3EODA

Crystal structure of n-terminal domain of e. coli rssb
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
115
Chain Sequence
b'QPLVGKQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAGLKLLEHIRNRGDQTPVLVISATENMADIAKALRLGVEDVLLKPVNRLREMVFACLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hnr
publication title The structure of RssB, a ClpX adaptor protein that regulates sigma S
rcsb
source organism Escherichia coli k12
molecule tags Signaling protein
total genus 38
structure length 115
sequence length 123
ec nomenclature
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3eodA00
1W25A 2FSPA 3HJFA 1RPJA 4XAQA 4MAAA 2M98A 3CG0A 3QLUA 4M88A 2B4AA 2QSJA 2VK2A 3LUCA 3O1HB 3FFTA 3H5LA 2LPMA 4O5AA 3BRSA 2A9QA 4MS4B 2PUFA 2YHAA 2FVYA 1ZY2A 1ZGGA 1GUBA 2NZVG 4JB0A 5I4CA 1QMPA 2MYUA 3T95A 3HEBA 5IX8A 3I5AA 2FW0A 3EGCA 4PE5B 2PKXA 3OMWA 2FMKA 2X7XA 3Q9SA 4EVRA 4LZLA 5IEJA 1U2QA 4NCBA 4N03A 5TPWB 1EWVA 5IUNC 5DGCA 1QQAA 3FFWA 2IYNA 4YLEA 2R48A 4EYGA 1D5WA 2JK1A 4N0QA 4IF4A 4D6YA 3FFXA 3N6VA 1DZ3A 2IPMA 3LMKA 4P98A 5HM6A 1XHEA 3KYJB 4WXMA 4MS1A 3KTOA 1JFTA 2PL1A 3HDGA 1NXPA 4KNYA 1LJLA 4G0ZA 2AYZA 3IP6A 1LBIA 4F8JA 1M5UA 4ETNA 3UKJA 1D4ZA 3EQZA 4QYWA 4EUKA 2PE5A 4G97A 4MQFB 1PEAA 5FWXA 5CHYA 1K66A 4LX8A 1ZAYA 3MMNA 3LFTA 5FWYA 4JOQA 3DBIA 4Y9TA 2RJOA 2WJWA 1BA2A 4MRMB 3D8UA 2XDYA 1ZH2A 3H6GA 2QR3A 3QK7A 3RVRA 2FTKE 4D6XA 2PUAA 4DADA 5IUJC 4FE7A 4OLBA 3HV2A 4YR7A 3H1EA 3T6KA 2E4YA 9ABPA 3FMVA 5TQ0A 2NT3A 1L5ZA 4RDCA 1QP7A 1AB5A 3NNDA 4WWHA 4FB4A 4F11A 2LBPA 4KVFA 4RK5A 3VNBA 1ISRA 3QELA 2JB9A 2QVCA 2E4VA 1C4WA 1W9HA 2GI4A 2RJNA 3C3MA 4YO7A 3IDOA 4XXHA 3QLTA 1XHFA 3HVRA 2GX6A 4MS3A 3KLOA 4JAVC 4G0PA 3H75A 4RKQA 3BILA 3GYBA 4CBVA 4UHJA 1PNRA 4OG2A 2ZWMA 3GL9A 1YVUA 4EYQA 1DCMA 1KGSA 3JPWA 1JDPA 2I6FA 1USKA 4QPJC 3O2QB 4Q7EA 3F73A 1JYEA 4TLLB 2E4ZA 5TE9A 1JBEA 1DP4A 1TVMA 2FMIA 5F64A 3OO0A 5C5EA 2PUBA 4RSMA 6CHYA 3NNNA 3HK2A 3E61A 3TD9A 1DRJA 4Z4FA 5KWSA 2O20A 1M5TA 4RV5A 5KC8A 4KMRA 1DBQA 4HNRA 4ETIA 2HJ9A 3KKEA 2PUDA 4Z4IA 3SAJA 4Z4HA 2F8TA 1JF8A 4RK7A 2P4UA 1J56A 2HQRA 3JVIA 2JVIA 3A0RB 1YS6A 3OM0A 4OBBA 4G0QA 4P1ZA 4NV3A 3KG2A 5FWXB 1S8NA 2L18A 4IILA 5IBQA 2L2QA 1Z12A 3HSYA 5FWYB 1E2BA 4WUTA 5TQJA 2E4XA 5TQ2A 3SY8A 1ISSA 3SM9A 4W5RA 4WZZA 3KS9A 2IOYA 4F06A 4XARA 3H1GA 4XLTA 1P6UA 1JWLA 3Q7TA 4PEVA 3HCWA 3OLXA 5TQ0B 4UHKA 1ZDMA 4RK0A 4WT7A 3Q15C 3H5IA 3Q7SA 5CNKA 6ABPA 1JX6A 3OQNA 1DG9A 1Z26A 3QELB 2KYRA 3BRQA 3QLVA 2HQBA 3DZDA 3M9WA 3RVQA 3NNSA 4G0XA 4MS3B 4RWEA 1SXHA 5E3JA 3H6HA 3LUDA 3CNBA 3LUFA 1R8JA 1FFGA 4G0OA 1P2FA 5HKOA 1LJUA 1YTUA 4PICA 5DCLA 3A3KA 2M1ZA 1P6QA 1D2AA 4RY8A 1SXGA 3LUKA 1GCGA 1Z13A 1KMIY 1Z25A 5GQSA 4EGSA 3GBVA 3HUTA 2JBAA 1CHNA 3EAFA 5IULC 4MYRA 3CG4A 2IKSA 1YIOA 3M9XA 3O21A 4YP9A 3CZCA 1LBHA 2W42A 4YS6A 4Z99A 4NICA 1DCKA 3CLKA 3CHYA 4RXUA 4G0YA 3TO5A 2FEPA 3F7NA 3LUGA 1QP0A 4N0PA 2PUEA 1MAVA 3H5OA 4ML3A 3RQIA 1FSPA 3MIZA 4RXMA 3LKVA 4RY9A 1BAPA 3LTEA 3N0XA 2GKGA 1FFWA 1Z2EA 4Q6WA 4TN5A 3HO1A 4KRFA 4WXEA 1K68A 3OQMA 4LDAA 5T3YA 3JTEA 1RXEA 3RVMA 5BQ3A 4N47A 1JH9A 2FLKA 1ZGZA 3DGEC 5TQ2B 4Q6BA 5B3JC 2FQXA 3Q41A 2E4UA 4G86A 5DKFA 4O1IA 1KRWA 1D1QA 2PL9A 4XFKA 3BREA 3ILYA 5JNRA 1FQWA 1USIA 1ZH4A 3SQNA 1USGA 1JFVA 1TJYA 1PUXA 2FQWA 1E6KA 1RXIA 2V0NA 4OTZA 3O2JA 3HZHA 2GBPA 1QKKA 3RVJA 4MR7A 4H60A 1CEYA 1VKRA 2CD7A 3H5TA 4MGEA 2HPHA 4DQDA 3IP5A 4KZKA 3CTPA 4PYRA 1UDRA 2IPLA 3B2NA 4EY3A 1A04A 3OLVA 3QLVC 3L6UA 3GA5A 1EWTA 3FDFA 3C97A 3OQOA 2JVKA 2JBAB 3GBPA 2QW1A 2ZAYA 1FFSA 3RVOA 5TPZA 3QLUC 2TMYA 1QO0D 1JL3A 3EJWA 3JVDA 4H3KB 1MIHA 1ZN2A 4JB2A 4TMYA 4G0MA 2FLWA 3CFYA 3HDVA 3KYIB 3JPYA 4RS3A 1EFAA 4QYMA 2PJUA 4E7OA 3OO1A 2MYNA 1P8AA 1T34A 2NZUG 2OQRA 1OXKB 3RVSA 3QEKA 3MA0A 1NXSA 3O1IC 2H0AA 4LE2A 2R25B 4KK3A 3RH0A 2H3HA 3EULA 1JLKA 4YWHA 5BRJA 3O75A 4RU1A 1BDHA 4W5NA 3MQ4A 1DBPA 1ZHHA 4MS1B 4ETMA 4RK6A 4ZMRA 2QXYA 3K4HA 3FGZA 3ROFA 5BR1A 1VLZA 1TMYA 4TLMB 2MYTA 1Z17A 2FXIA 2RDMA 1MB0A 1NTRA 1DJMA 4HYEA 4F12A 5ED4A 5GOTA 3T8YA 3S99A 3OLYA 1L5YA 4KV7A 2CWDA 3RVLA 1E6LA 2R4QA 3KCNA 3Q7RA 3HXMA 4JASB 4YCSA 1VPWA 4ZJPA 3LOPA 5JNSA 2A9OA 2E4WA 2MSLA 4EVQA 5IEBA 1D1PA 2CHFA 5FBHA 1HEYA 2J48A 4RK4A 3LUAA 4GNRA 4KQCA 1Z16A 2N9UA 4MR9A 2L17A 2WRZA 4MQEA 4D74A 4RXTA 5KQPA 4W5QA 1C0EA 8ABPA 3G85A 4XASA 4MR7B 5KQGA 2WY2D 4DN6A 7ABPA 4KFCA 4H3HB 1IIBA 4RZSA 4ZYLA 1RNLA 3VNAA 5JNUA 3BBLA 1JDNA 3CRNA 3RVPA 3O2SB 5JNWA 2FQYA 1Z18A 2F8SA 3DLHA 4B09A 2VUIB 3URMA 1SD5A 4RY0A 5FBKA 1NXVA 2WJAA 1ABEA 5DTEA 2FEKA 5DLEA 1BVHA 3HUUA 1QPZA 2BGGA 4MRMA 1M2EA 1NY5A 4RK1A 1NXXA 3MM4A 2QU7A 4LE0A 3OMXA 5EWLA 3HS3A 3N0RA 1H9CA 2ID9A 3F6CA 5JS1A 1RZRA 2VYCA 4L85A 1YMVA 4Z4CA 4FE4A 3D02A 2R47A 1PEYA 3IP7A 3M6MD 1A2OA 1EWKA 3LKBA 5KC9A 3ILHA 2FN9A 1PHRA 1Z15A 2QVGA 3I45A 3OLZA 3CZ5A 5HSGA 3RVNA 4NQRA 4HNQA 5KQMA 4LE1A 3OLWA 1SRRA 4LDZA 1OXBB 3CU5A 5PNTA 3UUGA 4E7PA 1WETA 4MLCA 3KSMA 4W5TA 4MPTA 4W5OA 3MYYA 2MSKA 1NATA 4IGAA 3F6PA 3N53A 3GV0A 4O1HA 2IDMA 3K9CA 5CNMA 1NXTA 2FMHA 4N41A 3H1FA 3JY6A 3I42A 3P9YA 3R0JA 3O1JC 4MR9B 2ID7A 1QNLA 4MQEB 1ZVVA 