3EP0A

Methyltransferase domain of human pr domain-containing protein 12
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
129
structure length
113
Chain Sequence
VQKLSSLVLPAEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPLMWEVFNEDGTVRYFIDASWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PR domain zinc finger protein 12
publication title The crystal structure of methyltransferase domain of human PR Domain-containing protein 12.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 26
structure length 113
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ep0A00
1MUFA 3KMAA 4YPAA 3S7FA 3RQ4A 4C1QA 4FMUA 1N6AA 3OXGA 2QPWA 5CPRB 2JV0A 2G46A 5T0MA 4IJDA 3TG4A 3QWVA 4NJ5A 5T0KA 3VUZA 5JJ0A 2F69A 3QWPA 4IJ8A 1H3IA 2W5YA 3HNAA 5HQ8A 1N6CA 3F9ZA 3DALA 2IGQA 5KJLA 1ZKKA 3M54A 5LSXA 3RJWA 3N71A 5KJMA 3EP0A 3S8PA 4J83A 5F59A 3M55A 3TG5A 5KJNA 4BUPA 3MO2A 4MI5A 3PDNA 4RZ0A 3CBPA 4AU7A 4YNPA 3S7JA 3F9XA 3OOIA 5ARGA 2RFIA 2O8JA 5F5EA 5HI7A 3RU0A 3FPDA 4E47A 3DB5A 4J7FA 4LDGA 4YPEA 3KMTA 3M57A 4O30A 3QWWA 5EG2A 1XQHA 4YPUA 3F9YA 2R3AA 4JLGA 5LSZA 5T5GA 4YNMA 4J7IA 4Z4PA 3BO5A 5AYFA 3SWCA 4QENA 1N3JA 3M56A 5EX0A 1MVXA 5JINA 5F6KC 5KJKA 3M58A 4JDSA 5TTFA 5CCLA 1PEGA 3F9WA 4MI0A 4YNDA 3OS5A 1MVHA 1O9SA 3MO0A 5CCMA 5EX3A 3RAYA 4H12A 2BQZA 3RIBA 1MT6A 3KMJA 3S7BA 5ARFA 4QEPA 4NVQA 3MO5A 3SW9A 2W5ZA 3CBMA 3MEKA 3K5KA 3S7DA 5F6LA 3CBOA 5TH7A 3OXLA 4I51A 3M53A 1ML9A 3VV0A 3IHXA 3OPEA 4QEOA 3OXFA 4J8OA 5JHNA 3M5AA 4WUYA 5TEGA 5JIYA 4O6FA 3M59A
chains in the Genus database with same CATH superfamily
1MUFA 3KMAA 4YPAA 3S7FA 3RQ4A 4C1QA 4FMUA 1N6AA 3OXGA 2QPWA 5CPRB 2JV0A 2G46A 5T0MA 4IJDA 3TG4A 3QWVA 4NJ5A 5T0KA 3VUZA 5JJ0A 2F69A 3QWPA 4IJ8A 1H3IA 2W5YA 3HNAA 5HQ8A 1N6CA 3F9ZA 3DALA 2IGQA 5KJLA 1ZKKA 3M54A 5LSXA 3RJWA 3N71A 5KJMA 3EP0A 3S8PA 4J83A 5F59A 3M55A 3TG5A 5KJNA 4BUPA 3MO2A 4MI5A 3PDNA 4RZ0A 3CBPA 4AU7A 4YNPA 3S7JA 3F9XA 3OOIA 5ARGA 2RFIA 2O8JA 5F5EA 5HI7A 3RU0A 3FPDA 4E47A 3DB5A 4J7FA 4LDGA 4YPEA 3KMTA 3M57A 4O30A 3QWWA 5EG2A 1XQHA 4YPUA 3F9YA 2R3AA 4JLGA 5LSZA 5T5GA 4YNMA 4J7IA 4Z4PA 3BO5A 5AYFA 3SWCA 4QENA 1N3JA 3M56A 5EX0A 1MVXA 5JINA 5F6KC 5KJKA 3M58A 4JDSA 5TTFA 5CCLA 1PEGA 3F9WA 4MI0A 4YNDA 3OS5A 1MVHA 1O9SA 3MO0A 5CCMA 5EX3A 3RAYA 4H12A 2BQZA 3RIBA 1MT6A 3KMJA 3S7BA 5ARFA 4QEPA 4NVQA 3MO5A 3SW9A 2W5ZA 3CBMA 3MEKA 3K5KA 3S7DA 5F6LA 3CBOA 5TH7A 3OXLA 4I51A 3M53A 1ML9A 3VV0A 3IHXA 3OPEA 4QEOA 3OXFA 4J8OA 5JHNA 3M5AA 4WUYA 5TEGA 5JIYA 4O6FA 3M59A
chains in the Genus database with same CATH topology
