK0A 9ABPA 3ROTA 3EJWA 4M88A 1M2EA 1MB3A 2PMCA 3QLVA 5IULC 4Z9AA 1VRVA 1RZRA 3Q7SA 5KC9A 5DCLA 4MQFA 3T38A 1KGSA 3G1WA 2V0NA 1Z25A 3H5TA 5B3JA 5FWYA 4EVRA 3Q15C 2A9OA 1NATA 4MR7B 3T6KA 1AB6A 2JVIA 2HPHA 3OLVA 2JB9A 5IC5A 3N53A 1Z26A 3GYBA 2AYXA 4MS3B 3IPCA 4F12A 2IKSA 3CRNA 4MR9B 3C97A 1ZDMA 2GKGA 3N75A 5B3JC 3OQNA 2JK1A 4MQEA 4YGXB 5GQSA 3KKEA 2FLKA 3GBPA 4WT7A 4YO7A 5IBQA 5JNSA 1D1PA 2OENG 4JASB 4WXMA 3HUTA 3SAJA 1QQAA 1C4WA 1L5YA 1TLFA 3TO5A 5IEJA 5BRJA 1EWTA 4P1ZA 4RY9A 2FMFA 1LJLA 1RXEA 2NZVG 1JFVA 4XLTA 3VNBA 4LX8A 4IGAA 3LUKA 3NBMA 4F11A 5KQLA 3QLUA 3HDVA 3JPWA 4LE0A 3O21A 4EY3A 5DLEA 4MS4A 4RK0A 3HM9A 1VLZA 3DBIA 3EQ2A 1NXXA 5IUKC 4G0QA 4TMYA 2NT3A 4MR8B 1DCFA 3C3KA 3KSMA 4EUKA 1YMUA 3BRQA 4MS1B 1QP4A 5IEBA 4E7PA 2E4ZA 2FEWB 2FLWA 4NCAA 4RXTA 3FFXA 4DQDA 1E6KA 2VK2A 3TB6A 1Z13A 3RVKA 4CBVA 4D74A 4KZKA 1WETA 4H3KB 4YWHA 3O74A 4RV5A 5JNVA 2XDYA 3NHMA 6CHYA 3FFWA 3OQOA 1JL3A 2GI4A 1VKRA 3K9CA 3OLWA 3IPAA 5TPZD 4ZMSA 2WB4A 3C3MA 4N41A 1MVOA 4F8JA 4Z0NA 4IF4A 2A9QA 4YR7A 2TMYA 4Z4GA 4RXMA 1KRWA 1E6LA 1AB5A 5TE9A 2QR3A 3KCNA 1JYFA 1P6QA 1LJUA 2E4YA 5TPWB 5JNTA 1JBEA 5BQ3A 2RGYA 1DBQA 4G0OA 1PHRA 4LDAA 4LE2A 1YVUA 5CNJA 4G0PA 4KFCA 3SG0A 1R8JA 4OTZA 1PUXA 3HZHA 4N0PA 1D2AA 3O75A 4G97A 2QSJA 3RVRA 3P9YA 1U2QA 1IIBA 3CKMA 4QICA 2PUGA 1NXWA 4F3TA 2LPMA 2Q5CA 4KQCA 4FB4A 4WXEA 4ETIA 4EYGA 1Y1LA 1ZH2A 5IUJC 4D6XA 1F51E 1NXVA 2OQRA 3H6HA 3LKVA 4MGEA 1KMIY 3LUFA 3RVLA 3H5VA 4MLDA 3T8YA 2RJNA 5I4CA 3DLBA 5CNKA 3EULA 3H5LA 3CNBA 3IP6A 1MB0A 1Z17A 1K68A 1EHCA 2FQXA 4LDZA 3RVQA 2LBPA 4RDCA 2JBAA 2NUBA 4RK6A 3I45A 3RVSA 2W42A 3O1JC 2NT4A 2CHEA 5EWJA 1NXPA 2WRZA 5JNRA 3LUDA 2FMHA 4OG2A 1ISRA 1QO0D 3H5WA 2E4UA 1GCAA 2QXYA 2IPAB 2A9PA 1JLKA 1S8NA 4PZ0A 1ABFA 3KYIB 3NNSA 1FSPA 1GUDA 3HS3A 4RK7A 4RY8A 2PUAA 2IPLA 4PYRA 1URPA 5TQ0B 3FFTA 3RVMA 4JP1A 2PKXA 3QEMB 2MSWA 5HSGA 3CG4A 2WY2D 3CU5A 1EWKA 4W5TA 1FFGA 4HNRA 3KYJB 2GX6A 1QPZA 4MR7A 5JS1A 1GCGA 4TLMB 4KQ9A 4XXHA 4EYKA 1PNTA 1A2OA 4IMJB 3B2NA 4H3HB 5KC8A 1RXIA 5C5EA 3CLKA 3TX6A 3LUJA 2FQYA 4MR9A 1U8TA 5KQGA 1USGA 6ABPA 2X7XA 4MRMB 2HQRA 2ID7A 3F7NA 2IPNA 1NTRA 4OATA 3RQIA 1JDPA 4ZJPA 3QLTA 3E61A 1BDIA 2CWDA 4E7OA 4LRQA 1ZAYA 3Q41A 1LBHA 2PUCA 4IRXA 4Z4EA 2FN9A 2MYPA 3EAFA 4P98A 4QYWA 2VUHB 1XHEA 3A0UA 2PUFA 3FGZA 4S04A 3EDCA 3HJFA 4Z4IA 3K4HA 3UKJA 4XFKA 1BVHA 5IUNC 1JHZA 3JTEA 2R4QA 2P9HA 3LOPA 2HJ9A 5FWXB 5EWMB 4KNYA 2KYRA 1A0OA 3FDFA 5TPZA 4MR8A 3H6GA 2FEPA 1FFWA 4MS1A 4N76A 1GUBA 1QNLA 4IMIB 2PE5A 5FBHA 5C5CA 4S05A 4JB0A 2F8TA 4Z4CA 3CTPA 4RKRA 5DGCA 1JX6A 2NZUG 1FFSA 1ZESA 2IDMA 4L85A 2FN8A 1L5ZA 2WJAA 2JRLA 4W5QA 2LP4Y 3C6QA 4N0QA 2VUIB 1BAPA 4WZZA 2PJUA 4TN5A 1ZH4A 2H0AA 1P8AA 3H1EA 4GNRA 4Q6WA 1YK0A 3SM9A 3IP5A 4MLCA 5F64A 5ABPA 2AYZA 3LUCA 1CEYA 3I09A 2FQWA 5ED4A 3O2JA 1YMVA 3I42A 1DRJA 1HEYA 3A10A 4PICA 3C3WA 5BR1A 2FEKA 3IP7A 1TVMA 4FE7A 3CHYA 1YTUA 3O2SB 2M1ZA 1GLGA 3Q7RA 5CNIA 3KLNA 3OLXA 3ILYA 3RH0A 1YS7A 3GL9A 3RVJA 4NICA 4D6YA 1M5UA 1TJYA 3JY6A 4KK3A 1ZGZA 5PNTA 3HV2A 2L2QA 2QV0A 2M98A 3CZ5A 3FMVA 4PE5B 3KLOA 3KJXA 4O5AA 3SQNA 1RNLA 3MYYA 2R25B 1EAYA 3F6PA 2DRIA 2PAFA 5EWLB 3UUGA 3GBVA 3H75A 2WWVD 1OXBB 4FE4A 3OLZA 4NV3A 3QELB 7ABPA 4N03A 5CNMA 5JS2A 1ZVVA 3GRCA 1D5WA 2QVCA 3BBLA 5E3JA 4YP9A 4TLLB 4ZMRA 1SXGA 2VYCA 3EODA 4O1IA 1APBA 1E2BA 2MSLA 2PL1A 3EQZA 4QYMA 5HKOA 4EGSA 1I3CA 5TQ2B 1P2FA 5CHYA 5TQ0A 2PLNA 4ZYLA 2QU7A 4RZSA 2IPMA 3M9WA 4EYOA 3N8IA 3QEMA 2HQBA 3BILA 3HCWA 1BDHA 3KS9A 4YS6A 3TD9A 1U2PA 3QEKA 2CHFA 1USKA 3MM4A 5DKFA 4UHJA 1NXOA 1EFAA 1Z15A 2CD7A 4KK4A 4RY0A 1B00A 1Z2EA 1W25A 2QVGA 1LK0A 5HQJA 3LKBA 4RK5A 1DCMA 2PUBA 3LUGA 3OMXA 3DGEC 4RSMA 3OO1A 4G0MA 4NCBA 2FW0A 4MRMA 3O1HB 4L4UA 1QP7A 1CHNA 4MPTA 4W5NA 4LZLA 4KV7A 3E3MA 4JA2A 1U0SY 1ABEA 4Y9TA 1ISSA 1JWLA 4MYRA 1JFTA 1RPJA 1F4VA 4MS3A 2YHAA 2IYNA 2J48A 3GWGA 3MIZA 3OM0A 4MAAA 4ETMA 3OLYA 1A04A 3H1GA 2F8SA 5T3YA 3H5OA 3F6CA 3HDGA 2PUDA 2L18A 5IX8A 1SXIA 2MYNA 3HSYA 4Q6BA 4DN6A 5FWXA 4W5OA 5EWMA 3URMA 2QW1A 3RVPA 3OMWA 5GOTA 1QMPA 4G86A 3ILHA 2B4AA 1NXTA 1U04A 3A3KA 3OO0A 3LTEA 1Z12A 3MA0A 3L49A 3NHZA 1DG9A 1YK1A 1TMYA 3QX9A 1YS6A
chains in the Genus database with same CATH superfamily