1M2FA 2JRLA 4KREA 3NHZA 3JS5A 3C3KA 3MF4A 4KQ9A 4OLAA 2LUOA 1Y1LA 2HSGA 1JHZA 3TX6A 1JYFA 2PUGA 1YS7A 5T7BA 2FMFA 3QEMA 4JA2A 3GRCA 3NHMA 5EWMA 1U2PA 2A9RA 3EQ2A 4HNSA 4KPYA 5EWJA 5HQJA 5ABPA 2JCGA 3H5VA 5TPZD 1DBWA 2DRIA 1XWWA 1DCFA 2A9PA 1GLGA 3HM9A 3SNKA 1QQBA 4S05A 4IMIB 2Q5CA 4S04A 1BDIA 3T38A 3QX9A 1A0OA 4Z9BA 2QV0A 2LP4Y 2MSWA 5EWLB 3GT7A 5JNVA 3IPAA 2B1JA 1GUDA 3CS3A 1F51E 1AB6A 2CHEA 2WMYA 3N8IA 3O74A 4MR8A 1QP4A 4Z4GA 3RVKA 2PMCA 4L4UA 3W9SA 3LUHA 2LIVA 2OENG 5C5CA 4F3TA 4Z0NA 5CNIA 3C6QA 2RGYA 5JNTA 2YHBA 3L49A 4YRZA 3IPCA 4YV7A 1YK1A 4GPAA 3LUJA 4PZ0A 2WB4A 3DGFC 1LK0A 1U0SY 2IPNA 1URPA 3NBMA 1DRKA 3A0UA 4KK4A 4MS4A 3ROTA 5BRAA 2VUHB 2GWRA 4JP1A 1NXWA 2PAFA 4NCAA 1E6MA 1F4VA 1QO0A 3E3MA 4RKRA 4QICA 1EHCA 3OM1A 1MVOA 1YMUA 4Z4EA 2IPAB 4LRQA 4EYOA 2P9HA 3TB6A 2FEWB 2MYPA 5CNJA 4N76A 3A10A 5TPWA 3SG0A 2WWVD 3KLNA 4Z9AA 2JVJA 1U8TA 1ZITA 1APBA 3I09A 3EDCA 3QEMB 3CKMA 3G1WA 5EWMB 3EODA 4EYKA 1BDJA 5EWJB 5IUKC 1EAYA 3N0WA 2QZJA 2NUBA 3UK0A 4EVSA 3H5WA 5B3JA 1KRXA 2NT4A 2FKAA 2FN8A 1CYEA 4OATA 3QX8A 1VRVA 1YK0A 5KQLA 1DC7A 2PLNA 4IMJB 4MLDA 5JS2A 1ABFA 3TMYA 1JFSA 1SXIA 1DC8A 2PUCA 3GWGA 4IRXA 1B00A 4MQFA 1NXOA 5KI6A 3N75A 5IC5A 1Z2DA 4YGXB 4ZMSA 1RZRD 1PNTA 4MR8B 3KHTA 4ZPJA 2HQOA 1I3CA 1ZESA 2AYXA 1TLFA 5D2CA 2L19A 3DLBA 3IP9A 3C3WA 3KJXA 1GCAA 1U04A 1MB3A 1TM2A
chains in the Genus database with same CATH superfamily
4KPGA 3BMXA 2WFZA 2G6BA 3CKYA 3FI9A 1P31A 3HLTA 4HAIA 1GNLA 1GPUA 2Y1EA 3EB9A 1PJBA 4WK6A 4AKSA 4TLCA 4H7DA 1FNCA 4JYCA 3FCYA 1DRWA 2A9QA 3NI2A 3PT5A 3CQ9A 4FM9A 4WSOA 3OKFA 2DKNA 3H2JA 4IZHA 1IE3A 3BMNA 3HEBA 4IS2A 3E7FA 2V98A 2X42A 2Y1DA 4Q4DA 4BC1A 3ZI7A 3BDAA 4RKEA 1D6NA 4MUJA 4F2WA 1OA1A 5AJYA 1GAXA 5AKEA 1XXLA 1KORA 1Z0JA 2PTHA 3ADKA 3G8CA 4RVFA 3VV3A 4JI4B 1W19A 1WZEA 4QULA 5H3CA 4YRGA 5TPWB 2JLZA 1BGXT 4MRRA 4UBMA 4DIEA 5AW4A 1XE3A 2BH9A 4X45A 1D5WA 2D7CA 1Q7CA 3UTDA 1GPKA 2VK1A 4U2CA 2IPMA 5EL0A 3MD9A 2ZT5A 2OKGA 1S8AA 2UUCB 4L4YA 3R75A 3TYXA 2GDZA 2E18A 1HQYE 5H3LA 4ZV4A 3KTOA 2CSXA 1FBNA 2XNCA 3OZBA 5IASA 1NHGA 4JYZA 1NQWA 4G0ZA 3WSWA 5HPYB 1CY2A 2AYZA 2B8TA 4LN1A 2NO6A 4P3NA 3DHWC 1LBIA 5DSXA 3LK7A 1QONA 1OYYA 2PZJA 4B9EA 2Y99A 3VH3A 3OKPA 4NDAA 4EUKA 3KZKA 2Z6QA 3VAYA 3T3EA 2BCGY 5FWYA 3ZDEA 4MUXA 4MRMB 5LQDA 1NVMB 4BVBA 5EUCA 1PG5A 3EH1A 3EWAA 4X93A 5GM2A 5AOAA 3PQ2A 4EAAA 5C7IO 1EBFA 5ARBA 1EYZA 4YR7A 3LYLA 5KYVA 5IUJC 1PR2A 2EX0A 4NAUA 3VPSA 2XBUA 5HJ5A 5JJ5A 1RAAA 2F3SA 2ZRMA 4MZXA 5CM2Z 3UF0A 3FUXA 4AXBA 3VNBA 2XKJE 4FCWA 3V7YA 1RWBA 1MDFA 2JB9A 2X0FA 1RMYA 4HG2A 3NPAA 1IXSB 4UBLA 1O96B 3HP7A 4KQIA 2GN4A 1KHHA 5C18A 3E03A 3T3DA 1E7MA 2PZFA 2QMOA 1GGEA 5EI5A 2C5HA 2WAMA 1M2GA 1XNQB 4UFOA 1UR5A 5KYUA 1XAGA 5CLLA 5A0TA 1FMTA 1YR3A 5COQA 5C7OO 3IDQA 2YYYA 3GL9A 3DB2A 1GITA 1US8A 3UCXA 4EHDA 3KC2A 3DR5A 4H3VA 3A06A 5GADl 2XNKA 1X8XA 1G2QA 3VDMA 5K03A 4HDQB 2D2XA 3BKWA 4JSTA 5CDTA 1AQJA 5E1OA 1GTJ1 3PKJA 3C85A 2PT7A 2EX1A 2AG0A 4CEJA 2FK7A 4YT4A 5D87A 4XUDA 2JD2A 3QA3E 1LPPA 5EE0A 2QGFA 2WKWA 4DCGA 2DJ5A 4JVNA 2F62A 2QI9F 3BN3A 3KOUA 5TXGA 2XT9A 5KWSA 1JQLB 1NF9A 4HN2A 1BHQ1 5LZ7A 2ZJ1A 4FHGA 3STTA 1Y6GA 4DYDA 4AZVA 2PVPA 3UANA 4F2GA 3I23A 1A9QA 2NTEA 2OQIA 1KH2A 3ZE8A 1GNVA 3C7CB 4B4DA 1QVVA 1DJQA 4IILA 2ZIXA 4PRKA 2HTFA 3RF7A 4F3KA 5IDXA 1J5PA 1TA9A 4H08A 4RMHA 4WUTA 5DISB 1NBAA 1M8JA 3SY8A 4IOMA 1K5GA 1X8JA 3GFBA 4ZXFA 4A16A 1Y3FE 2OA0A 4JXXA 4XLTA 1N7HA 4K9KA 2Y1WA 4OA8A 2P2ZA 3H5IA 4XX0A 2W83A 4TRJA 3STUA 2JLXA 1XQYA 3L8ZA 5MHTA 2P2GA 1HL7A 2GPBA 1WP9A 3UY4A 4Q1VA 2DEUA 3AXSA 4B3TB 3ZWCA 3RVDA 3TQTA 1R8JA 1FFGA 2W6JA 4M7OA 2K7FA 3CY6A 3WL8A 2PM8A 2B6HA 3W5AA 2JFWA 3HNOA 3DE3X 4LOIA 5DCLA 2M1ZA 5DYNA 1QP4A 4ZQBA 3U6BA 4J03A 2C4UA 2GM4A 1ZICA 1KMIY 3EGOA 1NWCA 4RF2A 4EGSA 1NQVA 2WFLA 2K87A 3AJDA 2A9JA 2FRXA 4GMHA 1FY2A 1UJ4A 3EXFA 4I5DA 4OH7A 3O21A 4ALMA 1QTIA 1X86B 3QUQA 4C0HA 4CR6A 1BHJA 4FR5A 2BSQA 1BC5A 1H94A 1NVEA 3PZBA 1PKEA 1T8WA 2ZTLA 4ON9A 1OFUA 2PKQO 4IYRA 3LS2A 1QP0A 3GLHB 1FUKA 4YREA 4B8YA 1GWNA 3AUFA 3H5OA 1QGAA 2CBZA 3W9YA 2HJVA 2HF7A 5AM2A 2F3RA 1R5BA 3EBLA 1GUYA 1N9KA 2NTNA 3GLTA 3HKBB 4IJ5A 1GR0A 2CVZA 2EV9A 3NBQA 4H17A 2IYQA 1Z29A 3V1KA 2VYVD 3AFIA 4Q1CA 4JC8A 2JCYA 2C84A 1GZHB 2VPPA 4B87A 3H0EA 3A6LA 3NDJA 4JITA 3MAGA 1V5WA 2YJTD 3A6PC 3AVTA 1ND6A 3RG2A 4G2NA 4JKOA 1BU5A 2O50A 4HQRA 1MX5A 3FMGA 1Y82A 2QLMA 3BWYA 2FR1A 3U9LA 1Q0ZA 4KQEA 1ORWA 5JBQA 2A35A 2VAXA 3C6MA 3NHPA 3PFBA 5FI0B 2PL9A 1HY3A 3HJBA 4XFKA 5FTJA 2VUUA 4DGSA 4OYRA 4YUWA 3BGVA 5BVGA 3EC2A 4BV3A 2CK3D 3MZ0A 1SUWA 5IJ9B 1GZ6A 1QQ6A 1FVFA 2OO3A 3FNRA 2H7YA 4WV3A 3H8VA 3TSYA 4TZKA 2JJYA 3T9DA 4IUCS 5KTTA 2D3TA 2IIBA 3RVJA 4H60A 3H84A 2N75A 3LCJA 5SY4A 2GEJA 3H17A 4E4RA 1CEYA 1UEXC 3KWLA 4FWTA 2GJ4A 4BLRA 3I6YA 3BK1A 1C1DA 3MWDA 4OB6A 3TIVA 1KI3A 1LW6E 3AFOA 1IDOA 1YBMA 4RBNA 1A04A 1HYBA 2P9CA 1AKNA 3NAZA 3GA5A 4I1SA 3LKDA 2JLBA 4IGIA 3R8FA 2JBAB 3JR7A 1XC7A 4WN9B 5A06A 5JWOA 3SZ3A 1NMYA 3DEIA 3A3PA 4H3KB 1DC6A 2C77A 4DXAA 5J4HA 4PAQA 1RJ9B 2VJMB 1B0ZA 5JS6A 3HDVA 4IS3A 4G81A 3UJHA 2EARA 1ULTA 4INJA 1T9GS 4BNJA 1YDEA 3OO1A 4CM5A 