1MUFA 3KMAA 4YPAA 3S7FA 3RQ4A 4C1QA 4FMUA 1N6AA 3OXGA 2QPWA 5CPRB 2JV0A 2G46A 5T0MA 4IJDA 3TG4A 3QWVA 4NJ5A 5T0KA 3VUZA 5JJ0A 2F69A 3QWPA 4IJ8A 1H3IA 2W5YA 3HNAA 5HQ8A 1N6CA 3F9ZA 3DALA 2IGQA 5KJLA 1ZKKA 3M54A 5LSXA 3RJWA 3N71A 5KJMA 3EP0A 3S8PA 4J83A 5F59A 3M55A 3TG5A 5KJNA 4BUPA 3MO2A 4MI5A 3PDNA 4RZ0A 3CBPA 4AU7A 4YNPA 3S7JA 3F9XA 3OOIA 5ARGA 2RFIA 2O8JA 5F5EA 5HI7A 3RU0A 3FPDA 4E47A 3DB5A 4J7FA 4LDGA 4YPEA 3KMTA 3M57A 4O30A 3QWWA 5EG2A 1XQHA 4YPUA 3F9YA 2R3AA 4JLGA 5LSZA 5T5GA 4YNMA 4J7IA 4Z4PA 3BO5A 5AYFA 3SWCA 4QENA 1N3JA 3M56A 5EX0A 1MVXA 5JINA 5F6KC 5KJKA 3M58A 4JDSA 5TTFA 5CCLA 1PEGA 3F9WA 4MI0A 4YNDA 3OS5A 1MVHA 1O9SA 3MO0A 5CCMA 5EX3A 3RAYA 4H12A 2BQZA 3RIBA 1MT6A 3KMJA 3S7BA 5ARFA 4QEPA 4NVQA 3MO5A 3SW9A 2W5ZA 3CBMA 3MEKA 3K5KA 3S7DA 5F6LA 3CBOA 5TH7A 3OXLA 4I51A 3M53A 1ML9A 3VV0A 3IHXA 3OPEA 4QEOA 3OXFA 4J8OA 5JHNA 3M5AA 4WUYA 5TEGA 5JIYA 4O6FA 3M59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MUF A;  3KMA A;  4YPA A;  3S7F A;  3RQ4 A;  4C1Q A;  4FMU A;  1N6A A;  3OXG A;  2QPW A;  5CPR B;  2JV0 A;  2G46 A;  5T0M A;  4IJD A;  3TG4 A;  3QWV A;  4NJ5 A;  5T0K A;  3VUZ A;  5JJ0 A;  2F69 A;  3QWP A;  4IJ8 A;  1H3I A;  2W5Y A;  3HNA A;  5HQ8 A;  1N6C A;  3F9Z A;  3DAL A;  2IGQ A;  5KJL A;  1ZKK A;  3M54 A;  5LSX A;  3RJW A;  3N71 A;  5KJM A;  3EP0 A;  3S8P A;  4J83 A;  5F59 A;  3M55 A;  3TG5 A;  5KJN A;  4BUP A;  3MO2 A;  4MI5 A;  3PDN A;  4RZ0 A;  3CBP A;  4AU7 A;  4YNP A;  3S7J A;  3F9X A;  3OOI A;  5ARG A;  2RFI A;  2O8J A;  5F5E A;  5HI7 A;  3RU0 A;  3FPD A;  4E47 A;  3DB5 A;  4J7F A;  4LDG A;  4YPE A;  3KMT A;  3M57 A;  4O30 A;  3QWW A;  5EG2 A;  1XQH A;  4YPU A;  3F9Y A;  2R3A A;  4JLG A;  5LSZ A;  5T5G A;  4YNM A;  4J7I A;  4Z4P A;  3BO5 A;  5AYF A;  3SWC A;  4QEN A;  1N3J A;  3M56 A;  5EX0 A;  1MVX A;  5JIN A;  5F6K C;  5KJK A;  3M58 A;  4JDS A;  5TTF A;  5CCL A;  1PEG A;  3F9W A;  4MI0 A;  4YND A;  3OS5 A;  1MVH A;  1O9S A;  3MO0 A;  5CCM A;  5EX3 A;  3RAY A;  4H12 A;  2BQZ A;  3RIB A;  1MT6 A;  3KMJ A;  3S7B A;  5ARF A;  4QEP A;  4NVQ A;  3MO5 A;  3SW9 A;  2W5Z A;  3CBM A;  3MEK A;  3K5K A;  3S7D A;  5F6L A;  3CBO A;  5TH7 A;  3OXL A;  4I51 A;  3M53 A;  1ML9 A;  3VV0 A;  3IHX A;  3OPE A;  4QEO A;  3OXF A;  4J8O A;  5JHN A;  3M5A A;  4WUY A;  5TEG A;  5JIY A;  4O6F A;  3M59 A; 
#chains in the Genus database with same CATH topology
