3EODA

Crystal structure of n-terminal domain of e. coli rssb
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
115
Chain Sequence
QPLVGKQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAGLKLLEHIRNRGDQTPVLVISATENMADIAKALRLGVEDVLLKPVNRLREMVFACLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hnr
publication title The structure of RssB, a ClpX adaptor protein that regulates sigma S
rcsb
source organism Escherichia coli k12
molecule tags Signaling protein
total genus 38
structure length 115
sequence length 123
ec nomenclature
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3eodA00
3NNDA 4D6YA 2FQWA 4QICA 5ED4A 4PEVA 4KV7A 1U2PA 3TX6A 2A9OA 5DKFA 2IPAB 3I5AA 3TD9A 4EYQA 4LZLA 3H5IA 4RK4A 2NUBA 4N41A 1CEYA 3CFYA 3MM4A 1BDJA 1E2BA 2ID9A 3SG0A 1ZGZA 1LK0A 3A0UA 3KHTA 4RXTA 5FWXA 2HJ9A 3O1HB 1M5UA 4Z9AA 2R47A 4GPAA 4KREA 1D1QA 2LBPA 4RDCA 2QSJA 5JNVA 4O1IA 2PUDA 2QW1A 1OXBB 4ZMRA 2FEKA 1U8TA 5EWJB 1NXWA 4XLTA 4JP1A 2JB9A 3FFWA 3N0RA 1D1PA 5JNSA 3HJFA 4RK7A 1CHNA 1GUDA 1PNRA 2NT3A 3QLUC 5B3JA 2QVGA 1Z17A 2AYXA 4RKRA 3QLVA 1NXXA 2P9HA 1DBWA 1VKRA 3C3MA 3IP9A 3T8YA 1EWVA 2JVJA 2NZUG 3OLYA 3SNKA 1Z26A 2PUBA 4NQRA 4FE4A 3CG0A 1C0EA 1YTUA 3RQIA 1ZN2A 3SM9A 4RSMA 3FFXA 4E7OA 1D5WA 1ZH2A 3O75A 3K4HA 5T7BA 1FQWA 4RU1A 2HQOA 1DCMA 5EWMB 1QPZA 1JYFA 2FTKE 1C4WA 2FMKA 2HPHA 3D8UA 3H5VA 3UUGA 4MR9B 4YV7A 3F7NA 4EYOA 4WUTA 4KRFA 4Z4FA 3E3MA 3HSYA 4KQ9A 3OQOA 3TO5A 3T38A 3OM0A 1FFGA 2LIVA 4JB0A 1JF8A 3B2NA 3IP5A 1JFTA 4NCAA 1SXGA 3LKBA 3GYBA 3BBLA 5DCLA 2FLWA 1DP4A 4FB4A 4W5RA 2IPLA 1YK1A 2WJWA 1P2FA 1F51E 3Q41A 1R8JA 4OTZA 3EULA 4MS4B 2OENG 4MRMA 1RZRA 2PUEA 4N76A 5TE9A 2QZJA 3HDVA 3VNAA 3KG2A 3MIZA 5KC9A 1RPJA 1BA2A 4RY8A 1RZRD 1DBPA 3OO0A 1NXVA 2R4QA 3M9WA 3GL9A 3LMKA 5HQJA 5TQ0A 1DC8A 2H0AA 1NXSA 4G0OA 2W42A 1K66A 3H6GA 5IX8A 2QV0A 4KK3A 4UHKA 1GUBA 3GBVA 3CLKA 4ML3A 3LUDA 2MSKA 3GV0A 4O1HA 3RVMA 4ETIA 2VYCA 1DCFA 2X7XA 3H75A 5I4CA 1BVHA 3LUKA 2A9RA 3CZ5A 2E4YA 2QXYA 2XDYA 4UHJA 3KLOA 4W5OA 4OLAA 2JBAA 3H1GA 3LUFA 5FWXB 1GCGA 1U04A 1DBQA 3KS9A 3EQ2A 4D74A 2H3HA 3LUAA 4L4UA 3DZDA 4PE5B 2E4UA 1YMUA 3O1IC 2JVIA 3F6CA 2OQRA 5CNKA 7ABPA 2FEWB 5KC8A 5IBQA 4LDZA 1TJYA 3Q7RA 4YLEA 3NNSA 5IUKC 5TQ2A 4KFCA 2WB4A 1SRRA 3C97A 1QP7A 1PHRA 3ILYA 3RVKA 5KQLA 1KRXA 3ILHA 4JB2A 3NHZA 3QLUA 3RVRA 1PNTA 4TMYA 3FMVA 3SAJA 2JCGA 2NZVG 1LJLA 3EODA 3O74A 5FBHA 1ISRA 1S8NA 2FN9A 4NV3A 2PKXA 3GBPA 3CNBA 3IDOA 2DRIA 3LUGA 3CZCA 3QEKA 5DTEA 3UK0A 1M2FA 4XAQA 4HNQA 4Q6WA 1EWTA 1L5ZA 1ZESA 2LPMA 3E61A 1M5TA 5TPWA 3H1FA 1BDHA 2MSWA 2M98A 4G0XA 2HQRA 2MYNA 5D2CA 3RVNA 2GX6A 2P4UA 3I09A 1D2AA 2YHBA 4YS6A 2CD7A 1JFSA 4Z4GA 3I42A 3Q7SA 3GT7A 3UKJA 4DADA 4F8JA 3FGZA 2FQYA 3O2JA 4RY0A 3JVIA 1XHFA 1Z18A 2IDMA 3KLNA 4N03A 4IGAA 3JVDA 2FXIA 2VUHB 3A3KA 3HUTA 5KI6A 2IKSA 1ZY2A 3CU5A 3OMXA 4YGXB 3DLHA 3CKMA 4RXUA 3SY8A 5BQ3A 4RS3A 4G0YA 3DBIA 3CTPA 3MQ4A 4WZZA 1QO0A 3OLVA 4W5NA 1JL3A 2R25B 1ZDMA 3JPWA 4LDAA 2LP4Y 1WETA 3W9SA 1DRJA 3KJXA 4P1ZA 5CNMA 1I3CA 1QO0D 6CHYA 4W5TA 5ABPA 2E4XA 5CNIA 4F12A 3QX8A 3Q7TA 4MRMB 1LBIA 4PYRA 4CBVA 3NHMA 1A0OA 4P98A 4Z9BA 4DQDA 3HVRA 4Z4IA 1VLZA 1AB5A 2KYRA 2CWDA 4WXMA 1MAVA 2L2QA 1DRKA 2FKAA 1HEYA 3DGEC 4MS3A 5FWYA 2L19A 4LE0A 2O20A 3NBMA 5TQ0B 1TM2A 1E6LA 1Z15A 1QKKA 2JVKA 3C3KA 3QELA 3BILA 4L85A 4RK5A 3BRQA 4MR7A 2FQXA 4WT7A 4EVRA 2PUAA 3D02A 3H1EA 3MYYA 1P6QA 2B4AA 3RVOA 4ZMSA 5CHYA 4XASA 2WRZA 1LJUA 3OQMA 1GLGA 1ZGGA 4ETMA 4MPTA 4MQFB 2QR3A 3H5WA 4HYEA 1P6UA 5T3YA 4Q7EA 2MYTA 4H3KB 4PZ0A 3K9CA 3RVQA 3L6UA 4EVQA 3EGCA 1DC7A 2FVYA 3HUUA 3IPAA 3TMYA 2A9QA 4ETNA 4IRXA 3JS5A 3M6MD 3QLVC 5EWLB 1EFAA 3OLXA 1U0SY 1EHCA 4KQCA 3O21A 5TPZA 2RGYA 3HZHA 5TQ2B 3A10A 1Z12A 2YHAA 1ZITA 4KMRA 1JWLA 3CHYA 1DG9A 2QU7A 3OQNA 1Z25A 4MQEA 5TPZD 4KNYA 2VK2A 3KYIB 3L49A 4KZKA 3RVSA 4F06A 4EYKA 5C5CA 3Q15C 1QQBA 3KTOA 3KSMA 3HO1A 4KK4A 2ZWMA 4LRQA 2PUGA 3H5TA 1KGSA 1RNLA 3C6QA 4LE2A 2PL1A 8ABPA 2FN8A 3EAFA 4PICA 3OO1A 1NXOA 3O2SB 1JFVA 4MR9A 1E6KA 1JDNA 1DZ3A 1Z13A 2WMYA 4MLCA 4MLDA 4N47A 1QNLA 1APBA 4QPJC 3F73A 1USGA 2MYUA 2WJAA 3OM1A 3LUCA 4MR8A 1ZH4A 5FBKA 3LKVA 3HDGA 2PLNA 1NXPA 3IP6A 3QLTA 1JBEA 2GBPA 2PAFA 2VUIB 3R0JA 3HK2A 1NTRA 3RH0A 4Q6BA 4LE1A 4XARA 3S99A 4NICA 1SXIA 5HSGA 5IEBA 4JASB 5GOTA 2F8SA 4ZPJA 2GWRA 3GWGA 4G0MA 1PEAA 3QEMA 1VPWA 5JNUA 2NT4A 3HV2A 3HCWA 2E4ZA 1EWKA 5CNJA 1YS7A 4MS1A 1TLFA 4Z4EA 3GRCA 4WWHA 5IEJA 5GQSA 1USIA 1KMIY 4O5AA 5E3JA 4YP9A 3F6PA 1Z2EA 3KKEA 4YRZA 1Y1LA 1BAPA 2QVCA 4G97A 4QYWA 3MMNA 3QK7A 4N0PA 2GI4A 3FFTA 3N53A 5HKOA 4IILA 2FMIA 2MYPA 4XFKA 3CRNA 3ROTA 4Z0NA 3A0RB 3LUHA 4MS3B 3BREA 2WWVD 5JS1A 4HNSA 3H5OA 1MIHA 3EDCA 1ZAYA 1A2OA 2HSGA 3QELB 3OLWA 4GNRA 3HS3A 4MR7B 1NXTA 2LUOA 5IC5A 1NATA 4RK6A 3VNBA 1BDIA 4TLLB 2PL9A 3H6HA 2WY2D 2IOYA 4Z4HA 2PUCA 5BR1A 3G85A 5JNRA 3RVLA 2RJNA 1AB6A 2GKGA 5JNTA 4S05A 3URMA 3DGFC 1XHEA 2R48A 4E7PA 2A9PA 1T34A 2PMCA 4G0QA 4MYRA 1K68A 4YWHA 4KPYA 1JHZA 4S04A 4F3TA 2FMHA 1JYEA 5IULC 1SD5A 1H9CA 2B1JA 4JAVC 4OATA 3C3WA 3H5LA 4JA2A 2RJOA 4OG2A 3O1JC 1YK0A 1PUXA 3JTEA 3N0XA 3LOPA 3NNNA 1EAYA 4RK1A 3JY6A 