3O31A 3WMRA 1P8AA 5AHWA 3PS9A 5JDIC 1OX5A 2R9VA 1C3EA 4OBEA 3RYFB 1EESA 1Q0LA 5A3RA 3H18A 3D7RA 4Y2XA 3VI3B 1SB8A 4JYMA 5LZ8A 4ZVKA 3SIWA 3DT6A 2GJ9A 4I5EA 4EUFA 3TEMA 5KTPA 1IMOA 1I1OA 3MQ4A 2B2CA 2RJ3A 1EVYA 2GD2A 2ZRJA 4JCCA 2FHSA 4FS8A 5JHGB 3H1AA 3L93A 2A14A 3KSBC 2GJKA 2QTGA 3F7TA 4RV4A 1LS1A 3OOHA 5GOTA 5AO9A 2RE8A 1J22A 1MU0A 3ZV5A 2H4ZA 3GQBB 3SOZA 1GU7A 2HJSA 3KCNA 1PS9A 5E9JA 4YCSA 4BATA 2IFTA 2P6PA 4HAYA 4YRAA 1P80A 5HHTA 3KEGA 4KYTA 1YR1A 2NZXA 2R1ZA 4KRGA 1UZNA 1L1QA 3KP1A 2CJXA 4XASA 3UJPA 1I3NA 2WZQA 3CEJA 2ZI4A 3AMVA 3OZRA 3U17A 1Z7WA 1J99A 3NHAA 2WJ6A 4HEJA 3WX0A 4BB0A 3JD1A 1D4FA 1N6OA 2GAIA 2M1XA 1PR4A 4MO2A 4PSDA 4UAVA 1M6WA 2P40A 4QXAA 4IO1A 4E6PA 4FOTA 1A9XB 2L0XA 3LBIA 3OIYA 2JLUA 3UPDA 2FE4A 2VJAA 1HEUA 1H0HA 4Z9FA 2DTXA 3I01M 4AZ3A 3PNMA 3K31A 2B9VA 2D3WA 4BAUA 1E5VA 1PV2A 4DJTA 2X8AA 4TKVA 2G7ZA 3M6IA 4UBIA 5JSYA 3FRHA 3TD2A 1ZHFA 3T7IA 4CPDA 3KPVA 3ZDZB 1M72A 3PX2A 1Q50A 1QRUA 2WAYA 3RSFA 1X15A 4HFJA 2R00A 4YAJA 3DDSA 1NRXA 3OCJA 1HZZC 2GGSA 3MM4A 5D5PA 4Z51A 2F9FA 3KLPX 4ARSA 4H4DA 3KTDA 3I4FA 2WHPA 3SZUA 1DOHA 1G0OA 1NLUA 3ERCA 3ITKA 2VYCA 3O82A 4BFUA 5TLSA 3I0NA 4L0QA 4C01A 4EMBA 5KSWB 3EAQA 1UT8A 1VG0B 4IWNA 3G2PA 2FPSA 4XUCA 4OFBA 5DGIA 3OLZA 2ZTUA 2ZCJA 2QD3A 2YNMA 4QHYA 1PTJC 5FBZA 5CJ2A 1EQAA 1BW9B 1HDYA 1PJLA 1U65A 4MB6A 1ZUD1 4GPEA 4Z4QA 2BSAA 5F2EA 3KX2A 3MXOA 5SYAA 4V0KA 5CM9C 1YQXA 4ZAGA 2ODAA 4S35A 4X3OA 5DP2A 5G2OA 1BMQA 2MDTA 3WKEA 4LOKA 1PDWA 3IOBA 2FUG1 1CHDA 1XROA 2VH5R 4GMFA 1V35A 2QENA 4F71A 1DQYA 1FPQA 5FO0A 3JWIA 3GRPA 2MU1A 3KAKA 2GK3A 1KY5A 3ULKA 4JD5A 1EDDA 5AH0A 3I42A 5FPHA 3BMCA 1BN6A 4MR9B 4LMAA 3VGJA 1P72A 2J67A 2YQ5A 2A92A 4K40A 2ZRQA 3NV7A 4I9FA 3BUSA 4PSCA 5D01A 5GONB 4FDAA 4K9LA 4PR3A 2OHFA 3U3DA 1OC4A 5EMJA 3RODA 4CKEB 1C8LA 5BV0A 1UDXA 5EIOA 3WLNA 3A6EA 3H9BA 3R20A 5EWMA 2XECA 3FOEC 1JE0A 2RHCA 4LRUA 2QMQA 2QM0A 3R8XA 1P2DA 3GEGA 3SR0A 3ZGOA 3T1VA 4GZMA 1XWIA 1HLFA 3B36A 3OQ6A 1JBKA 1K7EB 4Q1FA 2CEKA 5E6UB 1VL6A 4LQLA 1J90A 1F8GA 3EZ7A 2G3YA 5DYGA 3RGGA 3U40A 2F6RA 5EE1A 5JOQA 1NR7A 2ZAOA 3O7WA 3N2NA 4RYDA 5EWLB 3SS7X 1GG9A 1CNFA 4QXRA 2X0DA 3UT0A 1OLSB 1J21A 4GKJB 1E0JA 2I3DA 3SE7A 1HT2E 1PK9A 4NECA 4F38A 4DCOA 1R4AA 4J29A 2H4XA 3QNUA 4ZGBA 1W94A 1GZVA 3B6ZA 2LIVA 3G2QA 1N6NA 4GZ6A 3K2EA 5LU8A 2QQ0A 1PCXA 4FC6A 2YINC 5JD4A 5K0CA 5KU1A 1Y8QB 2D0DA 5CXQA 1K7XB 4YV7A 1CFJA 2REOA 5G0TA 1EP3B 5AI6A 4DMCA 1V5IA 2FU5C 1P5RA 4EDHA 1SC9A 4DXHA 3LY9A 3PT9A 3QPDA 1E7SA 5BOSB 5FQOA 1SHUX 1Z5NA 4MUIA 2WUDA 1DRKA 1RPTA 1V41E 3NLLA 3AUXA 4O4IF 5BSTA 4JXKA 2EJBA 4FMDF 2YIVX 3F7OA 1ZEMA 1R6UA 2JFZA 3HYTA 3OE5A 3GRZA 2PDAA 3IQWA 2A5LA 4MV0A 1OX4A 3W2FA 3WFZA 4NJMA 4HB0A 2OZLA 1Y6QA 2GBCA 1JEJA 1ID1A 1AOXA 3TVDA 4GD3Q 2E2WA 4ZK2A 1Q95A 1F7UA 3A10A 3OBBA 4ZVRA 3S2ZA 4UEQA 2HRRA 2X7HA 5IC4A 2GQ0A 2ZREA 3OMLA 3P9RA 2VDLB 2QUKA 2NVUA 4XD2A 5IDWA 3MCUA 2RBKA 1C5KA 3QEMB 3BERA 1K3TA 3GFOA 3GBSA 5GVSA 4M99A 4FLMA 2QZJA 5BSRA 3TE7A 2BFMA 3H5WA 4FBMA 2DHCA 1NMQA 4TTJA 1LWNA 3ZIAA 1W36B 4MITA 3FLMA 1J0DA 3HFRA 4B6EA 2GPTA 3JV7A 4NV1A 1GSOA 2QNBA 2PLNA 2JLAA 3HVKA 4AC9A 4CM7A 4L6IA 3X1DA 5LYJB 3UXEA 2BFNA 5ISMA 1EI9A 2X9NA 2EGHA 3BGOS 2FOIA 3FIJA 1GL7A 2IELA 4KI7A 5D5QA 3S5JA 2WDZA 1FL9A 1PT9A 4V0SA 1Q1ZA 2QTMA 3LC2O 2JAXA 3RW9A 3PC7A 3VYTB 4JJ6A 5DNYB 5JASA 1GV0A 2BMEA 1RWWA 3PUYA 4GNKA 5C7LO 1U2GA 2AYXA 4MKFA 1VLVA 2DHDA 2HRDA 3B5IA 3PNOA 4KLAA 5E3HA 3WBJA 5TIIA 1DTSA 1R16A 2O2GA 4AB1A 3A9VA 3QE9Y 2JG3A 5EZQA 3VPHA 3R7FA 5BRNA 4PG8A 3DO8A 4NYMQ 3L8EA 2B1GA 4KFTA 4E2FA 2KW5A 3P8ZA 5JD5A 5HQ3A 2XUGA 2VBIA 1W47A 3GHHA 5KNCD 2NPIA 2B4AA 1OMOA 2WWTA 1B3BA 2KX7A 4RGYA 1AKRA 2YXPX 3L05A 4FYIA 5FJJA 3ESAA 1BKDR 1ZD2P 3V8NA 3T35A 4ZAZA 1NQUA 3W6NA 1VHWA 2G17A 4YAFA 2RHGB 3M6WA 3P9XA 4LHSA 5JO0A 2HN9A 4UDOA 4PE5B 3UMFA 4DDTA 4TS3A 1N5LA 3CNOA 3ROEA 3F5MA 1AJEA 3MGBA 3RC3A 1E20A 4OMFG 4CUZA 1GDDA 3P9SA 3D8NA 3KKPA 4QHSA 1XALA 5C5IA 3ZVKA 1IQPA 4IFTA 4NCBA 4G84A 1HQDA 4IIVA 4V0ME 3RKSA 1T26A 3TL3A 5ECWA 1GPLA 2HA7A 5HS4A 4I55F 4BZZA 3TXAA 3AW8A 4BVAA 3AHGA 4Z2AA 1DBIA 3DDCA 4CMIA 3LVBA 4YNBA 1S2LA 2JCBA 2OCBA 1IRIA 2Y66A 4CDRA 3VZCA 2XGSA 4UU8A 3K6RA 721PA 2YDYA 1HT3A 3AC0A 1PWXA 1YBFA 3K0FB 3NTUA 3QP9A 4S1TA 1JB9A 1VKOA 1WXXA 4I50B 3QEJA 1RI5A 5DI3A 1PJRA 2I4IA 2J87A 4JA0A 3W2EA 4ARVA 4EJFA 2E21A 5KWIA 1KAEA 2HHLA 3G5MA 1CW2B 3D8HA 2F3QA 3I53A 2IX9A 3VKUA 3VR3D 1T6YA 4QYWA 4QEZA 2ESRA 3HACA 4A2WA 4G5YA 4WE3A 3TTUA 3RR2A 3FPBA 1XXHB 4P83A 2V8BA 4F5WA 2QG4A 4Y9RA 3W9UA 5UKDA 1FZTA 2OORC 1YI1A 2QR3A 2FTKE 3H3FA 1QS0A 2I6QA 4F45A 1WJGA 2VZ8A 1YVPA 4H7JA 2GSDA 4JL5A 1M2OA 2RB5A 5K0TA 3MWYW 5AI4A 3S70A 2V59A 2W6ID 1IG3A 4H7FA 3KQKA 4KP7A 4QGSA 3HVRA 3QFTA 1X7XB 4YCCA 3KLOA 4DQLA 4FFRA 1Y1RA 5B7NA 3R9XB 3KZMA 3ONEA 4XKJA 3NH9A 3TKAA 2AFVA 3PRHA 1EP1B 4ZQHA 5EMLA 2QRMA 3EUAA 3VDXA 3TDMA 5GIPE 4ZO6A 1BXZA 4OXYA 2OLEA 1FSSA 4AKTA 4IM7A 1Q3TA 1RQRA 5JLAA 5E0OA 4BNGA 1IN8A 2JZCA 3MPUA 4ZMBA 2OVBA 3F5DA 3JPWA 4NNOA 1BCRA 3FNQA 2HHJA 4JDPA 2FMTA 4D9BA 1IRXA 1EJ0A 1DVRA 6AT1A 4ZI7A 1T6ZA 4A2PA 1CRZA 5IC6A 2NW6A 1L0BA 3OICA 1I7PA 