3EP0A

Methyltransferase domain of human pr domain-containing protein 12
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
129
structure length
113
Chain Sequence
VQKLSSLVLPAEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGRVIAPLMWEVFNEDGTVRYFIDASWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of methyltransferase domain of human PR Domain-containing protein 12.
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PR domain zinc finger protein 12
total genus 26
structure length 113
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3ep0A00
3QWWA 4IJDA 5CPRB 3KMTA 3OXGA 5AYFA 5T0MA 4C1QA 5F6KC 3M5AA 5JINA 3M57A 1MVXA 5JHNA 3RAYA 3SW9A 3S7JA 5LSXA 3M56A 4J83A 5EX3A 4QEOA 3OOIA 3MO5A 3TG5A 5CCLA 4QEPA 3F9WA 4RZ0A 4WUYA 3MO2A 2W5YA 3OXFA 3FPDA 1MUFA 3RU0A 5T5GA 5KJKA 4O6FA 3SWCA 4NVQA 3F9YA 2W5ZA 3M59A 4YNPA 3S7DA 5ARGA 3M58A 1MT6A 1PEGA 3F9ZA 4YNMA 5T0KA 3MEKA 3DB5A 3IHXA 5HQ8A 4JDSA 3OXLA 1XQHA 4IJ8A 5CCMA 4JLGA 5LSZA 4J7IA 1O9SA 5ARFA 4H12A 2G46A 5EX0A 2QPWA 3KMAA 3RIBA 2O8JA 3M53A 1H3IA 4YNDA 4QENA 4BUPA 4NJ5A 2RFIA 5KJLA 5TH7A 3S7BA 5JJ0A 3HNAA 3CBPA 1MVHA 1ML9A 3CBOA 4YPEA 5F5EA 3RJWA 3K5KA 3MO0A 4J7FA 3PDNA 3S8PA 3N71A 3QWPA 4AU7A 4MI5A 3M54A 4I51A 3TG4A 3RQ4A 4YPAA 5F6LA 4Z4PA 4YPUA 1N6CA 1N6AA 4LDGA 3QWVA 1N3JA 3EP0A 3OS5A 3DALA 2JV0A 3S7FA 3VUZA 2F69A 5KJMA 5HI7A 5TEGA 4FMUA 5TTFA 3CBMA 3VV0A 5JIYA 4J8OA 5KJNA 3BO5A 4O30A 5F59A 2R3AA 1ZKKA 3OPEA 2IGQA 3F9XA 2BQZA 4MI0A 4E47A 3KMJA 5EG2A 3M55A
chains in the Genus database with same CATH superfamily
3QWWA 4IJDA 5CPRB 3KMTA 3OXGA 5AYFA 5T0MA 4C1QA 5F6KC 3M5AA 5JINA 3M57A 1MVXA 5JHNA 3RAYA 3SW9A 3S7JA 5LSXA 3M56A 4J83A 5EX3A 4QEOA 3OOIA 3MO5A 3TG5A 5CCLA 4QEPA 3F9WA 4RZ0A 4WUYA 3MO2A 2W5YA 3OXFA 3FPDA 1MUFA 3RU0A 5T5GA 5KJKA 4O6FA 3SWCA 4NVQA 3F9YA 2W5ZA 3M59A 4YNPA 3S7DA 5ARGA 3M58A 1MT6A 1PEGA 3F9ZA 4YNMA 5T0KA 3MEKA 3DB5A 3IHXA 5HQ8A 4JDSA 3OXLA 1XQHA 4IJ8A 5CCMA 4JLGA 5LSZA 4J7IA 1O9SA 5ARFA 4H12A 2G46A 5EX0A 2QPWA 3KMAA 3RIBA 2O8JA 3M53A 1H3IA 4YNDA 4QENA 4BUPA 4NJ5A 2RFIA 5KJLA 5TH7A 3S7BA 5JJ0A 3HNAA 3CBPA 1MVHA 1ML9A 3CBOA 4YPEA 5F5EA 3RJWA 3K5KA 3MO0A 4J7FA 3PDNA 3S8PA 3N71A 3QWPA 4AU7A 4MI5A 3M54A 4I51A 3TG4A 3RQ4A 4YPAA 5F6LA 4Z4PA 4YPUA 1N6CA 1N6AA 4LDGA 3QWVA 1N3JA 3EP0A 3OS5A 3DALA 2JV0A 3S7FA 3VUZA 2F69A 5KJMA 5HI7A 5TEGA 4FMUA 5TTFA 3CBMA 3VV0A 5JIYA 4J8OA 5KJNA 3BO5A 4O30A 5F59A 2R3AA 1ZKKA 3OPEA 2IGQA 3F9XA 2BQZA 4MI0A 4E47A 3KMJA 5EG2A 3M55A
chains in the Genus database with same CATH topology