4IF4A 1MB0A 2FW0A 3ROFA 1JDPA 2L17A 4MQEB 5KWSA 2IPNA 2IYNA 3P9YA 4EVSA 4YR7A 1A04A 3HEBA 3Q9SA 3EQZA 3LUJA 4RXMA 3T6KA 2FSPA 4OBBA 5F64A 1UDRA 1CYEA 3IP7A 5TQJA 1ZVVA 2IPMA 3M9XA 9ABPA 2PE5A 4RV5A 3RVJA 5KQMA 5BRAA 3CS3A 2CHEA 2N9UA 3N8IA 1OXKB 4IMIB 2FEPA 2BGGA 2TMYA 3GA5A 1ABEA 3QX9A 1F4VA 3KYJB 2JBAB 5C5EA 3T95A 4B09A 2HQBA 3OLZA 4D6XA 5B3JC 5EWJA 3LFTA 3LTEA 4MR8B 1Z16A 1TVMA 1IIBA 3BRSA 1ABFA 1MVOA 4H3HB 4RK0A 1URPA 3O2QB 4YCSA 1JLKA 3MA0A 4H60A 1SXHA 2F8TA 1FSPA 4KVFA 1Z2DA 5KQPA 4RY9A 1B00A 2L18A 1JX6A 5IUNC 3MF4A 1LBHA 4EY3A 4Y9TA 5BRJA 3QEMB 4ZJPA 2AYZA 3HM9A 1ZHHA 4HNRA 1QP4A 4YO7A 2JRLA 4MS1B 4Z4CA 1FFSA 4WXEA 1YIOA 1NY5A 5EWMA 1L5YA 3I45A 6ABPA 4LX8A 4F11A 4ZYLA 3JPYA 4RKQA 2FMFA 5HM6A 1DCKA 3N75A 1J56A 4MGEA 5TPWB 1YS6A 1VRVA 3FDFA 1GCAA 4IMJB 2J48A 1TMYA 3DLBA 1DJMA 1YMVA 4G0ZA 4RZSA 2FLKA 2ID7A 4RWEA 3RVPA 1FFWA 1QQAA 3OMWA 5JS2A 2V0NA 4DN6A 5JNWA 4JOQA 1XWWA 2E4WA 3KCNA 4MAAA 3CG4A 4FE7A 1U2QA 4Z99A 1E6MA 1D4ZA 2Q5CA 4QYMA 2JK1A 1PEYA 4TN5A 2PUFA 1P8AA 5DLEA 4W5QA 1JH9A 2RDMA 2ZAYA 4MQFA 3G1WA 1QP0A 1QMPA 1YVUA 2MSLA 2CHFA 4G86A 5DGCA 4EGSA 4MS4A 1ISSA 4M88A 1USKA 1KRWA 4EYGA 3HXMA 5EWLA 1W25A 2I6FA 1RXEA 1M2EA 1RXIA 3N6VA 4TLMB 1W9HA 3SQNA 5KQGA 2PJUA 4EUKA 4G0PA 5IUJC 2M1ZA 4XXHA 3IPCA 2E4VA 4NCBA 3TB6A 3EJWA 4OLBA 4N0QA 3N0WA 5PNTA 1MB3A 5FWYB
chains in the Genus database with same CATH superfamily
3KHUA 3AFNA 1UH5A 4CMCA 2D7CA 4QICA 5DN6D 5EXSA 1TOAA 1B6RA 2XAUA 5KYNA 1E9CA 5ALLA 2FPUA 2JLQA 3I5AA 4WFKA 3UMFA 3TNYA 3VOTA 1LW6E 3ESXA 4LHZA 3O03A 1E1QD 2P9JA 2HMWA 4NEHB 4P32A 4XB6B 3D7MA 1C14A 1QHSA 2OKGA 2P9TA 4NK4A 2VDUE 1GPJA 2PX0A 2WVGA 2XZTA 4QG7A 4R6WA 3SOZA 1HC7A 3EEIA 1W5SA 2ZXUA 3OEEA 2QGZA 3D7NA 2Z5FA 1L4UA 4OHMA 4Z9AA 3NH6A 1Z08A 4KKXB 3X0DA 4M22A 1NBMD 5DLDA 3DM9B 2PUDA 3QMVA 1TMKA 1OXBB 3EZFA 2J4CA 2OLEA 421PA 3FOEC 4PAMA 3CRRA 1QZ3A 3A6HA 2OHHA 3IHTA 4ND1A 5JNSA 5DB4A 5FH9A 1NL3A 4KO8A 4YRLA 3G2MA 4H16A 2B78A 3KLBA 5KTRA 2DC1A 4KQWA 4H0NA 1KYZA 5EKTA 2HMUA 3EFHA 5GJCA 1HSOA 3CUKA 4F97A 1LFDB 4A8JA 2PWBA 2BGUA 3BRWA 3ESBA 2CJFA 3CLTC 1C7EA 5G0UA 3UMBA 3USZA 1U2ZA 4E5YA 3BK7A 1F2UA 2VHZA 2ZM5A 1T2DA 2ISCA 2IL1A 4NAUA 4EG6A 2XXJA 5IJWA 1OI7A 1XTVA 5DK6A 2XZLA 1H4QA 1WDLA 5FBQB 5JD5A 3OJEA 2Q3LA 1E60A 4E4RA 5GJBA 1YDGA 3NIWA 3FWZA 5JCPA 4X8OA 1XJ0A 5EY5B 4C87A 4KQ9A 5KMGA 3OQOA 4OQQA 3FPGA 5IK2D 4CXMA 3ZJ5A 2WZBA 4AKGA 3GR6A 1AD2A 1EFUA 1FFGA 4FI3C 4KH1A 4QU0A 5FBRB 2Z04A 3R8XA 1D4FA 3V32A 4ZKEA 1RD4A 4KC0A 1AQNA 5F98A 3QBVA 1LQ2A 1JDZA 5CVEA 2BKAA 4RQUA 4CLHA 4CUJA 4G2NA 3PNYA 1IY8A 1JFTA 2V9CA 1A9XB 4D9IA 3Q12A 2GFHA 4FONA 3W5BA 1II0A 3FDZB 3FIUA 4OQZA 5COAA 2HXSA 4OGLA 5E8JA 4EG8A 3JQCA 3R4CA 1ENZA 4FGUA 1CUGA 5AVKA 3ST7A 4JITA 4O8ZA 4G5QA 3K0HA 3MUEA 3D64A 3SJBA 2D62A 1EK2A 1NTOA 4C4ZA 3A1TA 5FI1B 2VPWA 3ICPA 1UKEA 3LPDA 4IGFA 1UBUS 4A8HA 4GEKA 3GVIA 4N4AA 1GNLA 2IF0A 4URZR 1DJNA 4QQKA 1XEAA 2V1XA 4IJ6A 3AR4A 3DVLA 4MGZR 4Y9SA 2OO3A 1F6DA 5GMOA 5BW6B 3H8WA 3OD1A 4BO1A 4CT4B 3BMCB 4FCVA 2RK6A 2Z2IA 1OGJA 1U8CB 2YWEA 3GL9A 1OV6A 3L07A 3L4BA 4P2GA 4RQBA 1DC8A 1TRKA 1UPBA 3EVCA 1P17A 4YJKA 3DJYA 3ZW7A 4A92A 1J22A 1L5KA 1W1UA 2QY9A 3WY9A 1JWAB 4CEHA 4MULA 1BEEA 3GIDA 1H69A 1Y6QA 2BTOA 4DZRA 1WXEA 3HMQA 1VL1A 3LUDA 2MSKA 1QF9A 5HZHA 2VF7A 4GUAA 1P4JA 1SVKA 3RM3A 3INYA 4F4DA 2WFZA 5EXEA 2FPPA 4MTLA 5TR9A 5DP2A 2OSBA 5LNK6 3GMSA 4FR0A 1TQ6A 4L0CA 1J09A 3N7TA 1G5HA 2VP3A 3QMMA 2HBZA 4OUDB 4QRDA 5FI0B 2I3BA 5CBKA 5E0OA 1KJZA 1IVYA 3DEFA 4B8WA 4BQEA 2OFPA 3GJXC 2QN6A 2HA7A 3JZMA 2PIDA 1K5HA 2R4UA 1QORA 1QZUA 2AG1A 3HY6A 4L4XA 4CMJA 3C70A 4H59A 2MINA 3EXHC 4N9QA 1KP9A 3QPDA 2UZ4A 3ZY4A 1VJ1A 4H77A 3TVYA 3RAEC 1HEUA 2C5EA 3IDFA 1B15A 3LVQE 3LRXA 4ZVUA 5ICSA 2J31A 1F48A 3B52X 3LBNA 5B1HA 1U3DA 3T5DA 4DJEC 2GK7A 3QLUA 3R20A 3LCJA 4NZ9A 1MF7A 1CJCA 2ONYA 3CJTA 4L8VA 1CULC 3TSWA 1FZTA 4FLFA 4MVJA 1OVMA 4MP6A 1ISRA 2HXYA 5FBHA 3KSUA 1V5GA 1UJCA 1W5AA 2A33A 3CX4A 3F7TA 3G2JA 2VL7A 3KWJA 3HFSA 1N6OA 3LVFO 2HSWA 1S3FA 2R8RA 3MAJA 4L5AA 1GGKA 4P4GA 3L7YA 5EXPA 1ZESA 3T5GA 4CLOA 1IEQA 2CC2A 1X92A 4ROSA 5EEHA 3DOUA 1RYYA 2WG2A 1LF0A 2FR1A 3X2EA 1ITZA 5D8DA 1BROA 1YDMA 2NYVA 4EHDA 3GEHA 1OU0A 2VUTA 2AQHA 2DHRA 2JFUA 3EQ9A 3K9NA 4C7OA 4ECAA 3P2IA 4K6GA 4MINA 1X6VA 4PFKA 3OG9A 3C7KA 4PS1A 3WTCA 4BZPA 3B1WA 4QODA 2FQYA 5DOZA 3KB1A 4ZK2A 5EE3A 4V1CA 1WSBA 2JI7A 4DEVA 4N03A 3CQ9A 3ORYA 2IGTA 1JI3A 3D8TA 5AK0A 5FPQA 5K4HA 2NP6A 1KC3A 5IF3A 2GB4A 1D2RA 2LCIA 1DKNA 4PYJA 3DC2A 3J81k 1FX1A 3E35A 4UE2A 5M04A 4KR6A 3SJUA 1AKEA 1V9LA 3CKYA 1E94E 1TD1A 3HADA 4EJFA 1OGYA 2W0MA 1AKWA 2EFEB 2AOTA 3KJXA 3MAAC 4XJTA 1WXGA 3NS7A 4TMWA 2PH5A 3JWGA 4KQJA 5DCUA 3BJEA 3BWEA 2C5LA 3MJCA 3QX8A 4PNHA 4WLOA 4Z8XA 4AMVA 4F12A 4EKNB 3I64A 4NH0A 5HE9A 1LVUA 2CL5A 2XKAA 3NHMA 5G2OA 4DQDA 1OZGA 1XAJA 5ETJA 2X3UA 1GL6A 4WXMA 3KFLA 2GZRA 3OQVA 4AO7A 3AF6A 2RH5A 5BQPA 4DCSA 3CF6R 4PBRA 2IX3A 2RAPA 1KI1A 1A8UA 3WB0A 5KYWA 3HV0A 1Z28A 1RJEA 4URVR 1B4DA 1E3TA 3DDZX 1N0HA 1X7ZA 1QKKA 2V7QD 3C3KA 3IEIA 1BCRA 4JLPA 1ORTA 4WT7A 4MR7A 2Q29A 3DH0A 3OJOA 4MYCA 2NSDA 3H1EA 