4ZQIA 1TAHA 1ZGBA 2BFWA 3M6LA 4RORA 4DV4B 2IKQA 3F9RA 5TMEA 3TD9A 2W98A 4OOFA 2CV2A 4EG7A 4PG6A 4V0MA 3V32A 2PD3A 3HFGA 3KK0A 3B60A 5KVVA 4TT3A 1FTQA 5BN5A 1QGED 1P0IA 1E63A 2JLSA 3PHLA 3FWNA 1ECFA 3GZNA 3QIAA 1RSZA 1SU7A 1QTNA 2VL7A 3SAJA 4B7UA 4C6SA 3O93A 2CT8A 2P4UA 4OJNA 2H65A 1YS6A 1T0UA 3AY6A 4PHFA 2JATA 4QXMA 4G0QA 4UBKA 4M36A 2Q6KA 3GUZA 5EERA 3X43A 4EF5A 1WNFA 5I7FA 2DG2A 3L2OB 5H0IA 2DF8A 4QBIA 2XZLA 2PXHA 1CR6A 4A91A 1HMPA 2EL9A 4NTZA 1QRAA 1Z5GA 2WSSD 1ORDA 2PLFA 3CR7A 4FNOA 3TLCA 4C08A 5I45A 2J3IA 2Y68A 4JI3B 4GEGA 4JROA 3P71T 2AXNA 4LHXA 3U4AA 4J0KA 3V8EA 4EPYA 3SEAA 1UK6A 2AX4A 4IR7A 4DCPA 3FNFA 1UC5B 1FTWA 2IEIA 3B51X 3Q7SA 2FWRA 1ADYA 2ATCA 4LGYA 2OBFA 4HX9A 3VYWA 2WTXA 3JALB 3EQ8A 3QTLA 4EKDA 3NHKA 3O4VA 5JATA 5DI9A 3VV2A 4DUGD 1W46A 5AKLA 2BFCB 3MEQA 3SFZA 4GYJA 2QY6A 1ZK4A 1HM5A 3DOOA 3ZJ5A 4BWFB 1GQOA 3LBYA 1O6CA 4HAUA 3P5BA 1RKUA 2EKQA 1YTUA 4LNAA 4TQUS 3KRTA 2RD2A 4AJNA 1T43A 4EO4A 1J07A 1P1JA 4H1TA 4H6PA 4URWR 4UZFA 2NXWA 2Q2VA 2W5UA 5BNFA 1CHNA 2F90A 3DJFA 1Z6QA 1CLEA 2PWYA 1HE3A 4V3BA 3WP1B 4N5IX 2IKSA 2CLLB 2FUG6 1R0YA 3FHLA 1OC2A 1N2CE 4P84A 1P3JA 1LS6A 2H57A 3O8DA 1LLDA 3UYKA 4FMBB 1G0NA 4KUEA 4BO2A 3HP4A 4Y6RA 5IT0A 4QUHA 5COBA 4QA9A 3TKYA 4JQYA 2GYYA 1IQ0A 3UAOA 3H11A 4W5WA 5FUXA 3ZDBA 2GKGA 2I4LA 4WOKA 1LBQA 4NEHB 2YVQA 4L95C 2GEVA 3DMYA 3GG9A 1J0EA 5CCEA 1BXGB 4GI2A 3NCHA 4RIGA 4HD8A 1RWMA 3W4IA 1ZXXA 5KNCH 4IDCA 4NBNA 1ST3A 1PSZA 4NCHA 1IUKA 1X1EA 3IYLW 4S12A 3TZCA 3UT5A 3ZZMA 3ZHVA 3T3HA 2BR4A 1ZU4A 2H5IA 5EE3A 2ZULA 4UUOA 5LXTF 3QG1A 4MLPA 5E7JA 5B3JC 5AI9A 4G86A 4KE6A 4IO0A 3CEHA 4BLPA 1SOMA 2H17A 4TTAA 3R23A 2HK8A 3C45A 1UKCA 4J0QA 1W73A 3MJEA 1PQUA 5KHOC 3UAGA 3W06A 2R8BA 1CQJB 1KERA 2ORED 2O8EB 4P36A 2G5TA 3T61A 2BKVA 1ADJA 2GNPA 2EWMA 2GAFA 3VNUA 4B2LA 4BV8A 1QFSA 1M0TA 1FLAA 2RGNC 2J1LA 3B53X 4B85A 2X5XA 2WQ6A 1UXHA 3S55A 2PEZA 1BWRA 3BHNA 3E7WA 1CUZA 1L7AA 3OX3A 2FEAA 2XT0A 2B21A 2XX3A 3VNQA 5ESXA 5EHIA 1YS1X 5I9MA 1EJBA 1P9WA 4ILKA 5IHPA 2XZPA 1OTYA 1TIKA 3OE7A 1JW9B 2HYDA 4CDNA 4IGKA 3ABZA 2P5TB 1KVUA 3RVOA 4I9NA 5FUVA 4X54A 5JEEA 4UHEA 4X20B 3ZVMA 4POOA 1NUHA 3OIGA 1P81A 4Y2VA 5D7BA 2ODEA 4BNLA 4RA6A 2FLWA 3CFYA 1E9RA 2NZJA 3DOJA 1OFHA 2GH1A 4PM4A 4YTEA 1BSVA 5HF9A 2VQFB 2J3QA 1YV9A 4J0CA 4DA6A 3EZXA 3LQRA 2CBGA 3SJBA 2DWPA 2G0TA 3DEFA 4XGKA 4B0OA 4EA9A 5LKRA 4LGCA 1N2CA 3R6WA 3EFOB 1POWA 1NXSA 1A98A 1JTEA 1UOPA 4XDYA 4FYPA 2GZSA 2FVXA 4EQ6A 1CRLA 1GNRA 1M1YE 3ITNA 4ID9A 3PDJA 2W6IA 1ONOA 3UXYA 1CP2A 1XQWA 3OY2A 2EWVA 4K6MA 5CTAA 4RK6A 3WHLA 1XDBA 4M89A 1YR7A 5JTUA 2H1WA 1QFXA 1TMYA 1Z5OA 4ZYWA 1X9HA 1X92A 5I8PA 3S2YA 4BP9A 5TGZA 5BN3A 4FOLA 3GNSA 2D5IA 3W6OA 4RSHA 4A0SA 3GFSA 3L0OA 3RS2A 2Q6OA 5F73A 1L5MA 4WBSA 2FW9A 2J3LA 2VHXA 2NSLA 2DY1A 3TW6A 1E6LA 3MINA 2R4QA 4Q4HB 5BO5A 1M33A 2E49A 4OQZA 1JA9A 1V8FA 2CUTA 2NYRA 3ICOA 1EFVB 3M89A 1E2FA 4NYMR 3N74A 1YQDA 3L92A 3EUFA 2MSLA 4CQMB 4X60A 3IQIX 3OSUA 1TZJA 3ST7A 3HKCB 3NTLA 1K6EA 3Q40A 3SKYA 4O29A 1E1RD 3VSDA 1C4OA 2QTNA 2HBYA 2ZSFA 2O2IA 1C30B 2XLBA 7ABPA 1QCZA 1BE8A 1U7HA 2VSNA 3K7EA 3VKFA 2WV7A 3L7BA 3AV3A 2V3CC 2ECQA 3QYFA 1LSOA 2GFQA 3L8YA 2R7AA 1W4RA 4KI0A 2AMFA 3HWSA 1CQIB 3ZTTA 1YQQA 1TK3A 1WXQA 1ZX1A 4BYMA 2C2WA 3TSWA 4D9IA 2AEFA 1GU1A 1KMNA 3LRTA 3NAMA 4TT8A 4D9KA 1ZJ6A 4L1KA 4ZRNA 2F1OA 4BS9A 2ZSIA 5F2KA 3KQUA 3JD0A 3NMUF 3ID6C 4UVGA 1KKUA 2XRFA 3PQ6A 1DDGA 2JFYA 4GDMA 4OQ4A 5J9FA 2W9XA 4X90A 1WXEA 1KDRA 3N7AA 2HSJA 4BUJA 2AN5A 4U9HS 3NIDB 1P4JA 1Z0IA 2C78A 4LE0A 1LV7A 1LI5A 1CDDA 1V5EA 5CDGA 2Z9CA 2YY6A 2CVOA 3IALA 1KZHA 4PAMA 4UM8B 2PVSA 1F20A 4EJMA 1JAZA 2ZXEA 1DFIA 2WVAA 2O8DA 4LRWA 4WAUA 1LQUA 4PYJA 3I5UA 4GF5A 3EXHA 1M7HA 3A11A 4JOCA 2QD5A 1M1YA 1F48A 4GR5A 4K9SA 3HABA 3AIMA 2XA2A 4LZJA 2JCVA 5BWCA 2VTDA 4Y2QA 1OCEA 4W4TA 4XWWA 4EW3A 2AJBA 3UUGA 4AN4A 4JUAA 4N0DA 3TFWA 1TYZA 2W2LA 2P62A 1Y7HA 2V6IA 1G55A 3C24A 3L7NA 4MTCA 5DBFA 3V4VB 3O8QB 4AJ4A 1HK7A 2RK3A 2DWCA 5AW7A 4U7DA 4C4AA 2J09A 4G56A 3JD2A 3BZUA 3ZJUA 4KXXA 3JY6A 5DWDA 3R0JA 5H4GA 4BKUA 3K8ZA 2DSTA 1P91A 5HKBA 2YH2A 2BZ1A 3U80A 1XLTC 1JFFB 2P91A 5ICGA 3N3BC 4MLZA 3W2HA 4EGFA 1GADO 2QL5A 4KQ9A 1JQDA 2QRLA 1JHZA 1P29A 3HY3A 5HFNA 2C1EA 2NP7A 4PSKA 4JL8A 3THWA 4YI5A 3ZDCA 3EY4A 1W44A 3A25A 1H69A 2PMEA 1ZM7A 2PBZA 5FLEX 4UNSA 1L8XA 3GARA 1NU6A 3PXAA 3WL7A 1MPXA 2Z2ZA 1BRTA 3ZHZA 3LQYA 4G85A 1XMOB 3DEAA 3L3BA 5IKOA 3STVA 2ZXUA 4R40A 1MB9A 2HWYA 5CP8A 1SM4A 4BGDA 1N4DA 3I62A 1YE8A 5TF4A 2H06A 1V6AA 4TYPA 2O1SA 4XX1A 1BDIA 2QN2A 1F17A 3QX9A 5CCBA 4HNHA 3NIGB 5EE5B 3IQFA 3FW1A 3GMSA 5BN4A 1RWXA 1HNZB 3NATA 2WJGA 2PR7A 4L4RA 2HMSA 2ZUFA 2IU3A 3BAFA 4Z4GA 1T5SA 3BXZA 2WSMA 3D4BA 5C1PA 1F8FA 2HK7A 1XCBA 3ER6A 2QW0X 1C0IA 3CH6A 1SQ0A 1BE1A 4N01A 3QI7A 2BGIA 5H8WA 1PVOA 5SZJA 2ZZMA 1JHVA 2W2NA 5AJTA 2AW5A 3FLBA 5DX8A 1DAGA 5CNIA 3UW3A 2RGYA 3S81A 1PGJA 4UEJA 2PQ0A 4YRZA 1PWYE 1RXSA 3IPCA 4EB3A 1KJIA 5MN6A 2Y1LA 3FOAA 2VVTA 3KQWA 4AS3A 4E2YA 2KHZA 3QWFA 4PFJA 3W1VA 2QRQA 2GESA 2J46A 3EMKA 5BRAA 4FZVA 1L7BA 4JVMA 3H7IA 5TJ9A 2NSJA 3G5LA 4LVCA 4YJ2F 4R2HA 1NUPA 5EJ6A 1W88B 1Y33E 3BZWA 