3L6OO 5KTPA 2JC3A 3FHLA 3H1BA 3N7UA 1JDBB 3KOZA 3RVNA 4L5CA 3IS3A 1US8A 1E18A 3C5EA 4PLTA 1ZGGA 2XMSA 2GEFA 3VR1A 2YHBA 1UKYA 2VH5R 2WAYA 3BA1A 1W35A 4LF8B 1MB9A 1Q2UA 1L9KA 1E8NA 1OA1A 1Z38A 2CCGA 3OJ0A 4ND6A 2E2WA 5H5JA 1EZ4A 1SCUB 5HQ3B 3SQXA 1P7CA 1X8LA 4DR2B 1YE5A 1CVLA 3PD1A 1LB1B 2H4FA 2OYSA 1H9CA 1U8FO 3REGA 2LVBA 3OCVA 2MDTA 2P5UA 2QRVB 1T5OA 3GLHA 3KUXA 2ZIVB 4RW0A 3KG2A 2RCYA 2A9JA 2H0RA 3QVKA 4MI1A 1JAYA 2Q6LA 1VA4A 1E2LA 2QDKA 4G67A 3R7FA 2HK9A 3FTDA 1Z5PA 2P75A 4HXYA 4KQKA 2EJCA 4PNEA 1M73E 3HA3A 2E82A 4K6OA 3I39X 4WSOA 4JI3B 3SBXA 4Z1MD 2BFBB 2VAXA 1NZFA 3IDOA 4Q34A 5FA6A 1SXJE 3LXUX 2DBYA 2YMMA 1WMSA 2PFKA 2W6JA 2EBFX 3G3EA 2Q07A 1DTWA 1OWPA 3GLTA 4IZ6A 3MJRA 4NDZA 5BYKA 4F91B 5KZMB 3I5YA 2LWIA 2ZJ4A 4DMLA 2RB4A 3V7UA 3LY7A 1Z0UA 4EENA 1ORDA 1UXOA 3I2KA 4BMOB 1H2AS 1Z6QA 3MQ4A 3VPDA 4J2TA 2BRUA 3QELA 2QORA 4MVJH 4ZZ3A 5CXUA 4GQBA 4QUHA 5CLJA 3MHTA 1WB9A 1UC9A 1KEEB 2O2GA 4NBNA 1MX1A 5HS6A 5T4FA 2WG1A 2A9KA 1GZ3A 3D7SA 2PJZA 4K05A 1SIUA 2BCEA 4XJTA 3A1SA 3GEIA 5DT2A 5J5CA 1Z5NA 3TRJA 3VPBA 2AOTA 5DCYA 2VRNA 2XEDA 1P80A 2WIBA 3GYGA 2CV2A 2V6GA 3CS3A 5YASA 2BELA 5B3LA 3WGIA 4L9RA 1GVNB 2HLNA 4HCJA 4L0MA 3RS4A 4Q48A 2GCPA 1IZ8A 3JARB 5BSUA 5BV2P 4BQFA 4Y2PA 3DE1X 2LIVA 1PJ2A 3P9CA 1UT6A 2LIPA 2IP2A 1QVWA 4LYFA 1MENA 2XDQB 1SBYA 2YJTD 4HZIA 1Q15A 4BPBA 2VJDA 3GW8A 1P7YA 1R10A 3UPUA 1WV0A 4UVGA 3NP7A 2K2WA 2XNCA 1KAHA 3ANXA 4W5JA 1O97C 5CYOA 3B36A 1SCNE 2RJOA 3ZBPA 1WQ1R 3GP5A 3W77A 1BE8A 3V55A 4B4VA 4B73A 4EA7A 1X6VA 2AN4A 4RK4A 2BBSA 1SWWA 2C3OA 1PG2A 4EUFA 1NV8A 2F64A 2B1JA 3UAXA 1DCKA 2XMRA 1CUFA 3NOQA 2IK8A 3QKSA 4B09A 1M2OA 2O6HA 2HMSA 3KP1A 2P0YA 1Q19A 1SBTA 3QFRA 4MINA 2WPDA 4TV9A 2VSYA 3K0AA 1VCIA 4KH1A 1TM1E 1VYTA 2HF2A 4AYTA 4D4HA 3E9CA 4GPIB 3S2UA 1JIIA 2I67A 1XEWY 2ZQYA 4DLZA 1K3FA 2P9FA 2NUPA 5AI9A 5JDCA 3F5SA 3FX2A 3ITKA 1U2ZA 5AVJA 1N5JA 2SCUA 3RJTA 4RKQA 4XZ3A 1S8AA 1E5QA 1M1YB 1OMOA 2AOUB 3A1WA 5JH7A 1ZM2A 4AY6A 2W37A 3H7AA 4N3AA 3HA5A 3EMKA 5JXGA 3KKOA 4C0SA 1LBIA 1CIVA 1ZLYA 1VYVA 4BKQA 1YRLA 2R86A 3RBXA 1GZ4A 4MW6A 2C2BA 5EWJB 3ZZUA 2GN0A 2X9LA 4QQNA 5JPIA 1H8EA 3WKCA 1IN6A 1FBNA 3U4DA 5I7HA 1FJHA 1U80A 3L8CA 1I7DA 4YXFA 1V35A 3G2JA 1ZOSA 5ESXA 3FYHA 5COBA 4QYXA 2BH9A 5CT5A 2JCSA 4LXTA 1Q44A 3CZPA 1OCEA 3IXMA 1ORWA 1R8SA 1N8TA 1YZGA 2GQ0A 2R6AA 3BHJA 2VKQA 3BXOA 1JVSA 3T94A 5HDBB 1A50B 3FNIA 1ILEA 4P0PB 3A4IA 4JLAA 4OGWA 4EF4A 3VZQA 1XEFA 3PQ4A 5L3QB 2IXDA 4NENA 3RRXA 1HTBA 2CJWA 3FDXA 2P78A 1N3YA 4RGYA 2HRRA 5BT8A 1TKCA 1JFTA 2WU4A 4RC9A 5ES3A 2ZB3A 4ABTA 4IZHA 5BYBA 4K6FA 5K45A 2R00C 2G9UA 1KEVA 1FTGA 1ACJA 2QPAA 3L7LA 3MTIA 1NR5A 3GYBA 2AYXA 4PAOA 5IK2D 4WY8A 4RMNA 1XRJA 4XX0B 3IT2A 3CNLA 5COAA 3V1YA 4DTIA 3RS7A 4XVUA 2RGNA 3W6NA 3W9BA 2WA2A 4DDWA 2RK4A 4E33A 4EKIA 3ENNA 1FNCA 1W87A 2VJLA 2B21A 4Q1FA 1RKQA 3ECAA 3JW8A 5IBQA 7AT1A 2FA9A 1PT5A 5GIPE 1PUJA 4BRWA 3D0OA 1A8IA 4U2DA 1QQAA 1NN0A 4RTRA 4HRVA 3K6KA 3KWJA 4O2BB 4ZQFA 1N2BA 3TOXA 3VNSA 3WLSA 2X7HA 5BRJA 4QDXA 3BG5A 4Z86A 5B1HA 4NRDA 1KEZA 3IBSA 5LBTA 2QPOA 1EBFA 2B4QA 2WJPA 2Q8QA 3PVZA 2OA0A 1O89A 3RTDA 4UUQA 4ACBA 1NVTA 3V4VB 3EUAA 3EFBA 2IYLD 2XD4A 3K0KA 3KHKA 4I9HA 2ILTA 1GTMA 3EQ2A 3MUFA 4TKVB 4UOQA 1Q57A 3A9TA 4KC0A 3SVTA 3IA2A 1ZR4A 1OQAA 3K9GA 3KKLA 1U2TA 4HWSA 4OHWA 1RPZA 5KYGA 1X80B 4M53A 3NFRA 2PSFA 4COOA 3K35A 3GWZA 2WEKA 2GZ2A 4BWGA 3ANNA 4CBVA 4NU5A 4HZUA 2IIVA 3KPYA 1RHJA 3FSRA 1LTHR 1W5FA 1VQ1A 5F7XA 7MHTA 5ERYA 1DBVO 2CLCX 2XDYA 2Y1FA 2HSJA 1KPGA 3NHMA 4MUMA 2H63A 4R8MA 3OQPA 5HCNA 3R76A 3ZWMA 3OQOA 2AFHA 3PNSA 3CSSA 3L0DA 3N2GA 2NTNA 2XVZA 3PLNA 3QU7A 3SD7A 3RIYA 4ZZ0A 1UKEA 2GAAA 1RQRA 2KQUA 3WIOA 3ESRA 3LBNA 5HK8A 3B6JA 3ZHTA 1KYYA 1NVUQ 2C9MA 3JAWB 4LVCA 4YJHA 3BSFA 1Q7RA 4DV4B 2W6IA 2BR3A 4EKYA 1GU0A 1FUIA 1R9JA 4LHWA 4TLAA 5BN3A 4MLPA 3FR7A 1FC0A 4Q3OA 1IJFA 4KFCA 1TUBB 4XWWA 1NVAA 2R8RA 4BNKA 2RHOA 2R1ZA 1A8PA 4DA9A 2PGNA 4I3GA 1JIQA 5LM3A 2CNWD 4YLGA 1PK9A 4BLPA 5BOSB 4GRDA 2PJRA 3CKMA 2C2WA 2IYTA 5HIIA 2P1ZA 2LPMA 1J5EB 3RBVA 3WHPA 5AM3A 4R0VA 1TZBA 3SXUB 3AU9A 3TOSA 4E3WA 1NYRA 5EJMA 5DNYB 3ZUGA 1R0KA 1KY3A 3OM9A 4BLTA 1TF7A 1J8DA 1UXJA 3TIIA 1QYVA 4S1TA 1E5XA 2XI4A 2QMOA 2I03A 2ZJBA 3LD9A 1TDJA 1W6RA 5DGTA 1M76A 2PUTA 3EVCA 3IT0A 4GLJA 4KP7A 4MP6A 5FWNA 1DLJA 5DMXA 3PTAA 3H99A 2CHEA 4LC0A 1EGMB 4QAJA 4B46A 3TR0A 3VO9A 3P2IA 2B30A 4LV6A 4UFNA 3T7AA 4E5UA 3PC7A 3KPVA 5EMHA 3STWA 1HI9A 1GTVA 3D31A 3W1VA 2V3CC 3WV5A 2OO5C 1Q20A 2E4UA 5FB3A 3TNFA 2W58A 3L7NA 3RJ9A 3GLRA 3ND7A 4YRTA 4ABYA 3CX4A 3TW6A 3UYLA 1PR4A 1Z4KA 3ROZA 1E6UA 4MWTA 1FRFS 1QIJA 3B8EA 3MELA 4E5SA 1TFRA 1U6KA 3IUBA 4C21A 3TSOA 5IKMA 2BM1A 2K4MA 4HH4A 1T9DA 3PVSA 4PYRA 5AKEA 3G8AA 1TEVA 3OD1A 2ZT7A 3ER9A 1ZC4A 1JPNA 1R74A 2OR3A 4F1WA 2RBGA 4DQLA 1TQ6A 3PQ8A 4HNRA 5FNZA 3KQPA 4LJ8A 3DTVD 3OFKA 4KO8A 1U0TA 3HU1A 3RUAA 4CIWA 2OOKA 4P08A 4IMJB 1LH0A 4PNHA 4QWMA 1ISJA 2VF5X 3AU8A 2A4KA 1FRVA 1MT0A 2YQ4A 3D6UA 1E3WA 1ODIA 3UW3A 2ZIUB 1V1RA 4PQFA 3HVHA 4R40A 4V1CI 2AF3C 1N5OX 2V03A 1QOPB 4DR6B 3UK1A 1HYBA 1VXRA 2ACKA 1EG2A 1XD2B 3F74A 3MPUA 1H9BA 2FPUA 5KKNB 1MXFA 4FIDA 2RCNA 3FKJA 1L7XA 1VE3A 3ORRA 1NT2A 1NF3A 3K0FA 1T8WA 3Q41A 4O0LA 4BN0A 1G5QA 3AOGA 4NMHA 5CDYA 4MHOA 2FNAA 4CMIA 4NTZA 3HKEB 4N5HX 1FFXB 2WKSA 1E3JA 4HWTA 4P98A 5IMBA 5ALPA 3RSFA 5HS4A 5DN9A 5DASA 4BO4A 3RC7A 4BNGA 2VZEA 2ZBDA 3FGZA 1LI4A 2PUFA 1Q3KA 2BGLA 2FEXA 3KTFA 3SHOA 4D3FA 2FP4B 3D8HA 3WYAA 1JEEA 