4AJ2A 1UIRA 3CRQA 4MZDA 4S2UA 1RPTA 3ZXYA 3KX2A 4CTNA 4ZMSA 1WU8A 4KBYA 3TXXA 4DDVA 1PL6A 4HNTA 4DLPA 2WAMA 3D4BA 1FP4B 3Q9LA 1W4AA 4PYMA 2E1PA 2C3OA 4QNNA 4BAZA 3JWIA 4E13A 3I2KA 4G0UA 2P4EA 3IOCA 3R4VA 2YUTA 3QU2A 2VDMB 4XYEA 1XVTA 3TFWA 3RVDA 3IIIA 1NLZA 2HSDA 3PE3A 4PZ0A 3CUTA 5DM0A 3SEFA 4RD4A 3JRWA 3KYCB 2GK3A 5E7IA 3CNQS 4BLTA 2DYKA 3NHLA 3R7DA 1GTMA 3RSCA 5K7SA 2P90A 2NP7A 3EFEA 3C5WP 5FPYA 3FPEA 1FXUA 4O0MA 4ZHQA 1EFAA 1U0SY 3N2GB 1TQ4A 2CXXA 3I9V6 2BD0A 5TJ9A 2MDTA 4DB2A 3CF4G 3T7JA 3WRVA 3QHPA 2YZNA 1SKMA 3GJ6A 1RAIA 2BBWA 4GBED 1P2DA 1JWLA 2ZRJA 3S5JA 5ADUS 1FYEA 4ZV7A 1Z25A 1DOAA 3DE4X 2P77A 1YBHA 3NP9A 3U49A 1W36C 4R0NA 1COWA 5C8XA 4PQEA 1EKXA 3KYIB 4KWCA 4O4LB 3WJ7A 3AKYA 3EX7C 5DHUA 2J9FB 2WUDA 1AIPA 3ETNA 4IXWA 3ZV4A 3AM3A 1CVRA 4ZTZB 1CBUA 1VI5A 3UEOA 1RNLA 4CDRA 1WDMA 2HADA 2OGWA 3L7MA 3U48A 1Q0PA 3BDAA 2L82A 2WSYB 1BXKA 1JFRA 4EO4A 2YWBA 3D8NA 3H84A 5HGXA 3ETEA 1LK7A 3NWEA 2D4AA 1C9MA 3BA1A 4S1WA 1L4BA 5LR6A 3LLSA 3NAGA 3PLAE 2E5LB 5DO9A 4L95C 4RF5A 2VNAA 2J0SA 5EIXA 5A0VA 1QRTA 4AJNA 1Q6YA 1UC5B 2IOFK 5DBEX 4PGHA 3JWEA 4ZJUA 3ZNNA 3ZWOA 1NUSA 4GZ6A 2A78A 3DMPA 4DF3A 4M1MA 3INRA 4DSTA 3UCEA 1OBCA 2F8SA 4YP1A 4Y1GA 1W49A 2D2XA 2KMLA 3CT4A 3GX1A 5TLSA 4JT8A 1JSLA 3FYUB 3KVYA 2QN2A 5E6SB 1W47A 3N59A 3K0BA 4Z4EA 1MEJA 1W581 4P6VF 3JW8A 3GLGA 1C0LA 3IQGX 1NF9A 3OZBA 4I3HA 5E3JA 4Y6GB 3TPZA 5TF4A 3LE8A 1DV2A 1N0UA 1PBNA 3K1TA 1SXJA 4S1NA 2ANCA 2WV7A 3KKEA 4DAOA 2HOQA 3CWCA 3EFBA 1SZJG 3DXFA 4X6XA 4R05A 3EXIA 1FIUA 1PSDA 1JAYA 4XIYA 1B6SA 1G9XA 2HM7A 1YQQA 1R4MA 1XK6A 5MHTA 1G8SA 5DRYA 1QIJA 4PV7A 5BSUA 4PLTA 3T1TA 1N33B 5CDFA 1RJGA 5ICEA 4U7HA 3GP5A 5LZ2A 2G04A 1P0CA 2Q6KA 1WETA 4BX9A 2V7WA 3AFIA 5DSXA 2PXCA 1M2VB 3O8OB 4DBLE 2G7MC 5CYFA 2M6RA 4L1KA 3VNBA 4AKIA 3H17A 1GAJA 1ID1A 1PQUA 2G9QA 3HQ4O 3QVOA 1G60A 2A9VA 5CM8B 5GM2A 1NY6A 5B1YA 1FVOA 3ZWCA 2HWWA 5HVNA 1GTZA 5BP7A 4TLAA 1QK5A 1R1DA 3NHAA 2DPGA 4EY6A 2ZRFA 3QVSA 4MV9A 3AI7A 5NLLA 2A94A 4YJGB 4UOEA 1Q16A 5HIKA 1T2CA 3TQFA 1KDOA 1OT3A 2PLRA 3DGFC 1RE0A 4K9DA 1ZJYA 3OZGA 5CJPA 3HC7A 4NCNA 2G25A 5JISA 1MVLA 4BNMA 4BWVA 3LWBA 1K7FB 2P62A 1SR8A 1YZVA 2ZAIA 2ZS7A 2BEUB 4QWWA 1Z07A 2CVHA 2NYUA 2EJCA 3PHGA 3SX0A 1MTOA 1NSFA 2BONA 4HXGA 1CKEA 4QJIA 1QB8A 2RI1A 2OCPA 2ZYRA 3T7RA 3O4FA 1TYZA 3SFZA 3HXOA 5AJTA 1MNAA 1BX1A 3HEBA 3EQ8A 1E4YA 1PJ3A 5KINB 4G1BA 3ONWA 1DQZA 2X8WA 3ZTTA 3BXHA 2P79A 2OHOA 3JXEA 3WLTA 1YRQA 1KEKA 3GJ0A 4V02A 2Z5VA 4JZYA 4AULA 4K5QA 3ACBA 3PGLA 4OHUA 4Y2YA 4TMZA 1DC4A 3SZRA 3UJDA 3I32A 1ATZA 2Y0PA 4JKYA 5JMPA 3TLMA 5IM4A 1MHTA 4M9CA 3TLJA 2JNWA 1GUFA 5DTMA 2G1PA 1QX4A 4EI7A 1VMAA 1NIPA 5LUBA 2WEKA 2XIJA 2HWXA 1EWRA 2VJCA 4MR8B 2ZB4A 1I1QB 2WP8J 2CFRA 3EVTA 4H3HB 5D3QA 1W44A 5GONB 2VLBA 3C3CA 4G5SA 2GBLC 1T0HB 3CUSA 4FIDA 4RIIA 4CN8A 5HOEA 3FVWA 4KVFA 4YPOA 4I8IA 4JMLA 1L3IA 1PT8A 4EO9A 1M2OB 4OBEA 4TTPA 4JQOA 1VDMA 3HDHA 4WKCA 2YCLA 2WUVA 2YV2A 1AKTA 5K6RA 5FCDA 5BWBA 2EU8A 1ATIA 1H5NA 1EE1A 5LQCA 4HCJA 1OSNA 2HL6A 1SUIA 3N0TA 3ZQ6A 4D4MA 2AR7A 2GF9A 3DZCA 4A6XA 1QIFA 1ORIA 3Q7QA 4C2UA 1FVHA 2AKEA 1KU6A 3T3OA 3F8TA 3H4TA 1N5LA 4ZYLA 2N42A 4QLAA 3NORA 1TDJA 4RKQA 4ZOLB 4BEVA 2Y0BA 3FZQA 4KLCA 1PFQA 2ODEA 3N7UA 4UC0A 1Y8ZA 5A71A 1ZVJA 3FDFA 1ICIA 2OBMA 5B4VA 3PNPA 1WSAA 1Z0KA 4Y2SA 5HMLA 3TR5A 3R6DA 2ID7A 1HG0A 5K0BA 3RYFA 2AOUB 4UZFA 5JFTA 3V2IA 1KH3A 4JOQA 2QR5A 4Q1DA 5IFLA 5L4NA 3F3SA 2OUIA 1TZKA 1M6NA 1TJ3A 2E48A 2OPBA 2JK1A 3BFJA 4PNZA 4N5DA 4R9UC 4X93A 4Z5XA 1ZNZA 2J5QA 2PRYA 3KZOA 5A02A 4F4CA 2NMVA 2C2KA 1F1JA 1IOVA 3KOXA 5JROA 1G21E 1Q91A 3IURA 1XZAA 3UB4A 5JZSA 5KZMB 5EJFA 1UK8A 1RWWA 1T0JB 5CK5A 2B5VA 3EPJA 5DPMA 2H4ZA 1RQLA 2GERA 3SMVA 3FPBA 4K81B 4RKEA 2ZT8A 2JIZD 2Z8YA 5HBRA 2VHYA 4MEBA 4DZTA 4HEA6 3OAAA 5FOXA 2J9ZB 2FSVC 4K7JA 1TIBA 2BSXA 3C4QA 3STUA 4TTAA 4UD6A 4EUKA 1M10A 1M0SA 1SKYB 2LKCA 2R751 2HIAA 4NV1A 4LXGA 3I9NA 2CUTA 2VK8A 3SFTA 4BBPA 4DRXA 1A5SB 5I4KA 1OYYA 4D9CA 2QUKA 5ITVA 5EE0A 4E11A 1MB3A 5IYZB 2PTHA 3CPSA 2ZR8A 4R5HA 2C2ZA 4UATA 1H2RS 1JKFA 2AYYA 3EASA 4IM7A 4EBFA 1VMDA 1PAUA 1X7WA 1DFHA 1ZICA 2WWXA 3EZ9A 3LECA 1UMCB 4ODIA 1DBVO 2DPLA 2J9RA 3H2YA 4TKLA 2KBEA 4QOSA 4DNQA 3MERA 3DSRA 1DWOA 2EGUA 1JJVA 2I3DA 4LZLA 4MV0A 1SPBS 3PYMA 3BMXA 3SPXA 1EG7A 4KN6A 4NFHA 2X86A 2JIRA 3DEYX 3VBCA 2BFCB 3CFYA 1XTIA 3E1KA 4UPDA 3GAZA 4UHDA 5MN6A 4MA4A 4RVOA 4TUYB 3AF1A 1QU2A 4ECEA 2OG1A 4G89A 1V25A 5EQTA 2KS6A 3PLNA 1YRYE 2HJ9A 2BFFA 5HCIA 5CA0B 5LOVB 4AKSA 1T0BA 3H18A 4O33A 2Z5LA 2C20A 3AF5A 3L7CA 5JPIA 1V5EA 4PRLA 1NT4A 4FK8A 2C3UA 4EZBA 1M2NA 1O95C 2R3SA 3FFWA 3GC6A 3N0RA 2BBOA 1GUDA 1T3SA 2YYYA 1JIQA 3MCUA 3DMDA 4IWNA 3SHQA 4HI0E 3VU9A 4EHIA 3B6JA 2P1ZA 3EXHB 1Y7LA 1RR6A 3MC1A 1Z26A 4X20B 4ER7A 5EIWA 2GYVA 1CS0A 2RGXA 4I4IA 4ENQA 2VQFB 3KYBA 2JFBA 1WR8A 5ALRA 3RQIA 3ZWKA 1WWKA 1W85A 1PR2A 2G07A 4BNLA 2XZDA 2QZSA 3ZZNA 1UBHS 1DCMA 1MHPA 4HQFA 3NJ8A 3EF3A 3TINA 4BVJA 2J3KA 2JGLA 1UOEA 1UZLA 1P7WA 4Z4FA 4WBNA 1AUQA 5F7OA 1H3EA 1PQPA 2XECA 4Q3NA 3BXFA 2C8VA 3KV3O 2G9VA 3C3DA 1PYOA 5AK5A 4XJSA 3QX3A 4B9EA 1DKPA 4L15A 5EIBC 1K3UB 1SHZA 3BMQA 3D6NB 