1E6MA 3JQRA 2QIPA 2VHEA 1R0BA 1Y8CA 4FQ5A 1Q7TA 3DOIA 2FW8A 4AIIA 3CEMA 3L7IA 2AWNA 3JQ7B 3TEJA 4YCAA 4DCMA 3F4KA 1U8EA 4US1R 2A5FA 3RBZA 2ISQA 3BD6A 3PE6A 4U2KA 2W6OA 3A28A 5TPWA 2WWVD 3SG0A 4CHTA 2XCTB 5IUKC 1QFMA 1NDUA 1NAHA 3QXXA 3TZHA 4DIFA 3MIIA 4RSRA 4UTOA 4S1PA 3EODA 1B41A 1D0IA 1EVEA 1AF7A 4M1YA 4URYR 3SJAA 4YYEA 4UEWA 2OB2A 3BYZA 1G8PA 1IUPA 2VJNA 3PRJA 3DF9A 4PYIA 2NT4A 3Q3IA 4QUJA 2FMXA 2YZ7A 4RL4A 1GQRA 1ZQ9A 4URVR 2YIMA 4ZYVA 2CFTA 1NW9B 3OPVA 3ENKA 1E2QA 4A1FA 1DC7A 5SY9A 2IYWA 2ZUDA 5G0WA 1E5LA 2YXEA 2VRCD 3GIDA 3UATA 1SXIA 2Q9CA 3QM1A 5JXWA 4C4TA 4FSHA 4B3CA 4Z3OA 1MW8X 2PU7A 2AC2A 2IVFA 4MNTA 5FYDA 3CC8A 4KWEA 2WMDA 1A7KA 2X8JB 2ECKA 2PIAA 1GZDA 2WT4A 2X4DA 3BEOA 1FW8A 1XVLA 1K98A 1M74A 2IITA 4KVAA 4NMHA 1U5AA 4ODIA 3H2SA 4ZZ3A 1KZGB 2VP3A 2PT6A 2CF6A 2C3PA 4QOGA 4GPIB 4KR6A 1XJCA 1QUEA 5CLHA 3VU3A 1RADA 4DQKA 2ZTSA 1VXOA 2FE1A 2FSPA 4YCJA 2F2TA 3FHCB 4OQYA 5H9WA 3T9CA 1J00A 2ZZKA 1SC3A 4OJYA 5HJ2A 3CG0A 3COZA 4MCIA 5L4NA 3JQ9A 4DADA 3NOVA 3H5LA 1U4SA 4JL6A 4R5MA 3NIWA 1O96A 1GSIA 1UP7A 2YHAA 3K16A 3L8HA 2FDRA 3FMIA 3S44A 3TTVA 4DC1A 5L40A 5IG2A 1GAQA 4GBED 5CIWA 4DRZA 2N3ZA 4X8OA 3L04A 3KT0A 4JB0A 5CHEA 1QDUA 2O7NA 3V8PA 1HYQA 1YQWA 2FW0A 4RVHA 4E5PA 4NOMA 3W79A 3C41J 4OI4A 3VZBA 1OZGA 4F7DA 3PGXA 2J9RA 3Q9SA 5FKJA 1MHPA 1RKVA 1XRPA 3HU5A 4UU7A 1YL5A 2JIBA 1GDTA 4B44A 1U1FA 3AZPA 4JJ8A 4FC7A 3Q3CA 3GLHE 1GY8A 1RPZA 3UPTA 2Y67A 4BY9E 1SBQA 4JFAA 3H05A 5AK5A 5K0NA 1BU8A 1XLWA 4KQ6A 5K3DA 3S27A 2GXUA 4HNAB 4J0JA 9GPBA 1Y4UA 1GNTA 2FPOA 5JCJA 3S1SA 3IT2A 1X77A 3GAAA 1KVRA 5HQTA 3F71A 1U8UA 2PL1A 3FHOA 4L5YA 1N6IA 2QJFA 2X19A 1ZVMA 3RYIB 1KZYC 3EIHA 3EVBA 4YP0A 1CDZA 3E53A 5F1OA 3DV2A 1FYWA 4LC1A 2QHXA 1RE1A 4DIDA 1CS4C 1XFDA 1Z5UA 2LE0A 3LVFO 3U7IA 2CNLA 2RHDA 3K6SB 4DCTA 3KEOA 1NVXQ 4LX8A 4A03A 2FZEA 4CTOA 1ILEA 2GEFA 1JVNA 1LDNA 2XOEA 5FR2A 2CXPA 4JOQA 2W70A 3NGMA 4W1PA 4J6FA 3IBCA 3U3MA 3NHJA 1NW6A 4Y6PA 3PXEA 2R6R1 4FE7A 4IHKA 3L6BA 1Z08A 3DB1A 1WIWA 4KH0A 4XQ0A 1E2EA 2NQ2C 2R00C 1XCJA 3AONB 1KF0A 4FPXA 1G291 3EXG1 3ZYCA 4QUKA 1M2KA 5KTMA 1KPGA 4UEOA 2VYQA 1NUAA 3NEAA 4FIZA 4ZC8A 3PFCA 1ZISA 4H0FA 3WDMA 2AOUA 3NBYC 2HTEA 2KI5A 2YMMA 2WP8J 1O5TA 3WGQA 5B58T 4YXFA 2HEIA 3IAHA 1P6XA 4PZCA 4CMJA 3JWJA 4DLYA 1SRQA 2VQDA 4EW6A 2FQ1A 2FSHA 1VHDA 4GX2A 4JR1A 3TS1A 5JI3E 1SQ5A 5JPDA 1V7ZA 2YNMC 1A96A 3MLAA 1JDPA 1OLOA 2OAGA 2XMQA 2B98A 1H2ZA 1X1RA 2Q2OA 1JEDA 3BGDA 1J4AA 3E9EA 4N5HX 3TBKA 5B1EA 1NN0A 3BBPA 1JBEA 2QORA 4AG3A 1YCFA 2HA5A 4BLVA 1QYWA 4DCSA 3QE4A 2QQFA 4YV2A 1J8MF 5M04A 3NNNA 1KIMA 2YL2A 3HK2A 2O6LA 3AP1A 3M6UA 3OHPA 4UNIA 3ND9A 4YPFA 2CC2A 3FCXA 4P4GA 3GLHA 3OTWA 2GEUA 4BB5A 4EMUA 3ZG6A 1E3JA 4BX3A 1E60A 1H2FA 1X1SA 2BGRA 5A5EA 2HJ9A 2CFSA 5ERYA 3ZOZA 4MQ6A 1K8ZB 2MSNA 3HKBA 2I67A 3MHTA 4ZI5A 5LIPA 2OCDA 4CLEA 4N3AA 1MR3F 4AMUA 1R10A 2GN2A 1LV8A 2ZG6A 1IEVA 2AUTA 2JAWA 3LHSA 1QF6A 1K86A 2Z2JA 4Q7KA 1M76A 2H2HA 4PN7A 3RWOA 3UOGA 4L28A 1D2RA 1KJWA 2CZGA 1S3GA 2F1RA 3PQDA 1T1IA 2AQKA 4OPMA 4RE6A 4MSUA 3ZHQA 4W5RA 2C7PA 3FDIA 4IQ4A 3U7QB 4F06A 2GZMA 3IILA 1P6UA 3ZVLA 3ILXA 4PEVA 3RIEA 4LPSA 3B6EA 4R9VA 4A23A 2RKOA 4ZZ1A 1E8DA 3Q15C 5IJ9A 4Z0PA 4OM7A 3REOA 2KYRA 521PA 1OOEA 2R65A 3AEKA 3IHTA 2CVPA 4KEAA 3K15A 2HQBA 4OUDB 1H85A 1VMEA 1ZNXA 3NHYA 3O38A 4L7QA 3MCWA 5GIOE 3I12A 1E2LA 1VRWA 3F46A 3WGIA 1T8YA 5ADWA 1EFRA 2FFRA 2DE0X 3JAKB 5JMPA 1Q3KA 3HYRA 1Z83A 3P0RA 3VGPA 4BDTA 5HKOA 3DTVD 3BVPA 4UJ5A 5G4KB 1VGVA 1ZU5A 1XT6A 4GPD1 1MW9X 3VR1A 3Q1LA 3TLBA 3TTWA 1D2AA 2ZE5A 3IFSA 4EUHA 4UHBA 1GCGA 3IE2A 2R85A 2XUPA 4BIMA 2ZQ5A 1Q7GA 4S1OA 5NULA 1JG4A 1PFGA 3ZKAA 1F8XA 3R9KA 3IUQA 2JBAA 4WN9A 2JIDA 2IUEA 4C7KA 1P1HA 1QLHA 3TI9A 1YQGA 2YWXA 1JSRA 2QAJA 1QYVA 1D3AA 2OGUA 1RJ9A 2VJMA 5E7IA 1NNLA 1VJ5A 2BGJA 2BOVA 2A1TS 2EXXA 2JGMA 3CF2A 1KBZA 1M66A 3ENNA 3ITEA 3Q98A 4YS6A 3EASA 4BO8A 3C1OA 2UVPB 3NBXX 1Y63A 2MHCA 4BNTA 1XZLA 2PSJA 3KJFA 1Z2AA 2HJGA 3Q7QA 3WC4A 4ADSG 1T6BY 1CJCA 4ZVOA 1VG9B 3VU1A 3PXDA 3U49A 5KYYB 2G77B 4NU5A 4QYIB 5H59A 1WG8A 2HNAA 2VNJA 3DMRA 4BNHA 1VDMA 2NTYC 3AVOA 3NKLA 4BQSA 1KEWA 3KYBA 3PPVA 1YI8A 4W9RA 3OQMA 1ID8A 1E4OA 2EEPA 2V6BA 5T3YA 1IATA 4OP1A 1THMA 1NW4A 2W2VA 4L5IA 4UKDA 3RVMA 1CD5A 3FHTA 3JQBA 2FLKA 4EFDA 5DHQA 5HW0A 1J2UA 4BVFA 1ZOOA 3IAUA 4FS3A 4W7IA 3ZYZA 3IRVA 3GQBA 3IBTA 5K9ZA 1O2DA 3ONVA 5KTSA 2AW3A 4BO5A 4C43A 3C87A 3LQKA 1VBFA 2ICAA 2EZTA 4ABTA 3I04M 4IDNA 2O52A 4J7XA 2PSDA 1NFRA 4F6CA 3ZS9A 1OI4A 3WYFA 3GMDA 1WTCA 5FL7D 5ALPA 1QGDA 2VXCA 1UJ5A 3KUUA 4CI0B 3GLFB 1H0KA 4HLUA 2Q3CA 4CCSA 3AV0B 2WHRA 1QKKA 4XOIA 4Q47A 3CRVA 3FZGA 2XUQA 3I6QA 1ZQ1A 3KDAA 5F9MA 2IY8A 3OOYA 3KQHA 4GXNA 2YX1A 1U2GC 4WKNA 3WHKA 5LWQA 3FYSA 4UQPA 2FUCA 3DPSA 4S3MA 4DSTA 5EHXA 5JQGB 2VPQA 1MG0A 1A9XA 3BFXA 3QVUA 1S2OA 1NL3A 4EY3A 2YFHA 3BJZA 4HK4A 1Z6AA 4DCJA 3CH5A 3L8GA 3THOA 1SJ9A 4R1NA 1IDN1 2AT1A 3IHKA 1QFJA 3L06A 4K87A 1SCKA 3I1IA 4KE9A 1MIHA 3R24A 1ZN2A 2I3AA 4JH0A 2J6IA 2POQX 5EIAA 4C5BA 5LP6F 1GNSA 3MJCA 3SC2A 4JLOA 4QL3A 1G7TA 1O6GA 1YRAA 2QAGA 2VHCA 3MERA 3DAFA 3ZHSA 4LECA 2VYFA 1XTJA 2AR9A 1B8OA 2VSXA 5FD8A 