2VYNA 3CRMA 4LGVA 4D97A 10MHA 3OY2A 4FHGA 4HTAA 1RLJA 1QV9A 5JALA 5K4HA 2WIFA 3ED5A 2CHUA 4IKEA 5BUZA 1DRUA 2ONCA 2EYUA 1QGDA 1A7UA 5BT9A 5HMLA 2WJ3A 4AY5A 2I6GA 4OU4A 4FX2A 3MCZA 3W5HA 1VGRA 4DQUA 5HHTA 3ZWBA 3Q8KA 2B0JA 4JOBA 1EFVB 1YS1X 5CA1F 3T3NA 4HZGA 4QEZA 1L5FA 3RUEA 4EFKA 1L7PA 1X1AA 2I55A 2VUUA 3VU9A 3L7CA 1ID8A 4S3MA 4RHEA 4EX7A 2DPHA 5LOVA 4X7MA 5EJ2A 3EYWA 4AT1A 4C2BA 4L8FA 3B9PA 3G9ZA 2O07A 2PVSA 4H35A 1HKHA 4W5QA 1L4BA 1NI3A 4HH1A 4UZEA 1BMTA 2GAIA 2J8ZA 3QUSA 3TSYA 5U4XA 5JTTA 2OP0A 1EVIA 1R0WA 3LDHA 3S2SA 5CK4A 3FCOA 3W2IA 1U98A 4Z0TA 1R0RE 1W36B 1Z6XA 5DNCA 3BFKA 3GEGA 1X1DA 4AZ0B 1U11A 5B5SA 1B2LA 1M2WA 2MIIA 3BMOB 3K96A 4NYMQ 2DR2A 1GRQA 1TJ3A 4D82A 1SUAA 2CDNA 4XUDA 1R16A 2VXBA 4FZ3A 1R4ZA 1H6DA 4J0IA 4MUJA 4PPYA 3W4KA 3OLXA 1O6GA 2O59A 4QYTA 3L1UA 3UYKA 2ST1A 1Y7PA 2AZ4A 4N8SA 4DB2A 1XVLA 3AETB 1Z5ZA 3INNA 3U09A 1FLNA 1R64A 1WLYA 2OM2A 3SJCA 4DVGA 5B4VA 3WYGA 1SEVA 3RTBA 2ECQA 3S8YA 3HACA 4B3MB 1ZN7A 4O5AA 4KR3A 2QN6A 4JFRA 4C4XA 1B1AA 1E2IA 4IL5A 4IS3A 3CF0A 1RI2A 1X92A 1ZJJA 5TF0A 5IDQA 1PAUA 1TGVA 4INOA 1OW3B 1JS1X 3PRHA 3OZFA 3R3WA 3MUOA 4WL0A 2GN4A 3SOZA 5MDHA 3L0PA 2HBYA 4FFWA 4IIHA 2AN3A 4LHZA 3UHOA 2GM9A 4OXKA 1ZQ9A 1GZ6A 1JU9A 3CWZA 1FTYA 3GARA 3W2TA 3BT7A 4GQAA 3OHPA 2Q3MA 2XB6A 4RIHA 2DERA 2W6JD 4HPWA 2A33A 1L9XA 5DBOA 3HO6A 5ALRA 1UXKA 3CF4G 3GN2A 4GI5A 1XVIA 3V00A 1UDAA 3GJTA 2PCJA 2PT9A 1R0XA 1WMFA 2P90A 1I3CA 3NT4A 4L08A 1KI7A 4QL3A 2CV1A 1AD2A 2VHVA 1B6RA 2ERCA 2IF2A 2OC4A 3GR6A 3QY0A 4V0OA 3P5SA 4JNKA 1Y4SA 4BP1A 4BO9A 2VHQA 4EYOA 8MHTA 2XGSA 4G81A 4PG5A 2X40A 3K16A 5DKFA 4BLSA 2D1FA 4ZDIA 4RY0A 1YO6A 3C15C 5B53A 1VHLA 1UJCA 3ROGA 3W5AA 2GPNA 4L4XA 2VCHA 3CUEF 2OO7A 3ADPA 2I4LA 3HYRA 5JLAA 4LF4B 2WVAA 1FUUA 1E3IA 3ZIAA 3H04A 3CN9A 3E22B 3PGLA 4UM8B 3RWOA 4E70A 1P7WA 3OZUA 2SNIE 1XU9A 3LUBA 3RARA 1F8XA 2HCRA 3FVTA 3V2HA 3O1HB 4ID9A 5THKA 4N12A 5J2TA 2A5YB 1G8GA 2RBEA 3BDAA 5EHGA 1JAZA 4RTLA 2W2MA 3FB1A 1IY1A 4Q9JA 4JA2A 4LXQA 1CF2O 3PHJA 2J1LA 1EKXA 1KE1A 3Q10A 5CITA 3F1LA 3H11A 3K9NA 3N2NA 1BS1A 3SYNA 4DW8A 4CFYA 5G53C 5C9ZA 4TVKA 3T4PA 2P9CA 4LOHA 2HMYB 2XT6A 4NDNE 3WLRA 3ZV4A 3EFOB 3U3DA 5T3YA 2RK3A 4ARUA 1GFZA 4JI0B 1GGNA 4XVHA 1E92A 4J0JA 5IN4A 2CLKB 2ZREA 3ZQUA 1EUCA 2BGNA 3FCAA 5DTRA 1P4JA 4J0CA 3VTZA 4B4WA 4HUQA 4RCVA 3O38A 4S35A 2RGXA 5FJIA 3RM3A 4A82A 4C87A 4DQKA 5A4FS 1G4HA 3ZE6A 1QUFA 1G8SA 4MYUA 3ILHA 4IJ5A 1V7CA 2FW6A 3WDKA 4ND8B 4E31A 4YV1A 3N5KA 1Z56C 4IXMA 3R7WB 3DD5A 3BORA 4ZQGA 4ER0A 1YS6A 3Q2KA 1ZJWA 4HF7A 3UOGA 1S2DA 1T9CA 2GILA 1GZ7A 2L69A 2CL6X 1CJTC 4IHAA 3KQUA 4RTKA 1C7FA 1RC8A 1Q6YA 3L05A 2JLWA 2XT0A 3I0NA 4OYLA 5C3UA 4CLXA 2Q1WA 1D2NA 4MW9A 1L5OA 1PGQA 2QP4A 2WD8A 3ACBA 3JPYA 4QFMA 2DWPA 4PEVA 4WK2B 3L46A 4LPSA 5TMPA 4PWYA 3UJ3X 1YFLA 4AMVA 1H8ED 2FVYA 2W0SA 3IEXA 1QWSA 4YPOA 3ZE9A 2P3OA 5AR1A 1I1OA 1JQKA 2JIQA 2BAGA 1OWLA 1Q83A 1L8XA 2JF0A 3FWNA 3OOJA 4M9RA 3GFRA 4M9CA 5FBKA 2BIFA 4F45A 5FAKA 3RYIB 1T9ZA 1AZLA 3LHFA 4AP9A 4EITA 1DBWA 4J7CA 1UIRA 3E35A 4K7JA 4AZ3B 4WBSA 1VBNA 3ZJ4A 4HDKB 3K2IA 2BJHA 4F2HA 1P7PA 3DGFC 3Q1KA 4XI9A 1GEGA 6PFKA 3D02A 3G2NA 3ZDZB 3GLGB 1JDNA 1OJLA 2AUNA 2VOJA 2HIMA 1SZDA 1FVXA 1ZS9A 2PSSA 3B2EA 1A9TA 4ARZA 5CB4F 4GXQA 1F1JA 2R6JA 3AIOA 1DXQA 3O8NA 4BFCA 4EF6A 4MMYB 4KVZA 1VJTA 3NYIA 4H60A 2ZSDA 4F93B 3UMVA 1J0XO 4G89A 1HX7A 3K94A 1KI6A 4MEAA 3S2ZA 3NC0C 1HURA 3Q0TA 4HVTA 3TRDA 3A4MA 3MSXA 4BQNA 4E5KA 2I5PO 5HRAA 1N33B 4BB6A 3C1AA 1QGUA 1KSJA 2O8BB 3O03A 2IEBA 4EFMA 1G98A 3MRTA 4PRZA 4AJ1A 1VIVA 4CM4B 1BDJA 3WAGA 1EWQA 1Z34A 2R87A 4GSLA 3T3GA 1IEQA 2AUMA 5IJZA 4G0YA 4OH1A 3RYFA 1JDZA 1X2EA 1UWKA 1Y8QA 2AFIE 2HJHA 3PQDA 4FK8A 2Q5IA 4ITVA 4GPD1 2AV6A 1CV2A 2ZP1A 4KLZA 4BNDB 4CKBA 4AY2A 1J20A 5A1TA 5AKJA 3W6OA 4EDFA 2QG9A 2E18A 4WZBB 4K9PA 3HJRA 2CUKA 4UVEA 3N2YA 2ZT8A 1F3OA 2VT2A 2GPWA 3MB5A 2AG0A 2J85A 3RNOA 3GLIE 3BK2A 2R8PA 1CJSA 5EIAA 1CB0A 2NWQA 3UJAA 4C20A 1QYXA 3WYCA 2UYQA 3BFPA 3KTAB 1UEIA 4N3NA 4REQB 5MN6A 1U3CA 3CB4A 4ZCQA 1EGHA 4ZDWA 4EG7A 1UZAA 1MHPA 1VJRA 1FNDA 2QMUA 4OJKA 4PANA 4ZHSA 5L53A 2YOGA 4G8JA 4YDQA 3QX8A 4FW8A 4EEKA 5JY6A 3HEBA 5CDUA 1QF9A 1D6JA 1UPAA 3MVEA 3O4JA 4TTTS 1JTEA 3EQ9A 3QPUA 3HU3A 1YDFA 4UHKA 4ANFA 3D0KA 3ENWA 3K9BA 4EHFA 2OXRA 1XTSA 4NBKA 1RAHA 3C5HA 2CVOA 3BREA 3E9MA 2R48A 5DW0A 2W6ID 3T35A 3B3QA 3UV3A 1E8MA 2N9UA 2XKJE 3NM5A 1NVXQ 5EGNA 4LI3X 2MHCA 4QQRA 1W4CA 4JC0A 3U37A 3EXFB 3OQIA 3PXAA 4MKIA 1ULSA 2VK8A 6REQA 1NBME 3D6FA 3INTA 5EPUA 3UA4A 4X71A 3NWEA 4U7TB 2GJAA 3NAZA 3TFWA 4EHJA 4IJWA 3ZDDA 3R2JA 5K0EA 4JT4A 3R74A 4DT1B 3DPUA 1FIUA 1TK2A 3R0IA 4G9BA 3CVUA 4JJEA 4W7HA 1KYVA 4U7JA 1QRRA 1LRKA 4UM5A 4YT5A 1TT7A 1Z5WA 1LNQA 3L6UA 4IH1A 1CRWG 3MF4A 5FI1B 3V7WA 3WRYC 4X7RA 2QXTA 2BKLA 1LPAB 4B8YA 2NVBA 4IIEA 1PBNA 4KN8A 1ZK4A 2JLSA 1VBKA 4BYMA 