1NN5A 2Y77A 4N6GA 5IJXA 2HHHB 2ZS8A 4HN4B 3B20A 3LQ2A 2O1WA 2CFCA 2VNKA 4WY5A 3ZE2B 3ZI0A 5FPHA 2XCLA 1LTQA 1YQDA 2VSNA 4AJOA 3E9RA 1TCBA 3P20A 4PCLA 2P75A 2X3YA 2P2SA 4KQIA 1QC5B 1U7PA 3BJMA 4HH0A 1K7SN 2XGSA 2C9CA 2IHNA 5H82A 5E4JA 2O3JA 2FLWA 3WYAA 4TKVA 2ID8A 1ZJ6A 4R2IA 3Q10A 4JNKA 5BSMA 4LXXA 4OTZA 4QPPA 4QOFA 4FZJA 3QYAA 2OQ2A 3OOWA 3O0TA 4MVJF 2FRDA 3GQVA 4B35A 1ZXLA 3CB2A 4IHKA 1ZD9A 3NT5A 2OGSA 4I1UA 3UV3A 4S1OA 1CQIB 2K6GA 1BMTA 2QV7A 2R00C 3A6KA 3GRYA 4FWBA 4AUKA 5KWVA 2Y0EA 3QKIA 5D84A 4YQEA 3B70A 1S89A 1LSOA 2ZVJA 3PGVA 5E1OA 2V1UA 2C8KA 4EECA 4K88A 2PKWA 1C3XA 1ZCJA 2JHPA 4FJ1A 4GZ3A 4GPBA 2ZPAA 3DE7X 3H6GA 2ONZA 4PU0A 3RCBA 4ARIA 1J0XO 1FRFS 3RS4A 1WS6A 1GUBA 4OJYA 1Z2PX 2ZSAA 1KJWA 3NDRA 4N7JA 3U4CA 4KB5A 1V8FA 3IT3A 1Y1QA 3U4AA 2V65A 4LOHA 1NRJB 3HKDB 5LOVF 1A77A 1XE3A 4II7A 3PUKA 4FWIB 4C05A 2YJTD 5JJCA 1U5AA 2COUA 2XDYA 1YV9A 3KLOA 4X5OA 2A30A 4QATA 4RM3A 4CMGA 3PQ6A 3KJZA 1A4UA 1J8YF 4N82A 2DAPA 3QBJA 3QXHA 4MROA 1WCXA 5DXAA 4S12A 4MQMA 2FW8A 3AEUA 3DZDA 3O1IC 3E1GA 3PYXA 1FZQA 3F8WA 2FEWB 3HN2A 3WQBA 5AKYA 5IBQA 1AZSC 3VV3A 3C8DA 4YVFA 2WWFA 4GD3Q 3FOWA 2Q3FA 5IUKC 3ROKA 2O8BB 2BHNA 5J2TF 2ROQA 1EEHA 1ZX1A 5K0TA 3DMTA 3PJDA 5K4AA 4F6CA 3L7AA 3AW9A 1LC0A 4BCDA 4E46A 1UANA 3ENVA 5SV2A 1N2IA 3DNPA 4QVKA 1T13A 2AMVA 4LOKA 1T4BA 3P4XA 1ZFNA 4WNAA 4KIJA 3GBPA 1EVIA 3A6DA 4Q3OA 1EBUA 2ANBA 2Q8PA 1W36B 2V03A 1JILA 1WXFA 4PRKA 3EW7A 2YJ4A 3TM4A 3R0QA 2DSNA 3U56A 2PZMA 5JYCA 5TPWA 2Q8NA 2O07A 1DS6A 3A7DA 4PX5A 3VC2A 1J2TA 3DR5A 2BCGY 2QRVA 5SZJA 4JOBA 3EFOB 2I80A 5AW4A 2YTZA 1G5RA 3OJ0A 1UMDB 2CD7A 4I1IA 4IKPA 2UZ1A 4E08A 1XMOB 2PTGA 5KNCH 3OKFA 1JLSA 3DQPA 3QY9A 1QYRA 3IE1A 3JD0A 3OZWA 3ORFA 1J20A 1R5OA 2VYNA 3NHYA 2H51A 3O8QB 4LTDA 1AQIA 2CDBA 4RH0A 4WAUA 4Z7JA 2BM1A 5T4BA 3TG2A 3NOQA 4F1WA 4YNBA 1U8XX 16PKA 3F1LA 2J46A 4BNDA 3UGKA 2IP2A 4GOJA 1PSZA 3CX6A 4WZZA 4LFCB 5CCBA 1C7RA 4TMKA 2QL6A 5CT8A 4DPMA 3MT7A 3DP7A 3JPWA 3FFAA 4O4HB 2PT6A 1KTVA 2C9OA 2NNLD 5DWDA 4O5OA 4UKDA 3WWYA 1TYDE 4NL4H 5D5HA 1EAMA 2VP4A 1CV2A 3ORSA 3NBAA 2D2EA 1U6JA 5H1YA 4ENRA 5A5DA 1UPCA 1AB5A 4MUIA 3W9YA 4D4IA 1PUIA 2B1IA 4PC2A 4YAFA 1M0EA 4M0MA 1R27A 5BYAA 3AF2A 1IC6A 3S55A 4HBGA 3OPMA 4YJHB 2ERCA 1KY4A 5FWYA 1YCFA 4L22A 4BFWA 2ZR0A 2H18A 1XL1A 1D4OA 2JVKA 4ZQCB 1B3RA 3DTTA 3QELA 4Z1MD 1RKQA 3H97A 1R3DA 3BRQA 3BSFA 3SXPA 4XEUA 2XGJA 1FJHA 1H2XA 3TL3A 3ANYB 3F3KA 4KHZA 4QXRA 4X84A 4ZO4A 4XX1A 4Q01A 4Q4JA 4F2WA 3K7EA 3UTCA 3K2EA 5CVJA 1CW2B 1U0OC 4I2NA 3I3OA 1K2VN 3QXCA 5BN5A 2H2IA 1YVPA 4XGNA 2G28A 3ZD8A 1EIWA 1CRWG 3CLRD 3L6UA 4LJRA 5TGZA 4KYUA 3DAGA 1MB2A 4KPFC 4QYXA 4YUXA 2YIDA 3FCOA 4ETNA 4TT8A 3RFUA 3M4YA 3GLHB 2YN0A 4BGEA 4JLJA 2Z1DA 3DR3A 1YONA 2ZOSA 3HYSA 3OLXA 3IT2A 4LC1A 3F9CA 4GLJA 3RU2A 4DKXA 3D6VA 5KYXB 4L8WB 2RGYA 4NNPA 1IN8A 4UM7A 4O25A 5HCUA 3A10A 5TQ2B 3BWVA 4HB3A 1YUNA 1YAHA 2HFKA 3L8HA 2AMFA 2W11A 5HS4A 4JEUA 2C2YA 2PZJA 2RGEA 3IAUA 4IHAA 3KQHA 5B7QA 4EYKA 1HE1C 1QXSA 3FETA 2C77A 1CJSA 2FHPA 2FX2A 4N1AA 5G4LA 3R75A 3ASZA 3R3SA 3H16A 1VQ1A 2O05A 4EHHA 1ZR2A 3L7KA 3ZHCA 4DG8A 3GJ4A 2DFLA 5B30A 2IYZA 1BWQA 1PDOA 4JB3A 2F3RA 4UXHA 2XVXA 2ZT5A 1JZSA 1Q15A 3AJEA 4J4TA 1CR4A 1DZ3A 1WVIA 3ZEIA 4KQXA 3T7SA 2WAAA 4RYDA 1G16A 5ALDA 4LEIA 3DZFA 3ZVKA 3M5WA 4FJ2A 4EY3A 3E70C 4P9NA 3HDJA 3B6MA 3L9XA 2RHDA 3BKXA 3ZWMA 4BX0A 3QVLA 2X15A 3FYHA 4EK9A 3ZXIA 1E1LA 4ZYZA 3KKKA 1IWPB 1AXGA 4E1BA 1SO8A 1VB5A 2CDRA 3IPXA 1RLJA 1A5BB 3GA7A 2HKIA 3DUWA 3DL0A 3H0CA 3T7AA 3L79A 3UOGA 5IWCA 2X5XA 5T3UA 4LK2A 4RIGA 4FYWA 3SMQA 4Q9HA 1X87A 1KF0A 1PS8A 3CCCA 3LPMA 1R4AA 1ZC3A 5G4KB 1H8ED 2F1OA 4HGNA 4C89A 4IG9A 4DV3B 1XMSA 4K6CA 5L9AA 3HG7A 3MD9A 1FRNA 2VUSA 1AMNA 2PGAA 4DSOA 2VHQA 1PLLA 3CVOA 4TSKA 1SG0A 1G8JA 1YZKA 2CT8A 4MS1A 1UK7A 3GRCA 1P62B 2HDHA 3JQEA 3T5MA 3UJNA 3IIKA 2BEWB 3OOYA 4NIMA 1VMEA 1Y4UA 1WUTA 5ELMA 4UAUA 4OPMA 4TYWA 1JYSA 1UT6A 4J7AA 3WLMA 1JJAA 4P7FA 3TSZA 1G4HA 1O57A 1WEHA 4G5RA 1KZ9A 4AM8A 3I6YA 5KEIA 1YDFA 1DIAA 2VH2A 3HH8A 2R96A 4KDEA 4YASA 1M1XB 2OYRA 5B2FA 2VA9A 3VAZA 1Y6GA 1NRWA 2AKAB 4NBRA 3WAGA 1KPIA 3HJNA 4N54A 5ERXA 3AZPA 4MGKR 4X94A 1Y63A 1TVKA 1YHZA 4FMCF 1XTBA 2BGRA 4RIEA 1WZIA 3A1VA 3CCFA 2ZIEA 5JV5A 5J2UF 2RGUA 1I01A 5TMDA 1YRHA 2J5RA 1GGEA 3PQ8A 2RE8A 3F49S 4XE5A 1XKQA 4TKUA 2EDAA 2GTIA 3QF4A 4FGSA 3T5PA 1BZYA 4MUBA 1JXMA 5F3WB 3PHHA 2CEKA 3P2KA 1YNOA 1OXMA 4R8VA 2R6CA 3IULA 3SNHA 2O2ZA 1GO2A 2XDWA 2H4HA 3AKDA 1QZTA 1YL7A 4D7AA 3RVLA 5FFFA 1W0JD 4DV5B 5KS2A 2Q27A 4YRJA 4CKBA 5IWAB 1U9ZA 4K3VA 1NA5A 2GAIA 1LPMA 4CW7A 1I3OA 1Z6ZA 4G3XA 3ND5A 2VWHA 2R48A 3E8MA 4G67A 1P18A 5SZHB 1PFKA 3D3EA 5ESXA 4WACA 5DNAA 1L7EA 1U7ZA 2PKCA 1ONPA 4EQZA 5HUQA 2P8JA 2GMWA 2B1JA 4YX9A 3AHEA 1KZ7B 1D4AA 1B26A 1M0TA 2CFOA 2G09A 2G36A 2R44A 3MOSA 2E6UX 4K3UA 1PS0A 4MWDA 4MVJG 4OG2A 3FKSA 3QNWA 3VM6A 4E09A 2V6GA 3PL5A 1OV4A 1O1YA 3G6KA 3ND9A 3QI2A 3JY6A 5CH8A 2OBXA 4BPRA 2IYLD 2CVQA 5BVHA 3FXAA 3EIHA 4ZC1A 2BJHA 2GM3A 4YDRA 3MTAA 3KOUA 1M34E 2J30A 4X60A 3AIKA 2I6GA 4HYTA 2FSHA 2PU5A 1I7QB 4FYMA 5HRAA 1CYEA 3IP7A 1VSVA 1DB3A 3ENNA 2PKQP 4WKPA 3UKOA 3AETB 