3EP0A

Methyltransferase domain of human pr domain-containing protein 12
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
129
structure length
113
Chain Sequence
VQKLSSLVLPAEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPLMWEVFNEDGTVRYFIDASWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 12
publication title The crystal structure of methyltransferase domain of human PR Domain-containing protein 12.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 26
structure length 113
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ep0A00
4O6FA 5KJMA 4MI5A 2RFIA 3F9ZA 3CBPA 5TEGA 5EG2A 3OXGA 3RJWA 3M59A 4NJ5A 4IJDA 4JLGA 3HNAA 3OXFA 4RZ0A 3S8PA 3TG4A 3VV0A 5TTFA 4AU7A 3S7BA 4YPAA 5KJNA 4NVQA 5HI7A 4JDSA 5CCLA 3MO0A 4MI0A 3MO5A 3M53A 3KMJA 3IHXA 3KMTA 4E47A 3M55A 3SW9A 5EX3A 4J7IA 4C1QA 4J8OA 5KJKA 3M58A 4YPUA 3N71A 4QENA 4YNDA 3CBMA 2W5ZA 3DALA 4FMUA 5T5GA 2G46A 3QWVA 1ML9A 4Z4PA 5CPRB 3F9XA 5F59A 2BQZA 5CCMA 5ARFA 5JJ0A 4YNMA 3OXLA 1N3JA 3RAYA 5AYFA 3RIBA 5JINA 3EP0A 4J83A 4IJ8A 4YNPA 5T0KA 1MVHA 2R3AA 3QWPA 3CBOA 3RU0A 3OOIA 4QEPA 3F9YA 3M57A 3M56A 3PDNA 3OPEA 5JIYA 3S7DA 3S7FA 3K5KA 3M54A 3S7JA 1H3IA 3M5AA 3QWWA 3F9WA 4YPEA 3MO2A 2W5YA 1N6AA 5F5EA 3KMAA 2IGQA 4H12A 5JHNA 1PEGA 5KJLA 5HQ8A 5TH7A 4BUPA 1N6CA 1ZKKA 5LSZA 3VUZA 3FPDA 4LDGA 1MT6A 1O9SA 3BO5A 3MEKA 5EX0A 4QEOA 3TG5A 2F69A 4O30A 5F6LA 1XQHA 4I51A 4WUYA 2O8JA 5F6KC 5T0MA 1MUFA 3DB5A 4J7FA 2QPWA 3RQ4A 5LSXA 5ARGA 3SWCA 3OS5A 1MVXA 2JV0A
chains in the Genus database with same CATH superfamily
4O6FA 5KJMA 4MI5A 2RFIA 3F9ZA 3CBPA 5TEGA 5EG2A 3OXGA 3RJWA 3M59A 4NJ5A 4IJDA 4JLGA 3HNAA 3OXFA 4RZ0A 3S8PA 3TG4A 3VV0A 5TTFA 4AU7A 3S7BA 4YPAA 5KJNA 4NVQA 5HI7A 4JDSA 5CCLA 3MO0A 4MI0A 3MO5A 3M53A 3KMJA 3IHXA 3KMTA 4E47A 3M55A 3SW9A 5EX3A 4J7IA 4C1QA 4J8OA 5KJKA 3M58A 4YPUA 3N71A 4QENA 4YNDA 3CBMA 2W5ZA 3DALA 4FMUA 5T5GA 2G46A 3QWVA 1ML9A 4Z4PA 5CPRB 3F9XA 5F59A 2BQZA 5CCMA 5ARFA 5JJ0A 4YNMA 3OXLA 1N3JA 3RAYA 5AYFA 3RIBA 5JINA 3EP0A 4J83A 4IJ8A 4YNPA 5T0KA 1MVHA 2R3AA 3QWPA 3CBOA 3RU0A 3OOIA 4QEPA 3F9YA 3M57A 3M56A 3PDNA 3OPEA 5JIYA 3S7DA 3S7FA 3K5KA 3M54A 3S7JA 1H3IA 3M5AA 3QWWA 3F9WA 4YPEA 3MO2A 2W5YA 1N6AA 5F5EA 3KMAA 2IGQA 4H12A 5JHNA 1PEGA 5KJLA 5HQ8A 5TH7A 4BUPA 1N6CA 1ZKKA 5LSZA 3VUZA 3FPDA 4LDGA 1MT6A 1O9SA 3BO5A 3MEKA 5EX0A 4QEOA 3TG5A 2F69A 4O30A 5F6LA 1XQHA 4I51A 4WUYA 2O8JA 5F6KC 5T0MA 1MUFA 3DB5A 4J7FA 2QPWA 3RQ4A 5LSXA 5ARGA 3SWCA 3OS5A 1MVXA 2JV0A
chains in the Genus database with same CATH topology