3QWWA 4IJDA 5CPRB 3KMTA 3OXGA 5AYFA 5T0MA 4C1QA 5F6KC 3M5AA 5JINA 3M57A 1MVXA 5JHNA 3RAYA 3SW9A 3S7JA 5LSXA 3M56A 4J83A 5EX3A 4QEOA 3OOIA 3MO5A 3TG5A 5CCLA 4QEPA 3F9WA 4RZ0A 4WUYA 3MO2A 2W5YA 3OXFA 3FPDA 1MUFA 3RU0A 5T5GA 5KJKA 4O6FA 3SWCA 4NVQA 3F9YA 2W5ZA 3M59A 4YNPA 3S7DA 5ARGA 3M58A 1MT6A 1PEGA 3F9ZA 4YNMA 5T0KA 3MEKA 3DB5A 3IHXA 5HQ8A 4JDSA 3OXLA 1XQHA 4IJ8A 5CCMA 4JLGA 5LSZA 4J7IA 1O9SA 5ARFA 4H12A 2G46A 5EX0A 2QPWA 3KMAA 3RIBA 2O8JA 3M53A 1H3IA 4YNDA 4QENA 4BUPA 4NJ5A 2RFIA 5KJLA 5TH7A 3S7BA 5JJ0A 3HNAA 3CBPA 1MVHA 1ML9A 3CBOA 4YPEA 5F5EA 3RJWA 3K5KA 3MO0A 4J7FA 3PDNA 3S8PA 3N71A 3QWPA 4AU7A 4MI5A 3M54A 4I51A 3TG4A 3RQ4A 4YPAA 5F6LA 4Z4PA 4YPUA 1N6CA 1N6AA 4LDGA 3QWVA 1N3JA 3EP0A 3OS5A 3DALA 2JV0A 3S7FA 3VUZA 2F69A 5KJMA 5HI7A 5TEGA 4FMUA 5TTFA 3CBMA 3VV0A 5JIYA 4J8OA 5KJNA 3BO5A 4O30A 5F59A 2R3AA 1ZKKA 3OPEA 2IGQA 3F9XA 2BQZA 4MI0A 4E47A 3KMJA 5EG2A 3M55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWW A;  4IJD A;  5CPR B;  3KMT A;  3OXG A;  5AYF A;  5T0M A;  4C1Q A;  5F6K C;  3M5A A;  5JIN A;  3M57 A;  1MVX A;  5JHN A;  3RAY A;  3SW9 A;  3S7J A;  5LSX A;  3M56 A;  4J83 A;  5EX3 A;  4QEO A;  3OOI A;  3MO5 A;  3TG5 A;  5CCL A;  4QEP A;  3F9W A;  4RZ0 A;  4WUY A;  3MO2 A;  2W5Y A;  3OXF A;  3FPD A;  1MUF A;  3RU0 A;  5T5G A;  5KJK A;  4O6F A;  3SWC A;  4NVQ A;  3F9Y A;  2W5Z A;  3M59 A;  4YNP A;  3S7D A;  5ARG A;  3M58 A;  1MT6 A;  1PEG A;  3F9Z A;  4YNM A;  5T0K A;  3MEK A;  3DB5 A;  3IHX A;  5HQ8 A;  4JDS A;  3OXL A;  1XQH A;  4IJ8 A;  5CCM A;  4JLG A;  5LSZ A;  4J7I A;  1O9S A;  5ARF A;  4H12 A;  2G46 A;  5EX0 A;  2QPW A;  3KMA A;  3RIB A;  2O8J A;  3M53 A;  1H3I A;  4YND A;  4QEN A;  4BUP A;  4NJ5 A;  2RFI A;  5KJL A;  5TH7 A;  3S7B A;  5JJ0 A;  3HNA A;  3CBP A;  1MVH A;  1ML9 A;  3CBO A;  4YPE A;  5F5E A;  3RJW A;  3K5K A;  3MO0 A;  4J7F A;  3PDN A;  3S8P A;  3N71 A;  3QWP A;  4AU7 A;  4MI5 A;  3M54 A;  4I51 A;  3TG4 A;  3RQ4 A;  4YPA A;  5F6L A;  4Z4P A;  4YPU A;  1N6C A;  1N6A A;  4LDG A;  3QWV A;  1N3J A;  3EP0 A;  3OS5 A;  3DAL A;  2JV0 A;  3S7F A;  3VUZ A;  2F69 A;  5KJM A;  5HI7 A;  5TEG A;  4FMU A;  5TTF A;  3CBM A;  3VV0 A;  5JIY A;  4J8O A;  5KJN A;  3BO5 A;  4O30 A;  5F59 A;  2R3A A;  1ZKK A;  3OPE A;  2IGQ A;  3F9X A;  2BQZ A;  4MI0 A;  4E47 A;  3KMJ A;  5EG2 A;  3M55 A; 
#chains in the Genus database with same CATH topology