1JNYA 3FUXA 4RV5A 4P82A 4KAJA 4TV9A 3KAJA 1J5EB 3V42A 2VDOB 3LL4A 2H1OA 3TLAA 1TT5B 2O57A 3PC8A 4Z1OA 1NJ5A 2IEAA 3U19A 2BHLA 2XPCA 4KWTA 4YAGA 3UPUA 5K03A 4FMPA 2OBNA 1RBZA 2OCAA 2GD0A 5SZKB 1IZZA 1I13A 1I4EB 2QLLA 2PRZA 3ZI4A 3AHCA 4D8VA 2JANA 7REQB 5FUWA 3OLZA 5EKDA 3EUAA 4NJMB 1SQ0A 3A36A 1Z16A 4RGQA 4I50B 5JHGB 3V55A 4QUGA 4R54A 5DNVA 2JIPA 3M4NA 4EENA 1A8IA 4GO1A 1Z0AA 4I46A 4QUEA 1JR2A 4RIFA 2F8TA 4G37A 4DWOA 3NDIA 1YVEI 3GIWA 1MH1A 3PNOA 1N5IA 3IRUA 2P5YA 3TTXA 4JYMA 3EG9B 3FTCA 3PQ3A 3ZHQA 3KB6A 1WZNA 5T64A 2FEMA 3LLUA 4WFQA 3B7PA 5CGZA 1MFZA 1N7JA 3CWZA 4B71A 3KFXA 3QIVA 1M75A 3D4PA 5IDXA 2Q5EA 4L28A 4YCJA 5D7NA 1QP4A 4IZIA 1FFSA 4F84A 3NP7A 5KHAA 121PA 5B37A 1WXIA 2FQQA 4QE3A 4LX8A 4I5EA 1GAEO 1E2DA 3UJBA 1CUDA 2Q07A 3ON5A 4QJ4A 5A0TA 2KJQA 1VRVA 3AX6A 3RADC 1TMYA 2AK3A 3UIEA 2HO4A 4BNVA 2HU7A 4ZVQA 2AS0A 2V0NA 3E0XA 1MDBA 2YVAA 1G17A 3MGGA 2E4WA 1XELA 3EIOA 2WSLA 1P2BA 3GRZA 4AG6A 5K3OA 3UV6A 1T5SA 3PUZA 5EZYB 1HLPA 3QW2A 4EX7A 3CEJA 3EH1A 2QTVB 1P2GA 1BWRA 4AUMA 2P91A 5BMVA 2IIBA 3K92A 3VKUA 4E1AA 1I7DA 3G1WA 3A1UA 3PEUA 3G0BA 5KWEA 2LIPA 3Q8KA 1H2BA 2MSLA 4IX1A 1P9RA 2AHRA 4GECA 3HU5A 4HL6A 4RTRA 2JW5A 2V96A 1TF5A 3QFHA 1I1HA 3HXMA 1GPKA 1H05A 1LK5A 1QCYA 1IBCA 4BNWA 4TXLA 5HK9A 4R8KA 3B1ZA 2HQSA 2YWFA 3Q88A 1C1XB 3AG6A 3C3EA 4XQ0A 3OOJA 4Q48A 4ZJYA 5KQGA 1PKEA 3V7YA 3ZQKA 2WHEA 4CIWA 2Q5FA 3CT6A 4DUPA 3FBGA 1QRUA 3AY0A 5CW2A 2ETXA 1G6Q1 1XEXB 1A72A 2VP5A 4MCHA 4TWRA 4AF6A 1F4PA 3ICVA 4WLVA 2GK4A 3BL5A 4KQHA 1E5QA 3QPCA 1BU5A 2NVWA 3KEGA 2A14A 3OBBA 4WZAB 2PSFA 3EYWA 2WZCA 3L0IB 3MEQA 3Q5EA 2HMTA 3W2TA 2CXUA 2OV1A 1Y5NA 1GU0A 3CTMA 3QSYA 3KSDO 2HT6A 1PZEA 4G5HA 1PRYA 2X40A 4RK4A 1KJQA 1MJ5A 4GC5A 4WUVA 1FY2A 2XIQA 4QPNA 4H1UA 1VGRA 4MQ5A 1HOXA 1L7NA 2FPGA 1NBMA 3MUNA 5HF5A 3FOAA 2PIAA 4FINA 2OXTA 2ZWIA 2QTBA 2FDXA 4HQKA 2AFHE 1E5XA 2IWRA 5IJ9B 5L3QA 1QGYA 1CZRA 2IHBA 1ULUA 2CUZA 2Q4OA 2QSJA 4Q05A 2XRZA 4O1IA 1Q11A 1SUFA 4FLEA 1GRQA 3EAQA 3BT7A 2GO1A 1F9EA 1CS4C 2HSZA 1QANA 4G24A 3JQ7B 3KWLA 4XJVA 4XLTA 4JP1A 1UXHA 1T6ZA 2ISSD 2N3ZA 3PZRA 2QMHA 4RK7A 3RRZA 1E98A 3H8SA 1K5DA 2HTFA 1XNHA 1NE7A 2QVGA 2IKQA 3LYAA 5AI4A 4MQUA 1YOBA 3BRCA 1UMBB 4LGCA 5BPFA 1EK1A 2XT9A 3E6AA 5HF6A 3WMXA 3ZCUA 4HMPA 3HZZA 3HB1A 2M9MA 5F3RA 1M8JA 1KMMA 4YH1A 1EX1A 1LUAA 1ZD8A 1UZUA 4W63A 5LP6C 4ENUA 1DBIA 2NXJA 2OD2A 2G8NA 2VPYA 3NBQA 2OLJA 4ZVOA 1YU9A 4ME6A 4RORA 4RU1A 2ALJA 3A4TA 3RKUA 3UUGA 2QVBA 3ND8A 3NTVA 3E23A 5KO2A 3DP9A 3FLEA 4RPKA 3ER6A 5TC4A 2UUPA 1JXQA 2J07A 1U3FA 5EYPA 3F67A 1KSGA 2Z4SA 4OFBA 4WNIA 5KNDA 1J9ZA 3AHJA 2YOFA 3UPTA 1XMVA 2IHTA 4EFLA 3Q1LA 4RKWA 2WVHA 3N76A 3RSQA 1G8MA 2YWXA 5C1OA 2HMVA 3GPLA 3TUZC 5E4YA 1HQDA 3P71T 1XYYA 3SXUB 4G56A 1JTEA 2QS9A 2VG8A 1K6XA 3UFXA 1PVOA 3IAFA 1E2LA 2VF8A 1QVVA 1SOAA 1OYWA 2FG7C 1GGJA 3C48A 1AO3A 3OQPA 1CQJB 3OZCA 3GP8A 2Z2KA 4XDYA 4X41A 4Z0PA 4MUFA 1E7RA 2GJKA 3Q3HA 2YWHA 4BO6A 3HYLA 1P81A 1ESEA 1H6BA 1U4SA 2YS7A 4NPAA 1FL9A 4LBYA 4XVHA 1TTTA 1EGQA 1E5VA 4WTOA 3TLBA 3VNAA 3RRJA 1UXOA 3RPEA 3EZXA 4ND6A 3VR5A 5DGDA 1Y9DA 2PVPA 3V6MA 1RRKA 1IHYA 2ORYA 1NXVA 5HQJA 3E53A 3LMKA 1VLHA 5CB4F 3E2PA 5A05A 2ZSEA 1FVFA 4LZPA 2GN9A 4EB8A 3HR4A 1KQOA 4F2GA 2G82A 2NM0A 3P9PA 4QRHA 2D6FA 1Y3IA 4LMPA 4KK3A 2ZKLA 4XDZA 1T5TA 5C52B 3QKSA 1XTUA 3BAFA 1W29A 4R2WA 4NC9A 4ES6A 4QQRA 4B83A 1MUUA 3QKRB 2R1VA 1OBVA 4JEIA 1E1YA 1GVHA 3LQFA 3VH3A 3WLSA 3X1JA 1QHHB 2MT9A 3T7DA 1RP1A 3UK7A 3F5QA 2C78A 1GNSA 5F2KA 4C4PA 5B1EA 4ITVA 2PMBA 3G3EA 3TX2A 4LF9B 3LHIA 1US8B 3NJRA 4RJ2A 3PQ4A 4OYHA 3TTSA 4C4OA 1LB1B 3CZ5A 5ILOA 3BL6A 5B55A 1SU8A 4G5YA 1ZN9A 1GCGA 3C1TA 3GO4A 3BH6A 3K09A 2N47A 3DVAB 3IUEA 2VUUA 4Z6KA 5CDHA 2OXFA 2P9FA 3D8RA 4F93B 4EP1A 2BKXA 4AZ0A 3IMFA 4OLHA 4OO3A 4LJKA 2QX8A 2HEIA 4UULA 5E4TA 3OJCA 3TYXA 4ZD6A 1BD4A 2HHLA 3MRVA 5KQLA 3DBHB 4QBHA 2VJQA 2YZ7A 1QSGA 4DR1B 1R50A 3K0SA 4F8YA 1Y4AE 2GJSA 1MORA 1EVQA 3KB2A 5CA1B 4LF4B 1ADYA 3JD1A 4WSOA 3EODA 3HVKA 3FSGD 4NV3A 4RQTA 3VNSA 2IELA 4HDRA 2BKVA 2VDWA 4DBLC 4UHHA 4DMUB 2HU5A 4XD7D 1KI2A 1U9YA 2PGDA 4ZI3A 5IDWA 2EIXA 4EF6A 3OZEA 1GTSA 2AZXA 1U0GA 1G3MA 3PWKA 4LVUA 3VYSB 1ABBA 1BA3A 5AOBA 4JJIA 1PL8A 2EFCB 4ZPXA 3ES9A 4D9HA 6GPBA 1PYDA 3IV7A 1RYMA 2I3ZA 1U8YA 1ODFA 2AMYA 3GT0A 2FN3A 4O2AA 2JEYA 1XRNA 3OT1B 3P2MA 3T99A 1IQUA 1D1TA 3S81A 1C3JA 1B73A 3C2QA 4MUEA 4ARBA 2P35A 1Y1RA 4EKDA 1VGQA 1XJWA 2IKSA 4AX4A 4HNAB 1N6LA 1W46A 3DLHA 4V3BA 1LNZA 2WYOA 4RXUA 4JHXA 4J29A 1SUEA 3CTPA 2VZEA 1Z63A 1I0ZA 4KITB 3GFSA 4GOKA 3IC5A 5K8UA 4HO1X 1QE3A 1BDMA 4JI5B 1S1CA 3AVUA 2ILVA 2QY6A 4YIKA 1E2NA 1QTQA 1T25A 2WYIA 1D9ZA 1R0CA 3D3WB 5HS6A 4GC9A 4LWPA 1N9ZA 1V16A 1QOQB 2H63A 4MKHA 1A0OA 3SYMA 1KH2A 1T6NA 1MV8A 3WNBA 2DR0A 3OZDA 4N0EA 5AI6A 2CWDA 4BQRA 3UGTA 1N7GA 4H3VA 2TS1A 2XQKA 1F3LA 1EUDB 1N1DA 2PY6A 3OQJA 4JBWA 1U1EA 4URXR 1ZK2A 5TQ0B 4ARZA 1Z15A 3I05A 5B1DA 1LCIA 2C1EA 1KY3A 2HWYA 2O8NA 3RREA 3UJHA 1B0AA 3WBJA 4XVUA 2JK0A 1YOVA 1GPYA 3MQ2A 5HQTA 3U4QB 5JNUA 2BFWA 5EPUA 5G0WA 4AFNA 5DZSA 3TKYA 2QLMA 3USCS 4K1LA 4EH1A 2F7SA 3PR1A 4D46A 1AHNA 1FMTA 2XD9A 4HS4A 2ZUSA 2OL4A 3FI9A 