4O6FA 5KJMA 4MI5A 2RFIA 3F9ZA 3CBPA 5TEGA 5EG2A 3OXGA 3RJWA 3M59A 4NJ5A 4IJDA 4JLGA 3HNAA 3OXFA 4RZ0A 3S8PA 3TG4A 3VV0A 5TTFA 4AU7A 3S7BA 4YPAA 5KJNA 4NVQA 5HI7A 4JDSA 5CCLA 3MO0A 4MI0A 3MO5A 3M53A 3KMJA 3IHXA 3KMTA 4E47A 3M55A 3SW9A 5EX3A 4J7IA 4C1QA 4J8OA 5KJKA 3M58A 4YPUA 3N71A 4QENA 4YNDA 3CBMA 2W5ZA 3DALA 4FMUA 5T5GA 2G46A 3QWVA 1ML9A 4Z4PA 5CPRB 3F9XA 5F59A 2BQZA 5CCMA 5ARFA 5JJ0A 4YNMA 3OXLA 1N3JA 3RAYA 5AYFA 3RIBA 5JINA 3EP0A 4J83A 4IJ8A 4YNPA 5T0KA 1MVHA 2R3AA 3QWPA 3CBOA 3RU0A 3OOIA 4QEPA 3F9YA 3M57A 3M56A 3PDNA 3OPEA 5JIYA 3S7DA 3S7FA 3K5KA 3M54A 3S7JA 1H3IA 3M5AA 3QWWA 3F9WA 4YPEA 3MO2A 2W5YA 1N6AA 5F5EA 3KMAA 2IGQA 4H12A 5JHNA 1PEGA 5KJLA 5HQ8A 5TH7A 4BUPA 1N6CA 1ZKKA 5LSZA 3VUZA 3FPDA 4LDGA 1MT6A 1O9SA 3BO5A 3MEKA 5EX0A 4QEOA 3TG5A 2F69A 4O30A 5F6LA 1XQHA 4I51A 4WUYA 2O8JA 5F6KC 5T0MA 1MUFA 3DB5A 4J7FA 2QPWA 3RQ4A 5LSXA 5ARGA 3SWCA 3OS5A 1MVXA 2JV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6F A;  5KJM A;  4MI5 A;  2RFI A;  3F9Z A;  3CBP A;  5TEG A;  5EG2 A;  3OXG A;  3RJW A;  3M59 A;  4NJ5 A;  4IJD A;  4JLG A;  3HNA A;  3OXF A;  4RZ0 A;  3S8P A;  3TG4 A;  3VV0 A;  5TTF A;  4AU7 A;  3S7B A;  4YPA A;  5KJN A;  4NVQ A;  5HI7 A;  4JDS A;  5CCL A;  3MO0 A;  4MI0 A;  3MO5 A;  3M53 A;  3KMJ A;  3IHX A;  3KMT A;  4E47 A;  3M55 A;  3SW9 A;  5EX3 A;  4J7I A;  4C1Q A;  4J8O A;  5KJK A;  3M58 A;  4YPU A;  3N71 A;  4QEN A;  4YND A;  3CBM A;  2W5Z A;  3DAL A;  4FMU A;  5T5G A;  2G46 A;  3QWV A;  1ML9 A;  4Z4P A;  5CPR B;  3F9X A;  5F59 A;  2BQZ A;  5CCM A;  5ARF A;  5JJ0 A;  4YNM A;  3OXL A;  1N3J A;  3RAY A;  5AYF A;  3RIB A;  5JIN A;  3EP0 A;  4J83 A;  4IJ8 A;  4YNP A;  5T0K A;  1MVH A;  2R3A A;  3QWP A;  3CBO A;  3RU0 A;  3OOI A;  4QEP A;  3F9Y A;  3M57 A;  3M56 A;  3PDN A;  3OPE A;  5JIY A;  3S7D A;  3S7F A;  3K5K A;  3M54 A;  3S7J A;  1H3I A;  3M5A A;  3QWW A;  3F9W A;  4YPE A;  3MO2 A;  2W5Y A;  1N6A A;  5F5E A;  3KMA A;  2IGQ A;  4H12 A;  5JHN A;  1PEG A;  5KJL A;  5HQ8 A;  5TH7 A;  4BUP A;  1N6C A;  1ZKK A;  5LSZ A;  3VUZ A;  3FPD A;  4LDG A;  1MT6 A;  1O9S A;  3BO5 A;  3MEK A;  5EX0 A;  4QEO A;  3TG5 A;  2F69 A;  4O30 A;  5F6L A;  1XQH A;  4I51 A;  4WUY A;  2O8J A;  5F6K C;  5T0M A;  1MUF A;  3DB5 A;  4J7F A;  2QPW A;  3RQ4 A;  5LSX A;  5ARG A;  3SWC A;  3OS5 A;  1MVX A;  2JV0 A; 
#chains in the Genus database with same CATH topology