3TIGA 5JAMA 1F9AA 4LSGA 2C31A 1O8BA 4YQZA 4ZV7A 2EP5A 1ZLXA 3SBDA 5KKAA 3LCVB 1VP3A 1OI4A 1JG2A 5EE1A 4NZPA 4PZDA 3ZGYA 3I83A 4MW0A 5HQ3A 1ZHOA 1DQZA 1SCUA 2NM0A 2EFJA 2PA0A 2VT6A 1XALA 1HE1C 5F7OA 4QHSA 4ZCIA 5LWQA 5EYPB 3T6KA 3SEQA 1FRNA 1JQ3A 3QKUA 2Y77A 1KFEB 2QP9X 2QRVA 3MWYW 1WWKA 5AVTA 5J5VA 2JK0A 4B3HA 4BO6A 3U5TA 4FZJA 1SKBA 3HI6A 1V37A 3EHEA 3NLLA 4MR9B 2QD1A 4BY9E 1ZDMA 2LDXA 4CLDA 2F59A 1NIPA 2BFBA 1J0CA 2HU5A 2P3SA 4FN5A 4R2MA 4XQCA 3PJFA 1K3TA 4C3VA 2JIZA 1NBIA 1WKVA 2DTEA 2OC9A 1G3UA 3LYAA 3HUTA 5CH8A 5HF9A 4OQPA 1HKUA 5B37A 2H16A 3ZCXA 1TLFA 1TOAA 1SCQA 3WWYA 4D4KA 5EZSA 5B12A 4F9GA 3VR0A 4D81A 1GG5A 3I32A 3E5HA 4FJ0A 4AJLA 5DTMA 1JFVA 3SLRA 2WC1A 2R1TB 4BMCA 1F5NA 3K9HA 3ELUA 1T0PA 2C78A 4FVTA 2BZSA 4IGAA 4FSHA 4P92A 4YMIA 2OAGA 4ZWNA 5TQVA 4E2FA 1XU4A 1KEEA 4G5RA 5AHRA 1W48A 4BV3A 3CJQA 2IPXA 3C5WP 4CIXA 2HA6A 1Z8NA 4NPHA 2ZJ7A 3BRQA 3NHLA 1NBHA 1UDXA 2MR5A 1U0GA 1KYXA 1TXGA 1UBFA 1AQUA 1Y82A 3I6YA 3RVKA 4FFBB 3JARA 5EVCA 3FDJA 4GKBA 1AXGA 1C7ZA 1P2SA 3IIJA 5KMGB 1C81A 3I5UA 4IIJB 4U7GA 3Q85A 5DB4A 4RV5A 3H5AA 3LZCA 4F96A 1SIBE 5CDFE 4ARVA 1FTNA 2XDQA 3FROA 3NIWA 3CRVA 3IPAA 2JCVA 1GARA 3PL5A 3U61B 4FKBA 3AP3A 4DR7B 1H0SA 5LP6F 2TMYA 5FOVA 2D5IA 1E6LA 1Z74A 2R2GA 5HBRA 2OV6A 3O8QB 4PN3A 2E7ZA 1Z63A 1E9EA 3NUZA 1F1BA 4DLKA 1Z8HA 3PS9A 5K0BA 1JBEA 3ZDBA 4DHEA 3MCTA 3GLFE 1ECCA 4FCCA 2EEPA 4LTDA 2OXCA 2YXEA 4MV4A 4B2IA 1ANKA 3D3JA 4CIBA 3G0DA 4G09A 1CUDA 1JHRA 1H94A 4N0PA 5LQAA 4LK3A 4TYWA 1VZ3A 3GCGA 4QTZA 2UYGA 2H06A 5CCBA 4CR6A 2JFWA 2Y1XA 1NQTA 3CNEA 2SICE 3D7KA 4RABA 2IXGA 3STXA 3UWOA 5FFFA 5BUSA 3N86A 1NOIA 1ESCA 4M1KA 4MOWA 5DBEX 3QFFA 5HZGA 1DO0A 4RGBA 1YB7A 4G85A 3RK4A 4ETIA 4IEIA 3TYXA 5MF6A 2HYIC 1Y1LA 3B3JA 5DGXA 4CF7A 1F51E 1J06A 5CH5A 4MUFA 5LMCA 2AOUA 5A3RA 4I4TB 4Z7JA 3EW9A 3T8YA 3QPVA 1ODJA 3CKLA 3AJEA 4U02A 1CHDA 1T2DA 3IP6A 1MB0A 2ZYTX 3HDTA 1SWVA 3RRFA 2QRPA 1FMTA 2YZGA 3A11A 6NULA 3HA2A 3Q8MA 3SEZA 3RVSA 2PX6A 3SIXA 1VJGA 5EWJA 3CLTD 5F52A 2L42A 3PFCA 1Z88A 2P4SA 3PEEA 4L4ZA 5LLSA 3REQB 5JQGF 1DO2A 2Y0EA 2AWOA 4R2KA 4AMZA 1YRYE 1WE2A 4X95A 1GCUA 5DN6A 1CUAA 2GBLC 3ICWA 4QHTA 3UMMA 2BP7B 3NNSA 1JW9B 1MAHA 1UJNA 1K0FA 1Q0HA 2CXOA 4O6VA 2JJ1D 4PLZA 4BNNA 4XCXA 1SOWA 1M7HA 1M0SA 4RPJA 3RVMA 1Y1KE 3TAXA 1EBBA 1NYLA 5L3QA 5HSGA 2J3QA 3C6XA 3USES 5H9WA 1L7NA 2BDEA 2CLIB 3FDZB 3E4DA 2IUFA 3LPAA 1KMNA 1MDFA 2B8EA 2PO7A 3QE0A 1TA0A 2FOLA 1YCDA 3NBFA 4AN0A 1I1NA 3OPXA 4H0CA 4DV7B 1L7VC 2D1QA 5JNLA 4YY3B 2WAAA 4MIKA 4C2AA 1ZWLA 1Y42X 3MWEB 4QGBA 5DTIA 1JG1A 4XX0A 3VVLA 1MN6A 4Q93A 3DOIA 3IEPA 4FR5A 4CG1A 4TMTA 4HBGA 4IFTA 2LRHA 3AR7A 3VJKA 1PFQA 1I4WA 1UK9A 4YYZA 1G8PA 3NH9A 1K6JA 1K86A 1WR8A 3BB3A 5ALQA 1PKEA 1U6IA 2PVPA 4K8RB 4OXIA 1GOTA 2C8LA 1JJVA 4O2BA 2ODAA 1SUCA 3ZIAD 2EJVA 3SJ7A 2JLYA 4B6RA 1K8ZB 3RS5A 2VSQA 5FUVA 2RONA 3AYZB 3I30X 1X9GA 4DCNA 2P9HA 2C83A 3VH4A 4DJAA 1P8JA 3CW9A 1JR6A 3BCUA 5LL6P 2R65A 2IHBA 3IBYA 2NUAB 4EO7A 2C9YA 3E7PA 2C97A 4BNIA 4G56A 1WOYA 2Q4RA 4QBGB 4JYCA 5LPNA 3BAZA 1X80A 4V2IA 2BPOA 2XUFA 3GJ7A 4J16C 4F60A 4K6GA 3TNDA 2J9XB 4Q16A 3NIBA 4JJ6A 4DNQA 3OBIA 3NTUA 2O3TA 1NJ1A 3ILSA 4TQUS 1ZVQA 2R2AA 3LDUA 4XDHA 3A9UA 1C8BA 4RAQA 2JAQA 4C0LA 1T3ZA 4Q1DA 3LPCA 1QIHA 4UVIA 2ZK7A 4YUAA 2VPZA 4RHYA 1TI7A 3SIPA 2DUNA 5EZYB 3NKVA 3DUFB 3PUVA 4HTFB 3WIUA 2DE0X 5FADA 1E1CA 2VUIB 4N7MA 1G2PA 1HNNA 1SG9A 2X9QA 5D3QA 1JBKA 2NPFA 1ZH4A 4HPXB 1NR1A 3T3DA 1HQKA 3H4TA 3RRBA 3IP5A 5B2ZA 3EZ6A 5KOHB 2H51A 1L4UA 3JAWA 1V48A 2R7MA 3FSEA 4PPFA 4X94A 1U5CA 5DCUA 3W5CA 1DELA 2XY4A 2P35A 1KY2A 1TUBA 3WQRA 4N6NA 4MI6A 4EZEA 3SFTA 5DM1A 2QYSA 1CR2A 1I4LD 4PC1A 4X20B 5DF1A 3RH0A 2IBMA 3HCNA 5AI0A 2FSHA 4WK0B 5FNVF 3ZVLA 2GN9A 3RKSA 3EAGA 3PDCA 4YJ2F 4ZV9A 1OV4A 5BOSA 1IONA 3HV2A 4D5EA 3O92A 1GT6A 4G23A 3VA7A 3KJXA 3ZUPA 3R23A 2VH2A 1E5TA 3UMCA 5T6MA 3SXUA 1H0KA 3AHDA 5B3AA 1R88A 1HOTA 4GZ5A 1NM5A 4RYLA 1YKSA 3K0EA 4B5KA 3UUGA 4AM8A 4P7FA 3ESBA 2ZR0A 2Z4RA 5AK5A 3AVWA 1K5PA 3W2GA 5KYNA 3DNPA 2REXB 3HMQA 1ESMA 1X77A 3H2ZA 4KWCA 4PVCA 2OFPA 3L5KA 3N39C 1UDWA 3SHWA 3FZGA 3I9KA 2ZJ8A 4N03A 1OU0A 4NWIA 1SXPA 3R9KA 1EGVB 3A9SA 2YMQA 3HRHA 3QA3E 5EERA 5SY6A 4P4TA 1TYCA 1UBNA 3UH1A 2YS6A 1CJUC 5J23A 1AS3A 3AVTA 1PX0A 1I6KA 1QPGA 1R0YA 1APBA 3KDPA 5JWRA 1HRDA 4J1QA 4Y9RA 1KERA 2BW0A 4WCFB 5M34A 2JI8A 4MYTA 1PQ4A 4NY1A 4XKJA 2BYTA 1Z82A 4ZYLA 1EXMA 1WHTB 3CO5A 3U56A 4FUTA 5KQRA 3HRKA 2IU4A 3SDSA 1OGIA 2GBGA 2Y71A 4YJ3F 4RVNA 3BRWA 3GD5A 2BHTA 2FK7A 2RC5A 4IXWA 4KMOA 3ZEAA 5B58C 3OCUA 2CD7A 3GOHA 1LXCA 4A16A 1KQ3A 4PS1A 1SC1A 3O47A 4JR1A 2WKRA 1LK0A 4JLMA 4JODA 3VKVA 1HQYE 3ZNNA 5FOXA 1E4YA 1T4DA 2ZAIA 1VMDA 4OCZA 4U8HA 3OIYA 3IAAA 1B8UA 2XZDA 3DGEC 1MX9A 4FQ5A 5TLSA 1FDSA 3D7RA 4RKYA 2FW0A 2DHCA 3HBNA 3HKCB 1K88A 3Q0IA 2FR1A 4E11A 1JILA 2MR6A 5REQB 3FRHA 