 3QWW A;  4IJD A;  5CPR B;  3KMT A;  3OXG A;  5AYF A;  5T0M A;  4C1Q A;  5F6K C;  3M5A A;  5JIN A;  3M57 A;  1MVX A;  5JHN A;  3RAY A;  3SW9 A;  3S7J A;  5LSX A;  3M56 A;  4J83 A;  5EX3 A;  4QEO A;  3OOI A;  3MO5 A;  3TG5 A;  5CCL A;  4QEP A;  3F9W A;  4RZ0 A;  4WUY A;  3MO2 A;  2W5Y A;  3OXF A;  3FPD A;  1MUF A;  3RU0 A;  5T5G A;  5KJK A;  4O6F A;  3SWC A;  4NVQ A;  3F9Y A;  2W5Z A;  3M59 A;  4YNP A;  3S7D A;  5ARG A;  3M58 A;  1MT6 A;  1PEG A;  3F9Z A;  4YNM A;  5T0K A;  3MEK A;  3DB5 A;  3IHX A;  5HQ8 A;  4JDS A;  3OXL A;  1XQH A;  4IJ8 A;  5CCM A;  4JLG A;  5LSZ A;  4J7I A;  1O9S A;  5ARF A;  4H12 A;  2G46 A;  5EX0 A;  2QPW A;  3KMA A;  3RIB A;  2O8J A;  3M53 A;  1H3I A;  4YND A;  4QEN A;  4BUP A;  4NJ5 A;  2RFI A;  5KJL A;  5TH7 A;  3S7B A;  5JJ0 A;  3HNA A;  3CBP A;  1MVH A;  1ML9 A;  3CBO A;  4YPE A;  5F5E A;  3RJW A;  3K5K A;  3MO0 A;  4J7F A;  3PDN A;  3S8P A;  3N71 A;  3QWP A;  4AU7 A;  4MI5 A;  3M54 A;  4I51 A;  3TG4 A;  3RQ4 A;  4YPA A;  5F6L A;  4Z4P A;  4YPU A;  1N6C A;  1N6A A;  4LDG A;  3QWV A;  1N3J A;  3EP0 A;  3OS5 A;  3DAL A;  2JV0 A;  3S7F A;  3VUZ A;  2F69 A;  5KJM A;  5HI7 A;  5TEG A;  4FMU A;  5TTF A;  3CBM A;  3VV0 A;  5JIY A;  4J8O A;  5KJN A;  3BO5 A;  4O30 A;  5F59 A;  2R3A A;  1ZKK A;  3OPE A;  2IGQ A;  3F9X A;  2BQZ A;  4MI0 A;  4E47 A;  3KMJ A;  5EG2 A;  3M55 A; 
#chains in the Genus database with same CATH homology
 3QWW A;  4IJD A;  5CPR B;  3KMT A;  3OXG A;  5AYF A;  5T0M A;  4C1Q A;  5F6K C;  3M5A A;  5JIN A;  3M57 A;  1MVX A;  5JHN A;  3RAY A;  3SW9 A;  3S7J A;  5LSX A;  3M56 A;  4J83 A;  5EX3 A;  4QEO A;  3OOI A;  3MO5 A;  3TG5 A;  5CCL A;  4QEP A;  3F9W A;  4RZ0 A;  4WUY A;  3MO2 A;  2W5Y A;  3OXF A;  3FPD A;  1MUF A;  3RU0 A;  5T5G A;  5KJK A;  4O6F A;  3SWC A;  4NVQ A;  3F9Y A;  2W5Z A;  3M59 A;  4YNP A;  3S7D A;  5ARG A;  3M58 A;  1MT6 A;  1PEG A;  3F9Z A;  4YNM A;  5T0K A;  3MEK A;  3DB5 A;  3IHX A;  5HQ8 A;  4JDS A;  3OXL A;  1XQH A;  4IJ8 A;  5CCM A;  4JLG A;  5LSZ A;  4J7I A;  1O9S A;  5ARF A;  4H12 A;  2G46 A;  5EX0 A;  2QPW A;  3KMA A;  3RIB A;  2O8J A;  3M53 A;  1H3I A;  4YND A;  4QEN A;  4BUP A;  4NJ5 A;  2RFI A;  5KJL A;  5TH7 A;  3S7B A;  5JJ0 A;  3HNA A;  3CBP A;  1MVH A;  1ML9 A;  3CBO A;  4YPE A;  5F5E A;  3RJW A;  3K5K A;  3MO0 A;  4J7F A;  3PDN A;  3S8P A;  3N71 A;  3QWP A;  4AU7 A;  4MI5 A;  3M54 A;  4I51 A;  3TG4 A;  3RQ4 A;  4YPA A;  5F6L A;  4Z4P A;  4YPU A;  1N6C A;  1N6A A;  4LDG A;  3QWV A;  1N3J A;  3EP0 A;  3OS5 A;  3DAL A;  2JV0 A;  3S7F A;  3VUZ A;  2F69 A;  5KJM A;  5HI7 A;  5TEG A;  4FMU A;  5TTF A;  3CBM A;  3VV0 A;  5JIY A;  4J8O A;  5KJN A;  3BO5 A;  4O30 A;  5F59 A;  2R3A A;  1ZKK A;  3OPE A;  2IGQ A;  3F9X A;  2BQZ A;  4MI0 A;  4E47 A;  3KMJ A;  5EG2 A;  3M55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...