 4O6F A;  5KJM A;  4MI5 A;  2RFI A;  3F9Z A;  3CBP A;  5TEG A;  5EG2 A;  3OXG A;  3RJW A;  3M59 A;  4NJ5 A;  4IJD A;  4JLG A;  3HNA A;  3OXF A;  4RZ0 A;  3S8P A;  3TG4 A;  3VV0 A;  5TTF A;  4AU7 A;  3S7B A;  4YPA A;  5KJN A;  4NVQ A;  5HI7 A;  4JDS A;  5CCL A;  3MO0 A;  4MI0 A;  3MO5 A;  3M53 A;  3KMJ A;  3IHX A;  3KMT A;  4E47 A;  3M55 A;  3SW9 A;  5EX3 A;  4J7I A;  4C1Q A;  4J8O A;  5KJK A;  3M58 A;  4YPU A;  3N71 A;  4QEN A;  4YND A;  3CBM A;  2W5Z A;  3DAL A;  4FMU A;  5T5G A;  2G46 A;  3QWV A;  1ML9 A;  4Z4P A;  5CPR B;  3F9X A;  5F59 A;  2BQZ A;  5CCM A;  5ARF A;  5JJ0 A;  4YNM A;  3OXL A;  1N3J A;  3RAY A;  5AYF A;  3RIB A;  5JIN A;  3EP0 A;  4J83 A;  4IJ8 A;  4YNP A;  5T0K A;  1MVH A;  2R3A A;  3QWP A;  3CBO A;  3RU0 A;  3OOI A;  4QEP A;  3F9Y A;  3M57 A;  3M56 A;  3PDN A;  3OPE A;  5JIY A;  3S7D A;  3S7F A;  3K5K A;  3M54 A;  3S7J A;  1H3I A;  3M5A A;  3QWW A;  3F9W A;  4YPE A;  3MO2 A;  2W5Y A;  1N6A A;  5F5E A;  3KMA A;  2IGQ A;  4H12 A;  5JHN A;  1PEG A;  5KJL A;  5HQ8 A;  5TH7 A;  4BUP A;  1N6C A;  1ZKK A;  5LSZ A;  3VUZ A;  3FPD A;  4LDG A;  1MT6 A;  1O9S A;  3BO5 A;  3MEK A;  5EX0 A;  4QEO A;  3TG5 A;  2F69 A;  4O30 A;  5F6L A;  1XQH A;  4I51 A;  4WUY A;  2O8J A;  5F6K C;  5T0M A;  1MUF A;  3DB5 A;  4J7F A;  2QPW A;  3RQ4 A;  5LSX A;  5ARG A;  3SWC A;  3OS5 A;  1MVX A;  2JV0 A; 
#chains in the Genus database with same CATH homology
 4O6F A;  5KJM A;  4MI5 A;  2RFI A;  3F9Z A;  3CBP A;  5TEG A;  5EG2 A;  3OXG A;  3RJW A;  3M59 A;  4NJ5 A;  4IJD A;  4JLG A;  3HNA A;  3OXF A;  4RZ0 A;  3S8P A;  3TG4 A;  3VV0 A;  5TTF A;  4AU7 A;  3S7B A;  4YPA A;  5KJN A;  4NVQ A;  5HI7 A;  4JDS A;  5CCL A;  3MO0 A;  4MI0 A;  3MO5 A;  3M53 A;  3KMJ A;  3IHX A;  3KMT A;  4E47 A;  3M55 A;  3SW9 A;  5EX3 A;  4J7I A;  4C1Q A;  4J8O A;  5KJK A;  3M58 A;  4YPU A;  3N71 A;  4QEN A;  4YND A;  3CBM A;  2W5Z A;  3DAL A;  4FMU A;  5T5G A;  2G46 A;  3QWV A;  1ML9 A;  4Z4P A;  5CPR B;  3F9X A;  5F59 A;  2BQZ A;  5CCM A;  5ARF A;  5JJ0 A;  4YNM A;  3OXL A;  1N3J A;  3RAY A;  5AYF A;  3RIB A;  5JIN A;  3EP0 A;  4J83 A;  4IJ8 A;  4YNP A;  5T0K A;  1MVH A;  2R3A A;  3QWP A;  3CBO A;  3RU0 A;  3OOI A;  4QEP A;  3F9Y A;  3M57 A;  3M56 A;  3PDN A;  3OPE A;  5JIY A;  3S7D A;  3S7F A;  3K5K A;  3M54 A;  3S7J A;  1H3I A;  3M5A A;  3QWW A;  3F9W A;  4YPE A;  3MO2 A;  2W5Y A;  1N6A A;  5F5E A;  3KMA A;  2IGQ A;  4H12 A;  5JHN A;  1PEG A;  5KJL A;  5HQ8 A;  5TH7 A;  4BUP A;  1N6C A;  1ZKK A;  5LSZ A;  3VUZ A;  3FPD A;  4LDG A;  1MT6 A;  1O9S A;  3BO5 A;  3MEK A;  5EX0 A;  4QEO A;  3TG5 A;  2F69 A;  4O30 A;  5F6L A;  1XQH A;  4I51 A;  4WUY A;  2O8J A;  5F6K C;  5T0M A;  1MUF A;  3DB5 A;  4J7F A;  2QPW A;  3RQ4 A;  5LSX A;  5ARG A;  3SWC A;  3OS5 A;  1MVX A;  2JV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...