1XD2A 3KT0A 4M0UA 4TKMA 5KTNA 3BL8A 2CFTA 5FPQA 3CLSC 4WY2A 4BGEA 3Q5DA 4K6MA 4Y9TA 5DLDA 5GJWC 4MYRA 2NPIA 2WIDA 3ID6C 3ZH2A 3FUVA 1CFJA 2XVYA 4J03A 2VHEA 4JXXA 3HKEA 4GHWA 1FFXA 4ZD6A 4G4SP 1GKUB 4RESA 3PGJA 4URWR 3I5MA 1P9NA 2PLAA 3V80A 2FDXA 2FP4A 1NN3A 2C4WA 3RABA 4ZIRA 4X7PA 1WBBA 4NLLA 2ZZNA 2MYNA 4CWAA 1T5LA 4TX1A 5JPCA 4NBLA 4F2PA 3U31A 3O93A 721PA 3O8RA 3EY9A 5FT9A 4D79A 1E94E 1SGWA 1Z28A 1S9DA 1WMBA 3QVXA 1Z36A 1C4KA 1EFVA 5BSFA 2O0LA 3RSQA 3NHZA 2WWXA 5BY2A 4N1AA 3RYTC 3FR8A 1A2BA 1V39A 3HB0A 1EBUA 2OCIA 3N0RA 3B48A 1L6RA 2HNAA 4BMNA 3RD5A 4Z9XA 5AQ1A 3EY4A 1S2GA 3WGLA 3QEAZ 2BGKA 5JW6A 3B5IA 3FJOA 2VNAA 2W4IA 3UMYA 1RE0A 16PKA 3IPYA 3DZ8A 3M5PA 4HWGA 5J3JA 2ZWOA 2OQIA 3HCEA 3M6AA 1YB4A 4MUXA 3V2IA 5T64A 3RT7A 1UINA 1WL8A 2Q46A 3EE6A 2PSDA 4OB7A 3WQSB 1EDBA 3UGKA 2W6QA 1NRIA 1ISIA 3BMOA 1COWA 1E2FA 1QKIA 4UMFA 1KI3A 2QN8A 1RSZA 3ANMA 2G5PA 2IEAA 4MSUA 4E2ZA 3K2QA 4BQRA 4TQGA 4DJEC 2DSTA 3GT7A 1RJFA 2FG5A 3WLKX 1TMKA 5IJ0B 4EM6A 2V9PA 3IAM6 1JEQB 2DTDA 1TYZA 4V0ME 2DEUA 1TA4A 1MV8A 3AETA 4PWZA 4KR7A 1JPJA 1MNQA 2C1XA 2AG6A 2O5RA 3N28A 1R0LA 3F5DA 2BGJA 4I1SA 4F72A 3LF1A 1QO7A 2WILA 4YMGA 3FF1A 3IUQA 3PX7A 3Q7TA 1TLLA 1G3QA 1W29A 3FYUB 1L4EA 3L6CA 5EE0A 5LMNB 5FBVB 1PFYA 1DAIA 2FG6C 4DB4A 1P0PA 3JQFC 5ARBA 3Q5EA 3BC1A 2CL5A 3L01A 3PKJA 2O3QA 1USVA 2XRYA 5GY7A 1D4ZA 2GWRA 1I0ZA 1JAHA 4ECAA 2I22A 2EFGA 3LUAA 4YBRA 5JS8A 3GFFA 2Q41A 4KCGA 3AVXA 3RHSA 4NEGA 1UT5A 2JIZD 4EGCB 4X85A 5B2EA 4GUAA 4ESVA 1U7PA 5K6TA 3G0HA 5LLDA 2HO5A 1BCSB 2CB9A 3I01A 4K9MA 1GNRA 3OZDA 2I8LA 4ND2A 3SZ3A 4ER7A 1SCKA 1ZMXA 2VHYA 5C1PA 4ZVSA 1N6NA 2CKMA 4Q1CA 5DWVA 2QPTA 4U9HS 4KIGA 2WF5A 4FCWA 4XM1A 1UT8A 4JJGA 4BE9A 5G0VA 3OUTA 1CIPA 1STOA 5F1PA 3DKIA 2I2FA 1J2JA 3GOQA 3BIOA 3T9FA 4DLNA 4WHMA 1JFSA 1IRIA 1S1CA 2VJQA 1RAAA 1A5TA 1YAJA 3P9RA 1SK8A 5KI6A 5K7SA 5ELXA 3AUYA 5C51B 3FF4A 1DWQA 4EVSA 4US2R 4TT8A 1EG7A 2O5VA 2R1VB 3LA8A 3UAOA 3L92A 1EVQA 3OSZA 3ASYA 4PIPA 2IXBA 4YRDA 3ZDRA 5BNWA 5BRAA 1HORA 2WE8A 3ZI0A 2EEZA 3GEMA 4UHEA 3EPRA 3E22A 3SOPA 2J87A 1VLJA 5C0OE 3TTYA 3W7BA 1NLYA 2BFOA 4OB6A 4FD2A 2WP8J 4JLNA 3SQWA 1XUOA 3KL2A 4KITB 5IHPA 1QP0A 4AO8A 3KJEA 1KK3A 1MGOA 2B78A 4Q5IA 2P40A 1K1EA 4PX3A 1IN4A 2C54A 2J3DA 3GUVA 4CMAA 3WLEA 2Y4OA 2JFFA 5B1DA 2VF8A 5BWBA 3QVWA 2HCBA 3E9ZA 4JAVC 1ZY2A 2ERYA 4G2NA 4LV5B 1XA3A 4IIUA 4LZZA 3VO1A 1SPBS 1OAKA 2GN2A 1D6NA 2Z6VA 3OQMA 3JYLA 4LEIA 1GSHA 3LW8A 3WGNA 1ZD5A 3ZE1B 3DZDA 3EFOA 1HF3A 1DFGA 2X86A 1Y7HA 2Q28A 3A1UA 2CEAA 2FXIA 4G5YA 1W49A 4IIBA 2DUUA 3B1ZA 4IXDA 5CW1A 3UJ6A 4BZPA 3OE4A 5LMUB 3ON5A 4RGQA 1IZ9A 1UMKA 4X45A 3RVOA 3QMWA 1N9ZA 3ED1A 4EWLA 1T2UA 4OQQA 3FCUB 4TV8F 4B85A 3GRFA 2HI0A 3TQQA 1FUEA 5BNIA 2ZZMA 5EHZA 4BBZA 2WLSA 3NTRA 4ND8A 4A3SA 4RKWA 1KSGA 1GXSB 4C4SA 3R7WA 1P62B 2B2NA 2CHGA 1E1LA 4FMPA 1TO6A 1SN7A 1W8IA 1XTRA 3AJ9A 3DZCA 4R41A 5DYTA 3UT0A 4YV0A 3R75A 4YCSA 1M8KA 3ZOZA 1K6EA 5C35A 2QN9A 3BE6A 5LYJB 3OTOB 1SHUX 3KJIA 4MK4A 1QNFA 1SB8A 3JZDA 4OP2A 2QG6A 2OECA 4W9MC 2RC6A 3IB3A 3TQTA 2WIJA 5FEUA 3PNLA 2V65A 1F12A 4RQBA 4Y6GB 3UA3A 4RIIA 4M88A 4MA4A 3CWQA 3ZE0B 3BMQB 1UZUA 4PYMA 3KVOA 4DCVA 1W44A 3I2JA 3ZZ1A 2BMWA 5K5EA 3UB3A 1AM4D 5ELMA 1XTVA 4OB8A 1PRYA 3GFPA 4EVRA 1C8LA 1ZXBA 2EAUA 5F3WB 1PG5A 4H9GA 3DAOA 1C41A 4M1MA 4WXRA 1ZICA 2F8LA 3RYIA 4GWGA 3ISTA 1Y1RA 1DV2A 4Q66C 3VKFA 2QRHA 1Z26A 3KR0A 4HDNB 4LY0A 4M0EA 4DLPA 2JCXA 4ENQA 4AZ3A 3I9OA 4WKBA 4HDKA 1RYBA 1PV2A 4GKVA 1G66A 2X5KO 3Q9UA 1H5NA 2JHCA 1U7WA 1NWCA 3O8OA 1MU0A 1T6NA 2C9DA 1NVEA 2P4QA 3UUWA 3GLGA 2H1LA 5JNSA 1VP9A 4W1SA 1Z0IA 5H4HA 4TRNA 1OYOA 3AY6A 3DAPA 2FE4A 3BHNA 3B8HA 5JEEA 5H9VA 5JCZA 4ENWA 5DP1A 3ER6A 4EGAA 2JLXA 1SHZA 4DLUA 1CUYA 3JRNA 4IIYA 4M1OA 2Z2JA 4HQ6A 4OKNA 3MSCA 4JJAA 4JQSA 1RFLA 1JI3A 3GJ8A 4XYMA 1UFQA 4EHDA 2JEOA 3N6RA 3ZWAA 3I76A 1DEHA 4LDNA 1DCTA 1VLQA 2O1EA 1CY2A 3DQPA 2YKGA 1ZVJA 2H3EA 2H7YA 2O8BA 3KUCA 1WUTA 1ZUIA 5DV9A 2F8MA 3DP9A 3X2SA 3BF7A 4Q3DA 4CM4A 5KTSA 3L40A 1HR0B 3P20A 3RTCA 4MR8B 2PRJA 1U0FA 4TTPA 1K08A 1LRJA 1MJ5A 1Q5PA 2D1YA 3IHLA 4XX1A 1COZA 1V4BA 3IPLA 1UBLS 3FFXA 3PFHA 1KVRA 4FFPA 4HP8A 2Y8EA 4I1UA 4REOA 2YWJA 3SKXA 1YJ5A 4BNDA 3A1TA 5C1BA 1Q21A 3F7MA 2AD5A 1OIVA 2CJPA 5K05A 3G13A 2OP1A 3KE8A 4EJSC 4ZP1A 3NV7A 4WZBA 1VDMA 2IH4A 1Q1BA 2ZRBA 3HQ4O 5L3SB 1YHYA 1PVVA 3WL4A 1XNHA 2QR5A 2PWAA 1Z33A 4U6QA 5IF3A 1IK4A 4MV7A 1QH1B 3T7DA 3L8DA 4PBTA 4G63A 1YC5A 3ZI4A 1JG7A 1P4RA 3EIEA 3KTAA 1KJJA 4REQA 4XR4A 4JC4A 1E0AA 4Z3OA 2I3ZA 1OILA 3B51X 3OY7A 3N1UA 1NNEA 3JD4A 2A5FA 4R2LA 4INJA 2QVBA 3ET5A 2Q5JA 5E4JA 4G0OA 4QGAA 4LDAA 2ODQA 2EKBA 3CRQA 2B3TA 3H1PA 3OQHA 4EA8A 3U1VA 2I2AA 2HSEA 1ZBQA 3C4JA 4KBYA 1QHEA 1L8LA 2HWKA 1B6SA 2HC9A 3A6FA 4YRAA 1Z4NA 3QRWA 3TPFA 1B8OA 3SC6A 3VNRA 2WWHA 3T7JA 1D2MA 1X8XA 3KV3O 4BEJA 1J00A 3QU2A 3I12A 1F0PA 