3R1IA 1U3WA 4IOKA 2OP0A 3H5WA 3L0CA 2YMQA 2QIPA 2VJBA 3WWOA 4Y2QA 5BVGB 1SXQA 3MBKA 2J9GA 3ZN2A 3K9CA 1NLUA 1N8KA 3L84A 3UGJA 4HZUA 4Y18A 3GRPA 4NY1A 4OGWA 4V0NA 4YAUA 1S1MA 4FFWA 3MOIA 2IITA 2Q4RA 5HIMA 1E0KA 2EF0A 2IYEA 4OM7A 4WZBA 3E15A 2J7PD 2X2FA 4KCGA 1JAZA 2QPLA 3FPHA 4QUIA 4RW0A 1EE2A 1XZJA 3WBBA 2I9KA 1YI0A 2Q5LA 3EXG1 4Y2JA 4PVCA 5FP0A 2G8LA 2HBRA 4Y7CA 4MIOA 3QKUA 1GCUA 4M21A 1BJTA 4OQXA 1XQ1A 4V0LA 3LT5A 1O77A 3A2MA 2GNPA 1VI6A 2DJIA 2DULA 3L7JA 3TOVA 4F9EA 3LCRA 5J1SB 2X7HA 3QFTA 3L02A 3NTOA 3Q8XB 4JELA 4RA9A 3RC9A 2FUKA 3RK1A 3K8OE 4FPXA 1RQGA 3EOZA 1E3MA 5KYUB 1NI4B 2ZI7A 1NVDA 2WPDD 3A27A 3JQ9A 2GTPA 5U1PA 4EFNA 1DDGA 4R1SA 1E92A 5IKEA 1ZK3A 4E22A 3WL6A 2ZRIA 3IQXA 1ACLA 3EPLA 3KRTA 2D13A 4ZHSA 4LXQA 4R51A 3TRIA 3IT1A 3ZPXA 2VPQA 4BNYA 5CBPB 2PR7A 1HZJA 2AJCA 2GBIA 2IEZA 2PLNA 3SJZA 5BXQC 1KS2A 5T5QA 2GBPA 4NYJR 2OFWA 1P4AA 3JATA 3LKZA 4OB6A 4QJ5A 3T0IA 4XARA 4KR7A 3PQCA 1O8CA 1CXZA 3R9XB 3AR5A 4HDQB 3GGGA 4OIMA 4DEYA 1V37A 1DMSA 3BQNB 1SVUA 3F4LA 3NEAA 3QV1A 5CGQB 2YBDA 4BP9A 1E3LA 2IHUA 2J59A 3K6KA 4N8SA 3GLIA 3UA3A 2Z9DA 1VPWA 1BCSB 3DFMA 1A9RA 2NT4A 4LZJA 5EJ2A 4AZSA 4DCPA 2B4TO 3CX3A 4JYCA 5C2JB 3B8HA 5CNJA 1S7CA 1SVMA 2OBBA 2HWUA 2Y92A 1N77A 1J07A 4EJMA 3NJ4A 4OK3A 4BVHA 2DPYA 5LIPA 3KZXA 4PIPA 2VS1A 1E2EA 1FQOA 1K8QA 1KO5A 1Z2EA 2P6OA 3JQGB 4Z2YA 2C29D 4K87A 2WJJA 1KDYA 3WYFA 1W2WB 4UU8A 4B43A 2CKDA 1P7ZA 3DBOB 2MYPA 2Z2YA 2GTHA 3KWMA 1XNQB 2ORIA 1C29B 3T7EA 2IP1A 3V1LA 4Z0NA 4MS3B 4YLYA 1DUVG 2J3DA 4HYQA 2NUTB 1R4NB 1SC9A 5DBHX 5JO9A 2WU1A 3S2SA 2QI9F 1L9KA 1AK2A 1AVTA 1CUCA 1L5QA 1H6CA 1CERA 1NATA 3AF0A 4MCIA 4RK6A 2B7BA 5CURA 5FR1A 4KXVA 2IXAA 521PA 1D2HA 2EIHA 2ODTX 5AKJA 3AL0C 1YZHA 2O59A 3OIYA 4KO1S 5K0EA 4CV2A 1EQAA 1KJ9A 1N2ZA 1MJGA 3PFBA 1VE1A 4HH4A 4U8HA 4MJXA 5ECGC 1AZTA 1XZLA 4OLFA 2H4FA 4BNNA 5JQWA 2WD7B 3VR3D 1E9SA 4H17A 4MAFA 4UXIA 3QE3A 3IA7A 2C2MA 2GCPA 2I54A 4JWTA 3V7NA 1K68A 2F1JA 2RONA 3D6AA 1PTJC 3IUSA 4AY5A 4EPXA 2HK8A 1F0YA 5TMBA 1ILWA 3A3YA 1H9CA 2JC3A 5JQGF 2CV1A 2JFNA 4WL0A 4MRVA 1L6RA 3FMGA 4HDMB 1D8AA 1V5FA 3JTEA 4MVCA 4MRAA 4URUR 2W70A 1BX0A 3F5DA 2Z83A 4OHKA 1SCBA 1WD7A 1LF5A 1ISMA 1C4OA 1BRMA 4GKVA 4LY3A 2XUPA 3NKVA 1SK8A 5BRNA 1DRVA 2OHXA 3JCZA 3MUOA 4PG7A 4PLVA 4YFVA 5JVDB 4G8CA 2XYHA 1UDRA 3JAKA 3MCAA 4UE6A 1J0BA 2V59A 2PE5A 4J91A 1K9VF 4NEGA 4G01B 5EKXA 4FCWA 1UOPA 2N9UA 3I3SR 4QPDA 1ZN7A 2BMJA 5KAPA 3KAKA 3KZKA 4CM9D 3CX7A 3LPCA 2V98A 3WNQA 3RSGA 3IO3A 1D1SA 1LVGA 2SCUB 4DC0A 1TPZA 3FPKA 3I6QA 4IPTA 4RLFA 5IVIA 1NJ2A 4D4HA 2ZQZA 3H5AA 2V6FA 3KJNA 3N8KA 4M9RA 4RMIA 2BMWA 2OWDA 4IWYA 4RK0A 5FLEX 2XB6A 1P1BA 5DCYA 2OGTA 2PMWB 1E32A 2GCOA 4L76A 4F04A 2GFQA 5C1PA 1RU3A 2H59A 2VKQA 4YGYA 1B16A 4QQNA 4W9NC 1FX0B 3MF4A 3S8YA 1VBMA 4D8UA 1C0KA 2OFXA 1C9EA 4LHSA 4CIBA 3K20A 3M6LA 4HNRA 5JOQA 2O54A 2NAPA 4JLWA 4YO7A 2H8GA 3L3BA 5IZCC 3CEHA 4NV0A 3JQDA 4YCSA 4PX2A 2OFOA 5LZ9A 5EWMA 1QLJA 2C4VA 2YNMD 3BB3A 2AG6A 4B6RA 4B3IA 4AAYA 3FWPA 3IVAA 5K0LA 2V97A 2O2DA 4MGEA 3TL2A 1YS6A 5LP6B 1ZOPA 5C0OE 2XB8A 4OA5A 4OUKX 1O08A 4KSCA 1B1CA 5EZSA 5LA6B 4CQMD 3U5TA 3RVPA 4YV2A 1HUQA 3IBFA 3D6HA 3ZY5A 5JNWA 4FXPA 4B6JA 5ALOA 5BN3A 2ZI3A 4A10A 4MAAA 4S1VA 5JJKA 3RARA 4FE7A 1HQYE 1EM6A 2ZK7A 4ND4A 5P21A 6YASA 3A37A 4XA8A 3BEOA 4B3GA 2EV9A 1RAGA 4DKJA 2X2EA 4FMDB 5AW3A 1JH9A 3IL2A 1ZR4A 2FJPA 3WDMA 4OAPA 2PKQO 2XJ9A 1BO6A 1QMPA 1UT5A 1Z5PA 1TFRA 2G5CA 3OI7A 3OHPA 3LZCA 5K8TA 4REMA 4G86A 2YICA 4LF5B 4DA4A 1FPMA 3VZQA 4XGKA 1GY8A 1B0UA 3DMYA 3B9BA 2FK7A 5B36A 2AGVA 1RVDA 2ZJ2A 3ZE1B 3DTVA 3BE8A 1C81A 2HN9A 5AOAA 2JJQA 1ZXBA 1CZUA 1SU6A 2R97A 1L7PA 5C1BA 1B74A 2X23A 3DE2X 4F4FA 5IW8A 2W2QA 4MWTA 5H02A 4BLRA 1B7GO 1RM3A 5JCXA 5PNTA 3T8YA 2DBYA 2VJAA 4QIHA 4PAGA 1Y9ZA 4XLLA 5ALEA 4XQGA 4CZ2A 1D2GA 3KOOA 3J7AC 1AMUA 3TX6A 1XJQA 2Q2NA 4YRFA 1ONBA 3WIVA 2BGKA 3HXQA 4KWHA 2A0YA 1PZFA 3LT0A 4CV0A 1I4LD 2V4MA 4PZCA 3MM4A 1BDJA 3OJWA 3P97A 2UU9B 4IIUA 3D43A 4GWGA 1E7SA 4UBKA 2BFAA 4G84A 1GA1A 1LJ8A 4F2HA 1HTTA 5BURA 4PY2A 3QWIA 3OURA 2XYQA 5J9FA 4JP8A 3GJRA 1Y48E 1VIAA 5AW9A 3RT9A 3I0MA 3C6YA 1L1EA 4ZMRA 2RIPA 4C1NA 1NM5C 3AYZB 2QAGA 1OWMA 1NXWA 4WKOA 1CDZA 4ZQEA 1Q1ZA 2AFIE 4TN1A 5AXAA 3OLCX 1S3GA 2FPKA 4AJ1A 5BORA 3CA8A 3WLIA 1L7XA 2X0NA 3UG7A 1Q1QA 2WC1A 1Z73A 3EWIA 4RD6A 3A9RA 1YE5A 2ZYGA 4BGDA 4PO9A 2Q0QA 1YZGA 5AVWA 4LGYA 4KNYA 4DY6A 5HQ3A 4HWKA 4KW7A 4UTNA 1XZBA 4IOMA 3SP1A 1Z4NA 3AEKA 3ZY2A 2IX9A 1XZDA 2B99A 3G8DA 4EA6A 4B3TB 1IXRC 2V58A 3CMCO 3O26A 5CUQA 2IU0A 2MR5A 1GG2A 2BJVA 5EQFA 5JS6A 3BHIA 3BWYA 1Z0UA 2WYUA 2DWOA 3DFIA 2AJTA 3O7WA 4O2LA 3M6WA 3C5VA 3IMCA 5C32A 3RIEA 3GUYA 1C3OA 4CDMA 3IUQA 3X2SA 2JJYA 2FZGA 4D92A 4DQVA 3GN2A 3QJGA 4N7MA 3MG9A 4M0KA 3AHGA 2PBRA 1KAEA 3SGLA 2W83A 2HI0A 5C7LO 4OF4A 2XWPA 4H7JA 1U2DC 4ZVSA 2HBYA 3DDHA 2R7LA 4KXNA 4D5EA 2O7SA 2X0IA 1NJ1A 5EUBA 1NVFA 4IICA 4P2BA 2DWQA 4IXNA 5J2UB 2REXB 1W2GA 3HN7A 2PSDA 4HQRA 2C2OA 4U3JA 1G1AA 4YB8A 2NV0A 3REGA 4B76A 2WD9A 3H4VA 3QWFA 4IIHA 1KI4A 4UHFA 4D3DA 2R85A 1EWQA 4U6QA 2JLSA 2YJ6A 2AXNA 1NQWA 5EKSA 5FTKA 4JJ8A 2RB4A 3HXTA 1DAGA 4B6EA 3IR7A 2DQZA 