3FOZA 1E2KA 3GD7A 5L7YA 5ALVA 4H77A 5CB6A 1LVUA 1XA0A 4EB6B 4MIYA 4NMWA 1YKGA 2GN0A 1KOFA 3O75A 4RU1A 1BDHA 3GQVA 4WY8A 2JI8A 1R6DA 1O95D 2RI0A 3HO6A 4BE9A 3AUUA 4C0AC 5K3SA 4L51A 2QF7A 3DLIA 1JHQA 2HRZA 4KN6A 4KZPA 3SX0A 1BW9A 3ZGVA 4G1CA 4DR2B 1DJMA 1DEOA 1MAUA 2XH8A 2DJIA 3NEPX 1KDOA 4IVQA 4R2WA 3PGA1 1IM2A 1CYDA 1U7WA 3STXA 2JAOA 1H0SA 1Z5WA 4RW0A 5E95A 3ND8A 1JIIA 1B74A 1KI4A 4FFPA 5JNSA 1P33A 3PYLA 1L1EA 5GJVC 4GGOA 1UDWA 3TZEA 3IBGA 3AHJA 1ZYUA 1EBUA 3JSXA 3F4LA 4MR9A 4BE7B 5LKAA 1GT91 3PJRA 1OAOA 1C0EA 3RUEA 2Z8YA 2GFHA 4RHXA 5HGXA 1M8PA 2Q07A 3WAKA 3GA0A 4K2AA 4Q48A 3UB3A 3VUFA 5GONA 1A5TA 1HSOA 2Q4DA 3C1UA 1O6ZA 2EATA 3UGTA 3A26A 3WNQA 1N1GA 4CKEA 4YRDA 3O4RA 1FEZA 4Q4LA 5G3ZA 4L07A 3CN7A 3NTXA 3X3HA 3KVRA 4PZAA 4KXQA 3DEHA 4LIPD 4ZGGA 4O4HF 4C3VA 5JY6A 4EF6A 1OTXA 1C0KA 3NU1A 4MW5A 4PCVA 1T9GR 3UCEA 4B09A 3G02A 2WA1A 1YUNA 3ME5A 1JDTA 2QS9A 1RR6A 3CF0A 2EFEB 3E5HA 2DFPA 1UWKA 5B1YA 3ZR4B 2BDEA 2HA3A 4QDKA 5E6UA 2UUAB 3PJGA 3WYCA 2GEDA 5DMXA 4KQHA 2E48A 3F8TA 5L4LA 3HUDA 4QNMA 5EWLA 1V2GA 3VO9A 3FUVA 4ISBA 3OF3A 4ER7A 5AXAA 3WRYA 3ORYA 3GP8A 1DDIA 1OLSA 1F6DA 5JS1A 3GRUA 3EPKA 1HDRA 1GTRA 3QEOA 1W0CA 1GGMA 5GV7A 4Z4CA 2WKSA 3QYPA 3T3MB 1VZ2A 3IOCA 1WXWA 1VB5A 2CNWA 4HXYA 4XYEA 5JJKA 2O2DA 1XVVA 3TXXA 1EWKA 2GMWA 1L7OA 2NO7A 1NQXA 4FP9A 4HEQA 3ZZTA 4URUR 1Y8QA 2NUTB 4GYWA 2G5PA 2QXTA 2HKIA 3OU6A 3P0EA 4KO8A 5AK0A 4CZ2A 1R18A 4ZANA 4WOCA 5BOSA 2VTKA 1DXYA 4F2HA 1CY1A 1JLLB 1I36A 1XZNA 4LDZA 5BOVA 3W2GA 3KV1A 2MINB 3KSMA 4W5OA 1BEUB 4TMZA 4B7CA 1UBOS 3MSXA 1LEHA 1WLYA 1CIVA 1XV5A 4R1UA 1T8SA 4TTQA 5D3QA 2QM8A 3K9CA 3R3WA 4B2YA 3E8XA 4IV0A 5TSDA 1MQAA 3O4IA 1VFPA 1OBOA 1PUJA 3TWOA 3QOWA 2EKLA 2VT7A 4RPGA 5JJIA 1G7CA 1PGPA 2O06A 1Y8RA 2WJJA 3KQVA 4JYBA 4PBRA 5NLLA 4MKIA 4BCBA 3C15C 1F3LA 5EIFA 1UBHS 2D1FA 2HSGA 5CW2A 3PDWA 2CHQA 3KETA 1KQOA 3C0KA 3EXIB 2JZNA 3OPYI 1M2WA 4JUBA 5I8WA 3QEMA 3TOSA 2NO0A 2A9RA 1UOEA 1KP9A 3GPCA 2H16A 2COUA 7REQB 3UN1A 3UICA 1GUAA 3KDPA 4QVKA 4IICA 2X76A 4XEHA 4AJLA 1L3CA 2IUSA 4ZFNA 1EG7A 3WZLA 1DBWA 3GP3A 10MHA 4CDMA 4II2A 1NYQA 4GYYA 3GNTA 1MC8A 2WICA 3I28A 4LS3A 4ZTBA 3DD5A 3ZLJA 1FOEB 5I01A 5LYJA 4KNVA 2ZJ5A 2XYVA 4CGZA 4R41A 2V7BA 1MCZA 5D00A 1RRCA 1ODFA 1OT3A 2LP4Y 3ANTA 3GT7A 1W8DA 2FPMA 3DMFA 1ZN8A 4S1WA 3K6JA 2NG1A 2SKEA 2ZE7A 4TX1A 4EW2A 4JEUA 2DFVA 1DOAA 2VR1A 1FJHA 2AMJA 5FOQA 1IM8A 2I3GA 3VR6A 2GSWA 1V96A 1A95A 4N8DA 3KJIA 4BO3A 3SVLA 2VDPB 5B4VA 5LFAA 3H65A 2ZBPA 4B3DA 4M7WA 2N47A 3PXXA 1UBUS 1M10A 3GPIA 2WHEA 1N2IA 5DW3A 4G0NA 4PYOA 5CYPA 2V1UA 3KVYA 4FFDA 4FCVA 2R751 3KKNA 4J0FA 4ME6A 1EXVA 1BVUA 1LK0A 1T1RA 2QX8A 3EVZA 3PFKA 5ANRB 1Q5PA 2HWWA 3R7SA 4LOAA 1KE1A 4MW6A 1JJVA 5E4FA 1F4VA 2FFQA 1FQJA 4FJ2A 5BSFA 4M9SA 1G7SA 4IFIA 4QICA 4PZEA 4G8DA 4UCXA 3Q5EA 3C4VA 5ADHA 2D06A 3D8BA 5K3OA 1Y7PA 2FEWB 1XL1A 3B78A 1II9A 1DEXA 1UAYA 5ITWA 4JT2A 2IU0A 1E4VA 2W4IA 4XB1A 4QFDA 1U0GA 2M6RA 1PT5A 4E2XA 5EMKA 3BIOA 1UUFA 3Q9UA 4WPGA 1ACJA 1TW2A 1X3LA 1JTFA 5JS8A 1WUKS 2XE8A 5CRIA 3T5DA 3TE6A 3K0FA 3GGOA 2VPTA 4WK2B 1DIOB 2B3TA 3NT4A 4WNYA 4CN9A 3WYEA 1NT4A 2F43B 1KMCA 4NFLA 3DZFA 2WTEA 4WD3A 2AZMA 1DG1G 2KJQA 4BP1A 5HWSA 2IX3A 1Y8ZA 3FOCA 1N5RA 1R5JA 4AWXA 4JYPA 2CNOA 1UJMA 4AULA 4I5GA 4DLPA 3TKLA 1SC6A 1V39A 1XXHA 2F00A 3DC7A 3EC7A 3HFJA 3QPVA 4ZCSA 5IC5A 1JDVA 2QMHA 3F6RA 2OLKA 2AL7A 3RHFA 1CETA 3ZU3A 2HLHA 3WWZA 1Q0UA 2QTFA 2OTCA 2FLVA 4R9NA 5ALGA 3EYWA 4UMFA 5C4IA 5KSYA 3PQ8A 1VLHA 2YVAA 4J3JA 3C3WA 3M1LA 1NPDA 2LZ0A 5ES3A 2NZYA 2AI1A 3G5TA 3KXLA 4PTLA 2CL6X 1BMFA 3V46A 2R5WA 5MDHA 4DLZA 4LXYA 2CXSA 2RI6A 5EJ4A 4M0MA 1X14A 1WOMA 4BQNA 1X7XA 1GFZA 3DHEA 1R0WA 1A9TA 3R9XA 3UOWA 1XHLA 3FWZA 1SZCA 3QHAA 1YKSA 2GJSA 3WY9A 4KR7A 1J2YA 2AB0A 5IPFA 1DIBA 2R7LA 3I64A 3E3NA 1MNAA 1X7WB 4LQCA 3VUEA 4BXOB 1VBMA 4QRDA 4YRPA 4Q3NA 4FT2A 5AM5A 4JLAA 2QTHA 1DI0A 1OH7A 3I5MA 5DBHX 3PA8A 2OSVA 2JGDB 1R50A 3Q85A 3WMEA 4CFSA 4EVRA 2Y0BA 4KIGA 5A7GA 2V4MA 5HZKA 1BCSB 1T0PA 2RBEA 4JIGA 3DXXA 2FDXA 5CIYA 1ODCA 3LBHA 2QY9A 4YLEA 4HQLA 4LCEA 2HLDD 4KGVA 4JT4A 3FFXA 4E22A 3TNYA 4G5QA 4GWLA 1J8VA 1B16A 4LXGA 3LW8A 3NWPA 3FFAA 2QT1A 2PKYX 3VDQA 1TT5A 4JLWA 1QHSA 2EG9A 2OEPA 3OQVA 3PX3A 4L6AA 3PUWA 1U81A 1Q77A 5AESA 1TF2A 4WKCA 1PS0A 4RD3A 4HBGA 1M75A 2VRWA 2FWAA 4IXDA 4HRYA 4NSNA 2BP7B 4B84A 2BI8A 2ZT6A 3C7TA 1D4ZA 2CBXA 2D1SA 2JJQA 1GZ7A 3EY9A 3PLRA 4GX5A 3P96A 4HWGA 4ND7A 5EJIA 5AXDA 4OYHA 4D3YA 4WBNF 1ZCAA 2PE5A 1H8HA 1PV1A 1QANA 3QPWA 4XD7D 5CHYA 4AJKA 4B8WA 3LFTA 3FNEA 4PLVA 5CK4A 2CN1A 4XFDA 2Y9MB 4MMXB 4WLEA 4EYSA 3TGLA 3H0CA 1L5WA 5CA1F 1SZJG 1HEIA 2C3OA 5BR7A 2XW6A 3DUFB 4OAQA 4A92A 4DR6B 2O5RA 4EA7A 4YCDA 3V1YA 2ZJ8A 3HYSA 3NNDA 1WTAA 4WW0A 3ICQB 3FUTA 4PPYA 4U3JB 5G4LA 5A4MS 3JALA 2RJNA 4RVCA 2WJ3A 3IUBA 1ZK2A 4HX2A 4ZOBA 3EZ6A 4IDGA 4URFA 5K2OA 2BFCA 1QIGA 1V7QA 2IODA 5FTLA 4JAVC 2PX6A 1GRQA 2AR7A 4DV6B 4KMMA 3TL2A 2RGBA 1GTMA 1O0BA 3UV6A 2I1WA 4GQBA 3ROPA 2J7KA 2BHNA 1LBSA 1Y4ZA 5AJZA 3EXHC 2RHHA 1KJNA 4D99A 3G89A 1DCMA 1HKHA 3PR3A 2RHRA 3JVUA 1RZ3A 1X94A 3LCCA 3NH6A 4GMKA 4OJMX 1KY2A 4WGGA 2Y3IA 1VTKA 3TN7A 2PCLA 