1M2HA 2C0PA 4BVBA 2FPKA 1AQJA 2GRJA 1NXVA 4MJLA 1VB3A 3EXFA 3O3OB 3ZS9A 4H6WA 1A4UA 2YYYA 5IHXA 2WJ6A 2XVXA 2ICAA 2ZRNA 1JEAA 1HXHA 1KBQA 3G89A 5HKBA 2UYCA 1EH5A 2BFDB 4Z0PA 3PRYA 1OFGA 1E2DA 3O73A 4MV9A 4DT1A 5JVDB 4IX1A 1U7HA 2QD3A 1IXRC 4LDZA 2NUBA 4C4ZA 2OPHA 5AK6A 4O4HF 4YHHB 3NM4A 5JCPA 3I62A 4IFEA 2EP8A 3DL7A 2D4HA 1YKFA 2QMZA 5KSPA 2C2XA 1A96A 3HYCA 4DR3B 4LRXA 2DPMA 4ZVMA 5LXTB 1DIGA 5BMVF 1AKRA 2DQSA 1W4AA 4XUEA 3DE5X 3GVIA 1GCOA 1FSPA 2G06A 4Z0HO 1GUDA 4LHYA 4OHUA 4IG4A 1NURA 4GM0A 5HE8A 3V2GA 5C80A 1Y4ZA 4MWOA 1A2QA 2ZYVX 4JP1A 4UHDA 2WY2D 3SS8A 1RXCA 4QT4A 4DLTA 3IP3A 3K5WA 1FFGA 3AILA 3BWBA 3GUUA 1EM6A 2ZVJA 2WD7B 3MJVA 2GX6A 3A3PA 1MEJA 3MRXA 2GM5A 1J5XA 1DRVA 1XVVA 5DBFA 5EYPA 4C03A 4X62B 2ATEA 1ODFA 3O94A 3GMTA 4MCJA 3WWDA 3TM5A 3B1YA 3A6JA 4U2GA 4KPUB 3TXAA 2MSNA 1KAGA 1YGPA 1G9XA 1I2ZA 4MR9A 4B6PA 4LFAB 4CL3A 2HK6A 1XZBA 4F5EA 3FZNA 1GNLA 3BRWD 4G5OA 2IPNA 3K5PA 2EXXA 1V4NA 2Q7XA 4IUYA 5TJHA 3ZWYA 1GIAA 4JOCA 5G41A 5KCMA 1YRQA 2H48A 4AF6A 1MV5A 2JH9A 2UDPA 3OT4A 3BJEA 4ZTZB 4C29A 4W8HA 4I50B 4V24A 2YZ7A 3GJQA 1G21E 5C37A 4OGGA 1IVSA 1GGKA 3K0CC 5HDQA 4BC0A 3HDHA 4PINA 1BIFA 2HYDA 2VUHB 3FOEC 1TD1A 3U48A 4FDUA 1CF4A 1JA1A 3IHKA 2W2KB 4PHGA 4QA9A 2VSFA 3D1VA 3GLVA 3I9NA 4X84A 3T3MB 3BHIA 1ESZA 4CLHA 1GV0A 2HJ9A 2DGDA 3P27A 5A6SB 1F8GA 1N5LA 3TTSA 4RIFA 1FNNA 2X7JA 4JI1B 3SICE 3WS7A 4ZT3A 3F90A 4G3XA 3OIFA 3WRXA 3OPYB 4TMXA 1N1GA 1XF9A 3RTAA 3PUZA 4IMIB 3ZHOA 2QENA 1LV8A 2J5BA 4LGMA 4FFBA 4B71A 5JDIA 5C5CA 1MTZA 4M9SA 2NSLA 2H29A 4ZOLF 5KMGA 3CJRA 4IIJA 4RZXA 3KL4A 4DLSA 2Z8YA 1P0MA 2G63A 2Q9BA 4L85A 3FMGA 1U7OA 5LCXA 2FUEA 1VB5A 2QU8A 3UXEA 4A7PA 4JZYA 1BAPA 3G17A 4BO3A 2IS6A 5ABPA 2AKAB 3DT6A 3WGVA 3O8QA 4MO2A 3K4QA 4NEQA 1FB5A 2PT5A 1VE6A 2IYZA 5CVJA 3KLBA 1GL6A 1JR3A 2EW8A 3PNPA 1G20E 5I7EA 4FE7A 1WOMA 1E2MA 2NGRA 2P5TB 4MROA 1CJMA 3GFVA 2DCUA 1W93A 2UYHA 1M6WA 2V7UA 1SD1A 3R9XB 1SKQA 1BH6A 3KEGA 1CEEA 3DE7X 3N9IA 5CP8A 3VHQA 4B0PA 4ALKA 1IM5A 1W36D 3KCQA 4A0SA 4MV8A 1GSOA 3FMVA 4GR5A 2YTZA 3VVCA 4EO9A 2FF7A 1CJKC 5AJWA 3ESXA 2ZAOA 4J4TA 1COWD 3HCCA 5A5DA 1SCDA 2WNHA 2O8DB 2QNIA 3BL6A 1ODCA 3FWPA 4CV1A 1XYYA 3SC2B 2G0NA 4I4TA 4UDNA 5HMMA 2R0QC 4R1LA 4P22A 4CLEA 1N0WA 2QLMA 1XDGA 1NFRA 4OOFA 1OREA 4KXLA 2O54A 4FOTA 5ALJA 3GLKA 3ZWNA 4PS0A 2C98A 3WV4A 1O3YA 5E3JA 4OBWA 2ATVA 1XG5A 3REQA 3VYUB 2RHDA 3SLKA 3AY3A 4MYCA 4A8HA 4TLLB 2XNSA 1R3DA 2X3YA 1T91A 2IEYA 5D3KA 4RZ3A 2WU8A 2V59A 1KJQA 4I5FA 4JQOA 1XTKA 3TQIA 4D9NA 5BWLA 3PENA 5HKOA 2BP7A 4NI5A 3NGMA 1DJNA 1OYYA 5ICGA 1YACA 4J76A 3CVOA 1KS9A 1MRSA 3B6IA 3DMRA 2IGBA 3M9WA 2QT9A 2JIBA 3HJCA 3FDZA 4OAPA 1UDBA 4J7XA 5FKJA 1KXJA 2HQ1A 3MM4A 4NFHA 3QBDA 4L4RA 1D3AA 3IQEA 5KAMA 5I8ZA 5TGZA 3PEUA 4NXNB 2UXBB 3WXMA 3EQ8A 2G5TA 4HOYA 4AXXA 5K0LA 4D9GA 3LKBA 3CBQA 2WVJA 2QOEA 4JQZA 3U3MA 1Z0ZA 3MWEA 3C6KA 1JHOA 2VQSA 4H7KA 4WZ6A 1A5BB 1AY0A 1XX6A 1Y1SA 1Z2OX 3F4KA 4C0BA 4JJIA 4P31A 2CDAA 4URHA 4O2AF 4AUNA 3OLCX 5DLPA 4P3YA 4CDMA 1KMCA 1D2EA 3GP8A 1OH7A 1PEKE 1Z3CA 5IVPA 3V32A 1C7RA 3G5MA 4U4AA 1YONA 5A4AA 1S96A 5HE9A 2IYOA 4UAVA 2RHTA 2Q8NA 2Q9UA 4R3UC 1VMIA 5LDGA 3YASA 3F6CA 3G2HA 1HDEA 5TJ9A 4B83A 3ANYB 3B1WA 4DMCA 2WTAA 4DTCA 1HQCA 4KQHA 4JVMA 1SKMA 3IP8A 5ENVA 2NUAA 4HYYA 3IRUA 4A0QA 2FPWA 1VG0B 3CX8A 2H1SA 2QW1A 3ZKAA 3OMWA 3GJ0A 3OPNA 3TJRA 3UANA 4G86A 4CCYB 3DDCA 1G59A 3P2EA 3ESYA 3OO0A 5F78A 5HQTA 2HHAA 5I9NA 4B32A 5PGMA 5LJLA 2IOHA 2JFQA 1M75A 5ECWA 3AJAA 5HPYB 3ZY6A 2OOSA 2RKBA 2EZ8A 1ZIDA 4GMXA 1VLHA 2VPXA 1WXFA 1WS6A 1RC0A 3IAS6 4MVJG 3HPQA 1SMKA 1HTWA 4UCFA 5EZYA 5BUCA 3ZTWA 3DUFA 4HTFA 3C2QA 4RORA 4LZNA 4RD3A 1GU1A 2Q3HA 1IK6A 3TDMA 1U2GC 1JYSA 4B76A 1XLTC 1J4AA 2EHDA 1PNQA 1TO2E 2C82A 3QK7A 1NUPA 2VPQA 2FMUA 5KOHA 3UVEA 1ZI8A 4CCWA 3ZJVA 4RJIA 1A95A 4LC1A 3TQSA 1HE3A 4Z4HA 2XPCA 1CQZA 3OFJA 2ZXEA 4TROA 1A9PA 3PGVA 4NFYA 3DMYA 3G59A 3F6RA 1RKUA 2AC2A 2XITA 5EUCA 5JT1A 3L4BA 1NJGA 4Q1EA 4X20A 4L3VA 4WJKB 1ZPDA 1SA0B 3IAXA 4PZ9A 4ND5A 4D9KA 3OZSA 3FOFC 2JW5A 4WVLA 3PWKA 1WSDA 3OPMA 5IDVA 2A5DA 1TNDA 4BO5A 4YACA 5CIYA 4Q03A 4JBWA 1K7XB 1ZUD1 4FIZA 2QTCA 5CGZA 1DAGA 1RLOA 4AU1A 4ARIA 4HUJA 4BMVA 4DEVA 4X9XA 5I8WA 2R6GA 1KDZA 4DADA 4BAZA 2Z2XA 4RLSA 1BE1A 1MVLA 2D5AA 1XSEA 3NWJA 4OQYA 2FJ0A 4GDFA 5F4ZA 4ZO4A 2EX0A 3NDRA 7MDHA 2HCJB 3JQAB 4ZEWA 3GPLA 2D62A 5DYIA 1ADCA 3HCFA 2DSNA 2PXHA 4MB6A 3IAEA 3Q8XB 3ZX5A 1A71A 1MO4A 2WM2A 2HSGA 2EQAA 3FPLA 4M8LA 3ZV6A 4F8EA 4Q19A 3K2EA 2BRUC 4FBMA 4PBRA 2O2XA 2QZ4A 4WCFA 4ZCPA 3WMRA 4C5CA 5JXHA 5DNAA 4Q21A 5F23A 4QUGA 2XE8A 2A5JA 3BH7A 3M2TA 2QRLA 1WHTA 3V1NA 4DDVA 1Q1GA 1II0A 1ZIYA 5EJ4A 5KVSA 4IUBS 4TYYA 1UL1X 1P1CA 2CVQA 2Q6KA 4P53A 4XPIB 2GZMA 3OZ7A 2K7ZA 5LSAA 1OI2A 4CU2A 1XZPA 3WK6A 5KVQA 3AM4A 1WXIA 3PXDA 3VQTA 5G1OA 4A8JB 3KJGA 1CCWA 1J0AA 1J39A 1QGYA 4E0BA 