1C3VA 1P2FA 3Q41A 4UZSA 4XRGA 3JD3A 4FKMA 3KT3A 1BYUA 3EULA 1T2NA 3PD1A 1PX2A 1U2EA 4KFUA 1TUEA 2OENG 1BXRA 1ADFA 2V6BA 1Z6YA 3ME5A 4XM1A 4ZQBA 4ZQFA 1GRVA 2PUEA 1SNYA 2JGRA 4DJAA 1Z0FA 3KG2A 1RPJA 4EHFA 2EBHX 2YHUA 2FA9A 1BA2A 4B75A 1JJBA 3KQUA 1QH8A 1BW9A 3L7DA 3MTQA 5DLQC 1AKNA 4AS2A 1ZOIA 1GGNA 2IE0A 1XB2A 3R77A 2QG6A 4KXLA 4X0EA 3E8XA 3ZS9A 1ZL0A 2GZ3A 2JFVA 2FXVA 4YT5A 5JTTA 4D98A 4DCJA 1GFSA 4LW8A 5BOVA 1BS9A 3VR0A 5BWOA 2HF8A 2Y71A 1XDSA 4IDQA 1U3TA 3CLSD 3T54A 3UMYA 5EJ8A 2VHWA 3K5IA 5HKLA 1RFGE 4GGPA 3GLFA 1BTOA 2CXTA 3H1PA 4JEHA 1ZMXA 5T8KA 3VJKA 3LDHA 3H75A 3WGLA 4AY4A 3AVVA 4DMMA 3N7AA 1OFHA 1B6TA 3PRKE 3TBHA 4DMFA 2R6JA 4LYHA 4OLAA 4IIJA 1FDIA 2JBAA 4BNGA 1E2KA 3UN1A 2BY4A 1GPH1 1RM5A 3KR0A 2I7TA 1TEXA 1IB0A 2RKWA 3PUXA 1VBFA 3QBTA 4N18A 1BMDA 2CB0A 1X9HA 3EQ2A 3TL6A 4L4UA 4YUWA 3CJQA 2WINI 4P58A 5KVQA 2ZRGA 1MOQA 4J0GA 3ZNPA 3RO7A 2GCNA 2CJWA 1BS1A 1QWOA 1T24A 3MJSA 1W7AA 3L0DA 2PX2A 1JBQA 1NYRA 1O94D 4CI9A 4E30A 1U7OA 1U9JA 4MWZA 1G41A 3QRWA 1PHRA 3MWJA 5GAJA 4BNIA 4BQSA 1T1RA 2OB1A 1QYIA 3BMOA 3NHZA 1OPXA 4JB2A 5HFJA 3T9EA 3G9QA 3LSYA 3WICA 3U6KA 3DWEX 5A9TA 3SC2B 1UBSB 4HTAA 1JIIA 3WQRA 2N46A 1NQVA 2PKXA 3L43A 4P3OA 4PZZA 4QPCA 2QMQA 3I04M 3K6JA 3EGDA 3L0YA 3MWKA 5G53C 3LO5A 2A9JA 2OCXA 3NBYC 4BVGA 3T9BA 5KNBH 1VE7A 3Q5GA 1KC1A 4ZDKA 1L7AA 2G0NA 4EMBA 1TLTA 1G1MA 1P6XA 4EJSC 5BQXA 1SG6A 3RJ5A 4COOA 1TYBE 3CZRA 2QTCA 1XZMA 2ZUDA 1CNMA 1QVRA 3UAYA 3I09A 4F1KA 4YYZA 2IEBA 2P7IA 3IOBA 3GGJA 2SHKA 2J08A 3OTGA 1MG0A 1G21B 5DHSA 4POOA 5DEOA 4FU0A 4LAFA 1PVVA 1I1NA 4Y0NA 3RBXA 3FUWA 1SBZA 1JEQA 1HV8A 3W2IA 4BDSA 3HNOA 5DM2A 3AM1A 2EFYA 3IT0A 1DIBA 1NQUA 3F7MA 4L27A 3U7QA 4ZOAA 1U0BB 3GLKA 1AQUA 1O6CA 3KJIA 2QRLA 2XYVA 1WL8A 1WHTA 2WPNA 3L8DA 4FD3A 2M32A 4MIYA 4W5NA 4M76B 8OHMA 5JYDA 2D5LA 2Q5HA 2ZYAA 2R25B 1SQ6A 3QZUA 2CSXA 2LP4Y 1B23P 1PV1A 3OPYI 1CUSA 4INPA 4DEXA 3RWMB 3K5PA 1OFVA 4NBNA 5CNMA 1HDEA 1UKCA 1W8DA 1WKVA 3QVUA 4JJAA 1FP6A 2W71A 5J4HA 5EG5A 5IH7A 4UAJA 1NBAA 3FJOA 3ZWQA 3VMFA 4NZZA 4MUNA 5K0FA 4Z4IA 2EZ4A 3NASA 2GDZA 3KQSA 3TKLA 4AW9A 3LH5A 1DTEA 1LWNA 2O4CA 4MVJE 1Q95A 1M8PA 4WI1A 4YJ3F 3V7FA 4YRQA 1CT9A 1HEYA 3HYTA 3B3GA 2ZRCA 4LE0A 1OAOA 2EBUA 1U28A 5BYJA 3TZ6A 2GPJA 4X1KA 2HCFA 4M7RA 2F3UA 5GZ6A 3ZGZA 5JEEA 3JD4A 4RD1A 1WJGA 1LEHA 4G26A 5KX5B 4G1MB 4X8MA 4Z0HO 5H8WA 2A7XA 3OCJA 3G7UA 2WVAA 1X74A 2HH9A 2WRZA 4HH1A 1B3BA 1CLUA 5H68A 1WVMA 3BFVA 1E7MA 2AI1A 2JGMA 2WUWE 3BHMA 3IV9A 3PUVA 1TM1E 5BYBA 4BFSA 3R74A 3PF8A 5DE3A 1OZ0A 2CSUA 3G0OA 1Z45A 1Z7GA 3FCCA 4OP2A 4P08A 1NVTA 4QTZA 2AR0A 4MGHA 4ZQGA 2WIGA 4EPTA 3WLJA 1ESCA 3O31A 1GYRA 4TMFA 1O6ZA 1WBJB 4UVGA 5CJ2A 4DLKA 4PZUA 3RSFA 1SD2A 4KYIB 2IXEA 4J2HA 4O2BB 5EWLB 4K0KB 2RH9B 3M6VA 3KPWA 2UUOA 2WUGA 3V8BA 1MO6A 1EFKA 2F1KA 3ZZUA 1CDOA 1F20A 1IDOA 1MX3A 2ZAOA 4Q9KA 4KMRA 3GFBA 1EPUA 4B8ZA 3C45A 1PLKA 1AF7A 1NYLA 3P96A 1U1FA 1Y5LA 3NHRA 1QRSA 1YBAA 2LGJA 2BTQB 3DFZA 3GD7A 3Q15C 1JHXA 4RACA 4ETWA 4DDTA 1HYBA 3KTOA 1ZJJA 3FGOA 1G9TA 4JLDA 2IUUA 4KK4A 4UU1A 3L0ZA 3TG8A 4DG5A 1PR9A 4HYYA 1PZMA 1ZGHA 4R1QA 3RJTA 1AY0A 3U44B 4DLYA 1U9IA 1P1IA 1DE0A 1ZNQO 2PG3A 3ABZA 4TXMA 3JQAD 5T57A 2EJUA 2WTBA 4MLCA 1CG6A 1GLVA 1NVVQ 1CZKA 2C4UA 3DOHA 3TMKA 1E8DA 5HKKD 5HTOA 2GCGA 5AVXA 2RHHA 3TRJA 1AZWA 1NVXQ 1SWVA 2FWRA 2JFFA 1N78A 1TB4A 2H06A 4JT2A 3WRYA 3ABRB 4A2QA 2FDCA 5JZMA 3A32A 1XLTA 3GJSA 3OFKA 3HNRA 4YROA 5B3AA 1MO5A 3L6DA 2TMDA 3MJRA 1ZKMA 3H19A 3DOCA 3H1TA 3HWWA 5IEBA 1H9AA 2XEXA 3V1KA 3MQFA 3T52A 3NANA 4R98A 5C1IA 4ZFNA 3QENA 1PJSA 3DPUA 4URWR 3FMIA 2DBVO 3A9WA 3IVXA 1GTVA 4C6HA 4L5BA 2Z57A 3B89A 2ZBQA 4HGOA 5DYIA 1YB1A 1F8XA 2CVPA 2ZG6A 1E2GA 1OF1A 1USIA 2ZIWB 1RCTE 4P4SB 1X19A 4NPCA 2PANA 4FNAA 1UDXA 4R1UA 3L04A 5F2OA 4DDWA 4QGSA 1RQNA 4MPRA 3F6PA 5JRDS 3VHRA 1X7XB 3KALA 1T8WA 2XCUA 2B69A 1MW9X 3K5HA 1JDUA 4G0VA 4IILA 3K9QO 3RAPR 1A5AB 4LZNA 3QEKA 2NO6A 4UEQA 1GUYA 3WLHA 2YZ2A 4C4TA 1RZVA 1ZC4A 1SHKA 3A0RB 1PJTA 2XGOA 3BREA 3DE1X 4TROA 5CB4B 4QVIA 2NYAA 2X1HA 2HD4A 3VI4B 2I8CA 2P5SA 4CR6A 1HL7A 1FDUA 2NU6B 1JEDA 5CYGA 2BMDA 2WVJA 1E5DA 2JGDB 3JYQA 4ZVRA 4E4TA 3STTA 3QE0A 3FHOA 4HXEB 5E6UA 3NV7A 1DSSG 1KL7A 2PZEA 2W2KB 2ZIFA 1E2PA 1AS3A 2OXCA 1TJ4A 2A0KA 2W9XA 4PZAA 4EA8A 2O2EA 2PO5A 3FVRA 1C5KA 2VP9A 3DKPA 3KUXA 1YACA 3LWNA 4FHCA 3WIEA 2HTEA 1W94A 3QE4A 1J8FA 4D81A 1QYWA 4PQRA 4QUJA 3D7KA 3MAGA 4UW9A 4HXFB 3UB3A 5B7NA 3O6VA 5JNTA 5DU2A 5LXTF 2XZOA 3DCJA 1KKLA 3OOHA 2W6ZA 3NIBA 3UW3A 3NKLA 1R0WA 2R8XA 1KFJB 4GR5A 1H4SA 1ZUNB 1Z2NX 3FROA 2VHEA 1LS6A 1I5EA 4IDPA 1EGHA 3FVTA 4PONA 4KSYA 5ALGA 3IP8A 2CB9A 4HDSB 4N7BA 2QUHA 1N32B 2BBTA 3UQYS 1E4VA 1G63A 3ZS8A 3A1WA 4FGJA 3GLGE 4IF4A 2V7TA 1TIKA 2NPOA 3FWKA 3PLRA 3IBTA 1SXJE 2YXLA 3ENWA 4NBTA 2IBSA 1XTKA 3PYLA 4FCCA 3I34X 1T15A 1EQUA 3RSHA 1OKKD 2ZZKA 3EF1A 2X8AA 4EHAA 4P34A 2ZRHA 1GL3A 1WMSA 4NCJA 4WVLA 1G7CA 4BX8A 2OV4A 3Q9UA 5KIAA 3KEFA 3O8CA 2VRBA 3S1LA 4CG2A 4AKHA 2GRJA 5CDFE 2HMYB 3OWXA 1RMQA 1ABEA 3OUUA 4G1FA 3UF0A 4HTFB 3UPDA 3CGWA 4AMUA 2X9VA 1D2MA 5ALQA 5I7RA 5EJGA 3X1WA 4CG3A 4GOOD 5CX1B 1AQ6A 2W6JD 3KQOA 3TRDA 3STHA 