4C0XA 1EG2A 1P1BA 3O26A 2XKAA 4O59O 1I01A 5D3ZA 5F1PA 5LP1A 2PUBA 3B9PA 1E96A 1MC4A 4F1KA 3SDZA 3UJDA 1QXSA 3U4CA 4X65B 4REMA 1JAYA 2JC3A 4FHCA 4HZUB 1KYZA 5TQVA 3TW0A 1Z3IX 2GBLA 1OAKA 1E1CB 2EBWA 5HUJA 5JZOA 1YF3A 3RBXA 2C2MA 2H54A 3M33A 5HTOA 2PUDA 3V5NA 2CHVA 2GPWA 2IT1A 4PS1A 2VBFA 1OPRA 1MO3A 3JVIA 5AKGA 2OXIA 3ZHYA 4OBBA 1BXGA 2B30A 4D6PA 1FU4A 2EFGA 2FWIA 1CERA 2FPKA 3QF4B 3JRWA 2PL5A 3KT8A 1H2HA 1PEDA 1WQ3A 5HM8A 4BJ1A 1FUIA 2DT8A 4OLFA 3SM9A 4HR7A 5AM0A 3DR3A 4IJWA 1ZJJA 1XYVA 3ELBA 3EH2A 3OP4A 1QR2A 4BMCA 5DGHA 3ZDQA 1U6IA 3LNCA 5IN4A 1IWOA 1CQJA 1SUFA 2WAOA 4X0EA 1Z26A 2O8EA 1MP0A 3F47A 2C57A 2OCAA 4UDNA 1PQWA 4IDAA 3RVQA 2ZEJA 3STYA 2Z2YA 2JGRA 3K5PA 4BQOA 1Y3IA 1TM1E 2RI1A 3KHUA 4JP5A 1SN7A 3AERA 1DAFA 3UWPA 3FOFC 2ONZA 3OJLA 2YV1A 1J39A 2JLVA 4NYIQ 4PICA 1O97D 1OWMA 3CLSC 5FHQA 1YBVA 2OP1A 2ZQYA 2Q9AA 3DCIA 2JARA 4P5DA 4HP8A 2DGDA 3DKVA 1KS9A 4IQ8A 1EA5A 4ENWA 2A58A 2I1VB 2O0JA 2PVCA 1KFKB 1FJ2A 1PGOA 3B7WA 3BCSA 3DXFA 4FBGA 4GIBA 4X20A 3T7TA 4CKYA 3JVVA 5A7FA 3KU1A 2GD6A 2HY7A 4YJ2A 1W75A 2NQ8A 1CJUC 4FZRA 4UXHA 3U2QA 3ER9A 2Q4RA 3PHCA 2X58A 3NONA 4ITUA 2B82A 3ML1A 4GL4A 1VE9A 4JXJA 1SC1A 4D8TA 1T1EA 1XPJA 2GCNA 3EFOA 2WIBA 1UBRS 1WQ4A 2DWQA 2OKCA 2X3UA 3GD5A 3H9JA 3IIEA 4M98A 4Y67A 2Q4BA 1FSPA 3ORSA 2Z6VA 1WDWB 2Z8XA 1E9DA 2AA3A 1XQ6A 4L4XA 2EC5A 2R5FA 4RPLA 1X74A 4U9UA 1MRNA 3FLAA 4OFZA 2ILVA 4QTTB 3F9IA 1TTPB 2C7VA 2Z98A 4M1WA 4AKIA 1JHYA 2OG1A 1JU9A 1J33A 2EKPA 2GEBA 2P41A 5HMMA 2YFKA 3HLYA 3IO5A 1UIRA 4BZXA 3PC8C 2Q62A 4L75A 5JVDF 2FK8A 1LX7A 2EJWA 1EB9A 3O2NA 2AQHA 4Q4HA 4XE5A 1LDYA 4JU9A 1H2AS 4L6CA 1G42A 1DJNA 2XXJA 1EFVA 4O4LB 1OHHD 1QDLB 4CQMA 1IJKA 3T94A 5K3CA 5P8WA 1V71A 1EE2A 3EQ9A 4LZNA 4XDGA 3TQCA 3BH0A 3HKCA 3JU3A 1SKBA 1TJYA 4PLTA 4WLUA 2PYIA 1AKQA 3DMNA 2PZAA 2NO5A 2Y0DA 4QM6A 3P9PA 2HLDA 1PFYA 1VJDA 2FCAA 1OXSC 2V55B 2XQJA 4LSMA 4LVUA 5DHSA 5F1YA 1C30A 1SVMA 2XF8A 3W7BA 3DP9A 1RAHA 5I3ZA 4ZCIA 3D4PA 4TTPA 3W6UA 1CQIA 1UDRA 4CNBA 2IHKA 4WZBA 4PQGA 3FTNA 2NTJA 5M34A 1JJBA 1TUGA 3M5CA 3OLVA 3I6BA 4BFSA 5BMVF 5DZSA 3BXHA 4XH9B 3D8TA 3PG5A 1FX1A 1LC0A 2BMJA 4OJKA 1E2MA 1JHMA 3BL8A 4E5NA 1HR0B 4LY6A 3JQ9C 1C29B 1NJSA 2XITA 3M5WA 4XD7A 2I6GA 4TMYA 1O6BA 4QWMA 1LSUA 2XCOA 1OF1A 4TQAA 5MGNA 4X6YA 2GHQA 4F91B 1G8YA 3HC7A 1T5LA 3QVTA 4ND8B 2NZUG 1HT1E 1TAGA 3ETDA 3B3GA 3INNA 2H29A 2JHGA 3E5RA 4C9BA 1W5AA 4IH4A 4DAEA 1IBCA 6PFKA 2PQ2A 2GAAA 4I1IA 5A3QA 4N5NA 1U2SA 4L9SA 3G0GA 1TMGE 3BD8A 3A1NA 3LECA 4OJQA 2CLEB 2OAEA 1IONA 3GYGA 4MMYB 3CCCA 1K7YA 2EFJA 4L8WB 3K4HA 4BNDB 4XSHA 3DFUA 4EF4A 4BTEA 2TMDA 3AR3A 3WGVA 1YHNA 1V9CA 2RDMA 4G41A 4P7KA 1G17A 3RNOA 1ACMA 3KE8A 4W7HA 1OWPA 1SBZA 3CZMA 1CQZA 2PN1A 3O95A 3ZZ0A 2FPRA 5CCXA 2E6UX 4UEKA 3G8DA 3KM0A 4UXIA 1VIAA 1HUQA 5EUMA 5BSUA 5CXUA 5LPNA 5CFMA 1ZW6A 4GLJA 3V1UA 3O8QA 4ZHQF 5JT1A 3IIJA 3KR1A 1M6YA 5JYCA 3AR8A 3R7AA 1P3DA 1HEYA 2M6LA 3IX7A 4YPVA 4GNRA 2LCQA 3KSUA 1RACA 3ELWA 3ZZNA 1OY1A 2QMUA 2O2SA 5JDCC 4E09A 4EY8A 3WIOA 1OFIA 5B55A 8ABPA 3G85A 5HZGA 4ZEXA 2VTBB 1H9CA 1JFFA 1TVKB 4HGQA 1PV4A 3F5FA 3AHFA 2ARKA 2YWDA 3EQ6A 4DG5A 1OE0A 1XCGB 1IIBA 1U3GA 2ZIEA 1MG5A 3ZCXA 1DCTA 2PO7A 4MDYA 5DHTA 1JDNA 2YC2C 3LLSA 1N5JA 3VNSA 2Z9BA 5FOTA 5BORA 4P80A 1TM5E 5IVIA 2PV7A 3E8MA 4GECA 4FOSA 4S1VA 1ZLYA 1FXWF 1GUFA 1OVGA 4CF7A 3EPJA 1O54A 2CXOA 4ZZ0A 2XXAB 4JJZA 5HTKA 3T5BA 5AJWA 2XSZA 2V7UA 5K3AA 2HA4A 3B1ZA 1M73E 1E98A 1IN7A 2BJHA 4N7JA 4RK1A 2XPCA 4HDMB 3LX4A 3JQPA 5EESA 1K06A 1V5GA 1BFDA 4HS4A 4RQTA 2CJFA 4GUDA 2NP6A 3J80A 2ASEA 4ZN6A 1LNSA 1DBRA 3D2AA 2H5JA 1P4AA 1EGMB 1PRYA 2XE6A 3GC6A 3GHYA 1E8MA 5IARA 5MF6A 3U16A 2VRBA 3T4XA 3ADDA 3I1FA 5AW6A 3IHLA 4LHZA 1XD2B 4ND2A 1GTG1 1SH7A 3MAJA 3QA9A 4WNCA 4XB2A 1PHRA 4E5VA 2QVGA 2CJWB 4O2BF 5M2QA 1RI3A 2F48A 4WX2B 3TGWA 4B4UA 1DADA 3M81A 4XYLA 3VO8A 2P75A 5D6NA 3WRVA 2YMPA 2H59A 2ZIZA 2NVOA 3AJ9A 3WKDA 2VDRB 1FVXA 2TRSB 3GLRA 3K5IA 3A05A 1W88A 3F6PA 1YJAA 1BJTA 5LSAA 4N41A 1EIWA 1NXTA 4ZOCA 4PO3X 1SBTA 2F8LA 5ALUA 1XCLA 1W1WA 3P9YA 5G40A 3JQ7A 1G3IA 4NCXA 2VQEB 5U4XA 1VZ3A 1O8BA 3H99A 1ZUNB 2ZK7A 3RUFA 1N8NA 1VCMA 2FF5A 1PJQA 1F8YA 4ZV7A 4FDLA 3UC5A 4BLWA 5I7RA 3UG7A 1HI9A 3BICA 3C3KA 3KEMA 4HQOA 2O8FB 4OVKA 3RAJA 2OE2A 3T1NA 4RVUA 1FUYB 2MR5A 3HJUA 1RJFA 3H2KA 4GLFA 4IJQA 3SLRA 2C9OA 3GRCA 3R41A 3GY0A 5ELLA 1NRWA 3ZWVA 1CR2A 2BGKA 4MVJE 4HFRA 4NBUA 3RYHB 2BFBB 1XEWY 1W52X 1NW7A 2EOAA 4UM7A 4ESHA 5JR3A 3KE9A 1QUFA 4YMIA 3HHEA 4O25A 5I7UA 3FPHA 3MS4A 5B37A 3PWKA 4U8HA 5AKZA 1ONBA 1XVTA 1Q6ZA 4DMMA 3B85A 1QQBA 4Q9AA 1T5DX 2P27A 3H9QA 4YBZA 3RFVA 5FLXA 3G6WA 1DLIA 4QPNA 3HDTA 4KNWA 4QG3A 3GH1A 1U4OA 2H1LA 1DMSA 1DJOA 1PJ4A 4PSVA 3O8CA 1CF2O 2I9PA 3E3LA 1UM8A 3RRBA 3A4MA 2WMYA 4WH0A 1XRMA 2X8JA 3MBIA 1E1MA 3LUHA 2NPFA 3I2JA 5H4HA 4LVOA 3GAMA 3IT0A 1BYIA 4IG9A 5BQXA 4NABA 4EARA 3K0KA 4TWJA 1Y3DE 1IPFA 2Q45A 1WUJS 4M1SA 4AJJA 1GL3A 3OZSA 5K8VA 4R2LA 4CN8A 4G2TA 221PA 1SR8A 5JXGA 5EZYF 1YXMA 2HM7A 1WNTA 4BV2A 3ZIUA 4DDVA 1J06A 2WHYA 2OV2A 2XCUA 3NFYA 4RSGA 2BL4A 3V8RA 4F9EA 1TZKA 3NDRA 5J2TA 3HPQA 1K88A 3T3PB 3HBLA 3W8DA 4XTRA 4EFNA 1GQ2A 