 1MUF A;  3KMA A;  4YPA A;  3S7F A;  3RQ4 A;  4C1Q A;  4FMU A;  1N6A A;  3OXG A;  2QPW A;  5CPR B;  2JV0 A;  2G46 A;  5T0M A;  4IJD A;  3TG4 A;  3QWV A;  4NJ5 A;  5T0K A;  3VUZ A;  5JJ0 A;  2F69 A;  3QWP A;  4IJ8 A;  1H3I A;  2W5Y A;  3HNA A;  5HQ8 A;  1N6C A;  3F9Z A;  3DAL A;  2IGQ A;  5KJL A;  1ZKK A;  3M54 A;  5LSX A;  3RJW A;  3N71 A;  5KJM A;  3EP0 A;  3S8P A;  4J83 A;  5F59 A;  3M55 A;  3TG5 A;  5KJN A;  4BUP A;  3MO2 A;  4MI5 A;  3PDN A;  4RZ0 A;  3CBP A;  4AU7 A;  4YNP A;  3S7J A;  3F9X A;  3OOI A;  5ARG A;  2RFI A;  2O8J A;  5F5E A;  5HI7 A;  3RU0 A;  3FPD A;  4E47 A;  3DB5 A;  4J7F A;  4LDG A;  4YPE A;  3KMT A;  3M57 A;  4O30 A;  3QWW A;  5EG2 A;  1XQH A;  4YPU A;  3F9Y A;  2R3A A;  4JLG A;  5LSZ A;  5T5G A;  4YNM A;  4J7I A;  4Z4P A;  3BO5 A;  5AYF A;  3SWC A;  4QEN A;  1N3J A;  3M56 A;  5EX0 A;  1MVX A;  5JIN A;  5F6K C;  5KJK A;  3M58 A;  4JDS A;  5TTF A;  5CCL A;  1PEG A;  3F9W A;  4MI0 A;  4YND A;  3OS5 A;  1MVH A;  1O9S A;  3MO0 A;  5CCM A;  5EX3 A;  3RAY A;  4H12 A;  2BQZ A;  3RIB A;  1MT6 A;  3KMJ A;  3S7B A;  5ARF A;  4QEP A;  4NVQ A;  3MO5 A;  3SW9 A;  2W5Z A;  3CBM A;  3MEK A;  3K5K A;  3S7D A;  5F6L A;  3CBO A;  5TH7 A;  3OXL A;  4I51 A;  3M53 A;  1ML9 A;  3VV0 A;  3IHX A;  3OPE A;  4QEO A;  3OXF A;  4J8O A;  5JHN A;  3M5A A;  4WUY A;  5TEG A;  5JIY A;  4O6F A;  3M59 A; 
#chains in the Genus database with same CATH homology
 1MUF A;  3KMA A;  4YPA A;  3S7F A;  3RQ4 A;  4C1Q A;  4FMU A;  1N6A A;  3OXG A;  2QPW A;  5CPR B;  2JV0 A;  2G46 A;  5T0M A;  4IJD A;  3TG4 A;  3QWV A;  4NJ5 A;  5T0K A;  3VUZ A;  5JJ0 A;  2F69 A;  3QWP A;  4IJ8 A;  1H3I A;  2W5Y A;  3HNA A;  5HQ8 A;  1N6C A;  3F9Z A;  3DAL A;  2IGQ A;  5KJL A;  1ZKK A;  3M54 A;  5LSX A;  3RJW A;  3N71 A;  5KJM A;  3EP0 A;  3S8P A;  4J83 A;  5F59 A;  3M55 A;  3TG5 A;  5KJN A;  4BUP A;  3MO2 A;  4MI5 A;  3PDN A;  4RZ0 A;  3CBP A;  4AU7 A;  4YNP A;  3S7J A;  3F9X A;  3OOI A;  5ARG A;  2RFI A;  2O8J A;  5F5E A;  5HI7 A;  3RU0 A;  3FPD A;  4E47 A;  3DB5 A;  4J7F A;  4LDG A;  4YPE A;  3KMT A;  3M57 A;  4O30 A;  3QWW A;  5EG2 A;  1XQH A;  4YPU A;  3F9Y A;  2R3A A;  4JLG A;  5LSZ A;  5T5G A;  4YNM A;  4J7I A;  4Z4P A;  3BO5 A;  5AYF A;  3SWC A;  4QEN A;  1N3J A;  3M56 A;  5EX0 A;  1MVX A;  5JIN A;  5F6K C;  5KJK A;  3M58 A;  4JDS A;  5TTF A;  5CCL A;  1PEG A;  3F9W A;  4MI0 A;  4YND A;  3OS5 A;  1MVH A;  1O9S A;  3MO0 A;  5CCM A;  5EX3 A;  3RAY A;  4H12 A;  2BQZ A;  3RIB A;  1MT6 A;  3KMJ A;  3S7B A;  5ARF A;  4QEP A;  4NVQ A;  3MO5 A;  3SW9 A;  2W5Z A;  3CBM A;  3MEK A;  3K5K A;  3S7D A;  5F6L A;  3CBO A;  5TH7 A;  3OXL A;  4I51 A;  3M53 A;  1ML9 A;  3VV0 A;  3IHX A;  3OPE A;  4QEO A;  3OXF A;  4J8O A;  5JHN A;  3M5A A;  4WUY A;  5TEG A;  5JIY A;  4O6F A;  3M59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...