5IJXA 3JATA 3QOWA 3UGJA 3CIFA 1W6UA 4KQXA 2YASA 2RHMA 3DDWA 4N0EA 1SY7A 4IUDS 3F4LA 3AUAA 1Y7LA 1R6UA 1L1EA 3CPHA 1KVUA 3HKCA 3M4XA 4JP8A 5DYWA 2BKVA 1P5JA 1W76A 4HS4A 2R9VA 1THGA 1YBMA 4JK3A 4K5QA 4XRRA 2WFLB 2FZ5A 2OAP1 5D51S 2Q7OE 1IWPB 1F60A 1BYUA 1X74A 2VAWA 3BE5A 2ZWVA 4QBFA 4TWZA 5EG5A 1UBGA 3V1TC 1ZN8A 3MLBA 4ETWA 2NSJA 1QCYA 3D43A 2NU9B 4C88A 2FETA 1MW9X 2R3SA 1GEEA 2J7KA 3DLCA 1IWOA 4IYJA 4S12A 1E9DA 1ZN2A 3EIUA 2HMWA 4N0DA 2WSSA 2PRYA 3ZU3A 5JOQA 3QUTA 1QHNA 3C7DB 3HVUA 1FYXA 4WNAB 4M0MA 4C22A 4EO4A 3LQ4A 3N3BC 2B6NA 3HBLA 2XYQA 3JQQA 1VPWA 3EVNA 4D2IA 3F67A 2GK7A 1IM2A 2Q5FA 2XCLA 3U62A 4LFBB 3L6BA 3DAHA 3GH1A 4R2JA 3SU8A 4Q01A 1DZ3A 1WXQA 5AESA 3RYCB 1F6WA 5AUPB 5JQWA 3OESA 2YV1A 3SHFA 4AJHA 3DWFA 4DANA 3DWEX 5ALWA 5ALNA 2IX9A 2IDJA 2CLDX 2E89A 1NJFA 1LLDA 3EN0A 3OOWA 5B6JA 4YRZA 3TSAA 2IYWA 2P2DA 1PW7A 5EXTA 2Q49A 4MAFA 4UW9A 5CXSA 3BPSA 5A05A 2G25A 4EG0A 2YVKA 2C5AA 1AGYA 2IHZA 3BMXA 1N6LA 2WDPA 3CH5A 5IULC 2BBOA 1FLDA 3OCXA 5FPSA 5LD2B 121PA 3QUAA 1RIIA 2V0NA 3E9EA 3E8XA 1YQXA 1YXMA 1T35A 1KRHA 1LBQA 1RLTA 4PSUA 1UQRA 1IULA 3TZCA 1TEXA 4NAUA 3MJTA 1HNWB 1J8MF 4LOJA 1XEWX 3QFHA 2H92A 4Y9SA 2JHFA 5IJ0A 1DINA 1LK5A 1JEQA 3B9RA 3MS7A 3OEED 1WXHA 3MFQA 4JC5A 4DV0B 1SVMA 1V47A 1J0DA 1Z6AA 2VJBA 5GQSA 3KKEA 1GNQA 3KOOA 4BL5A 4DWJA 1C3LA 2DPXA 2HL6A 3GBPA 5M7EA 4U8GA 3LWNA 2Q3LA 2OENG 5BV8A 4OL9A 4E4YA 4N49A 4ZGGA 1IVNA 1EWRA 2XCSB 2QZZA 2G5CA 2RGNC 2FMFA 1PJQA 1DKLA 2PMBA 2XQJA 4B80A 1TTPB 2QT1A 2JHGA 4XD7A 5B1EA 3LYLA 4TGLA 2VWHA 4F97A 5AW6A 3HL4A 4D92A 1WHSB 4ZOBA 2XGGA 3G7UA 2GS9A 1BCSA 1C80A 5K0NA 2NT3A 4PONA 4MS1B 4MUKA 1AE1A 4CUKA 2E4ZA 4IDPA 4TM7A 4EHLA 2AXQA 3G6WA 2JFPA 4RXTA 3ZXUB 5FDFA 2PPVA 1Z6PA 4D57A 2WTUA 1O87A 2WG0A 2G72A 4Q3NA 4PZUA 4EGFA 2ZYRA 3O5AA 2ZBFA 4KSBA 4YWHA 2PMDA 1XDDA 1OZAA 1ZKDA 3IVAA 1ZISA 3MMPA 2A8YA 3JQGB 4HL6A 5EQFA 3WQHA 3A27A 3E5MA 1MAUA 3R3VA 2FCAA 2ZRQA 4MVXA 4ZPXA 4C0QC 3EVTA 4HMOA 3EFEA 4GOOD 1XMPA 2FWPA 2R1VA 3W6UA 1QAMA 1T5HX 3AEQB 1PW5A 1Z7GA 2CXPA 3G9TA 1GQRA 3NXKA 2I3DA 4HNUA 4GX1A 1AB5A 5TE9A 2FDCA 2P9YA 1JYFA 5HFNA 3STVA 5FH9A 2YCBA 3RPEA 1KK0A 1RQPA 2A84A 4ENSA 5IXYA 1A8HA 1EFHA 2AZXA 4DNPA 1HO3A 1GTL1 1JHYA 3OTGA 3X1DA 1NZDA 2VBIA 1TLTA 2DKFA 4YUXA 1KHHA 4G26A 1LNSA 3SZLA 3BB4A 2FU5C 2H57A 4C05A 1R2QA 3DOHA 4KIJA 5DYNA 1VA5A 1DBRA 2BR4A 4DSAA 2IYEA 4K0KB 1T0HB 2POCA 1SBZA 3ABZA 4O29A 5FLEX 3RTEA 2YS7A 1PDWA 3LQKA 4F3TA 2WIKA 2ZLBA 3UAZA 4U7FA 3PNKA 1I2AA 1CU1A 1ZX1A 1XNQB 1ODSA 2BBWA 4WLNA 4YYEA 4YRFA 2LCIA 2CYBA 2D06A 3T1YB 2F67A 2H1RA 2QJOA 4GQIA 1II8B 1X1SA 4MLDA 4D96A 3OZTA 1E2NA 1OZ0A 1E1NA 4R6XA 4JYBA 4H0FA 1G1AA 3NVKI 2I1QA 2REQB 3K70B 1OBOA 1GXSA 4LYDA 3L1HA 4OK5A 4Q4LA 4QT0A 4JVLA 1TUIA 5AICA 1W581 4BIMA 4U6NA 3DOEA 4L6CA 3FN4A 2X5NA 3A4YA 3RI3A 3IHWA 2BF7A 5LYJA 2A9PA 1DPGA 2Y1LA 3WGOA 5ESWA 1IZZA 2V7BA 3AEYA 2I3GA 5EUBA 3ACCA 3FG9A 3WSTA 3ZYCA 2F9FA 3HVIA 3UQZA 5KO2A 4RK7A 2LDBA 3FFTA 3BMQA 3RFFA 1XOIA 3T54A 2Z5LA 5KJ6A 2SBTA 1PBTA 3G0OA 4W5TA 3FPJA 4FKZA 1F2VA 2VPWA 3BTUA 1EJ6A 4JB8A 1SULA 2ZETA 1M8PA 1OAAA 3IUNA 1LPMA 5ALFA 5C1OA 4M49A 2MCFA 4OAOA 3B85A 1C7QA 3C1OA 4I9GA 4QNRA 3STYA 2GVDC 5LP1A 4RCYA 5KSOA 3HZRA 4HDNA 4PZAA 4EA9A 4M1QA 4WTOA 5ICEA 5P8WA 2FQYA 2VT7A 2J4CA 2BHSA 3GA0A 3N5CA 3FJ1A 4RO0A 4U2EA 4IVQA 4UAJA 3LG2A 1MO3A 2X4GA 3RK0A 1USUA 3IJ5A 1JDPA 1OFUA 4M8IA 3VO8A 4M46A 4JYAB 4PLGA 4IXNA 3W78A 3DEZA 5K0GA 4EYEA 5H59A 1AKQA 3D1JA 4BKOA 5EE3A 3F98A 3GNSA 4BMXA 1YJXA 3BH6A 3PD0A 5FPPA 2QQ0A 2D5LA 2B7LA 2HGSA 3LNTA 3OWXA 3EH1A 3A0UA 3NR2A 4FQ8A 1NJ6A 3ACDA 2IBTA 3ICEA 4N5IX 2OZVA 3W7AA 2E37A 1H65A 3GDWA 1M6VA 4XFKA 3S27A 5IUNC 1K97A 4MWGA 1U3TA 2I4TA 4RHTA 2FFJA 4PZCA 4IIFA 1E0SA 1Q74A 3C7KA 3OWHA 5J9FA 3T9BA 3AIMA 4NH0A 1P9OA 4MR8A 2KWIA 2FEPA 3I4FA 2FFAA 5AM2A 3DBHB 3K09A 3HH8A 3OZGA 2QLJA 3T9DA 1XTUA 4B5LA 3F7OA 1DGQA 2ANCA 3HMKA 3LYHA 4CIDA 3WWPA 4QARA 5G0SA 2PE5A 4J0FA 1QX4A 2ZIEA 2Z56A 3R6DA 5DGCA 1TZ2A 4OXRA 1WPQA 3LP8A 5JJKA 4LVNA 4MVJD 5FPHA 4QJ3A 5L3SA 3ZDEA 3P96A 2YMLA 2FG7C 1T4BA 2OYRA 1QIFA 3ICVA 3KJFA 4D56A 2XV1A 3VRHA 4HDQB 1Q14A 4ZCRA 5FLXA 4FJ2A 1VL5A 3BUSA 3GROA 3RYHB 3EVGA 2RGCA 1N57A 4MLCA 2W70A 3LVRE 3NHRA 5DX0A 4AS2A 4DJFC 4DUGA 1KEKA 1ADBA 1Z07A 4BVFA 1QQ5A 3IP7A 1DKQA 4ZHQB 2FW8A 1M33A 3WKEA 2WFMA 6GPBA 1I2BA 1X7XB 1ULAA 1GPYA 3KKMA 2CVZA 2ILVA 2QL6A 4Q7KA 3FNHA 5DBIA 2GTPA 4NICA 1M5UA 2G7ZA 4DCOA 1NNI1 3GVXA 1ZGZA 2ROQA 2X9GA 3JVEA 3NT2A 4DLRA 5EJEA 2AQKA 3AHHA 1PYOA 4O4IF 3EIHA 1ND6A 2DR0A 4RPCA 2Q1XA 4MX8A 4YX9A 1TRKA 2I6XA 2PAFA 3A04A 4MVJF 1EUDB 4NBTA 4DG9A 1VSVA 2PSEA 4EIWA 4JP3A 5LWHA 1BKYA 2JJ2D 3F6EX 2WWVD 2BFDA 2J5XA 2WSIA 3O90A 4FE4A 4US1R 3ZOKA 1Q0SA 2ODEA 1W2WB 3ADCA 5JVDA 1E0KA 1U5AA 2G8LA 2QZSA 1EUYA 3S1LA 3S4YA 3EXIB 3HEMA 1MTOA 1TEHA 2GCNA 3H0EA 4PIMA 