3RPEA 3GT4A 1FYVA 1NX9A 4YXWA 3ZV6A 2C5LA 3VPFA 2J3KA 2QTZA 4DMGA 5J1TB 3QZUA 1HE5A 4REQB 4NYIR 2ZJ6A 3RSZA 3I4LA 1EBBA 2JFNA 1F6WA 2QNRA 1IHXA 3LRPA 1NI4B 1L7XA 3QKRA 1I2CA 5FT9A 4OX9Y 4HNAA 4RNDB 2C3UA 4G6ZA 4HGOA 4NFYA 1EAYA 3N0WA 4B35A 1G63A 2AN1A 1ZW1A 1YZQA 2HU5A 2PGIA 3O47A 3L02A 4MI1A 4EVSA 1JAIA 3NV9A 4UULA 2IS1A 4OLHA 4HLUC 1IBKB 4YJ3B 4JI5B 1LDEA 4MVJA 4XW2A 3AF0A 2FPXA 3RYIA 3QMPA 2CE2X 4ENSA 1M2VB 2AS0A 3MJRA 3UV7A 4HV4A 3AHDA 2X0EA 1G21E 3A2LA 3K6SA 3WJ2A 2ZB4A 4TM8A 2VN8A 4MI6A 4XUEA 2ANCA 2R6HA 1UC4B 2P2CA 2ZJZA 3I0MA 3N75A 3LPAA 3K2BA 1E2JA 2IDZA 4BNWA 5IMBA 1RZRD 1YKFA 3D1VA 4D79A 3DMHA 3FN4A 1UK9A 3QOYA 1F2VA 3E9RA 5J43A 1FNBA 1II0A 1T1JA 2YV4A 2H07A 4HXEB 3VH1A 2WJZB 2JI9A 4R7ZA 4HAOA 3RHTA 5AVJA 2CZQA 1EFHA 1PEAA 3V8BA 1KE2A 3CVXA 3RD5A 5L8VA 5BYJA 3ZX4A 4QPDA 3QWHA 3IUEA 1NFFA 2A5DA 3PGMA 3GEEA 4M88A 5TMDA 4ZQCB 2ZBFA 2JFPA 3QV2A 1CUIA 1H0RA 4R8KA 5DIZA 2OCLA 5K51A 3WDSA 2O0KA 4QYXA 2QEQA 4UQOA 1JDJA 2PWAA 5GP1A 4BEBA 5IXJA 4PNPA 1EK5A 1A7AA 1E1QD 3RIXA 1L6RA 2D8AA 4Z0TA 3RVBA 1ZCBA 2JKZA 4L27A 3J81k 1PAUA 3M4XA 2RGXA 3DDUA 2C0PA 3WXMA 4N03A 1A5AB 2OCGA 4LCBA 5KQRA 1PJ3A 2J33A 2QTAA 3RJZA 2B5OA 5DGCA 2K2WA 3E9QA 1ZH6A 3O90A 3VQTA 3RS8A 1K2VN 2AI2A 2XHEA 3A4IA 3BQNB 1IXKA 3WRWA 1QE0A 3PWSA 4JIMA 4P4TA 1J8FA 2ZDGA 3D3EA 3LT5A 3O4JA 3Q8MA 4CIBA 4ZJUA 4LJRA 1UBMS 1Z8HA 1GSAA 2Y0PA 4PGHA 5EHZA 1BS2A 1OAOC 3MWGA 4A0GA 3IP6A 4UZSA 5KDDA 1T15A 3VPAA 2ZU0C 5LU9A 3BA1A 3TTYA 3FPEA 4YAKA 2UVDA 1N9GB 3W5VA 2HH9A 2G9QA 4OY3A 4D3XA 4EY6A 3LY5A 5H7XA 2J07A 4FR2A 1ZAYA 2H3EA 1Q12A 3U4HA 4I0WB 1T4CA 4KE7A 5IAJA 1CRQA 3H9UA 4LYHA 4XIFA 2JA2A 2JF0A 3H6GA 1NVVQ 3WLTA 1JSZA 3U7QA 4YX9A 4M9ZA 3GLFE 3PXUA 4DW8A 9ABPA 1QP7A 3HRHA 2CXTA 4LNHA 4N7BA 3E1KA 3WHIA 4HZIA 5DDIP 5KTNA 4FWIB 1YBAA 2GI4A 1J8DA 3DNFA 5IBRA 5A4KA 2IYOA 2HMUA 2W2TA 4OUDA 1J9EA 3AESB 1S9DA 2YN0A 3WRYC 2Q2QA 4JLDA 3CW8X 3CVJA 4GE0A 4GWGA 1P1IA 2P4HX 3JAKA 3UV3A 1JILA 3ZWPA 1E1LA 1B0PA 2RMKA 4D92A 5CBPB 2XDWA 3UJ3X 3A6KA 5G4KA 4BGEA 3ZJYA 3SIRA 4MRAA 4EEXA 5IM4F 3IUPA 4IEEA 3D9QX 4N39A 3KKOA 2Y77A 3WJAA 1XTKA 3F8SA 3MTJA 4TVSA 3Q0EA 4G9EA 1MRZA 1TTQB 3AUYA 3FPCA 4G37A 4GICA 4JUCA 3KXPA 2CL5A 4NBRA 2WKPA 4TLLB 3G9ZA 3N8KA 1ZCFA 1FYXA 1F2TB 5DM4A 1UJ6A 5U1PA 2FWPA 2JANA 2UYQA 3L6CA 1EX7A 2DLDA 4R01A 4Y7CA 2XYQA 3GX1A 1W4LA 2OP0A 3PUXA 4YYZA 4Y1FA 4AIRA 3KLBA 5KCZA 5K0BA 2IP1A 1GR1A 5EKSA 2I2CA 1Y6ZA 3WFJA 5KC8A 1E7YA 1WM1A 2Q5IA 1Y9AA 1DBQA 2Q3FA 2GO7A 1RAIA 2XMCA 4JX8A 2ZSUA 4LXQA 4DSNA 2PH3A 1ZN9A 2G5CA 4EMSA 1GFIA 5KYYA 4QYIA 3FBWA 2BKAA 2OV6A 2XZTA 3D81A 1KFBB 1TD9A 1E32A 1JQKA 1C3XA 2QV7A 3ELDA 3VSCA 1J2RA 4ZGWA 1V0JA 2NO9A 2GZ3A 3ISVA 2EFCB 4NV3A 4R1TA 2UAGA 4W82A 4PC2A 1XRNA 5IH3A 3WLAA 5IBQA 1F5NA 1GRCA 2L2QA 3SS9X 4D43A 1YB7A 3CNHA 1PBNA 3PQEA 4FDMA 3DYIA 3EWNA 3FKJA 1ZD8A 3GN1A 4KBYA 2G71A 4OXIA 2H7VA 5JSUA 5JAPA 3F67A 1W36C 1RBYA 4E88A 4PAGA 1FQKA 2DVMA 4JR2A 1B2LA 3GEBA 4LI0A 4Q24A 3LPLA 1RIIA 3OF5A 4RVSA 5TQ0B 1A2BA 2J0VA 4EA8A 4RTRA 1JEEA 3W3AD 3OQNA 3QELB 3OWOA 5HE9A 3F78A 5C34B 4DQ0A 4RTLA 4K1LA 2HIMA 3JASB 3GLFA 2Z4RA 1FTYA 2Y6UA 3R5HA 4OKIA 2C42A 3M6XA 4LJYA 4CU2A 3QUSA 2J5KA 5EC8A 2EIXA 1QIFA 3ZX5A 3PP8A 1ZI9A 3AGPA 4UM9B 3DV0B 5JV5A 2Q5EA 3AVYA 2DFLA 2ZOSA 4RQBA 1K8QA 3ZGYA 1AK1A 4DLXA 4OHMA 2ACWA 2P3LA 4O2RA 1P6QA 2FSUA 3PUHA 1L4NA 2WWRA 1NJ1A 3D0OA 3G5AA 4LJAA 2X2EA 5CVCA 5H1YA 1HNWB 3CONA 3NQ41 3E9NA 2A9FA 3GR6A 4CKWB 1TZCA 1VCIA 1W2GA 4KPUA 5EKUA 2EFHB 1P2VA 2GWHA 1HDGO 5F76A 3WLMA 2YASA 3M9XA 2JHCA 5DX1A 4DEVA 1XYGA 3LYAA 1V11B 4NS1A 4YT5A 2MSEB 4JBHA 3CIFA 2ZIUB 4AP5A 3TO5A 1KEEB 2DPHA 4RXUA 4QUGA 5BSMA 2QR5A 3SFTA 2BTEA 2VBCA 2HXGA 4ZVQA 4KQGA 3AVUA 1Z39A 2WSIA 3BRWA 4L02A 2R11A 3ZPXA 4OMCA 1JALA 4CNQA 2O4CA 1O4WA 2GILA 3WLRA 1OB5A 3MELA 4FZ3A 5FI3A 4WXEA 3TSZA 1G8HA 1SU6A 1J9ZA 2C82A 4D97A 3FCSB 3K09A 5FB3A 2GZ1A 1RXEA 2ETVA 2D1QA 5J4VA 5I7OA 4N47A 3OFNA 4F4HA 4IGEA 4PF1A 3UCFA 2QUBA 5J63A 5CB4B 1FMFA 1SHTX 3DGEC 2C9CA 1IOLA 1V9LA 1KIFA 1T3LA 1ZKDA 2UYGA 3DZGA 3MUEA 3IEUA 2FWBA 4HT3B 4UQLA 4D0LB 1XNHA 3ILYA 3K0BA 4M6WB 5JNRA 4IIJB 2I03A 4A2CA 2GCPA 5EKDA 4CEHB 1H4SA 1J24A 3QVSA 3VKHA 1TFRA 2QPAA 4LBVA 4BL5A 3U13A 5CA0F 2FJUA 4XVQA 1V3UA 2C95A 4UUNA 1R9NA 2OVFA 4WCFB 1U28C 3CLRC 4EY5A 1JR6A 4LYDA 1M1UA 2AWOA 3CISA 1RQGA 2R87A 1NONA 1NT2A 2AKAB 2XVZA 4ZZ2A 3VX4A 1ZRNA 3VISA 5DNWA 4QQ8A 5JU6A 5B7GA 3CNLA 4MA4A 2GN6A 2H2IA 3WNDA 1HGXA 4DIMA 1AN0A 4K9NA 1U8XX 3IR7A 4X61A 3KPYA 2VSQA 2K4MA 2JH8A 1JQEA 1P74A 4QJ5A 4UMDA 3C97A 4GH5A 2JVKA 3GBPA 3LP6A 1SIBE 4L73A 2REXB 3R0IA 1ONPA 2BTQB 2IU6A 1U9ZA 3ZUGA 5T4FA 4XRGA 4EPWA 5C8DA 3OE4A 1U0JA 3FRIA 4RC9A 1DIRA 4ZHSA 1Y9EA 4JC4A 1WXFA 2YCLA 4K5QA 3NHSA 1XEAA 3OZGA 2PD4A 2CVFA 3NJ4A 4IH9A 6Q21A 1BQ3A 1U0HC 2XNHA 4OGFA 4HNGA 1JI0A 4Y2GA 2B7CA 4FT4A 1F2UB 1Y1SA 2Q0XA 5K99A 3U1BA 2GBGA 3IV7A 1T0HB 3E84A 1K89A 2CLIB 4BMPB 2H3HA 4YWHA 1TW3A 3VO1A 4QNNA 1IY1A 4ZVPA 4DILA 1ZHHA 2O7SA 1WCYA 2C1ZA 2W2OA 3OECA 1TM3E 4LY3A 3D0KA 2NUTA 4ZU3A 2HCRA 4UHDA 5HXAA 1ILWA 3RS0A 4HB4A 2EFYA 2BH2A 2DFDA 4GWKA 2GASA 4AJIA 1JLLA 5AW3A <