2HQBA 4BJ1A 4YAKA 3CZ4A 4TKZA 4D9FA 4WCDA 5AIBA 2YKGA 1Y6ZA 1HMYA 1JLKA 4PC1A 2V7PA 3PDJA 5DNDA 4MRSA 2XADA 4BB6A 4AY6A 1Z2DA 1SCQA 4ZEXA 2OUKA 4WLUA 3T0FA 1BEZA 3TQCA 5CDGA 1J2JA 2WJ6A 2BVNA 5EIFA 3LX6A 1V6CA 2DKOA 3IAHA 2WWWA 3UJ3X 2JDID 2IU3A 4QLOA 4JI6B 2QN3A 4EJ0A 4Z9FA 1DC3A 3EZLA 3QEMB 3ZGYA 1UIMA 4ZJPA 1FFXB 3HM9A 1ORVA 1II9A 3B3JA 3ADCA 3ONEA 2P2CA 4N12A 4U5QA 4EGFA 4JEMA 3RC8A 3A9CA 1J97A 2WG1A 4NEQA 1KQFA 1NY5A 3DZIA 4DM4A 4BU0A 3NHWA 4ICIA 4U4AA 1GM5A 5JO0A 4XGQA 1VE6A 4FOTA 3UC9A 4F38A 2XF8A 2WWHA 3DZBA 4YJFB 4ISCA 3AEYA 4FGLA 1W75A 5C5DA 5JNLA 1CY2A 3EGEA 3L05A 4P4TA 2C83A 2FUEA 1SHUX 4RZSA 4BX3A 4RSRA 4X7RA 1FFWA 1VMKA 3EZ2A 1C8KA 2RHOA 1ODTC 5EQDA 5JS2A 3VOSA 4YAJA 1WCIA 4UNPA 4WEOA 3VZRA 4KXYA 1YQTA 2O0LA 2FSIA 4NS1A 1ZN8A 4UTOA 3FDZA 2IEDA 3LYLA 1NVUQ 4INZA 5DLPA 3PK0A 4IJUA 3UT0A 4FZ5A 2WWYA 3Q8WA 1KJJA 1PBTA 1JHAA 4FE3A 4UAVA 1NURA 2C9MA 1VC2A 2PLFA 2PRKA 2IVFA 3DAHA 4OD0A 1MZPA 4I4TF 3T1HB 1KYIA 4WN9A 1V4VA 2O2JA 3FB1A 3M4JA 2WJIA 1N6IA 3CUEF 2DKFA 3K72B 3W1VA 3CB4A 4WVFA 1USKA 4JYZA 1KRWA 4EYGA 2REBA 3AVPA 3DL4A 3PUIA 4RESA 4AD8A 1AKVA 4II2A 2PVSA 4LJ6A 2QBYA 2R8OA 1WZ2A 1OJ7A 4OHBA 1NQAO 4QUHA 4Y98A 4Z9YA 1X9IA 1GT6A 3L6RA 2VF2A 3C3AA 1VXOA 2A5JA 3TZBA 1E8NA 2BGWA 1EHIA 1IU9A 2RCNA 5A1TA 3RNOA 5IP5A 3ORHA 3V5NA 1PFUA 3G5UA 2ODBA 1TF2A 5FNVF 4Z51A 3FHTA 2VSXA 1VDZA 4RLQA 5EMNA 4RANA 2HCRA 2WIFA 5U4XA 5AM4A 1BJKA 4UFOA 1SAYA 1RXYA 4KGXA 5L8VA 4IOJA 3YASA 4PC7A 4YRGA 2W43A 5IG2A 2WYWA 2CL6X 2DTXA 4J7CA 2CLCX 3GLSA 3PQFA 3SBOA 3NO4A 1LSSA 2ID9A 4RH1A 3RKSA 1ORRA 2DGDA 3KHTA 4OUDA 3I53A 2BI4A 1KMQA 1MENA 5DNWA 5CTAA 3SIRA 2LBPA 4KREA 1CDDA 1NNI1 3BSWA 3F2IA 3W7VA 1AXEA 4L2IB 1IUOA 2BUBA 2QW1A 1TFUA 4MW1A 4YJ2F 2ZJAA 1DXHA 3OD5A 4LSGA 5TVGA 3LD9A 1OT5A 1X2BA 2JB9A 3LHSA 5D3KA 4EIWA 3JARB 1RZUA 3N2EA 1FLVA 4GX1A 3SHTA 2NT3A 2BBSA 3SM3A 3T1QA 1H0HA 1IZ9A 2AYXA 2UYOA 4KR2A 1OC2A 4OXXA 4OBXA 4UE3S 3WKEA 1FFHA 4CLDA 2LR0A 4BCCA 2H7YA 3E9EA 2NSJA 4YTEA 4WXRA 5K8JB 3H3JA 4HZIA 2JD0A 4N5HX 3K1JA 3KJFA 4RLSA 2CL7X 5FWNA 4C0BA 2LCFA 4E2WA 2WUFA 3QWHA 3ZHBA 5DSTA 1XEWY 2TECE 3OY7A 1JYFA 2R68A 3H5VA 2PV7A 2QAJA 1SQSA 2VHJA 1W0KA 4RUKA 5HDQA 3G2OA 3WDLA 4XWKA 4AZWA 4YV7A 2IZOA 1IN5A 1ANKA 2R6GA 3ELYA 2OQVA 3SYTA 3N9IA 1GQFA 1I2DA 1JMYA 1ZD5A 3NYRA 3HDTA 1L1FA 5JSFA 4RETA 2LIVA 4EJSB 1JR3A 4D80A 3TGPA 2NXCA 5GP1A 3IQIX 3COYA 3O4HA 4D4GA 4XYMA 5AKKA 3BTSA 4FDVA 1N3LA 4A3SA 4AECA 2XKKA 3JQFC 4KTTE 1JN0A 2Q45A 1N6HA 1PK9A 1WUKS 5G0VA 2V3WA 4QGGA 4UEKA 4YAWA 2VOEA 9GPBA 3BBLA 3FWNA 4H3SA 1WKBA 5A7FA 1ZCAA 3LAWA 1NV8A 4KR9A 2Z6AA 3TW6A 3RHTA 3BTOA 2GN8A 3WZ2A 5BNFA 3ERCA 4MS4B 1E4EB 2FR8A 1Y4ZA 4V38A 2UYGA 2QZJA 3ML1A 3OE1A 5K8CA 2GPTA 5EMMA 5KC9A 1PQ4A 2O5VA 3WGOA 5FB3A 1J2EA 2D2IA 3WJ1A 4EFDA 1MJFA 1KAQA 3GK3A 2V3VA 2WSMA 4H1HA 4M3NA 1E5TA 5IJAA 5BN1A 4DIEA 1KMHB 4CG1A 1AT1A 4JVSB 3X1XA 4K9KA 2H92A 3GEEA 4Q21A 5F1KA 1FDSA 5AI5A 5GIOE 4J0HA 4GM0A 4KODA 3ZKWA 4RHCA 3WB2A 2DB3A 4X6LA 4JBYA 4UM9D 3D7LA 3OX2A 4B32A 3K1YA 3MIIA 5DMHA 5FUXA 1YIAA 2OCBA 1SIOA 1SQ5A 1Q0LA 1FP4A 3LGXA 4ETIA 2JIDA 1D2CA 3V4SA 1ZUHA 1Y1TA 2ZIXB 2WM9B 5IDQA 5ESDA 1QVAA 2E4YA 1Q7RA 2I7XA 3BGOS 4WHMA 4CEIA 1GDHA 1O5IA 4PIMA 1PI3A 3GFQA 1DHTA 2ZSDA 3GOHA 2CNWA 1MOPA 1RJ9A 1EI9A 4CR7A 1NW4A 4OHXA 1D0SA 4AJJA 2C0PA 1F7VA 3FNBA 3N2GA 5KC8A 3K96A 1A7AA 3DG9A 3VGJA 5FAKA 1YQWA 3Q0EA 4FYJA 3COWA 5K0ZA 1GYPA 5C81A 4ISBA 4BFYA 3IRVA 3VKVA 4KQKA 3FSGA 5AW2A 4P3KA 1U3VA 2EZUA 5DH9A 1N1EA 2C96A 4LYAA 1MO2A 4O4LA 1BS2A 3BFPA 4EGQA 2E3JA 2VQEB 4DUYB 1E6UA 2J9FA 2OMKA 1VJ0A 1D6MA 3FMVA 3SAJA 1G5PA 5KOYA 3OCZA 1XAHA 1D7AA 3A4NA 2CWWA 3LUGA 3P52A 1ECLA 1QVZA 1VPEA 4OHWA 3D7RA 3OZIA 3ZX5A 2A58A 2VTKA 3G2PA 4LHEA 4LZZA 4FW8A 3CURA 2M1XA 5JSQA 3HP7A 3IVMA 4JKOA 4PO1A 1XTTA 4IMPA 4AU1A 2BDEA 1X1CA 5LQAA 2HCBA 3B82A 1SVLA 2YHBA 4IH9A 1X3LA 2EOAA 1XVLA 3EPPA 2QTWB 3ZCPA 2C9DA 2PXXA 3AZOA 5IKPA 3I2GA 4H31A 4ZOEA 3KVVA 1V8DA 2RBKA 3S2YA 2SKDA 4BJ6A 2PWAA 4DADA 4DLSA 2ZU6A 1Z18A 3A4YA 4CMKA 2FW6A 5FLYA 2QP3A 5LL6P 2DQSA 5JATA 3EQ7A 2W98A 4JT9A 4YGXB 1CUXA 1QJ4A 3W5JA 2YZKA 3DBIA 3OKCA 1OTYA 4WCFC 4CMIB 5IJ0B 1L6IA 3FYUA 5E6SA 3H13A 2NU7B 3LDGA 2RAUA 4GP7A 3DV9A 2WQ6A 1ZGAA 2IXDA 3EG5A 4OXRA 1DAHA 1LI4A 1QZZA 3I9FA 1I2BA 3NZEA 3PFNA 1NKVA 1Q19A 1YB2A 3C8ZA 2WZQA 4MKRA 4W1SA 3BHNA 5IMBA 3ZR4B 3D6TB 4IQFA 2O2CA 6CHYA 2PZBA 4K1XA 5CNIA 4NE2A 5LLTA 2H1VA 3JZAA 1L5HA 5GPBA 4PYRA 4M1WA 1J90A 1DUSA 2HK9A 4QDKA 1CEQA 4XIFA 1W4ZA 4Z9BA 1V8OA 4LXIA 1ZJ4A 3HY3A 4DQLA 4FFBA 2C61A 2ID4A 5JMOA 1NW5A 5I7UA 3WP0A 3B78A 1PWEA 3V80A 1PGPA 2EYUA 3IDZA 4TLBA 1T6XA 5B4UA 2WTEA 2JIBA 2FX3A 2WJYA 4S2EA 2Q5QA 1UBNA 2CNNA 1MU0A 2PS9A 2XBLA 2RG1A 3NRCA 3O8OA 2IBMA 1HLDA 2NYRA 3KEMA 4M55A 1GUZA 3GEDA 3VBEA 2AFHB 4UQPA 2WF9A 1QH9A 1T9CA 1XZQA 1ZEMA 3B38A 1J06A 2XQGA 3RVOA 1PW7A 4B4KA 3A58B 3LZDA 5LDHA 1LJUA 2BEVB 1EE9A 2G83A 1W5BA 3L8EA 1P2UA 4MPTA 4NYMR 4P92A 3A8TA 4CKYA 2C4KA 3R40A 2OKCA 4U02A 4YJGA 3KDAA 3ESRA 5JI2E 2P0EA 3T3GA 2Z9BA 3QBDA 4CG0A 1DELA 4CV1A 4EVQA 5K9ZA 1CJVC 1KI7A 1IHXA 3E8SA 4BL5A 2H7VA 4A6PA 2BZSA 1WY7