4RKEA 3NYQA 3QYAA 3JWJA 1TCBA 4TKLA 2HTFA 4NECA 4YP9A 3ZWVA 5AW0A 2OGTA 1ISFA 2XHZA 3QJ5A 1AV7A 1N7GA 1VPLA 2AI3A 2EGUA 3SBEA 1HNXB 1VI2A 1V8FA 2PKQO 3UJHA 4M0LA 5E9JA 5K0FA 1B8NA 4IOJA 4DC0A 3LBAA 2YN0A 3PF9A 4PQEA 5AW3A 3OIUA 4EGSA 5K20A 5TQ2B 3H8VA 1OFIA 4NH4A 4OQ4A 4QKQA 3IAHA 1OUMA 1F2TB 4NOJA 1EP1B 5HUJA 3BSWA 5E7MA 1KC1A 1LPSA 3FCYA 4TVBA 5HG0A 4FYYA 4ZYZA 2B82A 3WZMA 1U2PA 3DEFA 1V7PC 3NB0A 4E88A 3PQ3A 4M1WA 2OO3A 1O6ZA 3CUWA 1NXOA 2WD7A 3R5XA 1R6VA 2V0CA 3I6QA 4UXHA 1W25A 1P5FA 4OPMA 3PD7A 2GUGA 3A36A 3IKMB 2C4HA 1DAOA 4MKRA 4LHEA 3OMXA 4D9EA 4QATA 3RAFC 2ONJA 2OFOA 4DMHA 2O57A 2W48A 4V0LA 5LVAA 3TFOA 2Z3ZA 5D7BA 2VQEB 1HDYA 3BJIC 3WLJA 2EF0A 3BA6A 3SHVA 1Q1ZA 5D87A 3M0EA 2JFHA 4B6FA 4AURA 3S29A 1FSGA 2HRBA 4HG2A 4I50A 4UNRA 2W6MA 4KODA 4OMDA 4G36A 5JASA 5ENDA 1SK9A 3FMFA 4MVWA 3TL3A 3L8YA 3ML1A 4WBXC 1Z4IA 1JMKC 3GWGA 3PUIA 1D6MA 1KY5A 3EBPA 2YDXA 1HZJA 2HJRA 4KYUA 2YXBA 2W2KA 3GFOA 3H1AA 4FYMA 3T7RA 4IEFB 2BGTA 4YJKA 5LQDA 2CD9A 5A6SA 1JPUA 3DQQA 3QPBA 1QFMA 4XOUA 4W9NA 3D4OA 2D74A 2EW1A 1T8PA 3MGBA 3PUKA 3E3OA 4I66A 4DWVA 5IAOA 4A8PA 5GOTA 3DMFA 5HW0A 4JI6B 3OPYA 2VSXA 3P9XA 3TI7A 3RIGA 4FR0A 4JOSA 2WSSD 1CG6A 3NDJA 3PIRA 5CU7A 1YK1A 1TMYA 1MJGM 3QX9A 1HLPA 3S2YA 2YC2C 1RPNA 2QLFA 1JYEA 4EDHA 2XB2A 2QM3A 1E98A 1AHNA 1LDYA 2QTGA 2OL4A 2WNSA 1X7YB 4FOOA 1AK1A 3LLCA 4JBIA 3FZEA 1W5BA 5KNLA 4R54A 2IS2A 3D8UA 1FEZA 1V7ZA 1GNTA 2FSSA 3DVAB 1DJMA 1POWA 2FGJA 3OCCA 3QLVC 2DXIA 2HGZA 1GL9B 1ILWA 1VZ2A 2O0JA 2GRAA 3AHCA 1C4XA 4EGQA 3A0RB 4XQEA 3KJNA 2G36A 1DE0A 4KWTA 2ZQZA 3E5NA 1GJRA 3I0MA 4U0JA 3U5ZB 2J33A 5ENZA 3WXBA 1P1RA 4HH0A 2P4HX 1QLWA 1YS9A 1ZM9A 3SJAA 4QXOA 1GSIA 3WNBA 1Y5LA 5JI3E 2JLQA 3LMKA 4IIXA 2F3RA 5AVSA 2EVWX 3R9XA 3B6MA 1GNSA 3QP9A 2WABA 3DLBA 1FLAA 5AYVA 1M83A 4Y0NA 1RWPA 2PD3A 2YBDA 1QR6A 4YV7A 4HNSA 1Y8ZA 3H16A 4OGFA 5CBPB 5AVQA 4PX9A 2O8DA 4PZZA 1NVBA 1HTTA 2GEBA 4WBNB 2WUVA 1KZ1A 3SC2A 1W0CA 2Q9AA 2YY6A 3K1YA 4D0NA 1AURA 3KEFA 4RVSA 1GQQA 4ARAA 3KQKA 2CV0A 4D4JA 4L07A 4C7BA 3CVYA 4JBHA 4B7XA 2QTRA 4WK6A 2IHYA 2YW2A 1PCXA 4XASA 2BEVB 5H16A 2X5JO 5JMPA 3IKJA 3ZIDA 4C08A 1W7AA 3A4LA 4HT3B 1RI4A 1HETA 3T7TA 2CCJA 1I4OA 1G2OA 2C1EA 1BA2A 4G9EA 2W8BB 1XR3A 2P11A 3W5IA 4FZRA 3AF4A 2C92A 2FSPA 5DT9A 4UM9B 5HZKA 3CVVA 1YJQA 3SMVA 2V96A 3CG0A 1CUCA 4G8BA 3P0HA 4GXRA 5KSYA 1LY1A 3ZI7A 4B9AA 5BNTA 3DDOA 4DRYA 5KWJA 1GAWA 1KEUA 3PUYA 4J4HA 5BSHA 2WJJA 1Y6GA 4TTRA 2PS9A 1AUPA 2LUOA 2QQFA 1RIFA 4F3YA 3U4MA 3R24A 3IMFA 1WM1A 4FOSA 1SUSA 1PZNA 2NNLD 1XRQA 2AEMA 4CZ2A 1CY6A 3ZW9A 3PQFA 4EK9A 4F3RA 2QRNA 1RCFA 2L19A 3TTVA 5M04A 3TQHA 1F06A 1YCFA 3O3CA 2AKYA 3L8MA 3OE7D 5K99A 2R68A 5CCXA 2WP0A 4BQOA 3RS0A 1NDUA 2VJMB 1DSSG 1JT2A 4CTMA 4FFMA 4RJ2A 3WKBA 1PGOA 2VJOA 3HFSA 3AERB 1CQJB 1WCXA 1RABA 3M9LA 4AVYA 1TB4A 2G4VA 3NHUA 3NPAA 3OZCA 4IICA 4LECA 4Q7QA 1I1QB 4EMBA 4GZMA 3R20A 3ETDA 4BQQA 1KH3A 4ZEXA 2ZRHA 3KSRA 1YRWA 4K1XA 4BMDA 1JF8A 3DB1A 5I5GA 5I7RA 4DBVO 1IN8A 2EKQA 1NJSA 2I7VA 2QRGA 3FI9A 4G24A 3D7NA 5HKKD 3R0VA 2JFXA 4TN1A 4FCVA 2HEIA 3BN3A 2HW8A 1EQ2A 5DHSA 3RO7A 3LKZA 4HWKA 1Q1EA 1WVMA 3QKRB 3V8VA 3NDBB 3HV0A 1YZYA 1K5DA 1ZK1A 1A1VA 5I3ZA 4OI1A 5C8YF 2IS1A 2BEUB 3QZUA 5H3LA 4OVKA 1XTBA 4CCYA 3A05A 4CGYA 2JKVA 3MJDA 1ND5A 4J8PA 4RVUA 1D7OA 3C7TA 2JH3A 3LZDA 3TIXB 4OLFA 4DQXA 1QIEA 2EG9A 4KPYA 4CGZA 4HDSB 1KZ7B 1XD9A 5GWXA 1ZM4A 3G2MA 2O8CA 1XZGA 2YX1A 1H0RA 3ER8A 1CZLA 4JKIA 5B30A 3PHHA 1QMGA 4AUKA 2X9NA 4X5OA 1WZIA 3ECCA 1EVLA 1Q1NA 3D4PA 3R0QA 3WK8A 1M2EA 4L50A 3B9QA 3Q7SA 5B58T 1YE8A 4H16A 3VI3B 4RH1A 4AJ2A 1JDBC 1QS0A 2OV4A 1PWYE 3JXEA 3G0IA 4QGFA 4EJFA 3STUA 1KFKB 4MR7B 2PH3A 4L15A 1M1YE 4IDHA 3INRA 4BEWA 4QVKA 1I9GA 5BVGB 3AY7A 4BCBA 3EEOA 4RNDB 3AFNA 4KAXA 3UATA 1MQAA 3VU3A 3ELWA 3N53A 4NFSA 1V3TA 4CQMB 1SA0A 3KJHA 2BE9A 1GYRA 2IKSA 3CRNA 4AJNA 3OURA 4IDBA 2P2SA 4M1EA 2AJTA 1WPXA 3G0CA 4M7OA 4S0XA 4P0QB 4DMMA 4RHCA 1E1KA 4X24A 1R3UA 1MO6A 1FP4B 3P0JA 4YO7A 4GR9A 3NATA 1HE4A 3EZ7A 1XVAA 5DIFA 3TTTA 1C4WA 4JL5A 4JYMA 4ENRA 1EWTA 2F00A 3HKBB 1C7EA 2FRXA 4P36A 1LJLA 2JA1A 4HX5A 1SOMA 4ZA2A 3UOWA 3KXPA 2ASVA 2GYYA 3N70A 4PGMA 4UTOA 4BVLA 4EPTA 4LX8A 3T1VA 2JAOA 4MUEA 1TQ8A 2XRZA 1A5ZA 3B1JA 3NONA 2V1UA 4BYGA 4GX5A 2KBFA 4RTJA 5EIXA 1X38A 1I01A 1SZCA 3JQAA 4OP1A 4E6PA 3FOZA 3FH0A 2DY0A 4C5BA 3UJDA 3N8NA 1OT5A 2PD4A 1DIHA 4UU1A 3O8BA 5L4SA 4MW7A 3KZOA 1BEUB 3M6IA 4JR0A 1SBHA 2XOKD 4OSPA 4JUCA 4AI6A 5KWIA 2VDUE 3LBFA 2YRXA 2ZBQA 3I9V1 2X0FA 1T9GS 2PAAA 3F3KA 4KZKA 5GONB 2I87A 3JWGA 3W04A 1D09A 4MGYR 1WAMA 2F7SA 2OLKA 4FX5A 3P5BA 4XPIA 3UJ7A 4M38A 1JL3A 2WG2A 3QNWA 2PGJA 1KOLA 1E4VA 1T9KA 1ZD8A 3C3MA 1PG0A 3EC1A 3NKFA 4NABA 4PYKA 5DH9A 4A8JA 5BSGA 1MVOA 4II3A 1G5TA 1RM5A 2ZDGA 4Z4GA 2FWJA 2Y1OA 3VBCA 1JAIA 1XCGB 4MRRA 4DKXA 2NYUA 1Y1TA 3PDJA 2BDUA 3RB8A 3FKSD 4AS3